Implementasi kolaborasi model pembelajaran concept map dengan snowball throwing untuk meningkat aktivitas dan hasil belajar siswa (studi pada siswa kelas X APK mata pelajaran pengantar administrasi perkantoran di SMK Negeri 1 Ngawi) / Nuning Pratiwi

 

ABSTRAK Pratiwi, Nuning. 2016. Implementasi Kolaborasi Model Pembelajaran Concept Map denganSnowball Throwing untuk Meningkatkan Aktivitas dan Hasil Belajar Siswa(StudipadaSiswaKelas X APK Mata PelajaranPengantarAdministrasiPerkantoran di SMK Negeri 1Ngawi). Skripsi, Program StudiPendidikanAdministrasiPerkantoran, JurusanManajemen, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (I) Dr. Hj. MadziatulChuriyah, S.Pd., M.M, (II) Drs. H. Mohammad Arief, M.Si. Kata Kunci: Concept Map, Snowball Throwing, aktivitas, hasilbelajar SMK Negeri 1 Ngawi merupakan sekolah perintis dalam penerapan kurikulum 2013. Berdasarkanhasilwawancaradaribeberapa guru SMK Negeri 1 NgawisiswapadajurusanAdministrasiPerkantoran, yaknikelas X APK 1 merupakankelasdenganaktivitasbelajar yang masihrendahkhususnyapadamatapelajaranPengantarAdministrasiPerkantoran. Secaralangsungataupuntidaklangsunghalinijugamempengaruhipadahasilbelajarsiswa.Untukmengatasihaltersebut, penelitimenerapkanvariasimetodebelajaryaitudenganmengkolaborasikan model pembelajaranConcept Map denganSnowball Throwingdalam proses belajar. Penelitianinidilaksanakandengantujuanuntukmengetahui bagaimana implementasi kolaborasi model pembelajaran Concept Map denganSnowball Throwing untuk meningkatkan aktivitas dan hasil belajar siswakelas X APK SMKN 1 Ngawipadamatapelajaranpengantaradministrasiperkantoran. JenispenelitianinimerupakanPenelitianTindakanKelas (PTK)denganmenggunakanpendekatandeskriptifkualitatif.Subyekpenelitianiniadalahsiswakelas X APK 1 SMKN 1 Ngawikarenakelasinimerupakankelasdenganaktivitasdanhasilbelajaryang masihdibawah rata-rata.Adapunjumlahsiswadikelastersebutadalah 32 orang.Teknikpengumpulan datayang digunakandalampenelitianinimeliputiobservasi, wawancara, tes, dokumentasi, dancatatanlapangan.Sedangkananalisis data dilakukandenganmereduksi data, penyajian data, danpenarikankesimpulan. Hasilpenelitianinimenunjukkanbahwaimplementasikolaborasi model pembelajaranConcept MapdenganSnowball Throwing dapatmeningkatkanaktivitasdanhasilbelajarsiswa.Hal iniditunjukkandenganadanyahasilpenelitiandimanaaktivitassiswamengalamipeningkatandarisiklus I kesiklus II sebesar 6.13% dengankategoribaik, hasilbelajarkognitifdengankategoricukuppadasiklus I menjadibaikpadasiklus IIsebesar 8.75%, danhasilbelajarafektifdengankategoribaikpadasiklus I menjadisangatbaikpadasiklus II denganpeningkatansebesar 6.33%.Melihatadanyapeningkatanpositifbaikdariaktivitasdanhasilbelajarsiswa, makasebaiknya guru menerapkankolaborasi model pembelajaranConcept Map denganSnowball Throwingpadamatapelajaran lain denganbasic-nyateorikarena model pembelajaraninimemudahkansiswadalammengingatdanmemahamimateri yang dipelajari.  

Penerapan metode bermain peran dalam bentuk dialog untuk melatih keterampilan berbicara siswa kelas XI SMAN 2 Malang pada mata pelajaran bahasa Mandarin / Erfan Mokhamad Wijaya

 

ABSTRAK Wijaya, Erfan Mokhamad. 2015. Penerapan Metode Bermain Peran dalam Bentuk Dialog untuk Melatih Keterampilan Berbicara Siswa Kelas XI SMAN 2 Malang Pada Mata Pelajaran Bahasa Mandarin. Skripsi, Program Studi Pendidikan Bahasa Mandarin Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Rizman Usman, M.Pd., (II) Dra. Rosyidah, M.Pd. Kata kunci: bermain peran, dialog, keterampilan berbicara. Metode bermain peran adalah cara yang digunakan dalam proses pembelajaran dengan memberikan suatu topik/ masalah yang dipecahkan oleh peserta didik dengan memainkan peran. Penggunaan metode bermain peran dalam bentuk dialog sebagai metode pembelajaran keterampilan berbicara perlu dilakukan. Penggunaan metode ini dapat membuat pembelajaran keterampilan berbicara bahasa Mandarin lebih efektif dan menyenangkan. Selain itu, siswa dapat menghilangkan perasaan malu dan lebih percaya diri, karena mereka tampil dan bekerja sama dengan anggota kelompoknya. Tujuan penelitian ini adalah mendeskripsikan penerapan metode bermain peran dalam bentuk dialog untuk melatih keterampilan berbicara siswa kelas XI SMAN 2 Malang pada mata pelajaran bahasa Mandarin, serta faktor pendukung dan penghambatnya. Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian deskriptif. Sumber data pada penelitian ini adalah siswa kelas XI LMT bahasa Mandarin semester genap tahun ajaran 2014/2015. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, dan dokumentasi. Hasil penelitian ini menunjukkan bahwa semua siswa aktif dan antusias dalam mengikuti pembelajaran dengan menggunakan metode bermain peran dalam bentuk dialog. Selain itu, siswa juga berpendapat bahwa metode bermain peran dalam bentuk dialog ini perlu diterapkan pada pembelajaran bahasa Mandarin, khususnya pada pembelajaran keterampilan berbicara. Tetapi masih terdapat hambatan dalam penerapan metode tersebut, yaitu siswa masih malu-malu dan tidak percaya diri saat praktik bermain peran dalam bentuk dialog. Dari penelitian ini dapat disimpulkan bahwa penerapan metode bermain peran dalam bentuk dialog terbukti dapat digunakan sebagai salah satu metode yang efektif dan menyenangkan untuk pembelajaran berbicara bahasa Mandarin.

Penerapan model pembelajaran problem solving untuk meningkatkan keaktifan dan hasil belajar pekerjaan dasar elektromekanik pada siswa kelas X di SMKN 6 Malang / Satria Putra Permana

 

ABSTRAK Permana, Satria Putra. 2016. Penerapan Model Pembelajaran Problem Solving untuk Meningkatkan Keaktifan dan Hasil Belajar Pekerjaan Dasar Elektromekanik pada Siswa Kelas X di SMKN 6 MALANG. Skripsi Jurusan Teknik Elektro Program Studi Pendidikan Teknik Elektro Universitas Negeri Malang. Pembimbing: (I) Drs. Puger Honggowiyono, M.T. (II) Drs. Sujono, M.T. Kata kunci: Penelitian Tindakan Kelas, Model Kemmis & McTaggart, Problem Solving, Keaktifan, Hasil Belajar, Pekerjaan Dasar Elektromekanik. Permasalahan pembelajaran yang terjadi di SMKN 6 Malang adalah saat proses pembelajaran terdapat siswa yang merasa jenuh, mengantuk dan bermain gadget, kurang aktifnya dalam bertanya, menjawab pertanyaan dan menyampaikan pendapat dalam mengikuti pembelajaran Pekerjaan Dasar Elektromekanik. Berangkat dari permasalahan tersebut, dilakukan sebuah Penelitian Tindakan Kelas untuk meningkatkan keaktifan dan hasil belajar siswa pada matapelajaran Pekerjaan Dasar Elektromekanik dengan menggunakan model pembelajaran Problem Solving. Metode penelitian yang digunakan adalah model Kemmis & McTaggart yang merupakan pengembangan dari metode Kurt Lewin. Hasil penelitian ditandai dengan meningkatnya keaktifan dan hasil belajar 32 siswa di kelas X-L2 pada ranah pengetahuan, sikap, keterampilan dan keaktifan. Keaktifan siswa nilai rata-rata pada siklus I sebesar 81,88 dengan 26 siswa tuntas, siklus 2 sebesar 84 dengan 29 siswa tuntas dan siklus III sebesar 85,57 dengan 32 siswa tuntas. Peningkatan hasil belajar siswa yang mencakup ranah pengetahuan, sikap dan keterampilan dengan nilai rata-rata siklus I sebesar 81,64, siklsu II sebesar 83,46 dan siklus III sebesar 86,3. Keterlaksaan skenario pembelajaran dengan nilai siklus I sebesar 78,50, siklsu II sebesar 85 dan siklus III sebesar 89,50. Kesimpulan dari penelitian yang dilakukan dengan model pembelajaran problem solving di kelas X pada matapelajaran Pekerjaan Dasar Elektromekanik dapat meningkatkan hasil belajar ranah keaktifan, keterampilan, sikap dan pengetahuan siswa.

Perancangan media iklan layanan masyarakat tentang Pekerja Anak untuk memberdayakan anak Indonesia / Wildan Amir Ma

 

ABSTRAK MA, Wildan Amir. 2015. Perancangan Media Iklan Layanan Masyarakat tentang Pekerja Anak untuk membedayakan anak Indonesia. Skripsi, Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Drs. Sarjono, M.Sn, (II) Joko Samudro, S.Kom, M.T. Kata Kunci: Perancangan, Media, Iklan Layanan Masyarakat, Pekerja Anak Anak-anak merupakan generasi penerus bangsa. Masalah pekerja anak menjadi perhatian masyarakat, pekerja anak adalah anak yang melakukan pekerjaan secara rutin untuk orang tuanya. Informasi tentang pekerja anak ini seharusnya dimengerti oleh masyarakat apalagi orangtua yang memiliki anak usia sekolah. Agar dapat menanggulangi masalah pekerja anak diperlukan solusi inovatif untuk meningkatkan kesadaran masyarakat tentang bahaya pekerja anak. Perancangan media Iklan Layanan Masyarakat (ILM) tentang pekerja anak untuk memberdayakan anak Indonesia ini menggunakan model prosedural yakni model yang bersifat deskriptif. Model ini menggariskan langkah-langkah yang harus diikuti utnuk menghasilkan produk. Model perancangan media informasi ini mengacu pada model 4Dyaitu Define, Data, Design, Disseminate. Telah dihasilkan sebuah media iklan layanan masyarakat tentang pekerja anak untuk memberdayakan anak Indonesia dari perancangan ini. media iklan layanan masyarakat ini sebagai media yang berisi informasi mengenai pekerja anak kepada masyarakat bertujuan mengajak masyarakat untuk peduli kepada anak terutama pekerja anak.serta menjadi media yang dapat membantu P2TP2A (Pusat Pelayanan Terpadu Pemberdayaan Perempuan dan Anak) sebagai media sosialisasi yang efektif. Selain media iklan layanan masyarakat, media pendukung yang dihasilkan yaitu berupa, smartphone, poster dan x - banner.

Pengaruh sikap pada cara hidup di pesantren dan sikap pada fisika terhadap prestasi belajar fisika siswa MAN Denanyar Yayasan Pondok Pesantren Mamba'ul Ma'arif Denanyar Jombang oleh Erna Aprilia

 

Keberhasilanb elajar seseomngd ipengaruhio leh faktor indoganm isalnya sikaps eseorangte rhadaps uatuo bjek tertentu,d an faktor exsogenm isalnya lingkungant emqalt inggal. Untuk mengetahusi eberapaja uh ritup t"r"or*g terhadaps uatuo bjek teftentu digunakans kala pengukurans ikap. penelitiani ni !'ertujyanu ntut

Perancangan media informasi tentang Pencegahan Obesitas berbasis infografis interaktif / Gallery Widya Eksa

 

ABSTRAK Eksa, Gallery Widya. 2015. Perancangan Media Informasi Tentang Pencegahan Obesitas Berbasis Infografis Interaktif. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Moeljadi Pranata, M.Pd, (II) Gunawan Susilo, S.Sn, M.Sn. Kata Kunci: media informasi, obesitas, infografis, interaktif Tujuan perancangan ini adalah untuk menghasilkan rancangan media informasi tentang pencegahan obesitas dalam upaya pencegahan yang melibatkan kalangan remaja yang memiliki kecenderungan menderita obesitas. Usia Dewasa yang terjangkit, upaya pencegahan menyasar usia remaja. Dengan pendekatan media yang dekat dengan remaja yaitu infografis interaktif yang dapat dijalankan di perangkat komputer. Infografis interaktif mengajak audien turut bereaksi dan berinteraksi dengan sistem navigasi yang disediakan. Audien akan mendapat pengalamn (user experience) dengan adanya konsep teknologi yang ada di dalamnya. Metode perancangan mengacu pada model prosedural 4D yaitu data, definie, design, disseminate. Konsep perancangan terdiri dari perencanaan media, perencanaan kreatif, dan perencanaan tata desain. Data yang diperoleh berupa data referansi dan data lapangan yang digunakan dalam konten media. Perancangan ini menghasilkan media berupa infografis interaktif dengan spesifikasi Judul Media yaitu Bebas Dari Obesitas dengan fungsi sebagai media informasi pencegahan obesitas. Target Audiennya adalah laki-laki dan perempuan usia 15-25 tahun. Dimensi media PAL D1/DV 788 x 576 px, 25 fps. Jenis Tipografi yang digunakan yaitu Lobster 1.3 dan Myriad Pro. Warna Dominan Merah C 12, M 90, Y 81, K 2, #D13E3C dan Hijau Biru C 88, M 44.5, Y 56, K 25, #1A6060.

Dampak sosial prostitusi terhadap kehidupan masyarakat di lingkungan Tretes Kecamatan Prigen Kabupaten Pasuruan dan implikasinya dalm pendidikan IPS di SMP/MTs / Afri Rachmad Fauzi

 

ABSTRAK Fauzi, Afri Rachmad. 2016. Dampak Sosial Prostitusi Terhadap Kehidupan Masyarakatdi Lingkungan Tretes Kecamatan Prigen Kabupaten Pasuruan dan Implikasinyadalam Pendidikan IPS di SMP/MTs.Skripsi. Prodi Pendidikan Ilmu Pengetahuan Sosial, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) I Dewa Putu Eskasasnanda, S.Ant., M.A. (II) Dra. Hj. Siti Malikhah Towaf, M.A., Ph.D. Kata Kunci:dampak sosialprostitusi,kehidupan masyarakat, Lingkungan Tretes. Indonesia merupakan salah satu negara di dunia yang memiliki berbagai jenis pariwisata. Wisata komersial merupakan salah satu jenis pariwisata yang dikenal saat ini karena dapat menyebabkan banyak orang datang untuk berkumpul. Oleh sebab itu, muncul berbagai macam kebutuhan di daerah pariwisata seperti jasa pelayanan seksual melalui praktik prostitusi terselubung di Lingkungan Tretes Kelurahan Prigen Kecamatan Prigen Kabupaten Pasuruan. Rumusan masalah penelitian ini adalah: 1) Bagaimana sejarah keberadaan prostitusi di Lingkungan Tretes Kelurahan Prigen Kecamatan Prigen Kabupaten Pasuruan?2) Bagaimana dampak sosial prostitusi terhadapkehidupan masyarakat di Lingkungan Tretes Kelurahan Prigen Kecamatan Prigen Kabupaten Pasuruan? 3) Bagaimanaupaya penanganan dampak sosial prostitusi di Lingkungan Tretes Kelurahan Prigen Kecamatan Prigen Kabupaten Pasuruan 4) Bagaimana implikasi dampak sosial prostitusidi Lingkungan Tretes Kelurahan Prigen Kecamatan Prigen Kabupaten Pasuruan dalamPendidikanIPS diSMP/MTs? Penelitian ini menggunakan pendekatankualitatif deskriptifdan jenis penelitian studi kasus. Prosedur pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, dan dokumentasi. Metode triangulasi digunakan untuk mengecek keabsahan data.Kegiatan analisis data terdiri dari tahap pengumpulan data, reduksi data, penyajian data, dan penarikan kesimpulan. Berdasarkan hasil analisis data, diperoleh empat kesimpulan penelitian sebagai berikut: Pertama,sejarah keberadaan prostitusi di Lingkungan Tretes berawal dari dijadikannya Prigen sebagai daerah peristirahatan pada zaman penjajahan Belanda, sehingga muncul jasa pijat yang berkembang menjadi praktik prostitusi. Prostitusi itu pernahmarak pada dekade tahun 1980 hingga 1990-an. Kedua,dampak sosial prostitusi mencakup pandangan masyarakat Tretes terhadap prostitusi, pandangan masyarakat luar terhadap masyarakat Tretes, manfaat prostitusi terhadap kegiatan ekonomi, dampak prostitusi terhadap kondisi kesehatan dan keberlangsungan rumah tangga masyarakat Tretes, serta dampak prostitusi terhadap perilaku remaja Tretes. Ketiga, upaya penanganan dampak sosial prostitusi mencakup strategi adaptasi masyarakat Tretes serta upaya penanganan dalam bidang hukum, kesehatan, dan sosial yang dilakukan oleh beberapa pihak terkait. Keempat, materi penyimpangan sosial terutama sub materi kenakalan remaja dalam bentuk perilaku seksual di luar nikahmerupakan implikasi dampak sosial prostitusi di Lingkungan Tretes dalam pembelajaran IPS di SMPNegeri 1 Prigen dan SMP Sejahtera Prigen yang diajarkan Ibu Indah dan Bapak Chotib. Berdasarkan penelitian yang telah dilakukan, saran yang dapat diberikanbagi peneliti selanjutnya adalah dapat menjelaskan mengenai interaksi sosial antara PSK dengan masyarakat yang tinggal di Lingkungan Tretes.

Perbedaan prestasi belajar fisika siswa yang diberi tugas sebelum materi pembelajaran dengan siswa yang diberi tugas setelah materi pembelajaran di SLTP Negeri 3 Malang oleh Kasful Anwar

 

Pemberiantu gasd iluar jam pelajaranm erupakans alahs atum etodey ang diterapkagnu rug unam eningkatkapnr estasbi elajarf isika siswa.D enganp emberian tugast ersebust iswad ituntut untuk belajarm andiri. Hal ini mengingatmateri pelajaranf, rsikay angw ajib diajarkanm enurutk urikulum jumlahnyac ukup banyak, sedangkawna ktut igaj am pelajaranp er minggua tau3 6j am pelajarans elamas atu catur wulan seringkali tidak cukup. Dalam pelajaran fisika tugas dapat diberikan sebelumm aterip embelajaraant aus etelahm aterip embelajaranP.e nelitianin i bertujuanu ntukm engetahuai danya perbedaanp restasib elajar fisika antaras iswa yangd iberi tugass ebelumm ateri pembelajarand engans isway ang diberi tugas setelahm aterip embelajaranp okok bahasanta ta surya. Populasdi alamp enelitian'inia dalahs iswak elasI SLTPN egeri3 Malang yangt erdirid arid elapank elas.S edangkasna mpelnya dalahk elasI c dank elasI e yangt erdiri dari 88 siswa.T eknik pengambilans ampeld engan" acak kelompok". Setelahp erlakuanb erakhir,k eduak elompoke ksperimend iberi tes prestasib elajar fisika dengans oaly ang sama.I nstrumen prestasib elajar fisika yang digunakan berjumlah2 5 soald enganre liabilitass oal0 ,743.S elanjutnyad atah asilt esp restasi belajarfi sikad ianalisism enggunakaunj i-t duap ihakd enganta rafs ig:tifikan5 %. Dari hasila nalisisd iketahubi ahwat 66"o: 2,152> t6s":11 ,99 I , sehingp dapadt isimpulkanb ahwaa dap erbedaapnr estasbi elajarf isikay angs ignifikana ntara kelompoks isway ang diberi tugass ebelumm ateri pembelajarand engank elompok sisway angd iberi tugass etelahm ateri pembelajaranB. erdasarkann llai rata-rata prestasbi elajarf isika sisway angd iberi tugass ebelumm aterip embelajaraand alah 84,818le biht inggid ari sisway angd iberi tugass etelahm aterip embelajarayna itu 81,727. Dengan demikian dapat dikaakan bahwa pemberian tugas sebelum materi pembelajaralne bih baik dari padap emberiant ugass etelahm ateri pembelajaran untukm eningkatkapnr estasbi elajarf isika siswa.

Penerapan model pembelajaran Team Based Learning (TBL) untuk meningkatkan kemampuan berfikir kritis dan hasil belajar kognitif siswa akuntansi di SMKN 2 Blitar / Arina Manasikana

 

ABSTRAK Manasikana, Arina. 2016. Penerapan Model Pembelajaran Team Based Learning (TBL) Untuk Meningkatkan Kemampuan Berpikir Kritis Dan Hasil Belajar Kognitif Siswa Akuntansi di SMKN 2 Blitar. Skripsi. Program Studi S1 Pendidikan Akuntansi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Diana Tien Irafahmi S. Pd., M. Ed. (II) Bety Nur Achadiah S. Pd., M. Sc. Kata Kunci: Model Pembelajaran Team Based Learning,Collaborative Learning, Berpikir Kritis, Hasil Belajar Kognitif. Melalui pendidikan, seseorang mampu menggali dan mengembangkan segala potensi yang ada pada dirinya. Pada siswa SMK keterampilan berpikir kritis sangat diperlukan dalam era global untuk meningkatkan kemampuan bersaing, mengatasi masalah-masalah kehidupan yang semakin kompleks dan menyiapkan siswa menghadapi dunia kerja. Penelitian ini bertujuan untuk meningkatkan kemampuan berpikir kritis dan hasil belajar kognitif siswa kelas X akuntansi SMKN 2 Blitar. Penelitian ini menggunakan pendekatan penelitian kualitatif dengan jenis PenelitianTindakan Kelas (PTK) yang terdiri dari dua siklus. Teknik pengumpulan data yang digunakan meliputi observasi, angket, dan tes. Sedangkan analisis data meliputi data tindakan penelitian, kemampuan berpikir kritis, dan hasil belajar kognitif siswa. Adapun subjek yang digunakan dalam penelitian ini adalah siswa kelas X Akuntansi 1 SMK Negeri 2 Blitar yang berjumlah 35 siswa. Hasil penelitian menunjukkan bahwa penerapan model pembelajaran Team Based Learning dapat meningkatan keterampilan berpikir kritis siswa dari siklus I ke siklus II. Hasil analisis data kemampuan berpikir kritis siswa pada siklus I mencapai rata-rata 79, pada siklus 1 sebanyak 57% siswa telah mendapatkan nilai di atas SKM. Pada siklus II siswa mencapai rata-rata 84,6. Hasil belajar kognitif siswa pada observasi awal yang didapatkan dari pre-test sebesar 29% meningkat pada siklus 1 sebesar 51% dengan ketuntasan individu sebanyak 18 siswa dari 35 siswa. Hasil ketuntasan pada siklus 2 sebesar 86% dengan ketuntasan individu sebanyak 30 siswa dari 35 siswa. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa penerapan model pembelajaran Team Based Learning dapat meningkatkan kemampuan berpikir kritis dan hasil belajar kognitif. Hal ini dikarenakan pada tahapan model pembelajaran Team Based Learning lebih mempersiapkan dengan baik kegiatan pra-persiapan sebelum kelas dimulai dan siswa melakukan diskusi pada tes individu selanjutnya diikuti pemecahan permasalahan secara kelompok.

Penggunaan media kartu kata untuk meningkatkan keterampilan membaca permulaan siswa kelas I di SDN Senggreng 01 Kecamatan Sumberpucung Kabupaten Malang / Nadia Joan Rahmadhani

 

ABSTRAK Rahmadhani, Nadia Joan. 2016. Penggunaan Media Kartu Kata Untuk Meningkatkan Keterampilan Membaca Permulaan Siswa Kelas I di SDN Senggreng 01 Kecamatan Sumberpucung Kabupaten Malang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. M.Thoha A.R., S.Pd., M. Pd. Pembimbing (2) Dr. Muhana Gipayana, M. Pd. Kata kunci : membaca permulaan, media kartu kata. Hasil observasi pembelajaran bahasa Indonesia keterampilan membaca permulaan siswa kelas I SDN Senggreng 01 Kecamatan Sumberpucung Kabupaten Malang terdapat beberapa kekurangan diantaranya, (1) guru hanya menggunakan metode ceramah, (2) guru tidak menggunakan media sehingga siswa kurang berminat dan tidak aktif dalam pembelajaran. Hal ini menyebabkan masih banyak siswa kelas I yang masih belum bisa membaca dengan lancar. Penelitian ini bertujuan untuk meningkatkan keterampilan membaca permulaan dengan menggunakan media kartu kata pada siswa kelas I SDN I Senggreng 01 Kecamatan Sumberpucung Kabupaten Malang. Penelitian ini dirancang dengan menggunakan pendekatan deskriptif kualitatif. Sedangkan jenis penelitian ini adalah Penelitian Tindakan Kelas kolaborasi yang dilakukan sebanyak dua siklus. Desain penelitian menggunakan model Kemmis Mc. Teggart dengan subjek penelitian siswa kelas 1 yang berjumlah 24 siswa. Langkah-langkah peneliti berupa, (1) perencanaan, (2) pelaksanaan, (3) observasi, (4) refleksi. Data yang diperoleh berupa tes, lembar observasi, dan dokumentasi. Analisis data diawali dengan mengumpulkan data, menyajikan dan mendeskripsikan data kemudian menarik kesimpulan. Hasil penelitian yang telah dilaksanakan dengan penerapan media kartu kata ternyata dapat meningkatkan keterampilan membaca permulaan pada siswa kelas I. Pada tahap pratindakan rata-rata nilai kelas 65 dengan persentase ketuntasan 42%. Siklus I pertemuan pertama mengalami peningkatan rata-rata menjadi 71 dengan persentase ketuntasan 58%., siklus I pertemuan kedua mengalami peningkatan rata-rata menjadi 76 dengan persentase ketuntasan 79%. Siklus II diperoleh rata-rata hasil belajar bahasa Indonesia siswa sebesar 80 dengan persentase keberhasilan tindakan sebesar 96%. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa terjadi peningkatan hasil belajar bahasa Indonesia keterampilan membaca permulaan setelah diterapkan pembelajaran menggunakan media kartu kata.

Penggunaan diksi dan gaya bahasa dalam opini harian Jawa Pos edisi Februari 2016 / Binti Nikmatur Rosidah

 

ABSTRAK Rosidah, Binti Nikmatur. 2016. Penggunaan Diksi dan Gaya Bahasa dalam Opini Harian Jawa Pos Edisi Februari 2016. Skripsi, Program Studi Pendidikan Bahasa, Sastra Indonesia, dan daerah, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Anang Santoso, M.Pd., (II) Drs. Pidekso Adi, M.Pd. Kata kunci: diksi, gaya bahasa, opini Jenis media massa yang memiliki peran besar untuk menyebarkan informasi dalam bentuk cetak adalah surat kabar. Selain berfungsi untuk menyebarkan informasi, surat kabar juga sebagai salah satu cara untuk melakukan pembinaan bahasa Indonesia. Oleh karena itu bahasa dalam surat kabar penting untuk diteliti. Surat kabar memiliki beberapa rubrik halaman, salah satunya adalah rubrik opini. Rubrik opini memiliki tiga bentuk penulisan yaitu opini artikel, tajuk rencana, dan surat pembaca. Opini artikel bertujuan untuk menyebarluaskan informasi, sebagai pembinaan bahasa Indonesia, dan memiliki keluasan jangkauan sehingga opini artikel layak untuk diteliti penggunaan bahasanya baik dari segi diksi maupun gaya bahasa. Pemilihan diksi dalam penyampaian gagasan opini dapat berimplikasi terhadap pemahaman pembaca dan minat pembaca untuk menikmati surat kabar tertentu. Oleh karena itu, pemilihan diksi dalam opini dianggap penting untuk diteliti. Selain diksi, gaya bahasa juga memiliki peran penting untuk menyampaikan gagasan dalam opini sebab gaya bahasa sebagai bagian dari diksi memiliki peran untuk menarik perhatian pembaca dan mendapatkan penekanan terhadap pesan atau gagasan yang ingin disampaikan. Jadi, penelitian ini bertujuan untuk mendeskripsikan penggunaan diksi dan gaya bahasa dalam opini harian Jawa Pos edisi Februari 2016. Penelitian ini menggunakan pendekatan penelitian kualitatif dengan jenis penelitian deskriptif. Data dalam penelitian ini ialah data verbal yang berupa diksi dan gaya bahasa opini dalam harian Jawa Pos edisi bulan Februari 2016. Teknik yang digunakan dalam penelitian ini adalah pengumpulan dokumen teks opini pada bulan Februari 2016. Langkah-langkah pengumpulan data yaitu (1) menyiapkan surat kabar harian Jawa Pos edisi Februari 2016, (2) mencari rubrik halaman opini, (3) mencari opini artikel utama, (4) memasukkan data berupa penggunaan diksi dan gaya bahasa dalam opini surat kabar harian Jawa Pos edisi Februari 2016, (5) memberi kode pada teks yang dikumpulkan. Teknik analisis data pada penelitian ini terdiri atas (1) identifikasi data, (2) reduksi data, (3) interpretasi data, (4) eksplanasi data. Pengecekan keabsahan temuan dilakukan dengan triangulasi peneliti. Triangulasi peneliti dilakukan dengan jalan memanfaatkan peneliti lain untuk mengurangi kesalahan dalam pengumpulan data. Berdasarkan hasil penelitian, ditemukan dua kesimpulan yaitu penggunaan diksi dan penggunaan gaya bahasa dalam opini harian Jawa Pos Edisi Februari 2016. Hasil penelitian tersebut akan dijelaskan sebagai berikut. Pertama, kategori diksi berdasarkan makna yang paling banyak digunakan adalah makna denotatif. Banyaknya diksi kategori makna denotatif karena opini adalah sebuah karya jurnalistik yang usianya tidak bisa mencapai ratusan atau ribuan tahun seperti karya sastra, sehingga opini harus disampaikan dengan makna sebenarnya dan mengandung informasi yang sederhana, ringkas, lugas, dan langsung pada titik masalah agar tidak terjadi kesalahan penafsiran. Kategori diksi berdasarkan ketepatan diksi yang paling banyak digunakan adalah kata khusus. Banyaknya diksi kategori kata khusus dalam opini karena semakin khusus sebuah kata, maka semakin mudah memahami maksud dan maknanya. Kategori diksi berdasarkan kesesuaian diksi yang paling banyak digunakan adalah kata ilmiah. Kategori ini banyak digunakan karena opini halaman artikel ditulis oleh penulis yang memiliki latar belakang pendidikan, keahlian atau pengalaman yang sesuai bidangnya. Oleh karena itu, opini sering menggunakan kata ilmiah sebab penulisnya memang sudah mendalami bidang yang dikaji. Kedua, kategori gaya bahasa retoris yang paling banyak digunakan adalah gaya bahasa erotesis atau pertanyaan retoris. Banyaknya gaya bahasa retoris kategori erotesis atau pertanyaan retoris karena penulis opini memberikan kesempatan pembaca untuk memilih sesuatu yang penting. Dengan adanya pertanyaan retoris, penulis bermaksud untuk tidak menggurui atas permasalahan yang sedang diulas. Kategori gaya bahasa kiasan yang paling banyak digunakan adalah gaya bahasa ironi, sinisme, dan sarkasme. Banyaknya gaya bahasa kiasan kategori ironi, sinisme, dan sarkasme karena digunakan sebagai bentuk pemenuhan fungsi koreksi dalam media massa. Berdasarkan temuan penelitian dapat diberikan saran kepada beberapa pihak yaitu sebagai berikut. Pertama, bagi penulis artikel dan pembaca artikel. Hasil skripsi ini dapat digunakan sebagai bahan pertimbangan dalam menulis artikel yang berkaitan dengan bahasa yang digunakan. Selanjutnya untuk pembaca artikel dapat digunakan untuk mengetahui keragaman diksi dan gaya bahasa beserta fungsinya. Kedua, bagi tenaga pendidik dapat memanfaatkan hasil penelitian ini sebagai media pembelajaran untuk materi diksi dan gaya bahasa. Ketiga, bagi peneliti selanjutnya disarankan untuk melakukan penelitian lain dengan mengaitkan pada proses pembelajaran yaitu pengaruh penggunaan diksi dan gaya bahasa dalam opini harian Jawa Pos untuk meningkatkan kemampuan menulis siswa. Selain itu, peneliti lain juga disarankan agar melakukan penelitian lebih lanjut misalnya pada aspek penalaran, struktur isi, penggunaan kalimat, penggunaan preposisi, kata majemuk, dan pemakaian kata serapan dalam opini harian Jawa Pos.

Peningkatan prestasi belajar fisika melalui pendekatan keterampilan proses dan model siklus belajar berbasis konstruktivis dari siswaq kelas IIB semester II SLTP Negeri I Malang tahun ajaran 2002/2003 oleh Anita Susy Atmodjo

 

Berdasarkano bservasip' embelajaran frsi-t1' A SLTP Negeri I Malang sementairnai masih rn""gfinulut' t"tod" ceramah dan hanya sesekali siswa melakukakne giatant "otiitlttt"l Hui *i *tnytbabkan kemampuan keterampilapnr ottt "'*iiii"[ i"p* u"*"*bung secara maksimal' karena kemampukaent erampttanp '*"' 'o*u '""tut'yuL dapat dilihat apabila melakukakne giatanla b. Blrdasarkan kenyataante rsebutp, erlu kiranyaditerapkan suaptue mbelalur.uunn ,ffi ry"ltltu"{:n pt"toti u"iuiu'm elaluki eterampiluno ror.r.U ntuk itu dipirih pembelajaran denganp endekatakne trampilan proses denemano de'llt ru' u"rula'luneu "1["LLt1t-q'ltivis' Karendae ngamn odel or,rib.luiurutne rsebut, "l*u Oupumt engkonsrrukspie ngetahuannya sendiri' penelitiani ni bertujuanu ntr* meningka*"" p."!tuti belajir fisika melalui keterampipla,no t"' o"ngol'I*of,"i 'iuu' FI:j3t nunl u"tu*it konstruktivis dari siswkae lasll -e ,"mt't"iii tt* ltttert lY:l:1" tihuna jaran2 002/200D3'a n' keterampiplatno '"' y*g lilrlii"a"r'""rt pengetat'iaanl atd anb ahani'n terpretast' orJ*ti, tf"tinkasi, dan menyimpulkan ' ; peneliti Dalamp enetitiainn i;c*+- P:td"kiy kualitatifd engaJne nr antindakakne las@ Tf)' TJ"i-t"ft"p dalampenelitiainni sesuadi engatna hap tahaPpT K,v akni( l ) o#ffi';;idakan' ()) pelaksanaatinn dakand' an( 3) analisdisa nr efleksPi t;;ii;i;;"i Jilaksanakanialam 2 siklusv' aitus: iklusI dengamna terpi "tt'u'li i:juit"v"J t tirtr"sI I densanm aterAi lat optik' Hasipl enelrtr"";";;;j'"kkanb ahwa prestab-sei lajafri sikam elalui keteralmanpo ir or""n"lf"ii#il,'f; ;;i4i;"Gt"t^ prestabseil ajamr elalui keterampilapn. or", ,,r*i ditunjukkan a.nganu Jun"ypae ningka.pne rsentase skor untukp re-tes*t " p""-i"tio"ii tliii."t I dan siklus lI' Dari hasil peneltttan tersebudta patd itarikk esimpulan bahwao "T:io;; pembelajaran'fisika melalui oendekatakne trampila;;roses dand engan'modesli klusy angb erbasts lon,,*t,iudi,. o*'"1'[?:"?; ;;;J'' *' ry;*lj:t 6airii s *aS LrPNe g erIi *tl,*:t;:'i$:lTlJ'l[i':tliTff'i- !'il;ff*ia gar:(1)prosedur oembelajarann,*uvnng.Jii",uptunalu,np"n"iitianini-dapatditerapkandi lelas,( 2) sekolahO *,,ii#i^""nn-p"itruti*un t.i"it"ai*n aiatu ntukk egiatalna b walaupusne derhan;a# ffi;j'-g p".U"f u;arank, are.tap rosedupr embelalarani ni mengutam'k*i l;J;;itj;?;.c* benda konkreat gars iswad apamt em l;;;;; k";t"P baruY angh arusd iPahami'

A summative teacher-made test of English conducted in the 2nd semester of grade 8 in SMPN 9 Malang academic year of 2014/2015 / Maharani Khansa

 

ABSTRAK Khansa, Maharani. 2016. A SummativeTeacher-made Test of English Conducted in the 2nd Semester of Grade 8 in SMPN 9 Malang Academic Year of 2014/2015. Thesis, English Language Teaching Program, English Department, Faculty of Letters, State University of Malang. Advisor I: Dr. Sintha Tresnadewi, M.Pd. Advisor II: Prof. H. Ali Saukah, M.A., Ph.D. Keywords: Teacher-made test, final English test, item analysis Tujuan diadakannya penelitian ini adalah untuk mengevaluasi kualitas tes yang dibuat oleh guru pada Ujian Akhir Semester Bahasa Inggris Semester 2 Kelas 8 di SMPN 9 Malang Tahun Ajaran 2014/2015. Aturan-aturan dan prinsip yang digunakan untuk mengevaluasi tes pada penelitian ini adalah berdasarkan kriteria tes yang baik yang harus dicapai oleh sebuah tes agar menjadi sebuah alat ukur yang baik dalam menilai kemampuan siswa. Syarat-syarat untuk mengevaluasi sebuah tes yang akan menjadi fokus dalam penelitian ini adalah reliabilitas, validitas muka, validitas isi, tingkat kesukaran, daya pembeda, keefektifan pengecoh, dan konstruksi soal maupun alternatif jawaban. Desain yang digunakan dalam penelitian ini adalah deskriptif evaluatif. Metode kuantitatif dan kualitatif digunakan untuk mengevaluasi kualitas tes dalam penelitian ini. Data yang digunakan dalam penelitian ini didapat dari dokumen sekolah. Data yang digunakan adalah kisi-kisi soal yang dibuat oleh guru, lembar jawab siswa, dan naskah soal. Semua data yang digunakan dalam penelitian ini berasal dari dokumen pribadi SMPN 9 Malang. Data yang diperoleh kemudian dihitung menggunakan programMicrosoft Excel. Berdasarkan hasil analisis, soal Ujian Akhir Semester Bahasa Inggris Semester 2 Kelas 8 di SMPN 9 Malang Tahun Ajaran 2014/2015 memiliki reliabilitas yang cukup diterima. Koefisien reliabilitas tes yang diperoleh adalah .72 yang mana itu dapat diterima untuk tes tingkat kelas. Kedua, validitas muka dari tes tidak cukup bagus karena tidak dapat mencerminkan soal Ujian Akhir Bahasa Inggris yang sebenarnya. Ketiga, validitas isi dari tes baik karena mencakup 68% dari materi yang tertera dalam kurikulum . Keempat, tingkat kesukaran dari tes tergolong rendah. Kelima, hanya sebanyak 36% butir soal yang dapat diterima di dalam tes menurut indeks daya beda. Kebanyakan dari butir soal tidak dapat membedakan murid dari golongan “atas” dan murid dari golongan “bawah”. Keenam, hanya 28% dari keseluruhan soal yang semua pengecohnya berfungsi dengan baik. Ketujuh, konstruksi soal dan alternatif jawaban tidak begitu baik karena hanya terdapat 685checksdari total 850checksyang harus dipenuhi dalam mengevaluasi konstruksi butir soal. Terakhir, setelah merangkum hasil dari analisis butir soal, terdapat 17 butir soal yang harus dibuang karena butir-butir soal tersebut tidak memenuhi kriteria dan prinsip-prinsip butir soal yang baik. Untuk merangkum secara keseluruhan, tes yang dibuat oleh guru pada Ujian Akhir Semester Bahasa Inggris Semester 2 Kelas 8 di SMPN 9 Malang Tahun Ajaran 2014/2015 memiliki reliabilitas dan validitas isi yang bagus, namun tidak dapat menunjukkan hasil yang memuaskan dalam validitas muka dan hasil dari analisis butir soal. Mengetahui hasil dari analisis kualitas tes, sangat penting bagi guru sebagai pembuat tes untuk mengetahui cara mengevaluasi dan menganalisis tes. Tes yang dibuat oleh guru seharusnya dianalisis dan dievaluasi lebih dulu untuk memberikan hasil yang valid dalam mengukur kemampuan siswa. Jadi, kemampuan siswa yang sebenarnya dapat terukur dan terpaparkan dengan baik.

Metode Titrimetri penentuan kadar total dan kadar parsial EDTA dalam campuran Na2H2EDTA,NaCaEDTA, dan NaFeEDTA / Umi Muafidatul Laily

 

ABSTRAK Laily, Umi M. 2016. MetodeTitrimetriPenentuan Kadar Total dan Kadar Parsial EDTAdalamCampuran Na2H2EDTA, Na2CaEDTA,danNaFeEDTA.Skripsi, Program Studi S1 Kimia,Pembimbing: (I) Dr. Irma K. Kusumaningrum, S.Si, M.Si (II) Eli HendrikSanjaya, S.Si, M.Si. Kata Kunci:EDTA, kompleksometri, titrimetri. EDTA (Etilendiamintetraasetat) adalahsalahsatubahantambahanpangan yang biasadigunakandalamberbagaiprodukmakanankemasan. EDTA dalammakananberfungsisebagaisekuestran. Penggunaan EDTA maksimumdalammakananharusdibatasi. MenurutPeraturanKepalaBadanPengawasObatdanMakananRepublik IndonesiaNomor 18 Tahun 2013,bataspenggunaan EDTA padamakananadalah 33-1000mg/kg tergantungjenismakanannya.EDTA dalambahanpanganberadadalambentuksenyawa Na2H2EDTA, Na2CaEDTA, danNaFeEDTA. Metodesebelumnyayang telahbanyakdigunakanyaituinstrumentasispektrofotometri UV-Visdan HPLC, namunbelummampumenganalisiskadar EDTA total dalammakanandanmemerlukanbiayaoperasional yang mahal.Perluadanyasebuahmetodealternatifpenetuankadar EDTA dalambahanmakanansebagaipenyempurnametode yang telahada.Penelitianinibertujuanuntukmenyusunmetodepenentuankadar EDTA total dan EDTA parsial yang terdapatdalambentuk Na2H2EDTA, Na2CaEDTA,danNaFeEDTAdalamcampuran yang mengandungtigajenissenyawatersebut. Penentuankadar EDTA dilakukandenganbeberapatahapanyaitu (1) penentuankadar EDTA sebagai Na2H2EDTA denganmetodetitrimetri; (2) penentuankadar EDTA sebagai Na2CaEDTA denganmetodetitrimetri; (3) penentuankadarEDTA total denganmetodetitrimetri; (4) penentuankadar EDTA sebagaiNaFeEDTAdenganmetodetitrimetri; dan(5) perhitunganpersentaserecovery. Metodepenentuankadar EDTA dilakukansecaratitrimetrimenggunakanbeberapamacamlogam. Penentuankadar EDTA sebagai Na2H2EDTA dilakukanmenggunakanlogamkalsium yang terdapatpadalarutan CaCl2, sedangkanpenentuankadar EDTA dalambentuk Na2CaEDTA, kadar EDTA total, dankadar EDTA dalambentukNaFeEDTAdilakukanmenggunakanlogamkobalt yang terdapatpadalarutanCo(NO3)2. Berdasarkanhasilanalisispenentuankadar EDTA dilakukanpadacampuran Na2H2EDTA: Na2CaEDTA:NaFeEDTAdenganperbandingan 4:4:4; 4:8:8; dan 6:6:4, persentaserecovery yang dapatdicapaisecaraberturut-turutuntuksetiapkomposisicampuran EDTA adalahsebagaiberikut, padapenentuan EDTA sebagai Na2H2EDTA adalah(77,5%; 70,8%; 77,5%), EDTA sebagai Na2CaEDTA (98,5%; 62,2%; 88,7%), EDTA total (85,8%; 86,5%; 88,7%), dan EDTA sebagaiNaFeEDTA(81,5%; 80,0%; 96,2%).

Peningkatan kemampuan mengenal konsep bilangan 1-10 melalui permainan misteri dadu pada anak kelompok A di TK Angkasa 07 Pringgodani Singosari / Wening Kridhaning Arum

 

ABSTRAK Arum, Wening.K. 2016. Peningkatan Kemampuan Mengenal Konsep Bilangan 1-10 Melalui Permainan Misteri Dadu Pada Anak Kelompok A di TK Angkasa 07 Pringgodani, Singosari. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Program Studi Pendidikan Guru Pendidikan Anak Usia Dini, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Usep Kustiawan, M.Sn (II) Drs. Tomas Iriyanto, S.Pd, M.Pd. Kata kunci : Mengenal Konsep Bilangan, Permainan Misteri Dadu, Kelompok A Hasil pengamatan yang dilakukan di TK Angkasa 07 Pringgodani, Singosari, diketahui bahwa metode pembelajaran dalam pengenalan konsep bilangan 1-10 yang masih konvensional dan media pembelajaran dalam pengenalan konsep bilangan 1-10 yang digunakan kurang menarik karena warna cat yang sudah kusam dan beberapa bagian sudah hilang. Hasil belajar anak didik dalam pembelajaran mengenal konsep bilangan belum sesuai dengan standar tingkat pencapaian perkembangan kognitif anak usia 4-5 tahun. Sebanyak 75% dari 16 anak belum mampu mengenal konsep bilangan 1–10. Rumusan masalah penelitian ini adalah (1) bagaimanakah penerapan permainan Misteri Dadu dalam meningkatkan kemampuan mengenal konsep bilangan 1-10 pada anak kelompok A di TK Angkasa 07 Pringgodani Singosari; (2) apakah melalui permainan Misteri Dadu dapat meningkatkan kemampuan mengenal konsep bilangan 1-10 pada anak kelompok A di TK Angkasa 07 Pringgodani Singosari?. Peneliti ini dirancang menggunakan Penelitian Tindakan Kelas. Tahap dalam penelitian ini (1) perancanaan; (2) pelaksanaan tindakan; (3) observasi; (4) refleksi. Instrument dalam penelitian ini berupa (1) lembar penilaian; dan (2) lembar wawancara. Berdasarkan analisis Permainan Misteri Dadu dapat meningkatkan kemampuan mengenal konsep bilangan 1-10 pada anak kelompok A di TK Angkasa 07 Pringgodani Singosari dengan hasil peningkatan sebagai berikut. Kemampuan anak pada pertemuan pertama siklus I anak yang tuntas sebesar 37,5%, pada pertemuan kedua anak yang tuntas sebesar 43,75%, pertemuan pertama pada siklus II anak yang tuntas sebesar 68,75% dan pada pertemuan kedua siklus II anak yang tuntas sebesar 81,25%. Secara garis besar peningkatan dicapai secara prosentase yang dicapai > 75%. Sehingga dapat disimpulkan bahwa pengenalan konsep bilangan anak kelompok A TK Angkasa 07 Pringgodani, Singosari mengalami peningkatan. Bagi peneliti lain disarankan untuk mencoba penelitian menggunakan permainan Misteri Dadu untuk peningkatkan aspek perkembangan yang lainnya.

Perbedaan keefektifan metode pembelajaran kelompo dan metode pembelajaran ceramah bermakna untuk konsep hidrokarbon pada siswa kelas I Madrasah aliyah Khairuddin Gondanglegi Malang oleh Isma Mufidah

 

Kualilasp rosesb elajar-rnengabjaers arp enganrhnylear hadapp.e ncapaian hasilb elaiars isuraK" egiatani ni dikatakanb erhasila prbilahasilb elajl yangd icapai olehs iswas esuadi errgatnu juanp embelajarayna ngt elahd itetapkanU. ntukm encapai tujuanp emhelajaralinr sebt,t clipcrltrkanm elodep embelainrrnya ngt epat'D i anlara sejumlahm etodep embela.iarayna ngt elahd ikenalp adaw aktuj ni, dikenalm etode belajark elompokc lanr r.clcCec eramahb ermtkna.S alahs atuk onsepy nngd iajarkan di krlas I MadrasahA liyah se;uaid enganG aris-garisB esarP rogmmP engajaran (GBPPm) ala pnlajarank ir:riak uikulum sMU | 994 adalahh itlrokarbonK. onsep iersebtdit iajarkand i kelasI semesleILr Padaw aktup enelilianin i akand ilakukan belump ernahc ligunakamn cludeb elajark elompokd anm elodec elamahb ernraknad i MadraiahA liyahK hairuddinG ondangleg(Mi alang)o. leh karenait u dilakukan penelitiany anghertuiuanrm tukm engelahupi erbedaakne el' cLtilnnc li anlarak ecltn metodete rsebuut ntukk onseph idrokarbon. Rancangntnla lemp enelitianin i berupap etlakttanp lda drrak elomgroski srva. Duak elompoks iswa( l-A danI -B) dilenlukand enganc arad igndi.S alahs atuk elas l-A (31 sisrva)d iajard engann etodeb elajark elompokd ank elas 'l-B (32 sis'rvad) iajar denganm elodec eramabhe rmaknaD. alak emampuaanr vals isrvad iambild arin ilai rapork imia semesteLr sedangkand atah asilb elajars iswad iperolehd engan minggunakanin strumenp engukuhr asilb elajarb erupas eperangkasto alk onsep hjdroliarbony, anglerdiri dari duab agiany aitu BagianI (15 butir soaljarutban pendekd) anB agianI I (30 butir soalp rlihang anda)y angk hususd isusuno lehp eneliti setelahd ilnkukanu ji cobas atuk ali. Analisisd atad ilakukardre nganu ji Anavad uajalurd enganb anluan$ PSS6 .0, selanjutnyad atal ersebutd ideskripsikanu ntuli memperolehg ambaranle ntang perbedaakne efektifana ntaram elod\:p embelajarakne lompokd anm elode pembelajaracn€ mmahb ermaknuan tukk onseph idrokarbonl'.l asilp enelitian menunjukkabna hwah asilb elajakr imias iswak elas| (semestellr) MadrasaAh liyah KhnjnrddinG ondangleg(iM nlang),b rik yirngb erkemnmpuma walt inggj maupun yangb erkemampuaanw ali endahy angd iajard enganm etodek elompgkd anm etode iera-mabhe rmaknma enunjukkapne rbednayntu rgs ignilikanI.' lal ini dapatd ilihatc hrri nilais ignikansyia ngk urangd ari0 ,05.B erdasarkadna lak eaki{ans is'rvyira ng diperolihd arib anyaknyas isway angb erpartisipasdia lamm enjarvabd anm enanggapi pertanyaagnu mc lapadt isimpulkabna hwak eaktifans iswale bihs eringte rjadid alam pembeiaiarad-ne nganm etodeb elajark elompok.D ari hasil uji Anavad uaj alur diperoleshk orr ata-ratam elodep embelajarakne lompoks ebesa7r 5,28d ans korr atare10ce ramabhe rmaknas ebesa5r 4,38.D nri hnsilp enelitiant crsebudt aperl disimpulkabna hwam etodep embelajarakne lompokl ebih efektif dibandingkan metodpee mbelajaracne ramalD, erm aknaS. ehubungndne nganh asilp enelitianin i dapadt ikemukakasna rana gaL(:1 ) guruk imia di sekolahy angb ersangkulamn encoba menggrmakmane todep embelqaranke lompokd alamm elaksanali,taung asnya(,2 ) bagpi enelitlia iny arrgb erminamt elakukapne nelitianya ngs erupad apamt encoba menggunakmane todep embela ja rank elo mpnku ntukk onsep'lani .

Analisis kekuatan tarik bahan komposit matriks resin berpenguat serat alam dengan berbagai varian tata letak / Muhamad Muhajir

 

ABSTRAK Muhajir, Muhamad. 2016. Analisis Kekuatan Tarik Bahan Komposit Matriks Resin Berpenguat Serat Alam dengan Berbagai Varian Tata Letak. Skripsi. Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dr. H. Muhammad Alfian Mizar, M.P., (2) Dr. H. Dwi Agus Sudjimat, S.T., M.Pd. Kata Kunci: kekuatan tarik, komposit, resin, serat alam (ijuk) Penggunaan serat sintetis sebagai penguat komposit memiliki dampak negatif pada lingkungan karena limbahnya tidak dapat terurai secara alami dan dapat mengganggu hingga beberapa generasi. Penggunaan serat alami sebagai penguat komposit merupakan langkah bijak, mengingat serat alami dapat terurai secara mudah. Penelitian ini bertujuan untuk mengetahui kekuatan tarik pada serat alam (ijuk) yang akan digunakan sebagai bahan pertimbangan dalam membuat bahan teknik berbasis komposit dengan serat penguat serat alam (ijuk). Penelitian ini dilakukan menggunakan metode kuantitatif dengan rancangan penelitian eksperimental yang dilakukan penelitian di laboratorium. Objek penelitian berupa serat alam (ijuk) yang dipilih karena melimpahnya sumber daya alam tersebut. Spesimen matriks resin dibuat dengan standar ASTM D 638 M-84 dengan bahan resin epoksi dan katalis menggunakan metode pengecoran. Pariabel terikat penelitian ini yaitu kekuatan tarik, pariabel bebas penelitian ini yaitu continuous, woven, cross, random. Hasil penelitian menunjukkan kekuatan tarik komposit tertinggi dengan tata letak random sebesar 3,38 kgf/mm2 dan perpanjangan sebesar 0,38 mm, Cross sebesar 3,03 kgf/mm2 dan perpanjangan sebesar 0,86 mm, continuous sebesar 2,24 kgf/mm2 dan perpanjangan sebesar 1,03 mm, woven sebesar 1,64 kgf/mm2 dan perpanjangan sebesar 0,64 mm. Bentuk patahan menunjukan bahwa hasil pengujian tarik mengalami patahan getas, karena ujung patahan terdapat patahan 900 dan kasar, adannya mekanisme fiber pull out, Hal ini menunjukkan lemahnya ikatan antara serat dan matrik, karena serat mengandung lapisan seperti lilin (lignin dan kotoran lainnya) yang menghalangi ikatan interface antara serat dengan matrik, sedangkan ada yang tidak terlalu menunjukkan fiber pull out, karena ikatan interface antara serat dan matrik kurang kua. Hasil penelitian yang menunjukkan adanya fiber pull out disebabkan karena ikatan interface antara serat dan matrik sangat kuat. Hal ini membuktikan bahwa jenis tata letak serat penguat juga berpengaruh besar terhadap bahan komposit.

Penerapan realistic mathematics education untuk meningkatkan aktivitas dan hasil belajar siswa kelas VIII D SMPn 2 Malang pada materi Teorema Pythagoras / Iva Setyowati

 

ABSTRAK Setyowati, Iva. 2015. Penerapan Realistic Mathematics Education untuk Meningkatkan Aktivitas dan Hasil Belajar Siswa Kelas VIII D SMP Negeri 2 Malang pada Materi Teorema Pythagoras. Skripsi. Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing : (1) Drs. Askury, M.Pd. Kata Kunci : Realistic Mathematics Education, Aktivitas siswa, Hasil Belajar Berdasarkan hasil observasi awal pada tanggal 18 September 2014 serta wawancara yang dilakukan terhadap guru matematika kelas VIII D SMP Negeri 2 Malang ditemukan bahwa siswa kelas VIII D cenderung tidak aktif dalam mengikuti pembelajaran. Selama observasi awal dilakukan lebih dari 50 % siswa jarang bertanya jika tidak mengerti serta jarang pula yang mau mengungkapkan ide atau pendapat. Bahkan ada beberapa siswa yang mengerjakan hal lain yang tidak berkaitan dengan pembelajaran yang sedang dilaksanakan. Selain itu berdasarkan hasil belajar yang diperoleh oleh siswa pada bab sebelumnya, banyaknya siswa yang mencapai nilai lebih dari atau sama dengan 75 tidak lebih dari 75 % dari jumlah siswa keseluruhan. Dari hasil observasi awal tersebut terlihat bahwa aktivitas siswa dalam mengikuti pembelajaran di kelas kurang serta hasil belajar yang diperoleh siswa setelah mengikuti proses pembelajaran juga kurang. Oleh karena itu diperlukan model pembelajaran yang menuntut siswa untuk lebih aktif serta diharapkan dapat meningkatkan hasil belajar siswa. Model pembelajaran yang diterapkan adalah realistic mathematics education. Peneliti memilih realistic mathematics education untuk meningkatkan aktivitas dan hasil belajar siswa karena beberapa alasan antara lain : (1) kesulitan siswa dalam mengubah soal cerita kedalam bentuk kalimat matematika serta kesulitan siswa dalam mengaitkan materi matematika yang saat ini diterima dengan konsep-konsep matematika yang sebelumnya telah dipelajari, (2) terdapat beberapa hasil penelitian yang menyatakan keberhasilan realistic mathematics education dalam meningkatkan aktivitas dan hasil belajar siswa serta (3) karakteristik yang dimiliki oleh realistic mathematics education yang menuntut lebih banyak keterlibatan dari siswa sehingga menjadikan siswa lebih aktif. Penelitian ini dimaksudkan untuk mendeskripsikan langkah-langkah pembelajaran realistic mathematics education yang dapat meningkatkan aktivitas dan hasil belajar siswa kelas VIII D SMP Negeri 2 Malang pada materi teorema Pythagoras. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang berjalan dalam 2 siklus. Data yang dikumpulkan dalam penelitian ini meliputi : (1) hasil observasi aktivitas guru selama proses pembelajaran yang berpedoman pada lembar observasi aktitas guru, (2) hasil penilaian aktivitas siswa selama proses pembelajaran yang berpedoman pada lembar penilaian aktiitas siswa, (3) hasil catatan lapangan, (4) hasil tes akhir siklus. Realistic mathematics education pada materi teorema Pythagoras yang dapat meningkatkan aktivitas dan hasil belajar siswa kelas VIII D SMP Negeri 2 Malang dengan langkah-langkah sebagai berikut yaitu (1) Langkah I. Menghadirkan masalah kontekstual.Di awal pembelajaran guru memberikan masalah kontekstual yang dapat diamati oleh siswa. Dari pengamatan yang telah dilakukan, siswa diharapkan untuk memberikan respon terhadap masalah kontekstual baik berupa pertanyaan tentang masalah kontekstual atau ide untuk menyelesaikan masalah kontekstual. Masalah kontekstual disajikan di LKS yang diberikan kepada masing-masing siswa dan dikerjakan secara berkelompok. (2) Langkah II. Menyelesaikan masalah kontekstual. Pada langkah kedua ini siswa mengerjakan LKS bersama dengan teman sekelompok untuk menemukan selesaian dari masalah kontekstual. (3) Langkah III. Mendiskusikan selesaian masalah kontekstual. Pada langkah ini perwakilan dari masing-masing kelompok mempresentasikan hasil kerjanya dan kelompok lain memberikan tanggapan terhadap kelompok yang presentasi. (4) Langkah IV. Menyimpulkan materi pembelajaran. Penyimpulan materi dilakukan secara bersama-sama dengan arahan dari guru sehingga diperoleh kesimpulan yang benar. Data penelitian juga menunjukkan bahwa aktivitas selama proses pembelajaran dan hasil belajar siswa setelah mengikuti pembelajaran meningkat. Hal ini dapat dilihat dari peningkatan persentase penilaian aktivitas siswa pada siklus I yaitu 16 % dari siswa kelas VIII D SMP Negeri 2 Malang yang melakukan aktivitas dengan kategori minimal “baik” dan pada siklus II yaitu 81 % dari siswa kelas VIII D SMP Negeri 2 Malang yang melakukan aktivitas dengan kategori minimal “baik”. Serta hasil tes akhir siklus I yaitu 61 % dari siswa kelas VIII D SMP Negeri 2 Malang yang mendapatkan nilai lebih dari atau sama dengan 75 dan pada siklus II yaitu 81 % dari siswa kelas VIII D SMP Negeri 2 Malang yang mendapatkan nilai lebih dari atau sama dengan 75.

Pengembangaan media pembelajaran menulis teks cerpen untuk siswa SMP berdasarkan program powtoon / Danang Febrianto

 

ABSTRAK Febrianto, Danang. 2015. Pengembangan Media Pembelajaran Menulis Teks Cerpen untuk Siswa Kelas VII Berdasarkan Program Powtoon. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Yuni Pratiwi, M.Pd., (II) Dra. Ida Lestari, M.Pd. Kata Kunci: media, menulis teks cerpen, program powtoon Kurikulum 2013 merupakan penyempurnaan dari KTSP dan berfungsi se-bagai sebagai acuan utama dalam penyelenggaraan pembelajaran.Perbedaan yang mencolok terdapat pada standar kompetensi lulusan.Kriteria dalam SKL menca-kup sikap, pengetahuan, dan keterampilan. Pada pembelajaran bahasa Indonesia berdasarkan K13 menerapkan pembelajaran berbasis teks. Salah satu teks yang diajarkan pada jenjang SMP adalah teks cerpen.Teks cerpen merupakan satu-satunya teks sastra yang diajarkan di kelas VII.Pembelajaran menulis cerpen ku-rang mendapat perhatian oleh peserta didik karena kurangnya apresiasi pendidik terhadap kegiatan pembelajaran ini. Berdasarkan hasil wawancara denganguru pembelajaran bahasa Indonesia di SMP Negeri 1 Campurdarat, diperoleh bahwa minat peserta didik pada kegiatan menulis cerpen masih kurang. Hasil wawancara dengan peserta didik pun menunjukkan bahwa sebenarnya peserta pendidik menginginkan suasana pembe-lajaran menulis cerpen yang lebih menyenangkan.Peserta didik menginginkan ter-sedianya media yang menyenangkan yang dapat mengatasi kesulitan mereka da-lam belajar sehingga mereka juga lebih bersemangat.Kesulitan menemukan ide, alur cerita, dan cara mengembangkan cerita merupakan salah satu kendala siswa dalam menulis cerpen. Tujuan penelitian dan pengembangan ini secara umum adalah menghasil-kan media pembelajaran menyusun teks cerpen untuk siswa SMP berdasarkan program powtoon.Produk media yang dihasilkan secara khusus dikembangkan dengan memperhatikan muatan informasi materi, bahasa, tampilan visual, dan latar belakang suara. Media yang dihasilkan berupa video interaktif untuk kegiatan menulis teks cerpen.Terdapat materi pemodelan teks cerpen, penyusunan teks secara bersama, dan penyusunan teks secara mandiri. Penelitan ini menggunakan metode penelitian dan pengembangan. Rancangan penelitian diadaptasi dari prosedur penelitian pengembangan Borg & Gall yang dimodifikasi menjadi tujuh langkah penelitian. Ketujuh langkah penelitian tersebut, meliputi(1) analisis kebutuhan, (2) pengembangan produk, (3) uji validasi, (4) revisi pertama (revisi I), (5) uji coba lapangan, (6) revisi tahap kedua (revisi II), dan (7) tahap akhir. Uji kelayakan produk media ini melibatkan (1) ahli pembelajaran bahasa Indonesia, (2) ahli media pembelajaran, (3) praktisi pembelajaran bahasa Indone-sia, yaitu pendidik bahasa Indonesia, dan (4) siswa kelas VII SMPN 1 Campurda-rat sebagai subjek uji lapangan. Wujud data dalam penelitian ini berupa data numerik dan verbal. Data numerik diperoleh melalui angket penilaian produk kepada ahli pembelajaran ba-hasa Indonesia, ahli media, praktisi pembelajaran bahasa Indonesia, dan subjek uji lapangan.Data verbal berupa catatan komentar, kritik maupun saran yang ditu-liskan dalam angket penilaian.Data verbal selanjutnya dianalisis sebagai salah satu acuan revisi produk. Berdasarkan hasil uji diketahui hasil penilaian produk dari ahli materi se-besar 86,30%, ahli media sebesar 89,33%, praktisi pembelajaran bahasa Indonesia sebesar 76%, dan uji lapangan sebesar 95,66%. Berdasarkan penilaian ahli materi, produk pembelajaran tergolong layak meskipun masih perlu direvisi.Berdasarkan uji ahli media, produk tergolong layak dan perlu direvisi.Berdasarkan uji praktisi pembelajaran bahasa Indonesia, produk tergolong layak.Hasil uji lapangan kepada siswa kelas VII SMP digunakan peneliti untuk mengetahui respon peserta didik terhadap media pembelajaran sebagai penunjang kegiatan pembelajaran menulis teks cerpen. Kesimpulan penelitian dan pengembangan ini adalah media pembelajaran menulis teks cerpen kelas VII SMP berdasarkan program powtoon tergolong layak dan dapat diimplementasikan. Sebagai langkah pemanfaatan produk hasil pengembangan, pendidik disarankan untuk menggunakan media pembelajaran ini sebagai penunjang kegiatan menyusun teks cerpen. Penggunaan media ini mampu mengatasi problematika peserta didik dalam kegiatan penulisan teks cerpen.Penggunaan media ini diharapkan menjadi alat evaluasi bagi pendidik sehingga mengembangkan media pembelajaran yang lebih kreatif dan inovatif. Prosedur penelitian pengembangan ini dapat menjadi pedoman bagi peneliti lainuntuk mengembangkan media dengan topik yang berbeda. Pengembang lain disarankan untuk mengikuti langkah-langkah yang ditempuh dalam penelitian ini. Penyebarluasan media ini dapat dilakukan dengan tiga cara, yaitu (1) melalui MGMP Guru bahasa Indonesia, (2) melalui peserta didik yang telah menggunakan media, dan (3) melalui media massa karena outputmedia ini langsung terunggah di situs www.youtube.com.

Implementing process writing strategy using weblogs to improve the students' ability in writing a descriptive text / Hendi Rizki Putra Prayogatama

 

ABSTRACT Prayogatama, Hendi Rizki Putra. 2015. Implementing Process Writing Strategy Using Weblogs to Improve the Students’ Ability in Writing a Descriptive Text. Thesis, English Department. Faculty of Letters, State University of Malang. Advisors: (1) Prof. Utami Widiati, M.A., Ph.D., (2) Dr. Utari Praba Astuti, M.A. Keywords: Writing, Descriptive Text, Process Writing Strategy, Weblogs This research aims at knowing how process writing strategy using weblogs is able to improve the ability of the X MIA 3 Students of Senior High School 2 Lamongan in writing a descriptive text. Process Writing Strategy is chosen due to its stages – such as pre-writing where the students gather the ideas, and revising and editing where the students can recognise what to add and omit towards their drafts- that can improve the students’ writing skill. Since the stages of the process writing strategy need more time, the media weblogs are employed in order to make the activity done in the class more time-saving since the activity of drafting, as well as giving peer review, can be continued and done at home. The design of this research is collaborative classroom action research comprising four stages: planning, implementing, observing, and reflecting. The instruments to gather data were observation checklist, interview guide, field notes, and questionnaires. The subjects of this research are the students of X MIA 3 of Senior High School 2 Lamongan. They were chosen since the results of the preliminary study show that the students were lack of both ability and interest in the writing activity. This study took a cycle which consists of four meetings. The findings of this study show that the students’ ability and participation in writing a descriptive text were improved. The improvement of the students’ ability was indicated by the fact that every student has successfully increased his/her score in at least 10 points in the final writing task compared to the their works in the preliminary study. It can also be found that the average scores in all aspects obtained by the students increased to good levels. Furthermore, it was also found that the students were more interested, and active, in doing any activity in the implementation. The improvement of both ability and participation of the students was due to the learning procedure implemented. The steps of the learning procedure are as follows: (1) the students get a modelling of a descriptive text, (2) compose a descriptive text in groups (3) post the works on the group leaders’ weblog pages, (4) identify the errors in group works, (5) make a descriptive text individually started by generating the ideas using either clustering or listing, (6) post the rough drafts on their weblog pages (7) give peer reviews on the weblogs, and finally (8) revise and edit their works based on the feedbacks given. The role of the researcher is to teach the students regarding the background knowledge of a descriptive text in the first meeting and supervise them when doing the stages of process writing strategy in the second, third, and fourth meeting. As a conclusion, if the process writing strategy facilitated by weblogs is implemented to the students’ writing activity, the ability of the students in writing, especially a descriptive text, will improve. Furthermore, the students will be more active and motivated in joining the activity. The improvement of the ability was due to the fact that the students got prepared with the ideas to be developed and learnt some vocabulary in the pre-writing stage. Beside that, when the students were revising and editing their drafts, they could recognise what should be added and omitted towards their descriptive texts. Meanwhile, the group discussion regarding the assigned objects in the pre-writing stage and the implementation of media weblogs could make the students participate more actively when the learning procedure was implemented. ABSTRAK Prayogatama, Hendi Rizki Putra. 2015.Implementasi Strategi Proses Menulis Menggunakan Weblogs untuk Meningkatkan Kemampuan Siswa dalam Menulis Teks Deskripsi. Skripsi, Jurusan Sastra Inggris. Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (1) Prof. Utami Widiati, M.A., Ph.D., (2) Dr. Utari Praba Astuti, M.A. Kata Kunci : Menulis, Teks Deskriptif, Strategi Proses Menulis, Weblogs Penelitian ini bertujuan untuk mengetahui penerapan strategi proses menulis dalam meningkatkan kemampuan menulis teks deskripsi siswa kelas X MIA 3 SMA N 2 Lamongan. Strategi proses menulis dipilih karena mempunyai beberapa tahapan yang dapat meningkatkan kemampuan menulis siswa, seperti pre-writing dimana siswa mencari gagasan, dan revising serta editing di mana siswa dapat mengetahui hal-hal apa saja yang harus ditambahkan atau dihilangkan dalam pekerjaan mereka. Tahapan-tahapan yang dimiliki strategi ini membutuhkan waktu yang lebih banyak untuk dilakukan. Peneliti menggabungkan media Weblogs untuk membuat aktivitas menulis lebih hemat waktu karena aktivitas drafting dan peer review dapat dilanjutkan dan dikerjakan di rumah. Penelitian ini merupakan penelitian tindakan kelas. Penelitian ini memiliki empat tahapan antara lain: persiapan, implementasi, observasi, dan refleksi. Instrumen yang digunakan dalam penelitian ini antara lain checklist observasi, pedoman interview, catatan lapangan, dan kuisioner. Subjek penelitian ini adalah siswa kelas X MIA 3 SMA Negeri 2 Lamongan. Subjek ini dipilih karena berdasarkan hasil dari studi awal, para siswa mempunyai tingkat kemampuan dan ketertarikan yang rendah dalam mengikuti aktivitas menulis. Penelitian ini membutuhkan satu siklus dengan empat pertemuan. Hasil dari penelitian ini menunjukkan bahwa kemampuan dan partisipasi siswa dalam menulis teks deskriptif meningkat. Peningkatan kemampuan siswa dalam menulis dapat ditunjukkan melalui fakta bahwa setiap siswa dapat meningkatkan nilainya paling tidak 10 poin pada tugas akhir menulis dibandingkan dengan pekerjaan mereka sebelum strategi dan media diterapkan. Nilai dari seluruh aspek yang didapatkan siswa meningkat ke level ‘baik’. Selain itu, dapat diketahui bahwa siswa lebih tertarik, dan aktif dalam melakukan segala kegiatan saat kegiatan belajar dilaksanakan. Peningkatan kemampuan dan partisipasi siswa dalam menulis adalah disebabkan oleh kegiatan belajar yang telah diterapkan oleh peneliti. Secara ringkas, tahapan-tahapan yang ada dalam kegiatan belajar siswa adalah sebagai berikut: (1) Siswa mendapatkan contoh teks deskriptif, (2) menulis teks deskriptif dalam kelompok, (3) mengunggah pekerjaan pada halaman blog ketua kelompok, (4) mengidentifikasi kesalahan yang terdapat pada pekerjaan kelompok, (5) menulis teks deskriptif secara individu yang dimulai dengan menentukan gagasan dengan menggunakan teknik clustering atau listing, (6) mengunggah draft pada halaman weblog mereka, (7) memberikan saran atau komentar secara berpasangan melalui weblog, dan (8) merevisi dan memperbaiki pekerjaan mereka berdasarkan saran yang telah diberikan. Peneliti berperan sebagai pengajar yang menyampaikan beberapa konsep dasar teks deskriptif pada pertemuan pertama, dan mendampingi siswa saat mereka mengerjakan tahap-tahap strategi proses menulis pada pertemuan kedua, ketiga, dan keempat. Sebagai kesimpulan, apabila strategi proses menulis dengan weblog diterapkan pada aktivitas menulis siswa, kemampuan menulis siswa khususnya menulis teks deskriptif akan meningkat. Selain itu, siswa akan berpartisipasi lebih aktif dalam mengikuti aktivitas menulis.Peningkatan kemampuan menulis siswa dikarenakan bahwa siswa mempersiapkan gagasan-gagasan pada taham pre-writing. Selain itu, saat siswa merevisi dan memperbaiki draf, mereka dapat mengetahui hal apa saja yang perlu ditambahkan dan dihilangkan. Sementara itu, diskusi kelompok mengenai objek di tahap pre-writing dan penerapan media weblogs dapat membuat siswa berpartisipasi lebih aktif saat pembelajaran dilakukan.

Analisis dan uji kekuatan kuda-kuda baja ringan profil U / Nur Rohman

 

ABSTRAK Rohman, Nur. 2016. Analisis dan Uji Kekuatan Kuda-kuda Baja Ringan Profil U, Skripsi, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Mohammad Sulton, S.T., M.T., (II) Imam Alfianto, S.T, M.T. Kata kunci: Kuda-kuda Baja Ringan, Baja Ringan Profil U. Baja ringan merupakan alternatif material rangka atap yang mulai banyak digunakan, dengan berbagai macam profil yang beredar salah satunya adalah profil U. Profil U banyak digunakan pada bangunan sipil dengan bentang kuda-kuda yang lebar. Akan tetapi, penelitian mengenai profil ini terhadap penggunaannya sebagai rangka atap di lapangan masih jarang dilakukan. SNI baja ringan (baja canai dingin) 7971-2013 juga masih baru, sehingga diperlukan pembahasan lebih lanjut dan mengaplikasikannya dalam perencanaan. Kekuatan konstruksi batang ditinjau dari gaya normal yang mampu dipikul, dan salah satu indikatornya pada lendutan yang terjadi. Lendutan yang melebihi kapasitas kekuatan material dapat mengakibatkan keruntuhan keseluruhan konstruksi. Penelitian diawali uji pendahuluan tarik material (tensile test) yang akan ditinjau secara analisis dan uji model. Sehingga didapatkan karakteristik material berupa Fy, Fu, dan E. Analisis dan pengujian model sebenarnya menggunakan kuda-kuda baja ringan profil U tipe rangka howe bentang 4 meter dengan sudut kemiringan atap 30° sebanyak 3 benda uji yang diberi beban terpusat di titik simpul atas tengah bentang. Pencatatan data lendutan model setiap 20 kg hingga model mengalami keruntuhan. Hasil penelitian secara analisis menggunakan metode Unit Load dan perhitungan lendutan (δ) model sebenarnya pada pengujian laboratorium. Batas lendutan maksimum model secara analisis sebesar 7.9846 mm terjadi pada beban 4900 kg. Batas lendutan model pengujian sebesar 7.96 mm pada beban 620 kg (Model 1), 7.71 pada beban 740 kg (Model 2), dan 7.91 pada beban 700 kg, apabila dirata-rata lendutan sebesar 7.78 pada beban 680 kg. Prosentase perbedaan hubungan beban-lendutan mencapai 80%, dimana uji model > analisis. Grafik hubungan beban-lendutan secara analisis merupakan linier, namun pada grafik uji model sebenarnya menunjukkan hubungan yang non-linier dengan keruntuhan utama kuda-kuda pada sambungan di area tumpuan dan Local Buckling of the Web (LBW). Saran perbaikan untuk penelitian selanjutnya dengan memperkuat area tumpuan dan pengawasan pengerjaan sebenarnya agar sesuai dengan perencanaan. Sehingga, didapatkan hasil penelitian yang lebih baik. Rohman, Nur. 2016. The Analysis and Experimental Tests of the Strength of U-Profile Steel Roof Truss, Thesis S1 Civil Engineering Faculty of Engineering, State University of Malang. Concelor: (I) Mohammad Sulton, S.T., M.T., (II) Imam Alfianto, S.T, M.T. Keyword: Lightweight steel of roof truss, U-Profile of roof truss Lightweight steel was a alternative of roof frame material that is widely used, with a variety of profiles of outstanding one is the profile U. Profile U widely used in civil buildings span the width of the sell light steel. But, research on this profile used as a roof truss at the field are still rarely. SNI light steel (cold rolled steel) 7971-2013 was still new, so it required further discussion and applied it in planning. Rod construction strength in terms of the normal force was able to shouldered, and one indicator on a deflection occurs. Deflection exceeded the capacity of the material strength could lead to collapse of the entire construction. The research began preliminary tested tensile material (tensile test) which will be reviewed in the analysis and test models. So we get the characteristics of the material in the form Fy, Fu, and E. Analysis and test used the actual model sell light steel U-type frame profile 4 meter span roof with a slope angle of 30 ° as much as 3 specimen by concentrated loads at a node on the middle landscape. Recorded data every 20 kg of deflection models to models of collapse. The results of analysis used calculation methods Unit Load and deflection (δ) models of actual laboratory testing. The results of the analysis model as a maximum deflection of 8.00 mm occurred at 4900 kg load, deflection resulted an average of 3 models in testing of 8.00 mm was achieved in 690 kg load. Percentage difference reached 80% (test models> analysis). Graph of load-deflection relationship in the analysis was linear, but in fact the model test chart showed the non-linear relationship with a major collapse of the sell at the junction in the area of the pedestal and Local Buckling of the Web (LBW). Suggested improvements for next research to strengthen the foundation area and the actual construction supervision order in accordance with planning. So that the results obtained are better.

Penerapan pembelajaran Think Talk Write (TTW) berbantuan peta konsep untuk meningkatkan kemampuan komunikasi matematis tertulis siswa kelas X KKA 2 SMK Negeri 5 Malang pada materi Relasi dan Fungsi / Novi Indriani

 

ABSTRAK Indriani, Novi. 2015. PenerapanPembelajaranThink Talk Write(TTW) berbantuanPetaKonsepuntukMeningkatkanKemampuanKomunikasiMatematisTertulisSiswaKelas X KKa2 SMK Negeri 5 Malang padaMateriRelasidanFungsi. Skripsi, JurusanMatematika, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: Dr. ErryHidayanto, M.Si. Kata kunci: TTW, petakonsep, komunikasimatematistertulis Berdasarkanobservasipembelajaranmatematika di kelas KKa2 diperolehfaktabahwasebagianbesarsiswamengalamimasalahdalammengomunikasikan ide-ide matematisbaiklisanmaupuntertulis. Guru menyampaikantopikpembelajarankemudian guru menjelaskanmateri di papantulis, memberikancontoh, danselanjutnyasiswadimintauntukmencatatpenjelasan guru danmengerjakanlatihansoal. Pembelajaranmasihdidominasi guru.Olehkarenaitu, diperlukanpembelajaran yang dapatmemberikesempatankepadasiswauntukmengomunikasikan ide-ide matematisbaiktertulismaupunlisanyaituThink Talk Write (TTW) berbantuanpetakonsep.Tujuandaripenelitaniniadalahuntukmendeskripsikanlangkah-langkahpembelajaranThink Talk Write(TTW) berbantuanpetakonsep yang dapatmeningkatkankemampuankomunikasimatematistertulissiswakelas X KKa 2 SMK Negeri 5 Malang padamaterirelasidanfungsi. Penelitianinimerupakanpenelitiantindakankelas (PTK) yang terdiridariempatlangkahyaituperencanaan, pelaksanaan, observasi, danrefleksi. Langkah-langkahpembelajaran TTW terdiridaritigatahap, yaitutahapthink, siswamembacadanmengamatipermasalahan-permasalahanpadalembaraktivitassiswakemudianmembuatcatatankeciltentangapa yang diketahuidanapa yang belumdiketahuidenganbahasasendiri. Tahaptalk, siswaberdiskusiuntukmenyelesaikanpermasalahan-permasalahan yang diberikanoleh guru dalamkelompokheterogen 4-5 siswa.Tahapwrite, siswamenuliskan ide-ide yang dihasilkanpadatahapthink dantalk. Pembelajaran TTW berbantuanpetakonsepadalahpenerapanpembelajaran TTW denganmembuatpetakonseppadatahapwrite.

Kajian tentang kemampuan siswa kelas III MAN Lumajang dalam memahami tipe-tipe reaksi senyawa karbon oleh Atik Widyawati

 

Berdasarkanh asil kajian terhadapG BPPm ata pelajarank imia kurikulum SMU 1994 dan GBPP mata pelajaran kimia kuriknlum MA 1994 dapat disimpulkan bahwap enyelenggaraapne mbelajarank imia di MA menggunakanp edomany ang sama dengan di SMU. Dalam penelitian yang telah dilakukan oleh Syarifa Wahidah Al Idrus tentang kesulitan siswa kelas III SMU Negeri I Selong NTB dalam memahammi ateri reaksi senyawak arborLm enunjrkkan batrwas iswak elasI tr SMU masih mengalami kesulitan dalam memahami reaksi substitusi, reaksi adisi dan reaksi eliminasi. Kesulitan tersebut mungkin juga dialami oleh siswa kelas III MA yangj uga mempelajarib ahank ajian reaksis enyawak arbon,s ehinggam endorong peneliti untuk meneliti kemampuan siswa kelas Itr MAN Lumajang datam memahamtii pe-tipe reaksi senyawak arbon. Masalahd alam penelitiani ni adalahb agaimanakahd eskripsik emampuan siswa kelas III ivfAN Lum ajang dalam memahami tipe+ipe reaksi senyawa karbon? Sesuadi enganm asalaht ersebut,m akat ujuan penelitiani ni adalahu ntuk mengetahui deskripsik uantitatif (persentases) iswak elasI tr MAN Lumajangy ang mampu menjawab dengan benar soal-soal tipe rea}si substitusi, adisi, dan eliminasi. Dengan demikian penelitian tersebut merupakan penelitian destriptif Dalam rangka keperluan tersebut, maka dilakukan penelitian dengan menggunakanin strumenb erupas eperangkast oal tes obyelcif tentangr eaksi substitusia, disi,d ane liminasid enganti ga tipe soaly aitu pilihan gandaa, sosiasi pilihan, dan hubung;ana ntarh al yang disusuno leh peneliti.Untukm emperoleh instrumen yang layak digunakan sebagai pengumpul data maka sebelumnya dilakukan uji coba instrumen di MA Putri Nurul lvlasyithah Lumajang pada siswa kelas III program khusus IPA. Hasil penelitiani ni menunjukkanb ahwa:( 1) persentasera ta-ratak emampurn siswad alamm emahamtii pe reaksis ubstitustie rmasukk ategoric ukup( 57,03%). Dalam hal ini, kemampuans iswad alamm enyebutkanre aksi-reakssi ubstitusil ebih baik daripada kemampuan mengidentifikasi senyawa karbon yang dapat mengalami reaksis ubstitusid an kemampuanm enyelesaikanp ersamaanre aksis ubstitusi,( 2) persentasera ta-ratak emampuans iswad alam memahamit ipe reaksia disi termasuk kategoric ukup( 56,31%)D, alamh al ini, kemampuansi swad alamm enuliskanb entuk umump ersamaanre aksia disi lebih baik daripadak emampuanm enyebutkanre aksil l l reaksai disi,k emampuanm endefinisikanre aksia disi,k emampuanm engidentifikasi struktur-struktusr enyawak arbony ang mengalamir eaksia disi, dan kemampuan menyelesaikapne rsamaanre aksia disi, (3) persentasera la-ratakemampuasni swa dalamm emahamtii pe reaksie liminasit ermasukk ategoric ukup( 5g,3g%)D. alamh al ini, kemampuans iswad alam menuliskanb entuk urnump ersamaanre aksie liminasi lebihb aik daripadak emampuanm endefinisikanre aksie liminasi,k em2mp,ran menyebutkanre aksi-reaksei liminasi, dan kemampuanm enyelesaikanp ersamaan reaksei liminasi,( a)iika ditinjaud ari tipe soalnyak, emampuansi swad alam memahamtii pe reaksi substitusi,a disi, dan eliminasi denganb entuk soalo byektif tip€.soapl ilihang andale bih baik daripadati pe asosiaspi ilihand anh ubungana ntar hal. Berdasarkanh asil penelitiand i atasd apatd isimpulkanb ahwak emampuan terendahs iswak elasI II MAN Lumajangd alam memahamit ipe-tipe reaksi senyawa karbont erletakp adam enyelesaikanp ersamaanre aksi. lv

Evaluasi kinerja pengolahan air Gunungsari Surabaya untuk mencukupi suplai air baku industri PT Petrokimia Gresik / Nur Jannah

 

ABSTRAK Jannah, Nur. 2016. Evaluasi Kinerja Instalasi Pengolahan Air Gunungsari Surabaya untuk Mencukupi Suplai Air Baku Indutri PT. Petrokimia Gresik. Skripsi, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Wasis,. M.T, (II) Drs. Pribadi ,. S.T,. M.T. Kata Kunci:pengolahan air, air industri, Gunungsari Instalasi pengolahan air Gunungsari merupakan salah satu penyedia air untuk industri PT. Petrokimia dari hasil pengamatan yang dilakukan pihak pengelolah instalasi menunjukkan bahwa terdapat permasalahan yaitu hasil pengolahan instalasi hanya tersalurkan dalam jumlah yang tidak sesuai dengan yang direncanakan, sering kali terjadi masalah pada kualitas air baku Penelitian ini dilakukan dengan tujuan mengetahui parameter kualitas air baku kali Surabaya, mengetahui kualitas air produksi instalasi, permasalahan yang ada di instalasi, dan memberikan masukan perbaikan serta optimalisasi berdasarkan hasil evaluasi. Penelitian ini menggunakan metode penelitian deskriptif evaluatif. Pegumpulan data dilakukan dengan menggunakan teknik observasi, wawancara dan dokumentasi. Kegiatan mengolah data dimulai dari analisa sumber air baku, analisa air produksi, perhitungan dan evaluasi kondisi instalasi, serta optimalisasi instalasi. Berdasarkan hasil evaluasi data tersebut, diperoleh tiga kesimpulan hasil penelitian sebagai berikut. Pertama, beberapa parameter air baku yang tidak memenuhi peraturan Pemerintah kota Surabaya nomor 02 tahun 2004 antara lain DO (Dissolve oxygen), tembaga, timbal, nitrit.Kedua, hasil kualitas air produksi instalasi pengolahan air Gunungsari cukup baik karena hanya terdapat dua parameter yang tidak sesuai dengan peraturan yang ditetapkan dalam perusahaan yaitu Ph, tembaga.Ketiga, perhitungan evaluasi kinerja instalasi pengolahan hanya terjadi masalah pada proses flokulasi, sedimentasi dan filtrasi yang ada. Dari penelitian ini, didapatkan beberapa masalah pada beberapa unit pengolahan yang sebaiknya dilakukan perbaikan seperti yang telah disarankan dari standard dari masing-masing unit.

Adressing terms in English translation of Negeri 5 Menara / Rohma Mustika Hayu

 

ABSTRAK Hayu, R.M. 2015. Kata Sapaan pada Novel Terjemahan Bahasa Inggris Negeri 5 Menara. Skripsi. Jurusan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Aulia Apriana, S.S., M.Pd.; (II) Maria Hidayati, S.S., M.Pd. Kata kunci: kata sapaan, terjemahan, negeri 5 menara Sebagai salah satu novel Indonesia, Negeri 5 Menara menjadi novel yang istimewa karena telah diterjemahkan ke dalam bahasa Inggris. Menganalisis novel terjemahan bahasa Inggris dari Negeri 5 Menara sangatlah menarik karena novel ini menceritakan kehidupan enam anak laki-laki yang berasal dari enam daerah yang berbeda di Indonesia dan mempunyai adat istiadat yang berbeda pula. Salah satu aspek yang menarik dalam novel ini adalah penerjemahan kata sapaan yang digunakan oleh enam tokoh utamanya. Kata sapaan dalam bahasa Indonesia umumnya diterjemahkan ke dalam bahasa Inggris dalam bentuk yang paling sederhana. Hal ini disebabkan karena cukup sulit menerjemahkan kata sapaan ke dalam bahasa lain yang mempunyai adat istiadat dan aturan yang berbeda dalam penggunakan kata sapaan tersebut. Dengan demikian, sangat diperlukan strategi yang tepat dalam menerjemahkan kata sapaan untuk memberikan kemudahan bagi para pembaca yang mempunyai latar belakang budaya, adat istiadat serta bahasa yang berbeda. Metode penelitian ini adalah deskriptif kualitatif. Proses analisis data dimulai dari pengumpulan data diikuti dengan mengelompokkan, menganalisis dan mendiskusikan temuan dan yang terakhir menarik kesimpulan. Dalam melaksanakan penelitian ini, penulis menganalisis jenis-jenis kata sapaan dan prosedur penerjemahan yang digunakan oleh penerjemah dalam menerjemahkan kata sapaan pada novel Negeri 5 Menara. Negeri 5 Menara dan terjemahan bahasa Inggrisnya yang berjudul The Land of Five Towers dipilih sebagai objek penelitian karena novel ini memiliki keanekaragaman kata sapaan, beberapa diantaranya sulit untuk ditemukan kata padanannya pada bahasa target. Penelitian ini memaparkan enam prosedur penerjemahan yang ditemukan dalam percakapan langsung oleh enam tokoh utama yang menggunakan kata sapaan dalam percakapan mereka. Enam prosedur penerjemahan yang ditemukan pada novel adalah Literal Translation, Transliteration, Componential Analysis, Transference, Adaptation, dan Cultural Equivalent. Dari hasil menganalisis data, ditemukan beberapa kata sapaan dalam novel terjemahan bahasa Inggris yang tidak sesuai dengan padanannya dalam bahasa Indonesia. Beberapa kata sapaan dalam bahasa Indonesia memang sulit untuk ditemukan padanannya ketika diterjemahkan ke dalam bahasa Inggris, sehingga penerjemah menggunakan padanan kata yang paling mendekati maknanya dalam bahasa target. Menggunakan padanan kata yang paling mendekati maknanya merupakan metode yang bisa digunakan penerjemah untuk membantu pembaca memahami konteks dengan lebih mudah. Namun demikian, pada beberapa kasus ada baiknya apabila penerjemah menggunakan prosedur yang disebut borrowing untuk menerjemahkan kata sapaan yang susah ditemukan padanannya dalam bahasa target tersebut. Dengan menggunakan prosedur borrowing, nilai budaya dan sosial yang terkandung dalam kata sapaan tersebut tetap bisa dipertahankan sehingga tidak mengubah nilai budaya dan kekhasan cerita. Hasil penelitian ini menunjukkan bahwa prosedur yang digunakan oleh penerjemah adalah Literal Translation, Transference, Adaptation, Transliteration, Cultural Equivalent dan Componential Analysis. Dengan demikian, berdasarkan hasil penelitian, dapat disimpulkan bahwa penggunaan prosedur penerjemahan oleh penerjemah disesuaikan dengan kebutuhan pembaca yang berdasarkan pada latar belakang budaya atau disesuaikan menurut padanannya dalam bahasa target. Pada penelitian ini peneliti juga memberikan beberapa saran. Pertama untuk mahasiswa linguistic penelitian ini diharapkan mampu memberikan informasi tambahan mengenai kata sapaan dan prosedur penerjemahan. Kedua untuk peneliti selanjutnya penelitian ini bisa menjadi referensi untuk melakukan penelitian tentang kata sapaan. Terakhir untuk penulis diharapkan dengan adanya penelitian ini penulis bisa menghasilkan berbagai macam karya yang menggunakan banyak istilah dan kata sapaan dari bahasa daerah di Indonesia.

Pengembangan multimedia interaktif berbasis pendekatan saintifik pada materi sistem transportasi dan sistem respirasi untuk siswa kelas VIII SMP Trimurti 2 Wagir Kabupaten Malang / Fetty Hariyanti

 

ABSTRAK Fetty, Hariyanti. 2016. Pengembangan Multimedia Interaktif Berbasis Pendekatan Saintifik pada Materi Sistem Transportasi dan Sistem Respirasi Untuk Kelas VIII SMP Trimurti 2 Wagir Kabupaten Malang. Skripsi, Jurusan Pendidikan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (1) Drs. Triastono Imam Prasetyo, M.Pd (II) Drs. I Wayan Sumberartha, M.Sc. Kata Kunci : Multimedia Interaktif, pendekatan saintifik, sistem trasnportasi dan sistem respirasi Kurikulum 2013 menggunakan pendekatan saintifik dalam proses pembelajarannya. Berdasarkan hasil analisis perangkat pembelajaran guru IPA SMP Trimurti 2 Wagir diketahui bahwa sekolah tersebut telah menerapkan kurikulum 2013. Namun proses pembelajaran yang terjadi belum mencerminkan misi kurikulum 2013 yaitu siswa mengkonstruksi sendiri konsep yang dipelajari. Tujuan dari penelitian ini mengembangkandan menguji kelayakan serta keefektifan multimedia interaktif berbasis pendekatan saintifik pada materi sistem transportasi dan sistem respirasi untuk kelas VIII SMP Trimurti 2 Wagir Kabupaten Malang. Model pengembangan yang digunakan adalah model pengembangan Lee & Owens yang terdiri dari 6 tahapan yaitu analisis kebutuhan, analisis awal-akhir, desain, pengembangan, implementasi dan evaluasi formatif. Tingkat keefektifan dilihat nilai post test siswa dan dibandingkan dengan 85% persentase ketuntasan klasikal. Hasil penelitian dan pengembangan multimedia interaktif berbasis pendekatan saintifik menunjukkan tingkat kevalidan sebesar 3,70 dengan kriteria “valid” dan tingkat kepraktisan sebesar 3,50 dengan kriteria “tinggi”. Persentase jumlah siswa yang mencapai KKM sebesar 90,91% yang melebihi standar ketuntasan klasikal sehingga dapat dikatakan bahwa multimedia interaktif berbasis pendekatan saintifik efektif untuk digunakan dalam proses pembelajaran.

Penentuan nilai kalor bakar batubara Kalimantan Timur dengan menggunakan par adiabatic bomb calorimeter oleh Nurul Kustiani

 

minyakK. arenna" p"t;ii?;;tilfidatry ah'aart tematif semakbina nvak dilakukan. Batubara *"topuil* tufah satu energi alternatifyang tersedia sangat banyak,d an belum dimaniaratkanse carao ptimal' baik untuk keperluanr umaht angga #fi;il;; p"*rni"-ii u*rj*r, untot menentukan nilai kalorbakar batutarad enganm enggunakavna riasib utiran' Data hasil "r.rp"Iil"i-iruanaingt

Penerapan siklus belajar dengan metode simulasi untuk meningkatkan kualitas pembelajaran sistem peredaran darah manusia di kelas II SMU Negeri 6 Kota Malang / oleh Erlis Fitriana Dewi

 

Konseps istemp eredarand arahm anusiam erupakank onsep yang abstrak' untuk memahaminydai perlukans trategdi alamp embelajaran,.misalnya.dengan ;;;;r*.drif.f* U"fljui J"rg* tn"ioa"s imulasSi. trategini i tampaknva dapat diterapkadna lamb iologiu ntuti reningkatkapne nguasaakent rampilan prosesa ins danp inguasaabni ologip adas iswa' Penelitianinibertujuanuntukmengetahui:l)konsepsiawalsiswatentang ,irt". p"i"a"ran oarar'unuriq 2) hasilb elajars iswat erhadapp embelajaran sistem p"i"J"*:" a"*fr manusias etet"t n,"nggo*tin srategis iklusb elajard enganm etode !i*uf url 3) keterampil; d- aktivitaiiiswad alamp embelajaramne nggunakan ,J"l riifrir belajard anganm etodes imulasi;4s) ikaps iswaqrhadappe rnbelajaran ;;;cc*"k* rnoa"t, it i* belajadr engan-T"t$"s imulasi5; ) sikapg urut erhadap pembelajaraynu ngr n"rrggunatil ryoae]s iklus.belajadre npn metodes imulasi' penelitiand itatsilakan di SMUN egeri6 KotaM alangk elasI I A danI I F paaafa nuar2l 002.J enisp enelitianu dulu!p enelitiantin dakank elasm, enggunakan duas iklust indakanS. etiaps iklusm eliputoi bsewasait aur efleksai wal,r encana tindakaruti ndakand ano bservastiin dakarlr efleksih asilt indakanP. roses pembelajaramne nggunakasink lusb elajard enganm etodes imulasi' ' Metodep engumpuladna tam enggunakatne:s ,o bsewasiw' awancardaa n angkete. nalisisd at-dai ilah melaluik: aiegordi atav alidasdi all dal interpretadsia ta' fta-sipt enetitiainn i yaitu:l ) konsepsaiw als iswas iklusI 50,875od/aon s iklusI I ioizirt",zl padas iklusI hasilt ess isra tentangs isternp eredaradna rah.manusia In"rringk"ti i,6zso/osementarpaa das iklusI I meningka2t 9'995%hali ni ,n"nunjukkonp enerapasni klusb elajard enganm etodes imulasmi eningkatkan ;;*[*" konsep,i rt". p.r"du"* darahhanusiad ari konsepsi awal dan konsepsi "f.ftit; :l siklusb eiajar."ningkatkuoke tampilanp rosesa ktivitasd anm otivasi U"i"j* ri"r*, 4) sikaps iswat irhadapp ernbelajaramn anggunakasnik lusb elajar ae"ia" metoaes imutasci ukupm endukunyga itus ebagiabne sars iswam enyatakan terta'ritd anl ebih senangte rhadapm odetp embelajarayna ngd iterapkan;.5s)i kapg uru terhadapp embelajaramn enggrmakamno dels iklusb elajard enganm etodes iklus belajari angatp ositifartinyag urus angatte rtarikd enganm odelp embelajarayna ng diteiapkaniehingggau rum eiyatakan-ingmine mperbaimki odeKl BM yangs elama ini dilikukan antarala in denganm erevisLi KS yangt clahd ibuat

Pengaruh variasi penurunan suhu pemadatan aspal beton (AC-WC) ditinjau dari karakteristik Marshall dan Indeks Kekuatan Sisa (IKS) / Ridha Satria Adri

 

ABSTRAK Adri, Ridha Satria. 2016. Pengaruh Variasi Penurunan Suhu Pemadatan Aspal Beton (AC–WC) Ditinjau dari Karakteristik Marshall dan Indeks Kekuatan Sisa (IKS). Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Pranoto, S.T., M.T, (II) Ir. Titi Rahayuningsih, M.Si. Kata Kunci: Suhu Pemadatan, AC-WC,Karakteristik Marshall, Indeks Kekuatan Sisa Lapis aspal beton jenis AC–WC (Asphalt Concrete–Wearing Course) merupakan lapisan yang sering dipakai pada lapisan permukaan dengan dirancang agar lapisan tersebut tidak mudah ditembus oleh air dan memiliki stabilitas yang tinggi. Penurunan suhu pada campuran saat pemadatan menyebabkan mutu campuran yang telah ditentukan akan menurun. Jauhnya tempat instalasi pencampur atau AMP (Asphalt Mixing Plant) dengan lokasi proyek kontruksi jalan juga menyebabkan turunnya suhu ketika campuran dipadatkan. Tujuan dari penelitian ini adalah untuk mengetahui kadar aspal optimum pada campuran aspal beton (AC–WC) serta mengetahui pengaruh variasi penurunan suhu pemadatan pada campuran aspal beton ditinjau dari karakteristik Marshall dan Indeks Kekuatan Sisa (IKS). Variasi kadar aspal yang digunakan adalah 4,5%, 5%, 5,5%, 6%, dan 6,5% dengan menggunakan aspal pen 60/70. Pencampuran dan pemadatan campuran dilakukan pada suhu 140o–160o. Tahap berikutnya melakukan pengujian Marshall untuk mendapatkan Kadar Aspal Optimum (KAO). KAO yang didapat akan digunakan sebagai kadar aspal untuk pembuatan benda uji variasi penurunan suhu pemadatan yaitu 1450C, 1150C, 850C, 550C serta akan ditinjau menggunakan karakteristik Marshall dan indeks kekuatan sisa (IKS). Hasil penelitian menghasilkan KAO campuran AC-WC sebesar 6,25%. Variasi penurunan suhu pemadatan berpengaruh pada nilai stabilitas dan MQ yang menurun seiring menurunnya suhu pemadatan, sedangkan flow, VIM, dan VMA cenderung naik dengan menurunnya suhu pemadatan. Nilai IKS variasi juga cenderung menurun seiringan dengan penurunan suhu pemadatan. Sedangkan suhu pemadatan minimum untuk mendapatkan nilai standar IKS yaitu 90% adalah 120oC.

Penerapan bahan ajar IPA terpadu dengan model siklus belajar (Learning cycle) untuk meningkatkan keterampilan proses ilmiah dan hasil belajar siswa kelas VII SMPN 18 Malang / Kuney Shofwatul Hamidah

 

Kata kunci: IPA terpadu, siklus belajar, keterampilan proses ilmiah, hasil belajar. Salah satu upaya peningkatan kualitas pendidikan Indonesia adalah pemberlakuan Kurikulum Tingkat Satuan Pendidikan. KTSP merupakan kurikulum operasional yang disusun oleh dan dilaksanakan di masing-masing satuan pendidikan. Hasil observasi dan wawancara dengan guru bidang studi IPA (Biologi) serta melakukan pengamatan langsung pembelajaran di kelas pada kelas VII G SMPN 18 Malang ditemukan beberapa permasalahan di antaranya adalah: 1) guru masih menggunakan metode ceramah; 2) rerata kriteria keterampilan proses yang dimiliki siswa cenderung rendah; 3) hasil belajar siswa belum mencapai kriteria ketuntasan minimal (KKM); 4) pembelajaran IPA yang diterapkan di kelas bukan merupakan pembelajaran IPA terpadu. Salah satu model pembelajaran yang dianggap sesuai untuk menyelesaikan permasalahan tersebut adalah siklus belajar (Learning Cycle). Siklus belajar pada penelitian ini terdiri dari empat fase, yaitu eksplorasi, eksplanasi, ekspansi, dan evaluasi. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang dilaksanakan dalam dua siklus, dan masing-masing siklus terdiri dari empat kali pertemuan. Penelitian ini dilaksanakan mulai bulan Desember 2009 sampai akhir bulan Juni 2010. Subjek yang diteliti adalah siswa kelas VII G SMPN 18 Malang yang berjumlah 40 siswa, 23 siswa laki-laki dan 17 siswa perempuan. Hasil penelitian menunjukkan bahwa penerapan bahan ajar IPA terpadu dengan model siklus belajar (Learning Cycle) dapat meningkatkan keterampilan proses ilmiah dan hasil belajar siswa kelas VII SMPN 18 Malang. Hal ini didasarkan pada meningkatnya persentase keterampilan proses dengan kriteria baik (B) dari siklus I ke siklus II dari 32,50% menjadi 75%. Meningkatkan hasil belajar siswa didasarkan pada 3 ranah, yaitu: 1) hasil belajar kognitif mengalami peningkatan persentase siswa yang tuntas belajar kognitif dari siklus I ke siklus II dari 87,57% menjadi 97,50%; 2) hasil belajar afektif siswa mengalami peningkatan persentase siswa yang tuntas belajar dari siklus I ke siklus II dari 40% menjadi 85%; 3) hasil belajar psikomotor siswa mengalami peningkatan persentase siswa yang tuntas belajar dari siklus I ke siklus II dari 72,50% menjadi 92,50%. Berdasarkan hasil penelitian yang telah dilaksanakan, maka saran dari penelitian ini yaitu: 1) bagi guru disarankan untuk menerapkan model pembelajaran ini pada materi dengan karakteristik yang sesuai; 2) pada penelitian selanjutnya hendaknya juga meneliti aspek lain selain keterampilan proses ilmiah dan hasil belajar siswa.

Pengaruh teknik shaping terhadap keterampilan memakai kemeja anak tunagrahita kelas 1 SDLB di SLB PGRI Kedungwaru Tulungagung / Gayatri Hardianti

 

ABSTRAK Hardianti, Gayatri. 2016. Pengaruh Teknik Shaping Terhadap keterampilan memakai kemeja anak tunagrahita kelas 1 SDLB di SLB PGRI Kedungwaru Tulungagung. Skripsi, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Sudarsini, M.Pd, (II) Drs. Abdul Huda, M.Pd Kata Kunci: teknik shaping, keterampilan memakai kemeja, tunagrahita Tunagrahita adalah kondisi dimana seseorang mengalami gangguan dalam perkembangan intelektual hingga berdampak pada kehidupan pribadinya yang tidak dapat lepas dari ketergantungan terhadap orang lain. Salah satu ketergantungan yang banyak terjadi pada anak tunagrahita yaitu kemampuan berpakaian terutama pada keterampilan memakai kemeja. Berkaitan dengan hal tersebut diperlukan adanya pembelajaran atau latihan yang dapat meningkatkan keterampilan memakai kemeja. Salah satu cara untuk meningkatkan keterampilan memakai kemeja adalah pembelajaran menggunakan teknik shaping. Teknik shaping adalah teknik pembentukan perilaku baru yang dilakukan dengan cara bertahap dan disertai dengan penguatan secara berturut-turut. Tujuan penelitian adalah (1) mendeskripsikan keterampilan memakai anak sebelum diberikan intervensi, (2) mendeskripsikan keterampilan memakai kemeja anak setelah diberikan intervensi, (3) mendeskripsikan pengaruh teknik shaping terhadap keterampilan memakai kemeja anak tunagrahita. Metode penelitian yang digunakan dalam penelitian ini adalah metode eksperimen dengan menggunakan subjek tunggal atau SSR (Single Subject Research) dengan desain A-B-A. Subjek penelitian ini adalah siswa tunagrahita ringan dengan gangguan motorik kelas 1 SDLB di SLB PGRI Kedungwaru Tulungagung. Jenis pengukuran variabel yang digunakan adalah persentase. Adapun analisis data yang digunakan adalah analisis dalam kondisi dan analisis antar kondisi. Hasil penelitian menunjukkan perolehan mean level yang meningkat dari 63,67% kondisi baseline-1, 89,71%, dan 85,17 pada kondisi baseline-2. Perhitungan persentase overlap antara kondisi baseline-1 ke kondisi intervensi adalah 0%. Kesimpulan dari penelitian ini adalah terdapat pengaruh antara teknik shaping sebagai variabel bebas, terhadap keterampilan memakai kemeja anak tunagrahita sebagai target behavior. Saran dari penelitian ini antara lain: (1) berikan variasi terhadap pendekatan pembelajaran khususnya bina diri, teknik pembelajaran bina diri, serta media pembelajaran yang sesuai dengan kebutuhan dan karakter individual anak (2) orang tua diharapkan dapat bekerjasama dalam mengembangkan kemandirian anak tunagrahita dengan gangguan motorik,dengan adanya kerjasama yang baik maka pembelajaran yang diberikan dari sekolah kemudian dilanjutkan dengan pembiasaannya di rumah (3) Perlu diadakan penelitian yang lebih mendasar dalam pembelajaran bina diri

Pengaruh ESAR (Engage, Study, Activate, Reflect) terhadap kemampuan analisis dan kemampuan argumentasi ilmiah (scientific argumentation) / Elis Yulianingrum

 

ABSTRAK Yulianingrum, Elis. 2016. Pengaruh ESAR (Engage, Study, Activate, Reflect) terhadap Kemampuan Analisis dan Kemampuan Argumentasi Ilmiah (Scientific Argumentation). Skripsi. Program Studi Pendidikan Biologi, Universitas Negeri Malang, Pembimbing: (1) Dr. Hadi Suwono, M. Si., (2) Drs. Sulissetijono, M. Si. Kata kunci: ESAR (Engage, Study, Activate, Reflect), kemampuan analisis, kemampuan argumentasi ilmiah (scientific argumentation). Biologi pada kurikulum 2013 menuntut siswa mampu mengkontruktivis dan membentuk pengetahuannya sendiri (student centered) sehingga membutuhkan kemampuan analisis dan kemampuan argumentasi ilmiah (scientific argumentation). Oleh karena itu dibutuhkan model pembelajaran yang sesuai yakni ESAR (Engage, Study, Activate, Reflect). Model ESAR memiliki kelebihan untuk meningkatkan motivasi, meningkatkan keaktifan siswa dan membentuk pengetahuan siswa secara utuh sehingga dilakukan penelitian untuk mengetahui pengaruh ESAR (Engage, Study, Activate, Reflect) terhadap kemampuan analisis dan kemampuan argumentasi ilmiah (scientific argumentation). Penelitian ini menggunakan jenis penelitian eksperimen semu (quasi experimental design). Desain penelitian adalah Pretest-Posttest Nonequivalent Control Group Design. Penelitian dilakukan di SMA Negeri 01 Pagak menggunakan dua kelas yakni kelas kontrol (X MIPA 3) dengan pembelajaran multimetode dan kelas eksperimen (X MIPA 2) dengan pembelajaran ESAR (Engage, Study, Activate, Reflect). Hasil penelitian (data) dianalisis dengan uji prasyarat yaitu uji normalitas dan uji homogenitas kemudian dilanjutkan dengan uji hipotesis menggunakan SPSS 22.0 for windows. Hasil penelitian menunjukkan bahwa pembelajaran ESAR (Engage, Study, Activate, Reflect)berpengaruh terhadap kemampuan analisis dan kemampuan argumentasi ilmiah (scientific arguemntation) siswa. Pembelajaran menggunakan ESAR (Engage, Study, Activate, Reflect)pada kelas eksperimen menghasilkan kemampuan analisis dan kemampuan argumentasi yang lebih baik dibanding kelas kontrol pada siswa. Peningkatan kemampuan analisis siswa pada kelas eksperimen sebesar 72,10% sedangkan pada kelas kontrol sebesar 9,83%. Sama halnya dengan kemampuan argumentasi ilmiah (scientific argumentation) siswa pada kelas eksperimen sebesar 61,82% sedangkan pada kelas kontrol sebesar 19,20%. Hasil penelitian juga menunjukkan bahwa kemampuan analisis memberikan sumbangan sebesar 96,7% dalam menjelaskan pencapaian kemampuan argumentasi ilmiah (scientific argumentation). Mengingat pembelajaran ESAR mampu meningkatkan kemampuan analisis dan argumentasi ilmiah, disarankan bagi guru untuk menggunakan ESAR dalam pembelajaran biologi.

Pembinaan guru PAUD/TK alumni PG-PAUD Universitas Negeri Malang di Kota Malang / Desi Widya Arum

 

ABSTRAK Arum, Desi Widya. 2016. Pembinaan Guru PAUD/TK Alumni PG-PAUD Universitas Negeri Malang di Kota Malang. Program Studi S1 Pendidikan Guru Pendidikan Anak Usia Dini. Jurusan Kependidikan Sekolah Dasar dan Pra Sekolah. Fakultas Ilmu Pendidikan. Universitas Negeri Malang. Pembimbing: (I) Drs. H. Ahmad Samawi, M.Hum, (II) Eny Nur Aisyah, S. Pd.I, M.Pd. Kata Kunci: Pembinaan, Guru TK/PAUD Guru sebagai pelaku utama pendidikan sudah seharusnya memiliki kemampuan profesional. Pembinaan guru TK/PAUD merupakan hal krusial untuk mengembangkan profesinalisme. Penelitian ini bertujuan untuk mendeskripsikan pembinaan yang diperoleh alumni PG-PAUD Universitas Negeri Malang di Kota Malang. Tujuan penelitian ini secara umum yaitu mendeskripsikan pembinaan yang diperoleh alumni S1 PG-PAUD Universitas Negeri Malang. Tujuan khusus dari penelitian ini yaitu mendeskripsikan bentuk pembinaan, mengetahui frekuensi pembinaan, mengetahui pelaku pembinaan dan mengetahui persepsi guru TK/PAUD alumni S1 PG-PAUD Universitas Negeri Malang terhadap dampak pembinaan yang diperoleh selama ini. Penelitian ini menggunakan metode penelitian survei deskriptif. Teknik pengumpulan data dilakukan dengan kuesioner atau angket, wawancara, serta dokumentasi. Analisis data hasil penelitian dilakukan menggunakan analisis statistik deskriptif. Kegiatan yang diteliti oleh peneliti terkait bentuk pembinaan yang selama ini diperoleh, mengetahui pelaku pembinaan, mengetahui frekuensi pembinaan yang diperoleh, dan persepsi guru terhadap dampak pembinaan. Hasil penelitian menunjukkan bahwa selama ini guru PAUD memperoleh pembinaan individu dan pembinaan kelompok. Pembinaan individu yang sering diperoleh yaitu observasi kelas dan pembinaan kelompok yang sering diperoleh adalah rapat guru. Pelaku pembinaan yang sering melakukan pembinaan adalah dinas pendidikan dan kepala sekolah. Frekuensi pembinaan yang diperoleh minimal sebulan sekali. Guru memiliki persepsi positif terhadap pembinaan yang selama ini diperoleh. Pembinaan selama ini dapat meningkatkan keprofesionalan guru dalam pembelajaran, sehingga perlu pembinaan yang dilakukan secara rutin dan berkelanjutan.

Pengembangan modul IPA berbasis konstruktivisme model learning cycle 5E materi energi dalam sistem kehidupan untuk siswa kelas VII SMP Muhammadiyah 6 Malang / Peni Handayani

 

ABSTRAK Handayani, Peni. 2016. Pengembangan Modul IPA Berbasis Kosntruktivisme Model Learning Cycle 5E Materi Energi dalam Sistem Kehidupan untuk Siswa Kelas VII SMP Muhammadiyah 6 Malang. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing: (1) Drs. Masjhudi, M.Pd, (II) Drs. Triastono Imam Prasetyo, M.Pd Kata Kunci: Modul IPA, Learning cycle 5E, Energi dalam Sistem Kehidupan IPA menyediakan berbagai pengalaman belajar untuk memahami konsep dan proses sains yang dapat diperoleh dengan pembelajaran yang berbasis konstruktivis. Hasil observasi pada SMP Muhammadiyah 6 Malang menunjukkan bahwa kebanyakan siswa kurang terbiasa dengan kegiatan konstruktivis, untuk itu perlu dibiasakan terlebih dahulu dengan modul yang membimbing siswa untuk membangun secara mandiri pengetahuannya. Model pembelajaran yang menerapkan konstruktivis salah satunya adalah model learning cycle 5E. Penelitian ini dilaksanakan dengan tujuan untuk menghasilkan modul IPA berbasis konstruktivisme model Learning cycle 5E untuk SMP Kelas VII. Modul dikembangkan menggunakan model pengembangan 4D dari Thiagarajan (1974). Prosedur pengembangan terdiri dari tahap define (pendefinisian), design (perancangan), develop (pengembangan), dan disseminate (penyebar luasan produk), namun pada pengembangan modul ini hanya sampai pada tahapan develop saja. Data yang diperoleh berupa data kuantitatif dan data kualitatif. Data kuantitatif berupa skor angket penilaian dari validator, skor angket penilaian modul oleh siswa, dan penilaian hasil belajar siswa. Data kualitatif berupa saran dan komentar dari validator maupun siswa terhadap modul. Instrumen pengumpulan data yang digunakan adalah angket validasi produk, angket siswa, dan lembar penilaian hasil belajar siswa. Uji coba skala terbatas dilakukan kepada siswa kelas VII SMP Muhammadiyah 6 Malang berjumlah 16 siswa. Hasil pengembangan berupa modul IPA berbasis konstruktivme model learning cycle 5E untuk siswa dan guru yang di dalamnya ada 6 kegiatan belajar. Setiap kegiatan belajar pada modul IPA mengacu pada model pembelajaran learning cycle 5E, yaitu kegiatan engagement, exploration, explanation, elaboration, dan evaluation. Hasil validasi oleh 3 validator ahli (ahli materi, ahli pengembangan modul, dan ahli praktisi lapangan) serta siswa (uji coba skala kecil) secara berturut-turut mendapatkan skor sebesar 4.4 dan 4.1 dari skor maksimal 5. Hasil belajar siswa secara klasikal mendapatkan nilai rata-rata 83. Kesimpulan dari hasil uji coba tersebut adalah produk yang dikembangkan termasuk dalam kriteria valid sehingga layak untuk digunakan dalam pembelajaran. Saran berdasarkan hasil pengembangan ini ditujukan kepada peneliti lain agar menggunakan produk ini sebagai inspirasi melakukan berbagai pengembangan. Penggunaan modul sebaiknya diimbangi dengan praktikum sehingga seluruh indikator dalam kompetensi dasar dapat tercapai.

Pengembangan buku teks geografi materi kondisi geografis Indonesia model buku blue gold / Falik Wardana

 

ABSTRAK Wardana, Falik. 2016. Pengembangan Buku Teks Geografi Materi Kondisi Geografis Indonesia Model Buku Blue Gold. Skripsi, Jurusan Pendidikan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Edy Purwanto, M.Pd., (II) Ir. Juarti, M.P. Kata Kunci: pengembangan, buku teks geografi, blue gold Pengembangan buku teks didasari permasalahan kelemahan dan kesalahan yang masih ditemukan dalam buku teks geografi. Kelemahan dan kesalahan tersebut diketahui setelah dilakukan analisis terhadap buku teks geografi penerbit Erlangga (2013) pada materi kondisi geografis Indonesia. Kelemahan dan kesalahan tersebut, yaitu: (1) isi (konten) buku teks didominasi oleh fakta/data, (2) kesalahan penggunaan tanda baca dan kosa kata, (3) susunan kalimat dan paragraf yang tidak tepat, (4) kesalahan konsep, dan (5) ilustrasi yang tidak berfungsi. Pengembanganini bertujuan untuk menghasilkan produk buku teks geog-rafi materi kondisi geografis Indonesia untuk SMA/MA kelas XI yang didesain dengan model buku Blue Gold. Pemilihan model buku didasaridengan standar kelayakan oleh Badan Standar Nasional Pendidikan (BSNP), meliputi: (1) materi, (2) penyajian, (3) kebahasaan, dan (4) ilustrasi. Pengembangan buku teks ini mengikuti langkah-langkahDick and Carey yang dimodifikasi, kemudian dipilih delapan langkah disesuaikan dengan kebu-tuhan, yaitu: (1) menganalisis kesalahan dan kelemahan buku teks geografi pener-bit Erlangga (2013) pada materi kondisi geografis Indonesia, (2) memilih model buku acuan dalam pengembangan, (3) menyusun draft buku teks geografi, (4) validasi buku teks oleh ahli materi, (5) revisi draft buku teks, (6) uji coba lapangan, (7) revisi, dan (8) diseminasi. Hasil uji coba lapangan menunjukkan nilai rata-rata siswa terhadap tes pe-ngetahuan dan pemahaman materi kondisi geografis Indonesia mencapai 80,48. Hal ini lebih dari kriteria ketuntasan minimal (KKM) mata pelajaran geografi di MAN 1 Malang yakni 78. Secara klasikal 84% siswa mencapai kriteria ketuntasan minimal (KKM). Merujuk pada kriteria tingkat pemahaman yang diadaptasi dari Akbar (2013), skor tersebut dapat dikategorikan sangat baik. Oleh karena itu, produk buku teks layak digunakan dalam pembelajaran.

Perkembangan rumah sakit HVA (Handells Vereeniging Amsterdam) 1996-2015 dan kontribusi terhadap pelayanan kesehatan masyarakat / Faizal Binti Aisyah

 

ABSTRAK Aisyah, FaizalBinti. 2016. PerkembanganRumahSakitHVA (Handels Vereeniging Amsterdam) 1996—2015 danKontribusiTerhadapPelayananKesehatanMasyarakat. Skripsi, JurusanIlmuSejarah FIS UniversitasNegeri Malang. Pembimbing: (I) Dr. JokoSayono, M. Pd, M. Hum (II) Drs. Mashuri, M. Hum Kata Kunci: RS Toeloengredjo, RumahSakit HVA, Pare Kota Kediri yang memilikibeberapapabrikperkebunanpadatahun 1900-an. Setiapperkebunanharusmemperhatikankondisikesehatandantempattinggalparakuli Hal initentusajaharusdilakukan demi kepentinganperkebunanitusendiri agar kegiatanproduksi di perkebunanitutidakterganggu. Untukmendukungtercapainyatujuandariperkebunanyaitumemperolehhasil yang semaksimalmungkinpihakperkebunan di Kediri mendirikanlayanankesehatanbagiparaburuhperkebunantersebut. KebijakaninitidakterlepasdarikepentinganekonomispihakpengusahaBelandauntukmempertahankandanbahkanmeningkatkanhasilproduksinya. Permasalahan yang dibahasdalampenelitianiniadalah (1) BagaimanaperkembanganRumahSakit HVA padatahun 1996-2015 (2) Bagaimanakontribusirumahsakitterhadappelayanankesehatanmasyarakatsekitarrumahsakit. Penelitianinimenggunakanmetodekualitatifdenganmengambillokasipenelitian di RS HVA Toeloengredjo. Informandalampenelitianiniadalahkaryawanrumahsakitdanpasienrumahsakit. Teknikpengumpulan data dalampenelitianinimenggunakanbeberapametode, (1) observasi, (2) wawancara, (3) studidokumen.Analisis data yang digunakanadalah (1) reduksi data, (2) penyajian data dan (3) penarikankesimpulan. Hasilpenelitianmenunjukkanbahwasejaktahun 1996 telahterjadibeberapaperubahandanperkembangan di RS HVA. PerubahandanperkembanganituterlihatpadaDirekturrumahsakit, bangunanrumahsakit, begitujugadenganpembiayaanrumahsakit, sertajumlahinvestasi yang mengalamipenurunandanpeningkatansecaraberkala. Dari penelitianinijugadapatdiketahuibahwa RS HVA selaluberupayameningkatkanpelayanankesehatan. Baikpelayanandarimedis, paramedisdan non medis. Selainitu, rumahsakit HVA jugameningkatkanpelayananunggulan. Berdasarkanpenelitianini, dapatdisarankan agar dilakukanpenelitianlebihlanjutmengenaisejarahkesehatan di Kabupaten Kediri. Hal ini di karenakanKabupaten Kediri memilikisejarahpanjangdalampembentukannya. Kajiansejarahkesehatansangatmenarikuntuk di kaji. Bagipemerintahdiharapkanpenelitianinimampumemberikanwawasanakanpentingnyaperistiwa-peristiwalalu yang terjadi di Kediri

Pengembangan model latihan long pass control dalam permainan sepakbola untuk siswa usia 14-16 tahun di sekolah sepakbola Mitra Jaya Soccer Kota Malang / Rizalul Mahbubi

 

ABSTRAK Mahbubi, Rizalul. 2016. Pengembangan Model Latihan Long Pass control dalam Permainan Sepakbola untuk Siswa Usia 14-16 Tahun di Sekolah Sepakbola Mitra Jaya Soccer Kota Malang. Skripsi, Jurusan Pendidikan Kepelatihan Olahraga, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Dr. Imam Hariadi, M.Kes., (II) Dr. Sapto Adi, M.Kes. Kata Kunci: sepakbola, penelitian dan pengembangan, keterampilan long pass. Sepakbola adalah olahraga permainan yang dimainkan oleh dua regu yang masing-masing beranggotakan sebelas lawan sebelas pemain yang dimainkan di lapangan oleh dua tim yang bertujuan untuk memasukkan bola ke gawang lawan. Kemampuan teknik menguasai bola merupakan syarat utama bagi setiap pemain sepakbola dimana sangat erat hubungannya dengan prestasi seorang pemain sebagai anggota tim. Ada beberapa teknik dasar untuk bermain sepakbola, salah satu teknik dasar tersebut adalah teknik menendang, dalam hal ini teknik menendang long pass. Ketrampilan dasar long pass juga harus diikuti dengan ketrampilan kontrol bola yang baik, karena kedua teknik tersebut sangat berhubungan. Berdasarkan hasil observasi dan wawancara dengan pelatih, model latihan long passing di Sekolah Sepakbola Mitra Jaya Soccer modelnya kurang bervariasi hanya long pass secara berhadap-hadapan dan pelatih jarang memberikan materi latihan tendangan long pass. Setelah dilakukan analisis kebutuhan peneliti memperoleh data 90% siswa mengungkapkan hanya sering diajarkan materi passing pendek (short pass) dan 79% mengungkapkan diajarkan materi latihan passing jauh (long pass). Kemudian 98% siswa mengungkapkan menginginkan model latihan passing jauh (long pass) yang bervariasai. Peneliti melaksanakan penelitian ini dengan tujuan untuk mengembangkan model latihan menendang long pass control di Sekolah Sepakbola Mitra Jaya Soccer Kota Malang. Penelitian ini menggunakan rancangan penelitian pengembangan dari teori Research and Development dari Borg dan Gall yang dimodifikasi dan disesuaikan dengan keadaan di lapangan yang mengacu dari teori Ardhana. Dari 10 langkah pengembangan yang dikemukakan oleh Borg dan Gall, peneliti hanya menggunakan 7 langkah dikarenakan keterbatasan waktu, tenaga dan biaya. Dalam penelitian ini telah melalui beberapa tahap, antara lain, (1) evaluasi produk dari 1 ahli sepakbola, 1 ahli kepelatihan sepakbola, 1 ahli media, (2) uji coba kelompok kecil dan uji coba kelompok besar, (3) tahap pengolahan data. Instrumen yang digunakan peneliti adalah angket kuisioner. Teknik analisis data yang digunakan adalah analisis kuantitatif. Subjek dalam penelitian ini adalah siswa Sekolah Sepakbola Mitra Jaya Soccer dengan jumlah 30 siswa. Dari evaluasi 1 ahli sepakbola dengan menggunakan instrumen 30 butir pertanyaan memperoleh hasil 91,6%. 1 ahli kepelatihan sepakbola dengan menggunakan instrumen 36 butir pertanyaan memperoleh hasil 81,25% dan 1 ahli media dengan menggunakan instrumen 36 butir pertanyaan memperoleh hasil 75%. Sehingga produk ini dinyatakan layak untuk diujicobakan pada kelompok kecil dan kelompok besar. Pada uji coba kelompok kecil dengan menggunakan instrumen 38 butir pertanyaan yang dilakukan oleh 8 siswa memperoleh hasil 88,73%. Sedangkan dari uji coba kelompok besar dengan menggunakan instrumen 38 butir pertanyaan yang dilakukan oleh 22 siswa memperoleh hasil 88,75%. Sehingga produk pengembangan model latihan long pass control yang dikemas dalam bentuk video ini dinyatakan layak digunakan sebagai model latihan untuk siswa usia 14-16 tahun di Sekolah Sepakbola Mitra Jaya Soccer Kota Malang. Saran oleh peneliti mengenai produk yang telah dikembangkan adalah sebagai berikut, (1) saran pemanfaatan, yaitu, model latihan ini diharapkan dapat digunakan dan dimanfaatkan oleh siswa sekolah sepakbola Mitra Jaya Soccer dan dapat membantu siswa dalam berlatih untuk meningkatkan ketrampilan tendangan long pass maupun beberapa teknik control, serta dapat digunakan dan membantu pelatih dalam memberikan materi latihan agar latihan tersebut lebih bervariasi, (2) saran diseminasi, yaitu, dalam penyebarannya ke sasaran yang lebih luas, disebarkan kepada siswa melalui sekolah sepakbola, klub ekstrakurikuler yang ada di sekolah, klub sepakbola yang berada dimasyarakat, disebarkan kepada guru olahraga yaitu melalui kegiatan mengajar di sekolah, disebarkan kepada pelatih yaitu melalui pelatihan sepakbola, seminar, (3) saran pengembangan lebih lanjut, yaitu, produk yang sudah ada agar dikembangkan menjadi lebih baik dan dapat meningkatkan prestasi keterampilan long pass dan control sepakbola.

Pengaruh mekanisme Good Corporate Governance (GCG), pengungkapan Corporate Social Responsibility (CSR), leverage dan profitabilitas perusahaan terhadap tindakan pajak agresif (studi kasus pada perusahaan yang listing di Bursa Efek Indonesia periode 2011-2013) / Nila Wul

 

ABSTRAK Wulandari, Nila. 2016. Pengaruh Mekanisme Good Corporate Governance, Pengungkapan Corporate Social Responsibility, Leverage, dan Profitabilitas Perusahaan Terhadap Tindakan Pajak Agresif (Studi Kasus pada Perusahaan yang Listing di Bursa Efek Indonesia periode 2011-2013). Malang. Pembimbing: (I) Dr. Puji Handayati, S.E, M.M., Ak. CA, C.MA. (II) Sulastri, S. Pd., M. SA. Kata kunci : mekanisme gcg, pengungkapan csr, leverage, profitabilitas, tindakan pajak agresif Pajak merupakan salah satu sumber pendapatan terbesar di Indonesia, kontribusi penerimaan dari sektor pajak menempati presentase paling tinggi dibandingkan dengan sumber penerimaan yang lain sehingga pajak diperhitungkan sebagai tulang punggung penerimaan negara. Namun, meskipun pajak merupakan tulang punggung penerimaan negara, pelaksanaan pemungutan pajak tidak selalu mandapat sambutan baik dari perusahaan karena perusahaan menganggap pajak sebagai biaya yang akan mengurangi keuntungan perusahaan, oleh sebab itu banyak perusahaan yang agresif terhadap pajak.Tujuan dari penelitian ini adalah untuk mengetahui pengaruh mekanisme gcg, pengungkapan csr, leverage, profitabilitas perusahaan terhadap tindakan pajak agresif. Penelitian ini merupakan penelitian ekplanasi. Sampel dari penelitian ini adalah 47 perusahaan yang listing di Bursa Efek Indonesia selama periode 2011-2013 dan memenuhi kreteria yang ditentukan. Pengujian variabel dalam penelitian ini menggunakan model analisis regresi linier berganda dengan level of significant sebesar 5%. Data yang digunakan merupakan data sekunder yang diperoleh dari laporan keuangan yang ada didalam laporan tahunan perusahaan. Hasil dari penelitian ini adalah kepemilikan manajerial, komisaris independen, pengungkapan CSR, leverage tidak berpengaruh secara signifikan terhadap tindakan pajak agresif, sedangkan profitabilitas berpengaruh secara signifikan terhadap tindakan pajak. Berdasarkan hasil penelitian ini, peneliti menyarankan bagi penelitian selanjutnya adalah mengerucutkan kembai objek perusahaan yang akan dijadikan penelitian misal perusahaan manufaktur agar penelitian lebih valid karena dilihat dari penelitian terdahulu semakinspesifik objek penelitian maka hipotesis penelitian diterima lebih besar.

Pembinaan moral terhadap penyandang cacat netra I Panti Rehabilitasi Sosial Bina Cacat Netra "Budi Mulya" Malang / Marita Pungkasanti Suryaning

 

ABSTRAK Suryaning, Marita Pungkasanti.Pembinaan Moral Terhadap Penyandang Cacat Tunanetra (Studi Di Panti Rehabilitasi Sosial Bina Cacat Netra ”Budi Mulya” Malang). Skripsi, Jurusan Pendidikan Pancasila dan Kewarganegaraan FIP Universitas Negeri Malang. Pembimbing (I) H. Suparlan, M.Si. Pembimbing (II) Drs. I Ketut Diara Astawa, SH. M.Si. Kata kunci: Pembinaan moral, Penyandang cacat netra Bersosialisasi dengan masyarakat harus mengikuti norma dan aturan yang berlaku dimasyarakat agar tercipta komunikasi yang serasi dan seimbang. Tetapi komunikasi tidak akan terjadi jika salah satu komunikator tidak dapat berkomunikasi dengan baik. Penyandang cacat tunanetra sering merasa sulit berkomunikasi dengan masyarakat karena malu dengan kondisi fisik yang memiliki kekurangan dan merasa tidak bisa berbuat banyak tanpa bantuan orang lain. Untuk menghilangkan rasa tidak percaya diri tersebut diperlukan pembinaan moral secara bertahap. Pembinaan moral yang diberikan Panti Rehabilitasi Sosial Bina Cacat Netra ”Budi Mulya” Malang untuk merubah mental dan perilaku klien atau penyandang cacat tunanetra agar dapat lebih mandiri dan dapat bersosialisasi dengan masyarakat. Proses rehabilitasi yang diberikan oleh pemerintah ini disosialisasikan kepada masyarakat melalui pemerintah desa dan kota dengan biaya penuh dari pemerintah untuk segala kebutuhan klien. Rumusan masalah dalam penelitian ini adalah: (1) Bagaimana keberadaan Panti Rehabilitasi Sosial Bina Cacat Netra “Budi Mulya” di daerah tersebut, (2) Bagaimana pembinaan moral yang diberikan kepada penyandang cacat tunanetra, (3) Bagaimana efektivitas pembinaan moral yang diberikan dalam bersosialisasi di masyarakat, dan (4) Bagaimana Panti Rehabilitasi Sosial Bina Cacat Netra “Budi Mulya” dalam menyukseskan pembinaan Moral terhadap klien. Penelitian ini dilaksanakan pada semester pendek tahun ajaran 2007-2008. Adapun metode yang digunakan dalam penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian studi kasus. Dalam penelitian ini menggunakan tiga teknik pengumpulan data, yaitu (1) Teknik wawancara, yaitu peneliti mengadakan wawancara dengan pembina atau pengajar pembinaan moral, dan penyandang cacat tunanetra atau klien Panti Rehabilitasi Sosial Bina Cacat Netra ”Budi Mulya” Malang, (2) Teknik observasi, yaitu peneliti mengadakan observasi secara langsung pada kelas-kelas yang memberikan materi yang mengandung unsur pembinaan moral yang dilaksanakan setiap hari mulai dari kelas Persiapan A sampai dengan kelas Kejuruan, dan (3) Teknik dokumentasi, yaitu peneliti mengambil dokumentasi yang bisa berupa gambar atau arsip-arsip yang berhubungan dengan pembinaan moral terhadap penyandang cacat tunanetra. Pada penelitian ini difokuskan untuk meneliti pembinaan moral yang diberikan di seluruh kelas. Penelitian ini mengambil lokasi di Panti Rehabilitasi Sosial Bina Cacat Netra ”Budi Mulya” Malang yang merupakan satu-satunya panti rehabilitasi penyandang cacat tunanetra yang ada di Jawa Timur yang memberikan pendidikan dan pembinaan moral. Penelitian ini dilakukan mulai bulan April Hingga Juni 2008. Hasil penelitian menunjukkan bahwa, penyandang cacat tunanetra mengalami perubahan mental dan perilaku selama dalam proses rehabilitasi khususnya setelah menerima materi setiap hari yang ditekankan pada pembinaan moral. Hal ini ditunjukkan dengan klien dapat mengerjakan pekerjaan rumah sendiri da dapat berkomunikasi dengan masyarakat di lingkungan panti rehabilitasi dengan cara membeli kebutuhan sehari-hari di pasar Bentoel. Dengan sarana dan prasarana yang mendukung klien juga mendapatkan keterampilan bekerja untuk bekal setelah lulus dari panti rehabilitasi. Berdasarkan hasil penelitian, maka disarankan agar pihak Panti Rehabilitasi Sosial Bina Cacat Netra ”Budi Mulya” Malang meningkatkan mutu pelayanan dan pendidikan khususnya pembinaan moral kepada penyandang cacat tunanetra, dengan harapan klien dapat memperoleh hasil yang optimal selama mengikuti proses rehabilitasi. Selain itu sebelum memberikan materi secara keseluruhan, hendaknya semua pembina atau pengajar tidak mengerti rancangan materi yang diajarkan, tetapi juga mengerti rancangan materi yang diajarkan oleh pembina atau pengajar yang lain.

Konsep poros maritim sebagai paradigma baru dalam pembangunan nasional / Herlan Prasetyo

 

ABSTRAK Prasetyo, Herlan. 2016. Konsep Poros Maritim sebagai Paradigma Baru dalam Pembangunan Nasional. Skripsi, Program Studi Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. Nur Wahyu Rochmadi, M.Pd., M.Si., (II) Hj. Yuniastuti, S.H., M.Pd. Kata Kunci: konsep poros maritim, implementasi, pembangunan nasional. Konsep poros maritim yang dibentuk Presiden Jokowi dimaksudkan untuk mengoptimalkan seluruh potensi di wilayah laut Indonesia. Beragamnya potensi laut Indonesia yang berupa sumberdaya perikanan, sumberdaya minyak dan gas bumi, pariwisata bahari, industri dan jasa maritim, serta Alur Laut Kepulauan Indonesia (ALKI) dapat menghasilkan nilai ekonomi yang sangat tinggi apabila dikelola dengan maksimal. Tindakan melawan hukum yang banyak terjadi di laut Indonesia, seperti pencurian ikan, lamanya waktu bongkar muat di pelabuhan, dan pelanggaran wilayah perbatasan oleh negara tetangga adalah fakta, bahwa masih terdapat permasalahan dalam pengelolaan wilayah laut Indonesia. Tujuan dari penelitian ini adalah sebagai berikut. Pertama, untuk mendeskripsikan makna konsep poros maritim. Kedua, mendeskripsikan tentang implementasi konsep poros maritim. Ketiga, adalah mendeskripsikan tentang tantangan implementasi konsep poros maritim. Untuk mencapai tujuan tersebut peneliti menggunakan jenis penelitian kualitatif yang bersifat deskriptif dengan empat metode analisis yaitu: komparasi, kompilasi, deduktif, dan induktif. Analisis data dilakukan dengan cara pengumpulan bahan-bahan kepustakaan, melalui studi pustaka terkait sumber bacaan berupa buku-buku, dokumen perundang-undangan, penyajian rangkuman data (reduksi) dan penarikan kesimpulan (verifikasi). Untuk menjamin keabsahan data yang diperoleh, peneliti melakukan pengecekan data dengan ketekunan pengamatan dan uraian rinci. Berdasarkan analisis tersebut, diperoleh kesimpulan hasil penelitian sebagai berikut. Pertama, konsep poros maritim merupakan pemahaman tentang wilayah maritim Indonesia seluas 6 juta km2, garis pantai sepanjang 95.181 km, dan memiliki beragam jenis sumberdaya alam di lautan. Oleh karena itu, sangat tepat apabila pembangunan nasional diarahkan pada pemanfaatan seluruh potensi di wilayah maritim Indonesia. Kedua, implementasikan ke dalam empat bidang pembangunan nasional secara berkesinambungan. Bidang politik, ada kebijakan pembentukan Kementerian Koordinator Kemaritiman dan Sumberdaya dan pembentukan Satuan Tugas Pemberantasan Illegal Fishing. Bidang ekonomi, ada kebijakan Tol Laut, dengan pengembangan kapal-kapal nelayan, pembangunan dan pengembangan pelabuhan, pembangunan Pusat Logistik Berikat (PLB), pengembangan industri galangan kapal. Kemudian ada kebijakan investasi asing industri perikanan dan kebijakan percepatan waktu bongkar muat (dwelling time) di pelabuhan, dengan memperbanyak jalur hijau barang, meningkatkan biaya denda, kereta api pelabuhan, meningkatkan sistem teknologi informasi, penambahan kapasitas crane (alat derek), dan penyederhanaan peraturan perizinan, serta pemberantasan mafia di pelabuhan. Bidang sosial budaya ada kebijakan pengembangan pariwisata bahari dan pengembangan pendidikan maritim. Bidang pertahanan dan keamanan (hankam) ada kebijakan pembentukan Badan Keamanan Laut (Bakamla), pengembangan alutsista TNI Angkatan Laut, dan pengembangan alutsista TNI Angkatan Udara. Ketiga, tantangan implementasi konsep poros maritim terdiri dari sistem teknologi dan informasi, sarana dan prasarana, sumberdaya manusia, dan kondisi maritim Indonesia. Saran yang diberikan peneliti kepada pemerintah, yaitu (1) agar konsep poros maritim yang dibentuk oleh Presiden Jokowi benar-benar menjadi efektif dan efisien dalam rangka pembangunan nasional, sebaiknya kebijakan yang telah dibuat dapat diimplementasikan secara komprehensif. (2) tantangan implementasi konsep poros maritim, berupa pengembangan sistem teknologi dan informasi, sarana dan prasarana, sumberdaya manusia, dan kondisi maritim Indonesia sebaiknya terus dikembangkan agar dapat berfungsi optimal dalam mengelola wilayah laut Indonesia. Saran terakhir, bagi peneliti sejenis diharapkan untuk menyempurnakan dan melakukan penelitian lebih lanjut mengenai perkembangan pelaksanaan dari konsep poros maritim berikutnya, kemudian gagasan apa yang mungkin bisa diberikan bagi pengembangan kemaritiman nasional dimasa yang akan datang.

Uji preferensi Menochilus sexmaculatus (Coleoptera: Coccinelidae) terhadap tanaman hias Hydrangea Macrophylla (Thumb) Ser., Rosa hybrida L., Chrysantemum morifolium Ramat dan Gerbera jamesonii Bolus / Rahmah Sari Nastiti Ratman

 

ABSTRAK Ratman, Rahmah Sari Nastiti. 2016. Uji Preferensi Menochilus sexmaculatus (Coleoptera: Coccinelidae) terhadap Tanaman Hias Chrysantemum morifoliumRamat, Gerbera jamesonii Bolus, Hydrangea macrophylla(Tumb) Ser.,danRosa hybrida L. Skripsi. Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Fatchur Rohman, M. Si., (II) Sofia Ery Rahayu, S. Pd., M. Si. Kata kunci: preferensi, predator, Menochilus sexmaculatus, tanaman hias, senyawa volatil Menochilus sexmaculatus merupakan predator jenis kumbang kubah polifag terhadap beberapa serangga hama. Pemanfaatan predator sebagai salah satu agen pengendalian hayati perlu ditingkatkan.Beberapa jenis tanaman berpotensi sebagai mikrohabitat serangga predator.Daya potensi tanaman tersebut karena beberapa tanaman dapat menarik suatu jenis serangga predator berdasarkan bau yang dikeluarkan oleh tanaman tersebut.Penelitian ini bertujuan untuk mengetahui frekuensi dan waktu orientasi preferensiM. sexmaculatus terhadap tanaman hiasChrysantemum morifoliumRamat, Gerbera jamesonii Bolus, Hydrangea macrophylla (Tumb) Ser., dan Rosa hybrida Lyang berpotensi menarik serangga predator. Penelitian ini termasuk penelitian deskriptif eksploratif dengan pendekatan kuantitatif yang dilaksanakan pada bulan Februari sampai April 2016 di Laboratorium Ekologi dan Biodiversitas FMIPA Universitas Negeri Malang.Variabel yang digunakan berupa perbedaan jenis tanaman hias tanpa bunga dan berbunga dari Chrysantemum morifoliumRamat, Gerbera jamesonii Bolus, Hydrangea macrophylla (Tumb) Ser., dan Rosa hybrida L dan diulang sebanyak 4 ulangan.Prefrensi M. sexmaculatus terhadap tanaman diketahui dengan menggunakan alat olfaktometer.Hasil pengukuran preferensi berupa data frekuensi dan waktu orientasi pada tanaman uji yangdianalisis menggunakan ANAVA nonfaktorial. Hasil perhitunganfrekuensi menunjukkan M. sexmaculatus memiliki ketertarikan lebih tinggi terhadap tanaman tanpa bunga dan berbunga dari Rosa hybrida dan Hydrangea macrophylla.Perhitungan waktu orientasi preferensi terhadap tanaman hias tanpa bunga menunjukkan tidak adanya perbedaan waktu orientasi ketertarikansedangkan terhadap tanaman hias berbunga menunjukkan adanya perbedaan waktu orientasi preferensiyaitu pada tanaman Gerbera jamesoniiberbunga.

Pengembangan bahan ajar kimia berbasis learning cycle 5E pada materi kelarutan dan hasil kali kelarutan untuk siswa SMA kelas XI / Pustika Wulandari

 

ABSTRAK Wulandari, Pustika. 2016. PengembanganBahan Ajar Kimia Berbasis Learning Cycle 5E padaMateriKelarutandanHasil Kali KelarutanUntukSiswa SMA Kelas XI.Skripsi,Jurusan Kimia, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: (I) Dr. Endang Budiasih, M.S., (II) Drs. MohamadSodiqIbnu, M.Si Kata-katakunci: Learning Cycle 5E, Kelarutan, Hasil Kali Kelarutan Konsepdalammaterikelarutandanhasil kalikelarutanbersifatabstrakdankompleks.Hal tersebutmenyebabkanbanyaksiswa yang mengalamikesulitandalammempelajarimateritersebut.Atasdasarinilah, penelitimengembangkanbahan ajar untukmaterikelarutandanhasil kali kelarutan.Produk yang akandikembangkanberupabahan ajar kimiapadamaterikelarutandanhasil kali kelarutan yang digunakanuntuksiswadan guru. Produk yang akandihasilkandisusunberdasarkansintaks model pembelajaranlearning cycle 5E.Penelitianinibertujuanuntukmenghasilkanbahan ajar kimiamenggunakan model pembelajaranlearning cycle 5Epadamaterikelarutandanhasil kali kelarutanuntuksiswa SMA kelas XI sertamengetahuitingkatkelayakanbahan ajar tersebut. PenelitianinimenggunakanrancanganpenelitiandanpengembanganmenurutThiagarajan(1974) yang terdiridari 4 tahap, yaitu: define (pembatasan), design (perancangan), develop (pengembangan), dandisseminate (penyebaran). Namun, penelitianiniterbataspadatahapdefine, design, developtanpamelakukantahapdisseminate. Bahan ajar hasilpengembangandiujidenganvalidasiisidanujiketerbacaan.Validasiisidilakukandenganmemberikanangketpenilaianterhadapbahan ajar yang dikembangkankepada validator yaitudosenkimiadan guru kimia SMA.Ujiketerbacaandilaksanakanpada 10 siswakelas XI.Jenis data yang diperolehdarihasilvalidasidanujiketerbacaanbahan ajar adadua, yaitu data kuantitatif yang diperolehdariperhitunganpersentaseuntukmengetahuibesarnyakelayakanbahan ajartersebutdan data kualitatifberupatanggapan, kritik, dan saran. Hasilpenelitianmenunjukkanbahwapenilaian validator ahliterhadapbahan ajar yang dihasilkansangatlayakdigunakandalampembelajaran.Kelayakaniniditinjaudariaspekkelayakanisidanpenyajiansertakelayakankegrafisan.Hasilpenilaianbukusiswadiperolehpersentasekelayakansebesar 89,55%danbuku guru diperolehpersentasekelayakansebesar 91,65%.Kelayakanbahan ajar hasilpengembanganjugadapatdilihatberdasarkanpenilaiansiswaterhadapbahan ajarmelaluiujiketerbacaan.Ujiketerbacaandilakukanpada 10 siswa yang telahmenempuhmaterikelarutandanhasil kali kelarutandandiperolehpersentasekelayakansebesar 96,5%.Produkpengembangan yang dikembangkansecaraumumtelahmemenuhikriteriasangatvalid danlayakuntukdigunakan.Namunbelumdiujicobakan di kelas, sehinggadisarankanpadapeneliti lain untukmelakukanujicoba di beberapakelasdansekolah.

Pengembangan multimedia interaktif perubahan dan pelestarian lingkungan berbasis pendekatan ilmiah untuk siswa kelas X SMA Negeri 1 Lawang / Koko Setiadi Santoso

 

ABSTRAK Santoso, Koko Setiadi. 2016. Pengembangan Multimedia Interaktif Perubahan dan Pelestarian Lingkungan Berbasis Pendekatan Ilmiah untuk Siswa Kelas X SMA Negeri 1 Lawang. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Endang Suarsini, M.Ked. (II) Drs. Triastono Imam Prasetyo, M.Pd. Kata Kunci: Perubahan dan Pelestarian Lingkungan, Multimedia, Research and Development (R&D) Kegiatan belajar mengajar merupakan proses komunikasi antar komponen pembelajaran meliputi siswa dan guru. Media pembelajaran merupakan salah satu komponen pembelajaran yang berpengaruh untuk meningkatkan komunikasi dalam kegiatan belajar mengajar. Hasil analisis kebutuhan menunjukkan bahwa 95% siswa dan 100% guru membutuhkan pengembangan multimedia interaktif materi perubahan dan pelestarian lingkungan. Penelitian dan pengembangan multimedia menggunakan 7 tahap dari 10 tahap yang diadaptasi dari metode Penelitian dan Pengembangan (Research and Development) oleh Borg dan Gall (1989) yang terdiri dari (1) penyelidikan dan pengumpulan informasi, (2) perencanaan produk dan desain, (3) pengembangan produk awal, (4) uji awal produk, (5) revisi produk, (6) uji coba utama, (7) revisi produk akhir. Produk multimedia interaktif perubahan dan pelestarian lingkungan dikembangkan menggunakan program Autoplay Media Studio dan dikemas dalam ekstensi file.exe. Produk pengembangan dilakukan uji validasi, uji kepraktisan dan uji keefektifan. Hasil validasi ahli media (86,3%), ahli materi (95,7%), dan praktisi lapangan (92,5%) menunjukkan multimedia interaktif valid. Uji kepraktisan mendapat hasil 89,3% menunjukkan bahwa multimedia interaktif praktis digunakan. Hasil uji keefektifan mendapatkan hasil 0,51 pada Gain score dan pada ketuntasan belajar klasikal siswa diperoleh persentase 87,5% menunjukkan bahwa multimedia interaktif efektif. Berdasarkan hasil tersebut menunjukkan multimedia interaktif perubahan dan pelestarian lingkungan dapat digunakan di SMAN 1 Lawang.

Pengembangan nahan ajar Laju Reaksi berbasis Inkuiri Terbimbing (Guided Inquiry) berdasarkan Kurtikulum 2013 / Rizki Efiarti Nurwidya

 

ABSTRAK Nurwidya, Rizki Efiarti. 2015. Pengembangan Bahan Ajar Laju Reaksi Berbasis Inkuiri Terbimbing (Guided Inquiry) Berdasarkan Kurikulum 2013. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (1) Dr. Fauziatul Fajaroh, M.S., (2) Drs. Dermawan Afandy, M.Pd. Kata kunci: bahan ajar, laju reaksi, inkuiri terbimbing, kurikulum 2013 Pembelajaran kimia harus memberikan pengalaman belajar melalui pengembangan sikap ilmiah, berfikir ilmiah dan keterampilan kerja ilmiah. Sesuai dengan kurikulum 2013, kegiatan dalam pembelajaran kimia harus dilakukan dengan melibatkan proses mengamati, menanya, mencoba/mengumpulkan data/informasi, mengasosiasi, dan mengomunikasikan. Untuk memenuhi kriteria tersebut, dibutuhkan bahan ajar yang sesuai. Inkuiri terbimbing merupakan salah satu model pembelajaran yang sesuai dengan pola pembelajaran kimia pada kurikulum 2013. Penelitian pengembangan ini bertujuan untuk menghasilkan bahan ajar laju reaksi menggunakan pendekatan saintifik berbasis inkuiri terbimbing untuk SMA/MA kelas XI semester 1 dan untuk mengetahui tingkat kelayakan hasil pengembangan. Model pengembangan bahan ajar ini adalah model four-D yang terdiri dari 4 tahapan yaitu, membatasi (to define), merancang (to design), mengembangkan (to develop) dan menyebarluaskan (to disseminate). Namun pengembangan bahan ajar ini hanya dilakukan sampai pada tahap ketiga. Desain validasi terdiri dari validasi isi dan uji keterbacaan terbatas. Validasi isi dan uji keterbacaan terbatas ditentukan berdasarkan kelayakan isi, bahasa, dan tata letak yang dinilai dengan menggunakan instrumen yaitu: (1) lembar validasi yang berupa angket penilaian dan (2) lembar komentar atau saran validator terhadap bahan ajar. Produk hasil pengembangan berupa bahan ajar laju reaksi berbasis inkuiri terbimbing berdasarkan kurikulum 2013 yang terdiri dari buku guru dan buku siswa. Berdasarkan hasil analisa hasil validasi dan uji keterbacaan, diperoleh rata-rata tingkat kelayakan sebesar 86,88% pada buku siswa, 88,49% pada buku guru. Dari hasil uji keterbacaan pada 10 peserta didik, diperoleh tingkat kelayakan sebesar 90,77%. Dengan demikian, buku siswa dan buku guru laju reaksi berbasis inkuiri terbimbing berdasarkan kurikulum 2013 memiliki kriteria sangat layak untuk digunakan dalam kegiatan pembelajaran di kelas.

Analisis perbandingan tingkat kompetisi siswa kelas unggulan dengan siswa kelas reguler di SMK Negeri Senduro Lumajang / Abidah Nurjayati

 

ABSTRAK Nurjayati, Abidah. 2015. Analisis Perbandingan Tingkat Kompetisi Siswa Kelas Reguler dengan Siswa Kelas Unggulan di SMK Negeri Senduro Lumajang. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Dr. Suparti, M.P (2) Sulastri, S.Pd, M.SA. Kata Kunci: Kompetisi, Kelas Unggulan, Kelas Reguler Dalam kehidupan sosial, kita tidak bisa lepas dari kompetisi atau persaingan. Kompetisi adalah aktivitas dimana seseorang atau kelompok berusaha mencapai tujuannya dengan cara bersaing untuk memperoleh hasil yang lebih baik dari orang atau kelompok lain. Kompetisi dapat digunakan sebagai alat motivasi untuk mendorong anak didik agar bergairah belajar. Kompetisi, baik dalam individu maupun kelompok diperlukan dalam pendidikan. Kondisi ini dapat dimanfaatkan untuk menjadikan proses interaksi belajar mengajar yang kondusif karena siswa akan termotivasi untuk bersaing mencapai prestasi terbaik. Dalam perkembangannya, terdapat sekolah-sekolah yang membagi komunitas siswa dalam dua macam, yaitu kelas unggulan dan kelas reguler. Tujuan penelitian ini adalah untuk mengetahui tingkat kompetisi di kelas unggulan, tingkat kompetisi di kelas reguler dan untuk mengetahui apakah terdapat perbedaan tingkat kompetisi siswa kelas uggulan dengan siswa kelas reguler. Penelitian ini menggunakan rancangan deskriptif komparatif yang dilaksanakan di SMK Negeri Senduro Lumajang. Adapun subjek yang diteliti berjumlah 24 siswa kelas unggulan dan 24 siswa kelas reguler kelas XI akuntansi. Pengumpulan data menggunakan instrumen angket dan dokumentasi. Hasil penelitian pada kelas unggulan menunjukkan bahwa tingkat kompetisi siswa rata-rata berada pada level tinggi. Sedangkan pada kelas reguler menunjukkan rata-rata tingkat kompetisi siswa juga berada pada level tinggi. Pada pengujian analisis independent sample t-test, diperoleh koefisien thitung (1,444) lebih kecil dari t tabel (2,0129) dengan koefisien P-value sebesar 0,156 dan lebih besar dari taraf signifikansi α = 0,05, maka dari hasil analisa data yang dilakukan, diketahui bahwa tidak terdapat perbedaan yang signifikan antara tingkat kompetisi siswa kelas unggulan dengan siswa kelas reguler. Saran yang diajukan dalam penelitian ini adalah (1) bagi guru untuk mengarahkan siswa pada kompetisi positif dengan terus meningkatkan prestasi belajar siswa, (2) bagi peneliti selanjutnya diharapkan dapat meneliti faktor-faktor lain yang mempengaruhi tingkat kompetisi siswa pada kelas unggulan, reguler maupun akselerasi serta menambah variabel lain yang dijadikan alat ukur agar data yang diperoleh lebih spesifik.  

Penerapan algoritma K-Means Cluster pada sistem informasi alumni berbasis web di SMKN 1 Nganjuk / Aang Sobri Kresna Mukti

 

ABSTRAK Sobri, Aang. Penerapan Algoritma K-Means Cluster padaSistemInformasi Alumni Berbasis Webdi SMK Negeri 1 Nganjuk. Skripsi, Prodi S1 PendidikanTeknikInformatika, JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: (I) Heru Wahyu H., S.T., M.T. (II) M. Zainal Arifin., S.Si., M.Kom. Kata Kunci: Sistem Informasi, Waterfall, Web, K-MeansCluster. Setiap tahun Sekolah Menengah Kejuruan (SMK) di seluruh Indonesia meluluskan banyak siswa siswanya yang akhirnya disebut dengan alumni. Alumni dari sebuah sekolah sebenarnya memiliki peran yang sangat signifikan bagi perkembangan suatu sekolah. SMK Negeri 1 Nganjuk saat ini sudah memiliki halaman web sendiri dan sebagai penyampaian informasi kepada siswa dan masyarakat. Namun web yang dimiliki SMK Negeri 1 Nganjuk belum menyampaikan informasi tentang alumninya, hal ini menarik perhatian masyarakat karena berhasil atau tidaknya suatu instansi pendidikan melakukan pembinaan dapat dilihat dari record alumni yang dihasilkannya. Sistem informasi ini dilengkapi fitur untuk mengetahui masa tunggu kerja alumni, dengan menggunakan kuisioner yang ada pada sistem informasi ini. Fitur ini memanfaatkan algoritma K-Means Cluster. Algoritma ini mengelompokkan waktu tunggu alumni sesuai dengan pengelompokkannya. Di sini pengelompokkan waktu tunggu kerja alumni dibagi menjadi 3 (tiga), yaitu: (1) Cepat, (2) Sedang, dan (3) Lama. Model pengembangan yang digunakan di dalamrancangansystem informasiiniadalahpengembanganWaterfall. Model pengembanganinidilakukanmelalui 5 tahapan,yaitu: (1)analisiskebutuhansistem, (2)desainsistemdanperangkatlunak, (3)impelentasidanpengujian, (4)integrasidanpengujiansistem, (5)penerapandanperawatanproduk. Berdasarkan hasil uji coba yang dilakukan, didapat hasil sebagai berikut: (1) pengujian fungsionalitas oleh ahli sistem informasi mendapat skor 100%, (2) pengujian usabilitas oleh ahli sistem informasi mendapat skor 100%, (3) pengujian fungsionalitas oleh administrator mendapat skor 100%, (4) pengujian usabilitas oleh administrator mendapat skor 100%, (5) hasil uji coba fungsionalitas oleh alumni mendapat persentase sebesar 100%, dan (6) hasil uji coba usabilitas oleh alumni mendapat persentase sebesar 100%. Berdasarkan hasil uji coba tersebut, maka penerapan algoritma k-means cluster pada sisteminformasi alumni di SMKNegeri 1 Nganjukberbasis web layakuntukdigunakan.

Pengaruh pendekatan komunikasi total terhadap kemampuan menceritakan kembali isi bacaan siswa tunarunggu kelas 3 di SDLB Kepanjen Malang / Khusnul Khotimah

 

ABSTRAK Khotimah, Khusnul. 2015. Pengaruh Pendekatan Komunikasi Total Terhadap Kemampuan Menceritakan Kembali Isi Bacaan Siswa Tunarungu Kelas 3 di SDLB Kepanjen Malang. Skripsi, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Wiwik Dwi Hastuti, S. Pd., M. Pd., (II) Drs. Abdul Huda, M. Pd. Kata Kunci: tunarungu, komunikasi total, kemampuan menceritakan kembali isi bacaan Tunarungu adalah siswa dengan hambatan pendengaran dan biasanya diikuti hambatan dalam berbicara akibat dari tidak berfungsinya organ dengarnya sehingga membutuhkan pelayanan pendidikan khusus dalam pembelajarannya. Oleh karena itu pendekatan pembelajaran khusus yang dapat digunakan dalam pembelajaran siswa tunarungu untuk meningkatkan kemampuan berbicara dan lebih khususnya kemampuan menceritakan kembali isi bacaan yaitu dengan pendekatan komunikasi total. Tujuan penelitian ini adalah untuk mendeskripsikan proses pembelajaran pendekatan komunikasi total pada pengajaran menceritakan kembali isi bacaan siswa tunarungu kelas 3 di SDLB Kepanjen Malang dan untuk mengetahui pengaruh pendekatan komunikasi total terhadap kemampuan menceritakan kembali isi bacaan siswa tunarungu kelas 3 di SDLB Kepanjen Malang. Penelitian ini menggunakan metode eksperimen dengan bentuk Single Subject Research (SSR) desain A-B-A. Subjek penelitian ini yaitu YAH, seorang siswa tunarungu di SDLB Kepanjen Malang yang memiliki hambatan dalam menceritakan kembali isi bacaan. Variabel terikat dalam penelitian ini adalah kemampuan menceritakan kembali isi bacaan. Variabel bebas dalam penelitian ini adalah pendekata komunikasi total. Instrumen yang digunakan dalam penelitian ini adalah lembar wawancara, bahan bacaan, lembar penilaian, lembar observasi, dan dokumentasi. Instrumen divalidasi dengan menggunakan teknik expert judgement. Data penelitian dianalisis dengan menggunakan teknik analisis visual grafik dalam kondisi dan analisi visual antar kondisi. Hasil penelitian ini menunjukkan adanya pengaruh pendekatan komunikasi total terhadap kemampuan menceritakan kembali isi bacaan. Keadaan ini ditunjukkan pada penilaian kemampuan menceritakan kembali isi bacaan pada fase baseline (A1) berkisar antara 60% sampai dengan 65%, pada fase intervensi (B) berkisar antara 80% sampai dengan 90%, dan pada fase baseline ke 2 (A2) berkisar antara 85% sampai dengan 87,5%. Hal ini juga ditunjukkan dengan perhitungan overlap fase baseline (A1) ke fase intervensi (B) yaitu sebesar 0%. Perhitungan tersebut menyatakan intervensi memiliki pengaruh terhadap peningkatan terget behavior. Kesimpulan dari penelitian ini: 1) kemampuan menceritakan kembali isi bacaan siswa tunarungu pada fase baseline masih rendah dan membutuhkan intervensi, 2) kemampuan menceritakan kembali isi bacaan pada fase intervensi mengalami kenaikan akibat adanya intervensi, dan 3) pendekatan komunikasi total yang diterapkan pada siswa tunarungu kelas 3 memiliki pengaruh terhadap kemampuan menceritakan kembali isi bacaan. Hal tersebut ditunjukkan melalui adanya peningkatan kemampuan menceritakan kembali isi bacaan pada saat sebelum dan setelah diberi intervensi. Saran bagi guru dari hasil penelitian ini yaitu guru lebih mengoptimalkan pembelajaran tunarungu dengan pendekatan komunikasi total.

Memahami proses pemulihan pecandu narkotika / Lucky Indriana

 

ABSTRAK Indriana, Lucky. 2016. Memahami Proses Pemulihan Pecandu Narkotika. Skripsi, Jurusan Pendidikan Ilmu Pengetahuan Sosial, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) I Dewa Putu Eskasasnanda, S.Ant., M.A. (II) Dr. I Nyoman Ruja, S.U. Kata Kunci: Narkotika, Pecandu, Rehabilitasi, Pulih. Upaya penanggulangan penyalahgunaan Narkotika harus dilaksanakan dengan rangkaian tindakan yang berkesinambungan baik dari lembaga pemerintah maupun non pemerintah. Rehabilitasi merupakan salah satu upaya yang dilakukan oleh pemerintah dalam menaggulangi penyalahgunaan Narkotika. Selain mengikuti program rehabilitasi, pecandu juga dapat melaksanakan proses pemulihan terhadap ketergantungan Narkotika dengan caranya sendiri atau non-rehabilitasi. Rumusan masalah dalam penelitian ini adalah (1) Apa hal-hal yang melatarbelakangi pecandu Narkotika di Kota Malang ingin pulih dari ketergantungannya? (2) Bagaimana proses pemulihan ketergantungan Narkotika yang dilakukan oleh pecandu tersebut? (3) Bagaimana upaya pecandu yang telah pulih untuk mempertahankan kepulihannya? Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian yang digunakan adalah deskriptif. Kehadiran peneliti bertindak sebagai instrumen kunci atau pengumpul data. Lokasi penelitian ini terletak di kota Malang. Sumber data yang digunakan adalah data primer dan data sekunder, dengan dua tipe informan yaitu informan kunci dan informan pendukung. Teknik pengumpulan data yang digunakan adalah observasi, wawancara, dan dokumentasi. Analisis data menggunakan model analisis Miles dan Huberman, yang terdiri atas pengumpulan data, reduksi data, penyajian data dan verifikasi. Pengecekan keabsahan temuan yang digunakan adalah ketekunan pengamatan dan perpanjangan waktu penelitian. Tahapan penelitian yang dilakukan yaitu, tahap persiapan, tahap rancangan penelitian, tehap pelaksanaan, dan tahap pelaporan. Berdasarkan analisis data, diperoleh tiga kesimpulan hasil penelitian. Pertama, pecandu Narkotika memiliki motif dalam menghentikan kecanduannya terhadap Narkotika yang terdiri dari “motif sebab” dan “motif supaya”. Kedua, pecandu Narkotika yang mendapat dukungan dari keluarga untuk pulih dari ketergantungan Narkotika memilih untuk mengikuti rehabilitasi rawat inap atau rawat jalan, sedangkan pecandu yang tidak mendapat dukungan dari keluarga memilih untuk pulih dengan caranya sendiri. Ketiga, keputusan mantan pecandu untuk mempertahankan kepulihannya dilaksanakan melalui tindakan-tindakan yang konsisten untuk mencapai tujuan yang diinginkan melalui suatu pilihan yang rasional. Berdasarkan hasil penelitian yang telah dilakukan, saran yang bisa diberikan bagi peneliti selanjutnya adalah agar mengkaji terkait perbedaan efektivitas kegiatan pencegahan penyalahgunaan Narkotika berupa penyuluhan yang dilaksanakan oleh mantan penyalahguna Narkotika dan oleh orang yang tidak pernah menyalahgunakan Narkotika.

Pengaruh profitabilitas, leverage, reputasi kap, dan aggressive tax avoidance terhadap audit report lag (studi empiris pada perusahaan sektor pertambangan yang terdaftar di BEI tahun 2011-2014 / Lucia Dwi Kartika Sari

 

ABSTRAK Sari, Lucia Dwi Kartika. 2015. Pengaruh Profitabilitas, Leverage, Reputasi KAP, dan Aggressive Tax Avoidance Terhadap Audit Report Lag (Studi Empiris Pada Perusahaan Sektor Pertambangan yang Terdaftar di BEI Tahun 2011-2014). Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Sawitri Dwi Prastiti, S.E, M.Si, Ak., (II) Dr. H. Cipto Wardoyo, S.E, M.Pd, M.Si, Ak, CA. Kata Kunci: Audit Report Lag, Profitabilitas, Leverage, Reputasi KAP, Aggressive Tax Avoidance. Tingkat kewajaran laporan keuangan dinilai dari proses audit. Waktu yang dibutuhkan dalam proses audit ini disebut audit report lag. Audit Report Lag (ARL) menunjukkan jumlah interval tanggal laporan keuangan tahunan hingga tanggal laporan keuangan ditandatangani auditor. ARL dapat dipengaruhi berbagai faktor seperti, profitabilitas, leverage, reputasi KAP, dan aggressive tax avoidance. Sehingga penelitian ini bertujuan untuk mengetahui pengaruh faktor-faktor tersebut terhadap audit report lag. Populasi yang digunakan adalah laporan keuangan perusahaan sektor pertambangan yang terdaftar di BEI tahun 2011-2014. Teknik pengambilan sampel menggunakan purposive sampling dengan jumlah 177 laporan keuangan. Metode pengumpulan data menggunakan teknik dokumentasi. Sedangkan analisis data menggunakan analisis regresi linier berganda dengan prasyarat uji asumsi klasik, uji hipotesis, dan uji model. Hasil penelitian ini menunjukkan bahwa secara parsial variabel leverage reputasi KAP dan aggressive tax avoidance berpengaruh signifikan terhadap audit report lag. Sedangkan variabel profitabilitas berpengaruh positif tidak signifikan. Berdasarkan hasil penelitian tersebut, terdapat keterbatasan penelitian berupa tidak dapat diidentifikasi data mengenai waktu penyerahan laporan keuangan oleh emiten dan nilai adjusted R2 adalah 15%. Oleh kareana itu, disarankan bagi pengguna dan peneliti selanjutnya untuk dapat mengidentifikasi lebih lanjut mengenai waktu penyerahan laporan keuangan perusahaan kepada auditor, dan menambahkan faktor-faktor penelitian lain yang dapat mempengaruhi ARL seperti, fee auditor dan gender auditor.

Penggunaan media interaktif berbasis adobe flash matapelajaran sejarah Indonesia untuk meningkatkan hasil belajar siswa kelas X IIS 4 SMA Negeri 1 Kepanjen Malang / Alfian Weldan Arnanda

 

ABSTRAK Arnanda. Alfian Weldan. 2016. Penggunaan Media Interaktif Berbasis Adobe Flash Matapelajaran Sejarah Indonesia Untuk Meningkatkan Hasil Belajar Siswa Kelas X IIS 4 SMA Negeri 1 Kepanjen Malang. Skripsi Jurusan Sejarah. Fakultas Ilmu Sosial. Unversitas Negeri Malang. Pembimbing: (1) Najib Jauhari. S.Pd.. M.Hum. (2) Dr. Ari Sapto. M.Hum. Kata Kunci: pembelajaran sejarah, Adobe Flash, hasil belajar, SMA Negeri 1 Kepanjen Pembelajaran di kelas pada matapelajaran sejarah dirasa membosankan oleh siswa. Berdasarkan observasi yang telah dilakukan di kelas X IIS 4 SMA Negeri 1 Kepanjen Malang, proses pembelajaran yang dilakukan oleh guru sejarah menggunakan media papan tulis dan lembar kerja siswa. Peneliti menyimpulkan berdasarkan observasi hasil ulangan harian yang telah dilakukan mendapatkan hasil belajar di kelas X IIS 4 rendah, hal ini disebabkan kurangnya penggunaan media yang kreatif dan inovatif. Tidak digunakannya media belajar yang kreatif dan inovatif mengakibatkan siswa cenderung bermain dan mengobrol dengan teman, serta hasil belajar rendah. Peneliti mencari jawaban atas masalah (1) Bagaimana penggunaan media interaktif berbasis Adobe Flash sebagai upaya meningkatkan hasil belajar siswa dalam matapelajaran sejarah kelas X IIS 4 di SMA Negeri 1 Kepanjen Malang. (2) Bagaimana hasil belajar siswa X IIS 4 SMA Negeri 1 Kepanjen Malang setelah penggunaan media interaktif berbasis Adobe Flash. Prosedur penelitian menggunakan langkah Kemmis dan Teggart yaitu perencanaan, pelaksanaan, pengamatan dan refleksi. Proses pembelajaran menggunakan media interaktif berbasis Adobe Flash. Prasarana yang digunakan adalah LCD, Leptop dan speaker aktif. Pengumpulan data dengan observasi, catatan lapangan, wawancara dan tes untuk mendapatkan data di kelas. Penelitian menggunakan penelitian tindakan kelas yang dilaksanakan dua siklus tindakan. Setiap siklus terdiri dari dua pertemuan dan setiap siklus mendapat alokasi waktu selama 4x45 menit dengan materi persebaran Islam Kesultanan Pontianak dan Kesultanan Banjarmasin dan Sulawesi Islam Kesultanan Gowa-Tallo dan Kesultanan Wajo pada siklus I. Siklus II dengan materi Persebaran Islam Kesultanan Ternate dan Kesultanan Tidore dan Islam di Papua. Subyek penelitian adalah siswa kelas X IIS 4 SMA Negeri 1 Kepanjen Malang jumlah 35 siswa. Hasil penelitian menunjukan (1) penggunaan media interaktif berbasis Adobe Flash meningkatkan hasil belajar siswa kelas X IIS 4 SMA Negeri 1 Kepanjen Malang. (2) berdasarkan analisis hasil belajar kelas X IIS 4 menunjukan peningkatan dari pra tindakan sebesar 22.86% di siklus I meningkat menjadi 68.57% dan di siklus II meningkat menjadi 80%. Dapat disimpulkan bahwa media interaktif berbasis Adobe Flash meningkatkan hasil belajar siswa kelas X IIS 4 SMA N 1 Kepanjen Malang. Peningkatan ini ditunjukan dengan presentase hasli belajar pada awal observasi sebesar 22.86%. Siklus I meningkat menjadi 68.57% pada siklus II 80%. Disarankan guru dapat menyesuaikan media pembelajaran dengan perkembangan teknologi yang lebih kreatif dan inovatif untuk meningkatkan hasil belajar sejarah pada siswa.

Pengaruh persepsi wajib pajak tentang kualitas pelayanan perpajakan terhadap tingkat kepatuhan wajib pajak orang pribadi (studi pada KPP Pratama Malang Utara) / Helmi Nur Ardiansyah

 

ABSTRAK Ardiansyah, Helmi Nur. 2016. Pengaruh Persepsi Wajib Pajak Tentang Kualitas Pelayanan Perpajakan terhadap Tingkat Kepatuhan Wajib Pajak Orang Pribadi (Studi Pada KPP Pratama Malang Utara). Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Dr. Nurika Restuningdiah., S.E., M.Si., Ak, CA (II) Dr. Eka Ananta Sidharta., S.E., M.M., CA. Kata Kunci:kualitas pelayanan, persepsi bukti fisik, persepsi keandalan, persepsi daya tanggap, persepsi jaminan dan empati, tingkat kepatuhan wajib pajak orang pribadi. Penerimaan nasional suatu negara dihasilkan dari dua sumber penerimaan. Penerimaan dari sektor perpajakan merupakan sumber penerimaan yang utama di Indonesia. Penelitian ini bertujuan untuk mengetahui pengaruh persepsi bukti fisik, persepsi keandalan, persepsi daya tanggap, persepsi jaminan dan empati terhadap tingkat kepatuhan Wajib Pajak orang pribadi di Kantor Pelayanan Pajak Pratama Malang Utara. Penelitian ini menggunakan Perilaku yang Direncanakan sebagai grand theory, yang menyebutkan bahwa perilaku yang dilakukan individu muncul karena adanya niat untuk berperilaku. Penelitian ini menggunakan kuisioner sebagai alat penelitian. Metode sampling yang digunakan adalah accidential sampling. Populasi dalam penelitian ini adalah seluruh Wajib Pajak Orang Pribadi yang terdaftar di Kantor Pelayanan Pajak Pratama Malang Utara sebanyak 63.880 (enam puluh tiga ribu delapan ratus delapan puluh) wajib pajak orang pribadi. Sampel yang digunakan adalah 100 wajib pajak orang pribadi. Instrumen yang digunakan telah memenuhi uji validitas dan uji reliabilitas. Teknik analisis data yang digunakan adalah analisis regresi berganda. Berdasarkan hasil penelitian secara parsial diketahui bahwa persepsi bukti fisik, persepsi keandalan, persepsi daya tanggap, persepsi jaminan dan empati berpengaruh terhadap tingkat kepatuhan Wajib Pajak Orang Pribadi. Saran untuk KPP Pratama Malang Utara adalah mempertahankan dan meningkatkan kualitas pelayanan dengan memperhatikan kebutuhan dan keinginan, serta harapan Wajib Pajak orang pribadi. Saran untuk peneliti selanjutnya adalah (1) menambah variabel independen lain, (2) Menggunakan metode purposive sampling untuk pengambilan sampel, (3) melakukan metode wawancara untuk mengurangi bias dari jawaban responden.

Pengembangan buku ajar akuntansi berbasis scientific approach untuk SMK Bisnis dan Manajemen / Yuni Safitri

 

ABSTRAK Safitri, Yuni. 2016. Pengembangan Buku Ajar Akuntansi Berbasis Scientific Approach untuk SMKN Bisnis dan Manajemen. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang.Pembimbing: (1) Dr. H. Tuhardjo, S.E., M.Si., Ak., (2) Dr. Sri Pujiningsih, S.E., M.Si., Ak. Kata Kunci: Buku Ajar, Akuntansi Perusahaan Dagang, Scientific Approach Penerapan Kurikulum 2013 dan pergeseran paradigma belajar berdampak pada perubahan sistem pembelajaran yang lebih menekankan keaktifan peserta didik. Proses pembelajaran di kelas X Akuntansi SMKN 2 Blitar tahun ajaran 2015/2016 masih berpusat pada kehadiran guru, selain itu hasil belajar peserta didik pada pelajaran akuntansi perusahaan dagang masih rendah. Hal tersebut dikarenakan peserta didik kesulitan memahami materi dan belum tersedianya buku ajar yang menjadi pegangan peserta didik yang sesuai Kurikulum 2013. Kegiatan pembelajaran di kelas belum melibatkan peserta didik secara penuh, khususnya terkait pendekatan ilmiah (scientific approach) sesuai Kurikulum 2013. Tujuan penelitian ini adalah mengembangkan buku ajar akuntansi perusahaan dagang berbasis pendekatan ilmiah (scientific approach)yang layak digunakan untuk kegiatan pembelajaran. Model penelitian dan pengembangan yang digunakan pada penelitian ini adalah Model 4D yang dikembangkan oleh Thiagarajan et al, yang terdiri dari tahap pendefinisian (define), perancangan (design), pengembangan (develop), dan penyebaran (dissemination). Penelitian ini tidak menggunakan tahap penyebaran (dissemination) dikarenakan beberapa keterbatasan. Uji kelayakan buku ajar dilakukan oleh 2 ahli materi dan 1 ahli desain. Uji coba terbatas kepada pengguna buku ajar melibatkan 1 guru dan 21 peserta didik kelas X Akuntansi SMKN 2 Blitar tahun ajaran 2015/2016. Jenis data yang diambil berupa data kuantitatif dan data kualitatif. Data kuantitatif dianalisis menggunakan teknik analisis deskriptif. Data kualitatif digunakan untuk revisi buku ajar yang dikembangkan. Instrumen pengumpulan data yang digunakan adalah angket tertutup. Hasil validasi ahli materi diperoleh rata-rata penilaian 3,98 dari skala 4, hasil validasi ahli desain 3,94dari skala 4, dan hasil uji coba terbatas diperoleh rata-rata penilaian 3,46dari skala 4. Secara keseluruhan rata-rata penilaian kelayakan sebesar 3,79dari skala 4. Sesuai kriteria kelayakan maka dapat disimpulkan buku ajar akuntansi perusahaan dagang yang dikembangkan layak digunakan untuk pembelajaran akuntansi perusahaan dagang di SMKN 2 Blitar. Buku ajar akuntansi yang dikembangkan memiliki keunggulan antara lain: 1) buku ajar sesuai kurikulum yang berlaku, 2) uraian materi lebih mendalam, kontekstual, dan bahasa yang komunikatif, 3) memuat nilai karakterdan budaya bangsa, 4) berbasis pendekatan ilmiah (scientific approach) melalui kegiatan 5M, dan5) soal-soal bervariasi dan tidak monoton.Kelemahan buku ajar adalah materi terbatas sampai pencatatan akuntansi perusahaan dagang, belum dilakukannya uji efektifitas buku ajar, dan nilai budaya bangsa yang diintegrasikan diadaptasi dari nilai budaya di wilayah Jawa Timur, khususnya Blitar. Oleh karena itu, saran untuk penelitian selanjutnya sebaiknya melakukan uji efektifitas terhadap buku ajar serta mengembangkan produk dengan materi yang lebih luas.

Pengaruh motivasi belajar, intensitas belajar, dan lingkungan sekolah terhadap hasil belajar siswa kelas X program keahlian keuangan pada mata pelajaran pengantar ekonomi dan bisnis di SMK Negeri 1 Malang tahun ajaran 2015/2016 / Yogi Asmoro

 

ABSTRAK Asmoro, Yogi. 2016. Pengaruh Motivasi Belajar, Intensitas Belajar, Dan Lingkungan Sekolah Terhadap Hasil Belajar Siswa Kelas X Program Keahlian Keuangan Pada Mata Pelajaran Pengantar Ekonomi & Bisnis Di SMK Negeri I Malang. Skripsi, Jurusan Ekonomi Pembangunan Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Sri Umi Mintarti W., S.E., MP., Ak (II) Dr. Lisa Rokhmani, M.Si Kata Kunci: motivasi belajar, intensitas belajar, lingkungan sekolah, dan hasil belajar Motivasi memiliki peranan penting dalam proses pembelajaran, hal ini dengan motivasi merupakan salah satu penyebab keberhasilan siswa dalam menentukan hasil belajar, dalam pencapaian tujuan semakin besar motivasi akan semakin besar kemungkinan kesuksesannya. Intensitas juga memiliki peranan penting bsgi siswa guna mencapai hasil belajar yang baik, hal ini dengan intensitas belajar yang tinggi nanti akan terasa bahwa setiap usaha belajar selalu memberikan hasil yang sangat memuaskan, ilmu yang dipelajari dapat mengerti dan dikuasai sehingga ujian dapat dilakukan dengan berhasil. Selain itu, lingkungan sekolah yang baik juga memegang peranan penting bagi perkembangan belajar para siswa. Lingkungan tersebut meliputi sarana pembelajaran, prasarana pembelajaran, kurikulum sekolah, standar mata pelajaran, disiplin sekolah, waktu sekolah, dan relasi siswa dengan warga sekolah. Rumusan masalah yang diajukan dalam penelitian ini adalah (1) Apakah terdapat pengaruh motivasi belajar terhadap hasil belajar pada mata pelajaran pengantar ekonomi bisnis siswa kelas X Ak SMK Negeri I Malang? (2) Apakah terdapat pengaruh intensitas belajar terhadap hasil belajar pada mata pelajaran pengantar ekonomi bisnis siswa kelas X Ak SMK Negeri I Malang (3) Apakah terdapat pengaruh lingkungan sekolah terhadap hasil belajar pada mata pelajaran pengantar ekonomi bisnis siswa kelas X Ak SMK Negeri I Malang? (4) Apakah terdapat pengaruh simultan antara motivasi, intensitas,dan lingkungansekolah terhadap hasil belajar pada mata pelajaranpengantar ekonomi bisnis siswa kelas X AK SMK Negeri I Malang? Populasi dalam penelitian ini adalah seluruh siswa kelas X Program keHLIn Keungan (Ak) di SMK Negeri 1 Malang tahun ajaran 2015/2016 yang berjumlah 127 siswa. Pengambilan sampel dalam penelitian ini berdasarkan rumus Slovin dengan menggunakan teknik “random sampling”, dan diperoleh 96 responden. Jenis penelitian yang digunakan adalah penelitian eksplanasi, dengan teknis analisis regresi linear berganda. Variabel penelitian antara lain: motivasi belajar(X1), intensitas belajar(X2), lingkungan sekolah (X3), dan hasil belajar siswa pada mata pelajaran ekonomi (Y). Teknik pengumpulan data menggunakan angket atau kuesioner, observasi lapangan, dan dokumentasi. Kesimpulan dari penelitian ini adalah (1) motivasi belajar berpengaruh signifikan terhadap hasil belajar siswa X Ak pada mata pelajaran pengantar ekonomi & bisnis di SMK Negeri 1 Malang. (2) intensitas belajar berpengaruh signifikan terhadap hasil belajar siswa X Ak pada mata pelajaran pengantar ekonomi & bisnis di SMK Negeri 1 Malang. (3) lingkungan sekolah berpengaruh signifikan terhadap hasil belajar siswa X Ak pada mata pelajaran pengantar ekonomi & bisnis di SMK Negeri 1 Malang. (4) motivasi belajar, intensitas belajar,dan lingkungan sekolah berpengaruh signifikan terhadap hasil belajar siswa X Ak pada mata pelajaran pengantar ekonomi & bisnis di SMK Negeri 1 Malang. Saran yang diajukan adalah (1) bagi guru diharapkan guru meningkatkan lagi pemberian motivasi dan intensitasnya ditambah dalam memotivasi siswa pada saat mengajar supaya siswa lebih giat lagi dalam hal belajar untuk belajar lebih giat dalam proses belajar mengajar di sekolah. (2) bagi SMK Negeri 1 Malang diharapkan dapat terus meningkatkan kualitas lingkungan sekolah baik dari segi fisik maupun non fisik demi tercapainya lingkungan sekolah yang kondusif dan akademis untuk mendorong siswa berprestasi.(3) Bagi peneliti selanjutnya diharapkan dapat mengembangkan variabel penelitian sehingga hasil penelitiannya dapat melihat pokok masalah yang sama dari sudut pandang yang berbeda dengan perkembangan jaman.

Penerapan model pembelajaran problem solving pada mata pelajaran dasar dan pengukuran listrik untuk meningkatkan keaktifan dan hasil belajar siswa kelas X L 2 Jurusan Teknik Instalasi Tenaga Listrik SMK Negeri 6 Malang / Ardi Mukti Wibowo

 

ABSTRAK Wibowo, Ardi. 2016. Penerapan Model PembelajaranProblem Solving pada Mata Pelajaran Dasar Kelistrikan dan Pengukuran Listrik untuk Meningkatkan Keaktifan dan Hasil Belajar Siswa Kelas X L 2 SMK Jurusan Teknik Instalasi Tenaga Listrik Negeri 6 Malang. Proposal Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Puger Honggowiyono, M.T.,(II) M. Rodhi Faiz, S.T., M.T. Kata Kunci: Problem Solving, Keaktifan,Hasil Belajar, Dasar Kelistrikan dan Pengukuran Listrik Berdasarkan observasi pada peserta didik kelas X SMK Negeri 6 Malang permasalahan yang dihadapi oleh guru adalah : (1) pembelajaran masih berpusat pada siswa; (2) siswa tidak aktif dalam proses pembelajaran dan cenderung gaduh; (3) pemahaman materi dasar oleh siswa sangat kurang; (4) model pembelajaran yang diterapkan guru tidak dapat dijalankan dengan optimal.. Penelitian ini dilaksanakan dengan tujuan untuk menyelesaikan beberapa masalah pada guru dan peserta didik. Peneliti memilih untuk melaksanakan Penelitian Tindakan Kelas (PTK) dan menerapkan model pembelajaranProblem Solving untuk membantu meningkatkan keaktifan dan hasil belajar peserta didik yang belum optimal akibat metode pembelajaran yang kurang tepat. Peneliti menggunakan model penelitian berbentuk siklus (cycle). Model siklus yang digunakan berbentuk spiral, model penelitian ini dikembangkan oleh Kemmis dan Taggart. Langkah - langkah dalam model penelitian spiral meliputi planning (perencanaan), action (tindakan), observering (pengamatan) dan reflecting (refleksi) Hasil dari penelitian yang telah dilakukan terhadap siswa kelas X L 2SMK Negeri 6 Malang Malang pada mata pelajaran Dasar dan Pengukuran Listrik ini adalah : (1) keaktifan siswa meningkat dari 81,57% pada siklus I menjadi 93,55%; (2) hasil belajar siswa pada ranah pengetahuan meningkat dari 87,10% pada siklus I menjadi 96,77% pada siklus II; (3) hasil belajar siswa pada ranah sikap meningkat dari 87,10% pada siklus I menjadi 100% pada siklus II; (3) hasil belajar siswa pada ranah keterampilan meningkat dari 87,10% pada siklus I menjadi 96,77% pada siklus II. Dari uraian diatas dapat disimpulkan bahwa menerapkan model pembelajaranProblem Solving diharapkan dapat meningkatkan keaktifan dan hasil belajar Dasar Kelistrikan dan Pengukuran Listrik pada siswa kelas X L 2SMK Negeri 6 Malang.

Pengembangan permainan petualangan mencari harta karun untuk meningkatkan kemampuan kognitif pada peserta didik tunagrahita di SLB B-C Kepanjen Malang / Vemilia Riza Meiliana

 

ABSTRAK Meiliana, Vemilia Riza. 2015. Pengembangan Permainan Petualangan Mencari Harta Karun Untuk Meningkatkan Kemampuan Kognitif Pada Peserta Didik Tunagrahita Di SLB B-C Kepanjen Malang. Skripsi, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Wiwik Dwi Hastuti, S. Pd., M. Pd, (II) Pramono, S. Pd., M. Or. Kata Kunci:Permainan petulangan mencari harta karun, kemampuan kognitif, Tunagrahita Pendidikan jasmani adaptif yang dirancang untuk peserta didik tunagrahita tidak hanya dalam motoriknya melainkan kemampuan kognitif. Dilihat di lapangan, permainan yang diberuntukkan peserta didik tunagrahita, belum meningkatkan kemampuan kognitifnya. Oleh karena itu, melalui permainan ini dapat diaplikasikan ke dalam pendidikan jasmani adaptif sesuai dengan kebutuhan dan karakteristik peserta didik. Tujuan dari penelitian ini adalah mengembangkan permainan petualangan mencari harta karun untuk meningkatkan kemampuan kognitif peserta didik di SLB B-C Kepanjen Malang. Dengan menghasilkan suatu produk berupa permainan untuk anak tunagrahita. Dengan permainan ini diharapkan peserta didik tunagrahita di SLB B-C Kepanjen Malang dapat belajar lebih baik dan lebih mudah. Pengembangan ini diadaptasi dari langkah-langkah pengembangan model Sugiono kemudian diadaptasi lagi dalam model Dick & Carey. Subyek uji coba produk adalah ahli media, ahli praktisi, uji kelompok kecil yang terdiri dari dua siswa kelas III SLB B-C Kepanjen Malang dan uji kelompok besar terdiri dari delapan siswa kelas III dan IV di SLB B-C Kepanjen Malang. Penelitian ini menggunakan rancangan penelitian pengembangan. Hasil pengembangan permainan petualangan mencari harta karun untuk meningkatkan kemampuan kognitif peserta didik tunagrahita di SLB B-C Kepanjen Malang valid digunakan dalam pembelajaran pendidikan jasmani adaptif. Hasil penilaian ahli media diperoleh skor rata-rata 4. Hasil penilaian praktisi memperoleh skor rata-rata 4. Pada uji kelompok kecil dan uji kelompok besar juga memperoleh hasil yang layak digunakan. Kesimpulan dari penelitian yang dilakukan adalah pengembangan permainan petualangan mencari harta karun untuk meningkatkan kemampuan kognitif peserta didik di SLB B-C Kepanjen Malang telah valid untuk dilakukan.Saran yang duajukan: (1) Guru seharusnya betul-betul memahami buku panduan,(2) Peneliti selanjutnya dapat mengembangakan permainan yang lebih inovatif dalam pendidikan jasmani adaptif, dapat mempertimbangkan jenis kemampuan siswa tunagrahita dalam penyusunan permainan, sehingga permainan dapat dibedakan penggunanya, dan dapat memperbanyak keragaman populasi dan wilayah penelitian.

Pengaruh cash, retained earning, depreciation, dan long term liability terhadap capital expenditure (Studi empiris di Bursa Efek Indonesia tahun 2008-2010) / Muhammad Fikri

 

Kata kunci : cash, retained earning, depreciation, long term liability, capital expenditure, pecking order theory. Capital expenditure adalah salah satu bagian dari investasi yang sangat penting dalam perusahaan. Capital expenditure terkadang dikaitkan dengan kinerja perusahaan, karena diharapkan semakin tinggi capital expenditure maka semakin baik pula kinerja keuangan perusahaan tersebut. Dana yang diperlukan untuk capital expenditure berasal dari berbagai sumber baik internal maupun eksternal. Alternatif pembiayaan internal adalah penggunaan saldo laba perusahaan dan penyusutan, sedangkan alternatif pembiayaan eksternal adalah melalui hutang dan melalui penerbitan saham. Tujuan penelitian ini adalah menguji sejauh mana capital expenditure dipengaruhi oleh cash, retained earning, depreciation, long term liability. Penelitian ini merupakan jenis penelitian eksplanasi karena disesuaikan dengan rumusan hipotesis yang menduga bahwa cash, retained earning, depreciation, long term liability berpengaruh terhadap capital expenditure. Data yang digunakan dalam penelitian ini adalah data kuantitatif yang didapat dari data sekunder berupa jumlah ketersediaan kas, laba ditahan, penyusutan, hutang jangka panjang dan jumlah pengeluaran modal suatu perusahaan. Subjek dalam penelitian ini adalah seluruh perusahaan automotoive and allied product yang listing di Bursa Efek Indonesia pada tahun 2008-2010. Penelitian ini menggunakan analisis regresi linier berganda dengan pengujian hipotesis secara parsial dan simultan. Hasil penelitian ini menunjukkan bahwa terdapat pengaruh positif signifikan variabel cash, retained earning, depreciation, long term liability terhadap capital expenditure, baik secara parsial maupun simultan. Jumlah cash, retained earning, depreciation, long term liability sebagai sumber pembiayaan internal dan eksternal dalam suatu perusahaan akan menyebabkan usaha monitoring pendanaan modal suatu perusahaan lebih meningkat,. Berdasarkan hasil penelitian, disarankan agar penelitian selanjutnya dalam melakukan pengukuran besarnya penyusutan hendaknya tidak hanya berdasarkan pada nilai buku awal dan akhir periode tetapi juga memperhatikan perubahan metode penyusutan yang dipergunakan oleh perusahaan. Disisi lain, dalam melakukan pengukuran capital expenditure hendaknya tidak hanya berdasarkan pada nilai buku aktiva tetap awal dan akhir periode tetapi juga.

Peningkatan motivasi belajar dan pemahaman konsep gaya siswa kelas V SDN Manduro 2 Kabuh Jombang dengan starter experiment approach / Andreas Eko Susanto

 

Kata kunci: pemahaman konsep gaya, motivasi belajar, Starter Experiment Approach Motivasi belajar dan pemahaman konsep siswa kelas V SDN Manduro 2 tergolong rendah. Hal ini disebabkan karena proses pembelajaran yang selama ini dilakukan masih bersifat konvensional. Guru dalam menyampaikan materi pembelajaran hanya menggunakan metode ceramah. Siswa juga beranggapan bahwa belajar adalah menghafalkan konsep. Siswa hanya aktif secara mental, mendengar, dan mencatat penjelasan guru. Hasil pembelajaran yang diperoleh, yakni pemahaman konsep siswa yang bersifat sementara dan tidak adanya pengalaman belajar yang bermakna bagi siswa. Selama pembelajaran, siswa bersikap pasif. Untuk mengatasi hal tersebut, perlu dilaksanakan perbaikan pembelajaran dengan pembelajaran yang melibatkan siswa belajar secara aktif, yang memberikan kesempatan kepada siswa untuk membangun pengetahuannya sendiri. Salah satu pembelajaran tersebut adalah pembelajaran dengan Starter Experiment Approach. Tujuan dari penelitian ini adalah untuk 1) mendeskripsikan rancangan pembelajaran dengan Starter Experiment Approach untuk meningkatkan motivasi belajar dan pemahaman konsep gaya pada siswa kelas V SDN Manduro 2 Kabuh Jombang, 2) mendeskripsikan pelaksanaan rancangan pembelajaran dengan Starter Experiment Approach untuk meningkatkan motivasi belajar dan pemahaman konsep gaya pada siswa kelas V SDN Manduro 2 Kabuh Jombang 3) mendeskripsikan hasil dari pelaksanaan rancangan pembelajaran dengan Starter Experiment Approach untuk meningkatkan motivasi belajar dan pemahaman konsep gaya pada siswa kelas V SDN Manduro 2 Kabuh Jombang. Untuk mencapai tujuan tersebut, maka peneliti merancang suatu penelitian tindakan kelas yang dilaksanakan pada siswa Kelas V SDN Manduro 2 Kabuh Jombang. Data penelitian diperoleh dari hasil pengamatan aktivitas belajar siswa dan aktivitas mengajar guru, angket, penilaian rencana percobaan, penilaian laporan percobaan, dan hasil wawancara dengan siswa. Materi yang disampaikan pada penelitian ini berupa langkah siklus yang terdiri dari empat tahap, yaitu: perencanaan (plan), pelaksanaan tindakan (action), pengamatan (observation), dan refleksi (reflection). Langkah-langkah pembelajaran yang dilakukan dengan Starter Experiment Approach meliputi (1) Guru melakukan percobaan awal, (2) Pada saat yang bersamaan dengan percobaan awal, siswa melakukan pengamatan awal, (3) Siswa merumuskan hipotesis awal dari pertanyaan stimulus yang disampaikan guru, (4) Siswa merancang dan melakukan percobaan pengujian, (5) Melalui diskusi kelompok, siswa merumuskan konsep, (5) Siswa merumuskan aplikasi konsep pada kehidupan sehari-hari, dan (6) pelaksanaan evaluasi pembelajaran yang dilakukan oleh guru. Penelitian ini terdiri dari 3 siklus. Pada siklus I dan II, masing-masing dilaksanakan selama 3 kali pertemuan, sedangkan pada siklus III dilaksanakan selama 4 kali pertemuan. Pada siklus III dilaksanakan selama 4 kali pertemuan karena materi pembelajarannya lebih kompleks. Pada siklus I, siswa mengalami kesulitan dalam menyusun rencana percobaan dan laporan percobaan sehingga dari 22 siswa, hanya 1 siswa yang dinyatakan tuntas. Untuk mengatasi hal tersebut, pada siklus II guru memberikan contoh cara menyusun rencana dan laporan percobaan. Pada siklus 1 sebanyak 15 siswa telah mengikuti pembelajaran dengan aktif. Untuk meningkatkan aktifitas siswa, maka pada siklus II guru memberikan perhatian yang lebih baik pada siswa, sehingga siswa lebih aktif dalam pembelajaran. Pada siklus II, peningkatan pemahaman tampak dari ketuntasan belajar sebanyak 8 siswa yang dinyatakan tuntas. Sedangkan 14 siswa belum tuntas karena mengalami kesulitan dalam merumuskan konsep. Permasalahan ini diatasi dengan cara memberikan kalimat pengantar dalam penyusunan konsep. Untuk aktifitas siswa pengikatan yang signifikan tampak dengan data observasi yang menunjukkan sebanyak 18 siswa aktif dan antusias dalam mengikuti pembelajaran. Pada siklus III, sebanyak 19 siswa telah dinyatakan tuntas belajar. Sebanyak 20 siswa juga telah aktif dalam pembelajaran. Hal ini dikarenakan pada siklus II guru memberikan waktu dan kesempatan kepada siswa untuk memanipulasi media pembelajaran seluas-luasnya. Hasil penelitian menunjukkan bahwa pembelajaran dengan Starter Experiment Approach (SEA) yang memberikan kesempatan kepada siswa yang seluas-luasnya untuk memanipulasi media pembelajaran dapat meningkatkan motivasi belajar dan pemahaman konsep tentang gaya.

Pengembangan bahan ajar geografi struktur buku Cambridge Fundamentals of Geophysics untuk kelas XI SMA/MA materi sebaran barang tambang / Lintang Prawindia

 

ABSTRAK Prawindia, Lintang. 2016. PengembanganBahan Ajar GeografiStrukturBukuCambridge Fundamentals Of GeophysicsuntukKelas XI SMA/MA MateriSebaranBarang Tambang. Tesis. Program StudiPendidikanGeografi, Program PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Prof. Dr. Ach. Fatchan, M.Pd, M.P. (II) Drs. I KomangAstina.M.S, Ph.D. Kata Kunci: pengembangan, bahan ajar, sebaranbarangtambang Pengembanganbahan ajar geografimaterisebaranbarangtambangdilatarbelakangiolehkelemahanpadabahan ajar kurikulum 2013 yang digunakanolehsiswa.KelemahantersebutdiketahuisetelahmelakukananalisisterhadapbukuteksgeografipenerbitErlanggapenulisK.Wardiyatmokountuksiswakelas XI yang digunakan di SMA Negeri 1 RejotanganTulungagung.Beberapakekurangannyaantara lain: kebenaranbahasa, substansi, danpenyajiangambar. Selainitu, kebutuhansiswaakanbahan ajar berkualitassesuaidengantujuankurikulum 2013 merupakansalahsatulatarbelakangdalampengembanganini. Tujuanpenelitianiniadalahmengembangkanbahan ajar geografimenggunakanstrukturbukuCambridge Fundamentals Of Geophysicsuntukkelas XI SMA/MA semester II padamaterisebaranbarangtambang..Buku yang dikembangkanberasaldaripenerbitErlangga.Produk yang dihasilkandapatdimanfaatkansebagaisumberbelajargeografibagikelas XI SMA/MA. PengembanganinimengacupadastrukturbukuCambridge Fundamentals Of Geophysics. Bukuinidipilihkarenamemilikibeberapakeunggulan.Selainitu, sesuaidengantujuankurikulum 2013 yang menekankanaspekkognitif, afektif, danpsikomotor.Prosedurpengembanganmenggunakan model Dick and Carey. Model inimemilikisepuluhtahap, namundisederhanakanmenjadilimatahap, yaitu: (1) mengidentifikasikompetensi inti dankompetensidasar, (2) melakukananalisisbahan ajar, (3) mengembangkanbahan ajar, (4) validasidanrevisi, dan (5) ujicobaproduk. Hasilpenelitianmenunjukkanbahwabahan ajar layakdigunakansiswadalampembelajaran. Hal iniditunjukkandarihasilpersentasekelayakanproduksebesar 82,4%. Hal inimenunjukkanbahwaprodukbahan ajar sudah valid dandapatdigunakan.Skorujipemahamanmaterimenunjukkan 32 siswatelahmencapainilai KKM.Ujipemahamanmanggunakansoaltentangmaterisebanyak 20 butirpilihangandadan 1 butir essay.

Respon serangga nokturnal terhadap warna cahaya di Perkebunan Kakao (Theobroma cacao L.) DDesa Jambangan Kecamatan Dampit Kabupaten Malang / Hanifah Masaroh

 

ABSTRAK Masaroh, Hanifah. 2016. Respon Serangga Nokturnal terhadap Warna Cahaya di Perkebunana Kakao Desa Jambangan, Kecamatan Dampit, Kabupaten Malang. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (1) Drs. Agus Dharmawan, M. Si., (2) Sofia Ery Rahayu, S.Pd, M.Si Kata kunci: Respon, Warna Cahaya, Light trap Kakao (Theobrema cacao L.) merupakan salah satu komoditas unggulan sub sektor perkebunan. Salah satu daerah penghasil kakao di Kabupaten Malang adalah desa Jambangan, kecamatan Dampit. Adanya serangan hama Penggerek Buah Kakao dapat menurunkan produksi sampai 80%. Terkait dengan hal tersebut dilakukan penelitian dengan tujuan untuk mengetahui, jenis serangga nokturnal, distribusi temporal, respon serangga nokturnal terhadap variasi warna cahaya, dan hubungan antara faktor abiotik dengan jumlah serangga nokturnal tertinggi. Penelitian ini merupakan penelitian deskriptif eksploratif dengan pendekatan kuantitatif. Penelitian dilakukan pada bulan Januari-April 2016 di lahan perkebunan kakao Desa Jambangan, Kecamatan Dampit, Kabupaten Malang. Pengumpulan data dilakukan menggunakan light trap, variasi warna cahaya yang digunakan yaitu (putih, biru, kuning, hijau, dan merah) dengan waktu pengambilan sampel pada pukul 20.00, 22.00, dan 00.00 WIB. Pengambilan data dilakukan 6 kali ulangan. Data dianalisis menggunakan (ANAVA) dengan rancangan acak kelompok (RAK), dilanjutkan dengan uji lanjut BNJ. Hasil penelitian menunjukkan terdapat 10 ordo, 20 famili, dan 23 genus. Distribusi temporal serangga nokturnal paling banyak yaitu pada pukul 20.00 WIB, sedangkan respon serangga tertingi pada perlakuan warna cahaya biru pada waktu pengambilan sampel 20.00, dengan komposisi serangga hama 10 genus, predator 7 genus, dan parasitoid 1 genus. Hama utama yang ditemukan yaitu genus Empoasca. Selanjutnya untuk hasil regresi multiparameter memiliki nilai signifikansi sebesar 0,033, dengan sumbangan faktor abiotik (kelembaban udara) terhadap jumlah individu tertinggi waktu pengambilan sampel pukul 20.00 WIB sebasar R2 = 0,720.

Pengaruh metode drill berbantuan video terhadap kemampuan bina diri siswa tunagrahita kelas 1 di SLB C Negeri Tulungagung / Rosiana Febri Jayanti

 

ABSTRAK Jayanti, Rosiana Febri. 2015. Pengaruh Metode Drill Berbantuan Video terhadap Kemampuan Bina Diri Siswa Tunagrahita Kelas 1 SLB C Negeri Tulungagung. Skripsi. Jurusan Pendidikan Luar Biasa. Fakultas Ilmu Pendidikan. Universitas Negeri Malang. Pembimbing (1) Drs. Ir. Endro Wahyuno, M. Si., (2) Drs. Abdul Huda, M. Pd. Kata kunci : Metode Drill Berbantuan Video, Bina Diri, Tunagrahita. Rendahnya tingkat kecerdasan serta keterlambatan kemampuan perilaku adaftif pada anak tunagrahitaberimplikasipada rendahnya kemampuan bina diri. Kemampuan bina diri adalah kemampuan anak tunagrahita dalam melakukan aktivitas merawat diri sendiriseperti makan, minum, berpakaian, dll. Siswa mengalami kesulitan karena guru hanya menggunakan metode ceramah tanpa adanya praktek dan tidak penggunakan media yang membantu pembelajaran, sedangkan anak tunagrahitatidak cukup mampu untuk mengembangkan kemampuannya. Pengembangan kemampuannya harus bersandar pada kebiasaan dan latihanrutin. Berdasarkan masalah tersebut diperlukan metode yang sesuai salah satunya metode drill. Metode drill merupakan merupakan langkah- langkah yang digunakan untuk melatih suatu keterampilan secara bertahap dan berulang. Selain iu diperlukan bantuan media video sebagai demonstrasi langkah- langkah bina diri. Tujuan penelitian ini adalah mendeskripsikan tentang: (1) kemampuan bina diri siswa tunagrahita kelas 1 saat fase baseline (A1)? kemampuan bina diri siswa tunagrahita saat fase intervensi (B)? pengaruh metode drill berbantuan video terhadap kemampuan bina diri siswa tunagrahita kelas 1? Metode penelitian yang digunakan dalam penelitian ini adalah eksperimen dengan desain Single Subject Research (SSR) menggunakan model A-B-A dan menggunakan pengukuran persentase. Subjek penelitian ini adalah siswa tunagrahita kelas 1 SLB C Negeri Tulungagung pada tahun pelajaran 2014/2015. Teknik pengumpulan data menggunakan teknik non tes yaitu obeservasi dalam bentuk task analysis. Analisis data yang digunakan adalah analisis visual data grafik pada analisis dalam kondisi dan analisis antar kondisi. Hasil penelitian menunjukkan kemampuan bina diri siswa tunagrahita fase baseline 1 (A1) masih rendah dengan rentang nilai 63,5%-68,7%, kemampuan bina diri siswa tunagrahita fase intervensi (B) cenderung lebih tinggi berkisar antara 83,3%-96,8%, sementara fase baseline 2 (A2) lebih rendah dari fase intervensi tetapi lebih tinggi dari fase baseline 2 yaitu 84,3%-88,5%. Metode drill berbantuan video memiliki pengaruh terhadap kemampuan bina diri siswa tunagrahita kelas 1 SLB C Negeri Tulungagung dibuktikan dengan persentase overlap sebesar 0%. Semakin kecil persentase overlap maka semakin baik pengaruh intervensi terhadap target behavior. Adapun saran bagi guru berdasarkan hasil penelitian ini adalah guru dapat menerapkan metode ini dengan menyesuaikan kebutuhan dan karakteristik siswa.  

Pengembangan buku panduan tata rias pantomim bergambar untuk meningkatkan kemampuan anak tunarungu di SMALB Eka Mandiri Batu / Tri Hardiyanti Intan P.

 

ABSTRAK Intan P., Tri Hardiyanti. 2015. PengembanganBukuPanduan Tata Rias PantomimBergambaruntukMeningkatkanKemandirianAnakTunarungu di SMALB EKA MANDIRI BATU. Skripsi, JurusanPendidikanLuarBiasa, FakultasIlmuPendidikan, UniversitasNegeri Malang.Pembimbing: (I) Drs. Ir. EndroWahyuno, M.Si (II) Pramono, S.Pd, M.Or Kata Kunci :bukupanduanbergambar, pantomim, kemandirian, tunarungu, SMALB Padapenggunaan media pembelajaranterhadappengembanganbukupanduantata rias pantomimbergambaruntukmeningkatkankemandiriananaktunarungudapatdijadikansalahsatualternatifpembelajaranyang menarikdanmenyenangkanuntukmemperolehpemahamanpesertadidikterhadappembelajaranketerampilantata rias pantomim, jenispembelajaran yang diberikanadalahjenisketerampilankerjapraktisdantidakharusterikatdenganlegalitas formal akademis, mudahdilakukandanberorientasikerja. Tujuandaripenelitianpengembanganpenelitianadalahuntukmenyusunpengembanganbukupanduantata rias pantomimbergambar. PengembanganBukuPanduan Tata Rias PantomimBergambarmerupakansalahsatu media yang berbentukbuku yang terdiridarilembaran art paper. Selainitudapatmembantupesertadidikuntukbelajarsecaramandirisehinggadapatmenemukanpengalaman-pengalaman yang memberikankesempatanuntukmembangunsendiripengetahuannya. PenelitiandanpengembanganainimenggunakanmetodepenelitiandanpengembanganatauResearch and Development (R & D)dari Borg dan Gall yang telahdimodifikasi. Sedangkanpendekatan yang digunakanyaitukuantitatifdankualitatif, dasarrancanganpengembanganuntukmenganalisishasildanujicobaproduk yang dilakukanmeliputi :pengumpulan data daripenelitianawal (analisiskebutuhan), evaluasiahli, danujicobakelompokkecil. Hasilvalidasi “pengembanganbukupanduantata rias pantomimbergambaruntukmeningkatkankemandiriananaktunarungu di SMALB EKA MANDIRI BATU” secaraumumdinyatakanlayakatauvalid untukdigunakansebagai mediapembelajaranketerampilantata rias dansesuaidenganharapanpadaperencanaanpngembangan media.Produkdiujicobakankepadaahli media, ahlimateri, ahlipraktisidansiswadenganspesifikasiproduk: menggunakanjenis art paper ukuran A4, berat kertas150gr dan 260gr, menggunakan 3 perpaduanwarnadasar :hitam, putih, abu-abu.

Penerapan strategi inkuiri sebagai upaya meningkatkan hasil belajar matematika siswa kelas X SMA Negeri 4 Parepare / Sriyanti Mustafa

 

Kata kunci : Strategi Inkuiri, Hasil Belajar Matematika Pembelajaran dengan strategi inkuiri menekankan kepada proses mencari dan menemukan. Proses belajar ini dapat membentuk dan mengembangkan konsep diri pada siswa, mengembangkan keterampilan intelektual, berpikir kritis dan memecahkan masalah. Strategi inkuiri merupakan rangkaian kegiatan pembelajaran yang menekankan pada proses berpikir kritis, dan analitis untuk mencari dan menemukan sendiri jawaban dari suatu masalah. Dalam pembelajaran matematika, strategi inkuiri memiliki 3 (tiga) karakteristik, yaitu (1) partisipasi,(2) investigasi, dan (3) konstruksi pengetahuan. Partisipasi menekankan siswa terlibat aktif dalam pembelajaran, siswa tidak sekadar pasif menerima, tetapi ikut berperan aktif dalam seluruh rangkaian kegiatan pembelajaran di kelas. Investigasi merupakan proses penyelidikan yang dilakukan siswa terhadap masalah matematika, mengumpulkan data (materi pendukung), dan mendiskusikan hasil yang diperoleh. Investigasi dapat dilakukan dengan cara yang berbeda-beda. Konstruksi pengetahuan merupakan kegiatan membuat konjektur, menganalisis masalah matematika, dan melakukan diskusi ide. Ketiga karakteristik inilah yang secara operasional dirumuskan dalam langkah-langkah strategi inkuiri yang dapat meningkatkan hasil belajar matematika siswa. Rumusan masalah dalam penelitian ini adalah bagaimanakah langkah-langkah strategi inkuiri yang dapat meningkatkan hasil belajar matematika siswa kelas X SMA Negeri 4 Parepare. Penelitian dilaksanakan dalam 2 (dua) siklus (Planning, Acting, Observing, Reflecting), dimana hasil belajar matematika siswa dikatakan meningkat apabila persentase aktivitas belajar siswa mengalami kemajuan dari satu Siklus ke Siklus selanjutnya, dan tes hasil belajar siswa sekurang-kurangnya 85% dari keseluruhan siswa mendapatkan skor ≥ 65. Sumber data diperoleh dari proses pembelajaran berupa aktivitas dan tes hasil belajar siswa kelas X1 SMA Negeri 4 Parepare semester ganjil tahun pelajaran 2009/2010. Untuk menggali informasi siswa tentang strategi inkuri yang diterapkan dalam pembelajaran matematika, maka dipilih 3 (tiga) orang siswa yang akan diwawancarai. Adapun perangkat pembelajaran yang digunakan berupa Rencana Pelaksanaan Pembelajaran (RPP), dan Lembar Kerja Siswa (LKS), sedangkan instrumen penunjang berupa lembar observasi aktivitas siswa dan guru, lembar tes dan lembar wawancara. Data yang dikumpulkan akan dianalisis dengan menggunakan teknik analisis kualitatif. Dari hasil penelitian, pada Siklus I persentase aktivitas belajar siswa berada pada kategori cukup yaitu 78,18%, dan persentase hasil tes belajar matematika siswa sebesar 45,71%, sedangkan pada Siklus II, hasil belajar matematika siswa mengalami peningkatan, yaitu persentase aktivitas siswa berada pada kategori baik yaitu 87,27%, dan persentase tes hasil belajar sebesar 94,27%. Jadi, aktivitas siswa mengalami peningkatan sebesar 9,09%, dan peningkatan tes hasil belajar sebesar 48,58%. Dengan demikian, diperoleh langkah-langkah strategi inkuiri yang dapat meningkatkan hasil belajar matematika siswa kelas X1 SMA Negeri 4 Parepare, yaitu: (1) orientasi, (2) merumuskan masalah, (3) mengumpulkan data (bahan/materi penunjang) , membaca dan memahami secara akurat, (4) Membuat konjektur, menganalisis dan menyajikan hasilnya, (5) diskusi/komunikasi ide(pengecekan ulang), dan (6) membuat kesimpulan (pelaporan hasil).

Pengaruh model pembelajaran Group Investigation (GI) terhadap minat belajar dan kemampuan berpikir kritis siswa kelas XI IPS SMA Negeri 1 Pacet pada pelajaran geografi / Adhyta Satya Widyananda

 

ABSTRAK Widyananda, Adhyta Satya. 2016. Pengaruh Model Pembelajaran Group Investigation (GI)Terhadap Minat Belajar danKemampuan Berpikir Kritis Siswa Kelas XI IPS SMANegeri 1 Pacetpada Pelajaran Geografi. Skripsi, Jurusan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. Hendri Purwito, M.Si. (II) Purwanto, S.Pd., M.Si. Kata Kunci: model pembelajaran group investigation(GI), minatbelajar, dan kemampuan berpikir kritis. Minat dan kemampuan berpikir kritis siswa sangat penting dalam proses pembelajaran. Minat dan kemampuan berpikir kritis siswa SMA Negeri 1 Pacet tergolong rendah, karenaketerlibatan siswa dalam proses pembelajaran sangat minim. Kondisi ini membuat siswa menjadi bosan atau siswa kurang tertarik dengan pembelajaran geografi, sehingga minat dan kemampuan berpikir kritis siswa tidak berkembang. Dipilihnya model pembelajaran Group investigation karena model ini merancang pola pembelajaran yang aktif dan melibatkan siswa dalam proses pembelajaran.yang dapat meningkatkan minat dan kemampuan berpikir kritis siswa. Penelitianini bertujuan untukmengetahui pengaruh model pemelajaran Group Investigation terhadap minat belajar dan kemampuan berpikir kritis siswa di SMA Negeri 1 Pacet. Rancangan penelitian ini adalah eksperimen semu dengan desain penelitian pretest-posttest karena perlakuan yang diberikan pada subjek penelitian tidak dapat dikendalikan sepenuhnya. Metode pengumpulan data menggunakan angket untuk mengukur minat belajar dan soal esai untuk mengukur kemampuan berpikir kritis. Data dianalisis menggunakan Independent Sample t-Test dengan bantuan program program SPSS 16.00 for Windows. Hasil penelitian ini menunjukkan adanya pengaruh dari model pembelajaran Group Investigation terhadap minat belajar dan kemampuan berpikir kritis siswa kelas XI IPS SMA Negeri 1 Pacet, dengan nilai rata-rata posttest angket sebesar 56,35 untuk kelas kontrol, dan 60,13 untuk kelas eksperimen. Nilai rata-rata posttest soal adalah 51 untuk kelas kontrol dan 56 untuk kelas eksperimen, Model pembelajaran Group Investigation memiliki kelebihan mendorong siswa untuk belajar lebih aktif dan lebih bermakna. Artinya siswa dituntut selalu berpikir tentang suatu persoalan dan mereka mencari sendiri secara penyelesaiannya, sehingga bisa lebih meningkatkan minat dan kemampuan berpikir kritis siswa. Saran untuk guru agar mendapatkan hasil yang maksimal adalah seharusnya guru waktu siswa terjun langsung di lapangan hendaknya memantau kegiatan siswa dengan sungguh-sungguh, supaya siswa bisa fokus sama apa yang akan di investigasi, jika siswa fokus dengan apa yang di investigasi maka akan tercapai pembelajaran Group Investigationdengan baik dan maksimal.

Pengembangan media pembelajaran berbasis kuis interaktif bertingkat untuk latihan membaca huruf Al-Quran siswa tunarungu kelas X SMALB YPTB Malang / Isna Walidah

 

ABSTRAK Walidah, Isna. 2015. Pengembangan Media Pembelajaran Berbasis Kuis Interaktif Bertingkat untuk Latihan Membaca Huruf Al-Qur’an Siswa Tunarungu Kelas X SMALB-B YPTB Malang. Skripsi, Program Studi Pendidikan Luar Biasa, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Mohammad Efendi, M.Pd., M.Kes., (II) Henry Praherdhiono, S.Si., M.Pd. Kata Kunci: Kuis Interaktif Bertingkat, Latihan Membaca Huruf Al-Qur’an, Tunarungu Pelajaran Agama Islam yang berkaitan erat dengan membaca ayat-ayat Al-Qur’an merupakan salah satu pelajaran wajib bagi semua siswa tunarungu yang memeluk Agama Islam di Indonesia. Siswa tunarungu yang tidak memiliki pengalaman dalam mendengarkan bunyi ayat-ayat Al-Qur’an mengalami hambatan dalam mengucapkan huruf-huruf Al-Qur’an. Hal tersebut menyebabkan pengajar kesulitan untuk mengetahui tingkat pemahaman siswa dalam membaca huruf Al-Qur’an. Berdasarkan hasil observasi yang dilakukan melalui angket dan pengamatan langsung kepada siswa kelas X SMALB-B YPTB Malang, diperoleh data sebagai berikut: (1) semua siswa belum pernah berlatih membaca huruf Al-Qur’an menggunakan media kuis interaktif, (2) sebanyak 100% siswa menyatakan membutuhkan media kuis yang menarik seperti kuis interaktif untuk berlatih membaca huruf Al-Qur’an, (3) sebanyak 100% siswa membutuhkan kuis interaktif yang menarik dengan jenis soal yang variatif. Penelitian dan pengembangan ini bertujuan untuk menghasilkan media pembelajaran berbasis kuis interaktif bertingkat untuk latihan membaca huruf Al-Qur’an siswa tunarungu kelas X SMALB-B YPTB Malang. Sedangkan Model pengembangan dalam penelitian ini mengacu pada model pengembangan Research and Development (R & D) dari Borg dan Gall. Subjek uji coba produk adalah ahli materi, ahli media, ahli praktisi, dan kelompok kecil yang terdiri dari 4 siswa SMALB-B YPTB Malang. Hasil pengembangan produk media pembelajaran berbasis kuis interaktif bertingkat untuk latihan membaca huruf Al-Qur’an siswa tunarungu kelas X SMALB-B YPTB Malang diperoleh data sebagai berikut: (1) validasi ahli materi 91,67 (sangat baik), (2) validasi ahli media 96,25% (sangat baik), dan (3) validasi ahli praktisi 65,6% (baik), (4) uji coba kelompok kecil 81,125% (sangat baik). Hasil pengembangan secara keseluruhan dapat disimpulkan bahwa produk kuis interaktif bertingkat latihan membaca huruf Al-Qur’an telah layak menjadi media pembelajaran untuk melatih daya ingat dan pemahaman siswa terhadap bacaan huruf Al-Qur’an. Berdasarkan hasil penelitian tersebut, maka saran yang diajukan adalah: (1) guru hendaknya memahami isi materi setiap tahap dalam kuis interaktif bertingkat dan melakukan pendampingan secara individual terhadap siswa yang mengalami kesulitan, (2) peneliti selanjutnya mengembangkan kuis interaktif dengan memperbanyak keragaman populasi dan keragaman penelitian.

Pengembangan media pembelajaran interaktif pada matapelajaran pengukuran listrik untuk siswa kelas X SMK / Candra Putra Mahardika

 

ABSTRAK Putra Mahardika, Candra. 2016. Pengembangan Media Pembelajaran Interaktif Pada Matapelajaran Pengukuran Listrik Untuk Siswa Kelas X SMK. Skripsi Jurusan Teknik Elektro Program Studi Pendidikan Teknik Elektro Universitas Negeri Malang. Pembimbing: (I) Dr. Ir. H. Syaad Patmanthara, M.Pd (II) I Made Wirawan, S.T., S.S.T., M.T. Kata kunci: Pengembangan, Media Pembelajaran, Interaktif, Pengkuran Listrik Permasalahan pembelajaran yang terjadi di SMK PGRI 3 Malang adalah kurang minatnya siswa dalam mengikuti pembelajaran Pengukuran Listrik, karena guru dalam proses pembelajaran masih menggunakan media yang berupa buku dan slide point. Dari permasalahan tersebut, dilakukan sebuah penelitian pengembangan media pembelajaran interaktif Pengukuran Listrik. Hasil produk dari media pembelajaran ini berupa kaset CD (Compact Disk). Tujuan dari produk ini adalah: (1) Untuk membuat media pembelajaran interaktif Pengukuran listrik untuk SMK; (2) Mengembangkan media pembelajaran interaktif pengukuran listrik untuk SMK belajar; (3) Pengujian kelayakan media pembelajaran interaktif pada mata pelajaran pengukuran listrik untuk SMK. Model penelitian yang digunakan dalam pengembangan media pembelajaran ini adalah model ADDIE yang terdiri dari 5 langkah, yaitu (1) Analyz; (2) Design; (3) Develop, (4) Implementation, (5) Evaluation. Hasil akhir dari penelitan pengembangan ini adalah media pembelajaran Instalasi Lisrik Dasar berbentuk Adobe flash CS3, yang dikemas dalam bentuk CD (Compact Disk). Hasil dari penelitian ini adalah Media Pembelajaran Interaktif pada mata peajaran Pengukuran listrik yang berbentuk kaset CD (Compact Disk). Validasi dilakukan oleh beberapa ahli, (1) Validasi oleh ahli media mencapai 87.85%; (2) Validasi oleh ahli materi mencapai 93,51% ; (3) Hasil uji coba siswa mecapai 86.44%. Berdasarkan hasil validasi dan uji coba yang telah dilakukan, dapat disimpulkan bahwa media pembelajaran Interaktif Pengukuran Listrik dinyatakan layak digunakan untuk kegiatan pembelajaran di SMK PGRI 3 Malang, khususnya pada mata pelajaran Pengukuran Listrik.

Pengaruh pemanfaatan smartphone, kecerdasan intelektual (IQ), dan kecerdasan emosional (EQ) terhadap hasil belajar mata pelajaran ekonomi kelas X IPS 2 di SMA Laboratorium Universitas Negeri Malang tahun ajaran 2014/2015 / Eliza Silviana Miftakh

 

ABSTRAK Miftakh, Eliza Silviana. 2015. Pengaruh pemanfaatan smartphone, kecerdasan intelektual ( IQ ), dan kecerdasan emosional ( EQ ) terhadap hasil belajar siswa kelas X IPS 2 mata Pelajaran Ekonomi SMA Laboratorium UM. Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing ( I ) Drs. PrihHardinto, M.Si.,( II ) Dr. HadiSumarsono, S.T., M.Si. Kata kunci : Pemanfaatan smartphone, kecerdasan intelektual ( IQ ), kecerdasan emosional ( EQ ), hasil belajar. Teknologi merupakan suatu alat yang digunakan untuk memudahkan pekerjaan manusia, salah satunya teknologi yang sekarang ini menjadi tren dimasyarakat yaitu smartphone. Smartphone memberikan fasilitas dapat mengakses berbagai informasi dengan mudah, efektif dan efisien. Dalam dunia pendidikan alat ini dapat digunakan untuk menunjang pembelajaran siswa, selain dari kemampuan dari diri siswa itu sendiri berupa IQ dan EQ. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh antara variabel terikat dan variabel bebas secara simultan maupun parsial. Dengan mengambil subjek penelitian kelas X IPS 2 di SMA Laboratorium UM. Metode penelitian ini menggunakan pendekatan korelasi yang bersifat deskriptif kuantitatif, dan menggunakan analisis regresi berganda, uji t, uji F, serta mengunakan aplikasi spss for windows versi 16.0. Hasil dari analisis regresi berganda yaitu diperoleh bahwa distribusi data bersifat normal, dan berhubungan signifikan, yaitu : ( 1 ) terdapat pengaruh yang sigifikan antara pemanfaatan smartphone terhadap hasil belajar sebesar 22,4 %, ( 2 ) terdapat pengaruh yang signifikan antara kecerdasan intelektual ( IQ ) terhadap hasil belajar sebesar 25,0% . ( 3 ) terdapat pengaruh yang signifikan terhadap kecerdasan emsional ( EQ ) sebesar 21, 9%. Dari ketiga variabel yaitu smartphone, kecerdasan intelektual ( IQ ), dan kecerdasan emosional ( EQ ) mempunyai sumbangan efektif sebesar 69,3 % terhadap variabel hasil belajar.

Pengembangan media pembelajaran peta konsep pada mata kuliah Rekayasa Perangkat Lunak S1 Pendidikan Teknik Informatika Jurusan Teknik Elektro Universitas Negeri Malang / Siti Musyafaatin Mahardika

 

ABSTRAK Mahardika, SitiMusyafaatin. 2016. Pengembangan Media Pembelajaran Peta Konsep pada Mata Kuliah Rekayasa Perangkat LunakS1 Pendidikan Teknik InformatikaJurusan Teknik Elektro Universitas Negeri Malang. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs. Puger Honggowiyono, M.T., (2) Utomo Pujianto, S.Kom., M.Kom. Kata kunci :pengembangan, media pembelajaran, rekayasa perangkat lunak, peta konsep Salah satu matakuliah wajib pada Program Studi Pendidikan Teknik Informatika, Universitas Negeri Malang adalah Rekayasa Perangkat Lunak yang mempelajari pengelolaan dari sebuah software. Namun sekitar 86% mahasiswa menyatakan bahwa media dalam perkuliahan kurang memaparkan konsep-konsep dalam Rekayasa Perangkat Lunak,sehinggamembuat nilai evaluasi mahasiswa pun tidak memuaskan. Dari permasalahan tersebut maka dilakukan penelitian yang bertujuan untuk: (1)mengembangkan media pembelajaran peta konsep pada mata kuliah Rekayasa Perangkat Lunak yang layak berdasarkan standar dan kriteria yang telah ditetapkan dan telah dinilai oleh ahli media dan ahli materi, (2) mendapatkan media yang efektif digunakan dalam proses pembelajaran. Model penelitian dan pengembangan yang digunakan adalah model Pustekkom Depdiknas. Tahapan-tahapan dalam model tersebutmeliputi: (1) Bedah Kurikulum, (2) Identifikasi Media, (3) Pengembangan Naskah, (4) Produksi, (5) Penyempurnaan, (6) Test/Uji Coba, dan (7) Revisi. Proses penyempurnaan melibatkan tim ahli yang terdiri dari ahli materi dan ahli media. Proses Test/Uji Coba dilakukan pada mahasiswa Pendidikan Teknik Informatika angkatan 2013 sejumlah tujuh orang dan angkatan 2014 sejumlah 22 orang. Berdasarkan hasil analaisis data, validasi oleh ahli materi mendapatkan nilai sebesar 84%, validasi oleh ahli media mendapatkan nilai sebesar 92%, kedua validasi ini dinyatakan sangat valid. Hasil ujicoba kelompok kecil sebesar 84%, dan hasil ujicoba kelompok besar sebesar 86%. Dari data tersebut dapat disimpulkan bahwa media pembelajaran berupa media peta konsep berbasis website untuk matakuliah Rekayasa Perangkat Lunak di Jurusan Teknik Elektro Universitas Negeri Malang telah dinyatakan layak sehingga telah tersedia media yang efektif digunakan dalam pembelajaran Rekayasa Perangkat Lunak baik untuk pembelajaran di kelas maupun pembelajaran mandiri.

Pengaruh penggunaan dan kemudahan fasilitas e-filing terhadap tingkat kepuasan wajib pajak orang pribadi dalam pelaporan SPT secara online pada Kantor Pelayanan Pajak Pratama Batu / Sheyla Ken Nesya

 

ABSTRAK Nesya, Sheyla Ken. 2016. Pengaruh Penggunaan dan Kemudahan Fasilitas E-filing terhadap Tingkat Kepuasan Wajib Pajak Orang Pribadi dalam Pelaporan SPT Secara Online pada KPP Pratama Batu. Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Dr. H. Cipto Wardoyo, SE., M.Pd., M.Si., Ak., CA. (II) Dr. H. Tuhardjo, SE., M.Si., Ak Kata kunci: penggunaan dan kemudahan, e-filing, tingkat kepuasan wajib pajak orang pribadi Penelitian ini bertujuan untuk mengetahui pengaruh besarnya penggunaan dan kemudahan fasilitas e-filing yang terdiri dari penggunaan dan kemudahan terhadap tingkat kepuasan Wajib Pajak Orang Pribadi dalam pelaporan SPT secara Online pada Kantor Pelayanan Pajak Pratama Batu. Penelitian ini menggunakan grand theory Technology Acceptance Model (TAM) yang menjelaskan perilaku menggunakan Teknologi Informasi (TI) diawali oleh adanya persepsi mengenai manfaat (usefulness) dan persepsi mengenai kemudahan menggunakan TI (ease of use). Penelitian ini menggunakan kuisioner sebagai alat penelitian yang disebar kepada Wajib Pajak Orang Pribadi yang terdaftar di KPP Pratama Batu. Teknik sampling yang digunakan adalah nonprobability sampling dengan menggunakan metode incidental sampling. Populasi dalam penelitian ini adalah seluruh Wajib Pajak Orang Pribadi yang terdaftar di Kantor Pelayanan Pajak Pratama Batu yang menggunakan fasilitas e-filing sebanyak 21.374 (dua puluh satu ribu tiga ratus tujuh puluh empat) Wajib Pajak Orang Pribadi. Sampel yang digunakan adalah 100 Wajib Pajak Orang Pribadi. Instrumen yang digunakan telah memenuhi uji validitas dan uji reliabilitas. Teknik analisis data yang digunakan adalah teknik analisis regresi linier sederhana. Berdasarkan hasil pengujian hipotesis diketahui bahwa penggunaan fasilitas e-filing berpengaruh positif terhadap tingkat kepuasan Wajib Pajak Orang Pribadi sebesar 32,30%. Selanjutnya untuk kemudahan penggunaan fasilitas e-filing berpengaruh positif terhadap tingkat kepuasan Wajib Pajak Orang Pribadi sebesar 29,20%. Saran untuk KPP Pratama Batu adalah (1) Pelaksanaan pelaporan SPT secara online melalui fasilitas e-filing perlu dijaga dan ditingkatkan, (2) Agar memberikan surat himbauan kepada Wajib Pajak untuk dapat melaporkan SPT Tahunannya secara online menggunakan fasilitas e-filing, (3) Membuat suatu sistem yang memungkinkan pengguna / Wajib Pajak mendapatkan e-FIN secara online. Saran untuk peneliti selanjutnya adalah (1) diharapkan dapat meningkatkan nilai koefisien determinasi dengan meneliti variabel lain yang berpengaruh terhadap kepuasan wajib pajak orang pribadi, (2) agar dilengkapi dengan teknik pengumpulan data melalui instrumen penelitian wawancara sehingga hasil yang diberikan dapat lebih akurat.

Pengaruh dimensi kualitas layanan terhadap loyalitas pelanggan (studi pada cafe Ria Djenaka Malang) / Khoirul Huda

 

ABSTRAK Huda, Khoirul. 2014. Pengaruh Dimensi Kualitas Layanan terhadap Loyalitas Pelanggan (Studi Pada Cafe Rya Jenaka Malang). Skripsi, Jurusan Manajemen Program Studi Manajemen Pemasaran Fakultas Ekonomi Universitas Negeri Malang. Pembimbing : (I) Prof. Dr. Heri Praktikto, M.Si. (II) Dr. Titis Shinta Dhewi S.P, M.M. Kata Kunci : Kualitas Layanan, Loyalitas Pelanggan. Tujuan penelitian ini adalah untuk mengetahui presepsi pelanggan terhadap variabel kualitas layanan Cafe Rya Jenaka Malang, untuk mengetahui pengaruh signifikan kualitas layanan (kualitas interaksi, kualitas lingkunagan fisik dan kualitas hasil) terhadap loyalitas pelanggan Cafe Rya Jenaka Malang baik itu secara parsial maupun simultan, serta untuk mengetahui presepsi pelanggan tentang dimensi kualitas layanan (kualitas interaksi, kualitas lingkungan fisik, dan kualitas hasil) yang mempunyai pengaruh paling dominan terhadap loyalitas pelanggan Cafe Rya Jenaka Malang. Penelitian ini memakai Brady & Cronin (2011) yang telah dikembangkan dari Rust & Oliver (1994) dimana tempat dilakukan penelitiannya juga pada perusahaan jasa pengiriman barang. Teori ini membagi kualitas menjadi tiga dimensi yaitu kualitas interaksi, kualitas lingkungan fisik dan kualitas hasil. Jenis penelitian ini adalah penelitian kuantitatif dan deskriptif korelasional. Populasi dalam penelitian ini adalah pelanggan Cafe Rya Jenaka Malang yang berkunjung lebih dari dua kali. Teknik sampling menggunakan teknik aksidental sampling dan penentuan sampel memakai rumus Slovin sehingga didapatkan sampel sejumlah 270 responden. Sedangkan teknik analisis data menggunakan teknis analisis regresi berganda. Hasil penelitian ini adalah sebagai berikut: (1) Kualitas interaksi berpengaruh positif dan signifikan terhadap loyalitsa pelanggan (2) Kualitas lingkungan fisik berpengaruh positif dan signifikan terhadap loyalitsa pelanggan (3) Kualitas hasili berpengaruh positif dan signifikan terhadap loyalitsa pelanggan (4) terdapat pengaruh positif dan signifikan kualitas layanan secara simultan terhadap loyalitas pelanggan. Saran yang diberikan pada penelitian ini adalah (1) Konsumen. pelanggan hendaknya selektif dalam memilih jenis produk di Cafe Rya Jenaka Malang, sehingga seorang pelanggan tidak hanya memburu keuntungan semata tetapi juga harus memperhatikan kualitas produk yang diharapakan.(2) Cafe Rya Jenaka Malang, diharapkan untuk memperhatikan kualitas interaksi, kualitas lingkungan fisik dan kualitas hasil para pelanggan untuk tetap loyal pada Cafe Rya Jenaka Malang; (3) Peneliti Selanjutnya diharapkan untuk menggunakan variabel bebas diluar variabel kualitas interaksi, kualitas lingkungan fisik dan kualitas hasil, seperti keragaman produk, daya tahan atau ketahanan, dan lainnya yang berhubungan dengan loyalitas pelanggan Cafe Rya Jenaka Malang. Sebaiknya peneliti harus mampu mengidentifikasi apakah responden adalah benar-benar pelanggan loyal Cafe Rya Jenaka.

Pengaruh tingkat kecakapan sosial dan pengetahuan pedagogik pada minat menjadi guru di S1 Pendidikan Teknik Informatika Jurusan Teknik Elektro Universitas Negeri Malang / Fawzul Sinatrya Pramaja

 

ABSTRAK Pramaja, Fawzul Sinatrya. 2016. Pengaruh Tingkat Kecakapan Sosial dan Pengetahuan Pedagogik pada Minat Menjadi Guru di S1 Pendidikan Teknik Informatika Jurusan Teknik Elektro Universitas Negeri Malang. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs. Setiadi., M.Pd., M.T., (2) Dr. Eng. Siti Sendari, S.T., M.T. Kata Kunci: kecakapan sosial, pengetahuan pedagogik, minat menjadi guru Program Studi Pendidikan Teknik Informatika Jurusan Teknik Elektro Universitas Negeri Malang setiap tahunnya meluluskan calon guru TIK khususnya untuk jenjang SMK yang jumlahnya terus meningkat setiap tahunnya. Namun, kenyataannya pada saat ini masih ada beberapa daerah di Indonesia yang masih kekurangan guru TIK di jenjang SMK. Hal ini dikarenakan minat dari mahasiswa terhadap profesi guru berubah-ubah dari waktu disebabkan oleh beberapa faktor. Salah satunya adalah kecakapan sosial dan pengetahuan pedagogik yang dimiliki mahasiswa. Tujuan dari penelitian ini untuk mengungkap hubungan antara (1) kecakapan sosial (X1) dengan minat mahasiswa untuk menjadi guru; (2) pengetahuan pedagogik (X2) dengan minat mahasiswa untuk menjadi guru; dan (3) kecakapan sosial (X1) dan pengetahuan pedagogik (X2) dengan minat mahasiswa untuk menjadi guru (Y). Rancangan penelitian ini adalah penelitian korelasional. Penelitian dilakukan pada mahasiswa S1 PTI 2013 yang telah menempuh matakuliah keilmuan dan keterampilan kependidikan. Sampel penelitian sebanyak 133 mahasiswa dengan total populasi sebanyak 198 mahasiswa. Pengumpulan data variabel (X1) dan (Y) menggunakan angket tertutup dan variabel (X2) menggunakan dokumentasi. Uji prasyarat analisis telah terpenuhi. Untuk mengungkap hubungan (X1) dengan (Y) dan (X2) dengan (Y) menggunakan analisis korelasi parsial. Sedangkan untuk mengungkap hubungan (X1) dan (X2) secara simultan dengan (Y) menggunakan analisis regresi linier ganda. Hasil penelitian ini menunjukkan bahwa: (1) terdapat hubungan positif dan signifikan antara (X1) dengan (Y), dengan koefisien korelasi sebesar 0,586; (2) terdapat hubungan positif dan signifikan antara (X2) dengan (Y), dengan koefisien korelasi sebesar 0,396; dan (3) terdapat hubungan positif dan signifikan secara simultan antara (X1) dan (X2) dengan (Y), dengan koefisien korelasi sebesar 0,730. Sumbangan relatif (X1) dengan (Y) sebesar 67,59% dan sumbangan relatif (X2) dengan (Y) sebesar 32,41%. Sedangkan, sumbangan efektif (X1) dengan (Y) sebesar 36,03% dan sumbangan efektif (X2) dengan (Y) sebesar 17,27%. Kesimpulan dari penelitian ini adalah: (1) ada hubungan positif dan signifikan antara (X1) dengan (Y); (2) ada hubungan positif dan signifikan antara (X2) dengan (Y); dan (3) ada hubungan yang positif dan signifikan antara (X1) dan (X2) secara simultan dengan (Y).

Pengembangan media edutainment matematika ceria untuk anak usia dini / Wimyasari Fistia Wisdawati

 

Peran kepala madrasah sebagai inovator dan supervisor dalam implementasi kurikulum 2013 (studi multikasus pada MTsN Lawang, MTsN Turen, dan MTs NU Pakis) / Mohammad As'adul Anam

 

ABSTRAK Anam, Mohammad As'adul. 2016. Peran Kepala Madrasah sebagai Inovator dan Supervisor dalam Implementasi Kurikulum 2013 (Studi Multikasus pada MTs Negeri Lawang, MTs Negeri Turen, dan MTs NU Pakis). Disertasi, Program Studi Manajemen Pendidikan, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Ahmad Sonhadji K.H., M.A., Ph.D.; (II) Prof. Dr. Bambang Budi Wiyono, M.Pd.; dan (III) Prof. Dr. H. Ali Imron, M.Pd., M.M. Kata kunci : peran kepala madrasah, implementasi kurikulum, inovator, supervisor Perubahan dalam setiap aspek kehidupan tidak lepas dari berbagai hal yang berkaitan dengan perkembangan ilmu pengetahuan dan teknologi, seni dan budaya, dan pengaruh global. Perubahan ini menuntut adanya perbaikan sistem pendidikan yang didalamnya termasuk upaya perbaikan kurikulum. Perbaikan kurikulum dari Kurikulum 2006 menjadi Kurikulum 2016 dilakukan untuk memperbaiki kualitas pendidikan di Indonesia sehingga generasi bangsa Indonesia akan dapat bersaing dengan bangsa-bangsa lain, mampu beradaptasi tanpa kehilangan jati diri, produktif, dan kompetitif. Di kabupaten Malang ada enam madrasah yang ditunjuk sebagai pelaksana implementasi Kurikulum 2013. Dari keenam madrasah tersebut, ada tiga madrasah yang dinilai paling berhasil dan meraih banyak prestasi, yaitu MTs Negeri Lawang, MTs Negeri Turen, dan MTs NU Pakis. Oleh sebab itu, peneliti tertarik melaksanakan studi multikasus untuk mendeskripsikan peran kepala madrasah sebagai inovator dan supervisor, faktor-faktor pendukung, dan kendala-kendala dalam implementasi Kurikulum 2013 di tiga madrasah tersebut. Penelitian ini memiliki empat tujuan. Pertama, mendeskripsikan peran kepala madrasah sebagai inovator dalam implementasi kurikulum 2013. Kedua, mendeskripsikan peran kepala madrasah sebagai supervisor dalam implementasi kurikulum 2013. Ketiga, mendeskripsikan faktor-faktor pendukung keberhasilan implementasi kurikulum 2013. Keempat, mendeskripsikan kendala-kendala dalam upaya implementasi kurikulum 2013. Dalam penelitian ini digunakan pendekatan kualitatif karena peneliti perlu melakukan pengamatan yang mendalam dalam situasi yang wajar atau alamiah. Rancangan penelitian ini adalah studi multikasus dengan metode komparatif konstan (the constant comparative methode). Dalam rancangan ini peneliti hadir sebagai instrumen kunci sekaligus sebagai pengumpul data. Pengumpulan data dilakukan dengan teknik observasi, wawancara, dan dokumentasi. Sementara itu, analisis data dilakukan dengan teknik analisis Miles dan Huberman. Berdasarkan pembahasan hasil penelitian, dapat dibuat kesimpulan sesuai fokus penelitian, yaitu (1) peran kepala madrasah sebagai inovator; (2) peran kepala madrasah sebagai supervisor; (3) faktor pendukung implementasi; dan (4) kendala implementasi kurikulum. Pertama, peran kepala madrasah sebagai inovator dalam implementasi kurikulum yang baru akan berhasil apabila kepala madrasah (1) mengembangkan kekhasan madrasah yang sesuai visi dan misi, yang sesuai isi kurikulum, dan yang dapat memberikan pembiasaan karakter positif pada siswa; (2) mengadakan sarana kerja yang sebelumnya tidak ada dan yang sesuai dengan kebutuhan guru dan karyawan madrasah; (3) membekali para guru dengan pengetahuan dan keterampian yang memadai terkait kurikulum baru dengan berbagai cara kreatif sehingga inovasi pembelajaran dapat terwujud; (4) membekali para guru dengan pengetahuan dan keterampilan yang memadai tentang pembelajaran berbasis ICT sehingga para guru dapat memanfaatkan ICT untuk mengembangkan inovasi pembelajaran; (5) memberikan petunjuk-petunjuk pada guru untuk menyusun rencana pembelajaran yang inovatif dan kreatif; (6) mengembangkan sistem pembelajaran tertentu yang kreatif, efektif, bersifat baru, dan dapat mendukung keberhasilan implementasi kurikulum; dan (7) menciptakan lingkungan dan suasana madrasah yang sesuai karakteristik dan kekhasan madrasah sehingga terbentuk lingkungan yang aman, nyaman, kondusif, dan khas bagi proses pembelajaran di madrasah. Kedua, peran kepala madrasah sebagai supervisor dalam implementasi kurikulum yang baru akan berhasil apabila kepala madrasah (1) melakukan pendekatan interpersonal secara kreatif dan efektif agar kegiatan supervisi dapat mendorong kemajuan para guru; (2) menyosialisasikan program secara efektif kepada seluruh pihak yang terkait dan terlibat agar kegiatan supervisi dapat diterima dengan penuh konsekuensi; (3) menciptakan hubungan kerja antarelemen madrasah (kepala, guru, dan karyawan) yang harmonis dan penuh kebersamaan agar setiap elemen memiliki kesediaan menanggapi kegiatan supervisi secara p ositif; (4) menunjukkan sikap dan perilaku yang pantas diteladani oleh seluruh warga madrasah agar kegiatan supervisi yang dilakukan oleh kepala madrasah mendapat tanggapan positif dari warga madrasah; (5) melaksanakan peningkatan mutu guru dan karyawan secara kreatif dan efektif agar tindak lanjut dari kegiatan supervisi dapat diselesaikan dengan baik oleh para guru; (6) menjalankan kegiatan supervisi dengan sungguh-sungguh secara rutin dan berkelanjutan agar kualitas pembelajaran benar-benar terkontrol; (7) memberikan penghargaan kepada para guru yang berhasil menindaklanjuti hasil supervisi dengan baik sesuai kriteria agar para guru termotivasi untuk menindaklanjuti setiap hasil supervisi secara sungguh-sungguh; dan (8) mengupayakan peningkatan kesejahteraan bagi para guru terkait dengan perbaikan yang dilakukannya sesuai hasil supervisi agar para guru semakin termotivasi untuk memberikan tanggapan positif terhadap kegiatan supervisi. Ketiga, peran kepala madrasah sebagai inovator dan supervisor dapat berhasil dalam implementasi kurikulum yang baru apabila faktor pendukungnya diperhatikan, yaitu (1) personel madrasah yang meliputi kepala, wakil, guru, dan karyawan memiliki tekad dan semangat yang kuat untuk belajar khususnya mempelajari hal-hal yang terkait dengan implementasi kurikulum yang baru; (2) sarana dan prasarana yang dimiliki madrasah sudah relatif lengkap dengan jumlah dan kapasitas yang memadai, serta dengan kondisi yang layak pakai; dan (3) kondisi keuangan madrasah relatif kuat dan cukup untuk membiayai kebutuhan operasional madrasah, kesejahteraan personel madrasah, serta pengadaan sarana dan prasarana yang dibutuhkan. Keempat, ada tiga kendala besar yang biasa dihadapi oleh kepala madrasah sebagai inovator dan supervisor dalam upaya implementasi kurikulum yang baru, yaitu (1) personel madrasah (kepala, wakil, guru-guru, dan karyawan) belum memiliki kesiapan pengetahuan, keterampilan, dan pengalaman tentang kurikulum yang baru itu; (2) sarana dan prasarana yang dimiliki madrasah kurang memenuhi standar, seperti kualitas dan kapasitas laboratorium yang kurang memadai, distribusi buku siswa yang terlambat, atau jaringan internet yang kurang memadai dengan luas area madrasah; dan (3) ketersediaan dana madrasah kurang cukup untuk kebutuhan operasional serta pengadaan sarana dan prasarana madrasah, seperti karena partisipasi wali murid yang tidak maksimal, dana komite yang tidak bisa dipastikan tiap bulan, atau pencairan dana BOS yang sering terlambat. Berdasarkan simpulan penelitian, peneliti menyampaikan beberapa saran kepada (1) ketiga kepala madrasah yang menjadi subjek penelitian supaya tetap mempunyai komitmen untuk selalu berinovasi; (2) kepala madrasah yang lain supaya dalam mengembangkan kurikulum selalu mempertimbangkan karakteristik individu madrasah; dan (3) Kementerian Agama supaya memberikan perhatian, pemikiran, dan pembinaan dengan mengoptimalkan kinerja pengawas madrasah dalam upaya meningkatkan kualitas kepala madrasah, kualitas pembelajaran yang dilakukan oleh guru, serta kualitas tenaga kependidikan yang lain dalam upaya mengelola administrasi dan sarana pendukung pembelajaran di madrasah.

Karakterisasi berbagai jenis fly ash sebagai bahan acuan untuk pembuatan beton geopolimer bermutu tinggi / Dessy Kartika Sari

 

ABSTRAK DessyKartika, Sari. 2016. KarakterisasiBerbagaiJenis Fly Ash sebagaiBahanAcuanuntukPembuatanBetonGeopolimerBermutuTinggi. Skripsi. JurusanTeknikSipil, FakultasTeknikUniversitasNegeri Malang. Pembimbing: (I) PuputRisdanareni, S.T., M.T. (II) Drs.BoedyaDjatmiko. S.T., M.T. Kata kunci:Sifatkimia, Sifatfisik, Sifatmekanik, binder geopolimer. Betongeopolimeradalahbeton yang material penyusunnyabukan semen. Semen adalah material utamapenyusunbetonkonvensional yang berfungsisebagaibahanpengikatsehinggabetondapatmengeras. Proses produksi semen merupakanpenyumbangpolutancukupbesardalampencemaranlingkungan, karenamenghasilkan gas emisi CO2..Olehkarenaituperludigantidenganbahan yang lebihramahlingkunganyaitufly ash.Permasalahan yang inginditelitiyaitupengkarakterisasianfly ash yang digunakanuntukmengetahuikarakterdarimasing-masingfly ash.berdasarkansifatkimiayaituXRF (X-Ray Fluorences)dan XRD (X-Ray Difraction), sifatfisikyaituberatjenis, warnadanporositasyang berpengaruhterhadapkuattekan binder. Fly ash yang dikarakterisasiberasaldariempattempat yang berbeda, yaitufly ash PLTU Jeranjang (FA4), fly ash PLTU Paiton (FA3) , fly ash PT Petrokimia Gresik (FA2), danfly ash yang dijual di Pasaran (FA1). Benda uji yang digunakandalampenelitianiniberjumlah100sampeldengandimensi 2cm x 4cm. Alkali Activator digunakandalampembuatanbinder geopolimersebagaibahanpengikat. Alkali activator dihasilkandaripencampuranantaraNaOH (Sodium Hidroksida) dan Na2SiO3 (Sodium Silikat), kadar yang digunakanadalah 10M NaOHdenganperbandinganNa2SiO3 :NaOH = 2 : 1. Prosentasefly ashdanaktivator yang dipakaiadalah 75% dan 25%. Akan tetapipadafly ashJeranjangmemakaiprosentase 55% fly ash dan 45% activator. Hasilpengujiansifatkimiadidapatbahwapengklasifikasiankelasfly ashberdasarkan ASTM C163 didapatFA1 dan FA3termasukdalamkelas F, sedangkan FA2 dan FA4termasukdalamkelas C.Pengujiansifatfisikdidapatbahwaberatjenistidakberpengaruhterhadapkuattekanbinder, beratjenis FA1 senilai 2,15gr/cm3, FA2 2,47gr/cm3, FA3 2,43gr/cm3, FA4 1,93gr/cm3. Porositastertutup yang terjadiberbandinglurusdengannilaikuattekan binder. Pengujianwarnatidakmempengaruhinilaidarikuattekan .Sedangkankadar Fe dankadarCa yang terkandungmempengaruhiwarnapadafly ash.Kuattekanbinder FA1 dengannilai 48.45 MPa, FA2dengannilai 45.39 MPa, FA3dengannilai 38.58MPa, danFA4dengan nilai 20.18 MPa. Didapatbahwanilaikuattekantertinggiadalahfly ashdariPasaran (FA1).

Penerapan model belajar projek untuk meningkatkan pemahaman siswa tentang kegiatan ekonomi kelas IV SDN Klodan IV Nganjuk / Agus Hariyanto

 

Keywords: contextual teaching, project-based learning approach, understanding of economic activity. Understanding of economic activity for social subject by grade IV pupils of SDN Klodan IV still pertained to lower. Low understanding of the pupils because process of social study applied in SDN Klodan IV still in conventional, that is giving concept, giving examples and also practics problems These are causing pupil tend to memorize the concept and work by procedural. Therefore require to be created a condition of study able to assist the pupil to find by themself the way of finishing problem faced by the pupil of pursuant to experience and reality had. One of approach in social study strarting study by performing project matching with experience and mount the pupil knowledge is study contextual based on project approach. This research aim to get: (1)Model device learn project to increase the understanding of student about economic activity. (2) Steps of study model device learn project in crease of understanding students about economic activity at grade IV of SDN Klodan IV.(3) Description of learning grade IV pupil result of SDN Klodan IV at economic activity discussion through the study project model. To reach the the target, hence researcher design a classroom action research of action executed of grade IV pupils SDN Klodan IV, Nganjuk Regency. Research data obtained from early test result, activity perception learn the pupil and activity teach the teacher result, final test pupil, and interview with the pupil result. Of this research in the form of cycle step consisted of four phase, that is: planning, action, observation, and reflection. This research is executed in 3 (three) cycle. Research finding got at cycle I indicate that in the early study, pupils cannot work in the group to finish their project and difficult to question about product activity, consumption activity and product activity. In cycle II, focus to comprehension improve of study about activity of production, distribution and consumption, pupils can cooperation to finish their project but difficult to question about product activity . Cycle III focus to comprehension improve product activity cooperate between pupils can finish their project. Model device learn project in this research, (1) preparation, (2) determining topic, (3) plan activity, (4) investigation and presentation, (5) making report, (6) Evaluation. Model learn project in this research is started by grouping pupils, amount of group member is 4-5 pupils, second focus in project by preparing the source of information about economic activity in industry and market of tempe, third, pupils work in group to finish project, fourth, group report result of job/activity, this product is map conception about economic activity and process of tempe, last, student publicize result of its team-work. Pursuant to research result of cycle I, cycle II, and cycle III of learning economic activity items pupils by using learn project model, show the existence of the make-up of average value from cycle I to cycle hereinafter, (a) Percentage of pupils test increase, that is from 71, becoming 75,75 and becoming 80,25, (b) Percentage of activity efficacy teach the teacher are increase, that is from 72,5%, becoming 76,2%, and becoming 81,6%, (c) Average value of pupil activity increase, that is from 74%, becoming 81%, and becoming 86,6%. Pupil show the good respond. Such us: (a) Pupil become more enthusiastic or spirit to following study activity, (b) By conducting activity matching with their experience everyday, study process become more interesting, (c) Learntly team can be happened the worthwhile discussion activity, happened the social interaction, interaction think between pupil, among pupil with the teacher, happened the good cooperation between group member in finishing duties given in spread sheet pupil, Although study execution with project model have been executed good enoughly, there are some constraint faced, for example: (a), Management of time in study is diffcult to conducted so that have planned better. (b) Pupils are accustomed with the discussion activity yet and learn the group cause the discussion activity effectiveless. (c) Accustoming student not to fear to report result of its group discussion. Based of this research result, suggested the followings (1) Instruction of social study in elementary school teacher better don't only fetching up all standing in class but also can be outside class with visit project. (2) Design of project model for social study, because using project model can to help pupils entangle all nerve, and physical which including efficiency of social. (3) Instruction of social study about live in pupils around using project model, because project can help represent medium to development of brain by together. (4) Teacher in instruction project model don’t to get much of help, because can down pupils creativity and can make lazy pupils think. (5) High light Management of time in instruction project model in order to plan activity can good work.

Pengembangan perangkat pembelajaran biologi materi sistem ekskresi melalui model inkuiri terbimbing dengan pendekatan saintifik untuk meningkatkan hasil belajar siswa kelas XI IPA / Ary Maf'ula

 

ABSTRAK Maf’ula, Ary. 2015. Pengembangan Perangkat Pembelajaran Biologi Materi Sistem Ekskresi melalui Model Inkuiri Terbimbing dengan Pendekatan Saintifik untuk Meningkatkan Hasil Belajar Siswa Kelas XI IPA. Skripsi. Jurusan Biologi, Program Studi Pendidikan Biologi, Fakultas Pendidikan Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing : (1) Dra. Amy Tenzer, M.S, (2) Nuning Wulandari, S.Si., M.Si. Kata Kunci: perangkat pembelajaran, sistem ekskresi, inkuiri terbimbing, pendekatan saintifik, hasil belajar. Hasil wawancara dengan guru biologi di MAN Sidoarjo pada tanggal 24 dan 28 November 2014, menunjukkan bahwa pembelajaran di MAN Sidoarjo menggunakan metode diskusi, dan ceramah. Hasil wawancara juga diketahui bahwa sistem ekskresi merupakan salah satu materi kelas XI IPA Semester 2 yang diduga merupakan materi yang sulit bagi siswa, terlihat dari nilai ketuntasan belajar klasikal materi sistem ekskresi pada tahun ajaran 2013/2014 sebesar 43 %. Hal ini diduga disebabkan kegiatan pembelajaran yang kurang variatif, dan media yang digunakan tidak dapat membantu siswa memahami sistem ekskresi. Upaya yang dapat dilakukan untuk mengatasi masalah tersebut yakni mengembangkan perangkat pembelajaran dengan sintaks pembelajaran kombinasi pendekatan saintifik dan inkuiri terbimbing serta didukung dengan media pembelajaran berupa video animasi. Penelitian ini bertujuan: 1) mengembangkan perangkat pembelajaran biologi materi sistem ekskresi melalui model inkuiri terbimbingdengan pendekatan saintifik untuk meningkatkan hasil belajar siswa, 2) mengetahui keefektifan perangkat pembelajaran yang dikembangkan, 3) mengetahui kepraktisan perangkat pembelajaran yang dikembangkan. Penelitian dan pengembangan ini menggunakan model ADDIE Dick and Carey (1996). Data penelitian terdiri dari data kuantitatif dan kualitatif. Data kuantitatif diperoleh dari skor hasil validasi perangkat pembelajaran, skor angket uji kepraktisan, skor hasil belajar aspek sikap, aspek pengetahuan, dan aspek keterampilan. Data kualitatif berupa saran dan komentar dari validator dan siswa. Validasi dilakukan oleh dosen ahli perangkat pembelajaran, ahli media, ahli materi, dan praktisi lapangan. Uji keefektifan dilakukan dengan mengimplementasi¬kan perangkat pembelajaran di kelas XI IPA 8 MAN Sidoarjo dengan jumlah 34 siswa, sedangkan uji kepraktisan dilakukan terhadap 5 orang siswa. Hasil validasi perangkat pembelajaran menunjukkan kriteria sangat valid, dengan rincian nilai validitas silabus, RPP, LKS, dan media pembelajaran berturut-turut 97,13 %, 94,65 %, 90,65 %, dan 93,03 %. Keefektifan pembelajaran terlihat dari hasil belajar aspek pengetahuan, aspek sikap, dan aspek keterampilan berturut-turut adalah 86,17 %, 78 %, 85%, dan 85 %. Hasil uji coba kepraktisan menunjukkan bahwa perangkat pembelajaran sangat praktis dengan persentase 95,26 %. Perangkat pembelajaran dapat meningkat¬kan hasil belajar dengan nilai ketuntasan belajar klasikal 94 % dibandingkan nilai ketuntasan belajar klasikaltahun ajaran 2013/2014 yaitu 43%. Berdasarkan hasil tersebut memperlihatkan bahwa perangkat pembelajaran yang dikembangkan telah layak, efektif dan praktis digunakan dalam kegiatan pembelajaran.

Pengaruh Net Profit Margin (NPM), Capital Adequacy Ratio (CAR), dan inflasi terhadap harga saham perbankan yang terdaftar di Bursa Efek Indonesia (BEI) 2011-2014 / Esra Manurung

 

ABSTRAK Manurung, Esra. 2016.Pengaruh Net Profit Margin (NPM), Capital Adequacy Ratio (CAR), dan Inflasi terhadap Harga Saham Perbankan yang Terdaftar di Bursa Efek Indonesia (BEI) 2011-2014. Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (I) Dr. Grisvia Agustin, S.E., M.Sc, (II) Dr. Farida Rahmawati, S.E.,M.E. Kata Kunci: Net Profit Margin (NPM), Capital Adequacy Ratio (CAR), Inflasi, Harga Saham, Regresi Panel Perkembangan harga saham sangat sulit untuk diprediksi, terutama apabila seorang investor tidak memiliki keahlian dalam menentukan saat kapan harus membeli dan menjual saham yang dimiliki. Kesalahan dalam menganalisis harga saham dapat menyebabkan kerugian karena risiko investasi saham yang tergolong tinggi. Fluktuasi harga saham dapat dipengaruhi faktor yang berasal dari kondisi perusahaan penerbit sahamdan dari kondisi ekonomi. Faktor dari dalam perusahaan dapat dilihat dari kinerja perusahaan yang diukur dari NPM dan CAR. Faktor eksternal dapat dilihat dari kondisi indikator ekonomi makro yang berfluktuatif dengan indikator inflasi. Tujuan dari penelitian ini adalah untuk menganalisis pengaruh Net Profit Margin (NPM), Capital Adequacy Ratio (CAR),dan Inflasi terhadap Harga Saham Perbankanyang Terdaftar di Bursa Efek Indonesia (BEI) 2011-2014. Penelitian ini merupakan penelitian deskriptif kuantitatifdenganregresi panel. Sampel yang digunakan dalam penelitian ini ditentukan dengan metode purposive sampling pada perbankan swasta yang terdaftar di Bursa Efek Indonesia2011-2014 yaitu PT Bank Central Asia Tbk, PT Bank Mayapada International Tbk, PT Bank Danamon Indonesia Tbk, dan PT Bank CIMB Niaga, Tbk. Hasil penelitian dengan mengunakanmodel common effect menunjukkan bahwa secara parsial variabel Net Profit Margin dan Capital Adequacy Ratio berpengaruh signifikan terhadap harga saham perbankan, sedangkan variabel inflasi tidak berpengaruh signifikan terhadap harga saham perbankan. Namun, Secara simultan variabel Net Profit Margin, Capital Adequacy Ratio,dan inflasi berpengaruh signifikan terhadap harga sahamperbankan yang terdaftar di BEI 2011-2014.

Pengaruh lama maturasi pada sintesis komposit hydroxyapatite-polyethylene glycol terhadap kristalinitas dan kekerasan / Atika Rahmawati

 

ABSTRAK Rahmawati, Atika. 2015. Pengaruh Lama Maturasi pada Sintesis Komposit Hydroxyapatite-Polyethylene Glycol Terhadap Kristalinitas dan Kekerasan. Skripsi, Jurusan Fisika, Fakultas MIPA, Universitas Negeri Malang. Pembimbing: (1) Dra.Hartatiek, M.Si. (II) Nandang Mufti, S.Si, M.T, Ph.D Keyword: lama maturasi, calcite, hidroksiapatit, kopresipitasi, kristalinitas, kekerasan. Hydroxyapatite (Ca10(PO4)6(OH)2) merupakan salah satu jenis biokeramik yang banyak digunakan dalam aplikasi medis karena sifat-sifatnya yang unggul. Keunggulan dari hidroksiapatit adalah kemiripannya dengan struktur kimia tulang dan jaringan keras pada tulang manusia. Material ini dapat mendorong pertumbuhan tulang baru, serta mempercepat proses penyatuan tulang. Batuan Calcite Puger berpeluang sebagai bahan dasar pembuatan HA, karena calcite Puger mengandung kalsium sebesar 98,36% yang berpotensi untuk digunakan pada produksi HA. Untuk memenuhi syarat sebagai material substitusi tulang, HA harus didesain dalam bentuk komposit dengan polimer, karena tulang merupakan komposit alami yang terdiri dari bahan organik dan inorganik. Polyethylene Glycol merupakan salah satu polimer yang dapat digunakan sebagai komposit HA-PEG karena memilki sifat spesifik, yaitu tidak beracun, osteokonduktif, biocompatible, biodegradable, dan hidrofilik. Penelitian ini bertujuan untuk mengetahui pengaruh lama maturasi terhadap kristalinitas dan kekerasan. Mensintesis HA dengan menggunakan bahan dasar Ca(OH)2 dari calcite Puger, H3PO4, dan NH4OH sebagai pengontrol pH. Metode kopresipitasi digunakan untuk mempreparasi komposit HA-PEG dengan perbandingan 80:20% berat. Ukuran kristal, fasa dan kristalinitas dikarakterisasi menggunakan XRD, Fotografi mikrostruktur diamati dengan SEM, perbandingan Ca/P dengan menggunakan EDX, dan kekerasan menggunakan vickers hardness. Lama Maturasi komposit HA-PEG adalah 12, 24 dan 36 jam. Hasil yang diperoleh dari penelitian ini adalah HA dengan perbandingan Ca/P sebesar 1,68 dan ukuran kristal sebesar 22,87 nm. Hasil yang diperoleh dari karakterisasi XRD menunjukkan bahwa bertambahnya lama maturasi mempengaruhi ukuran kristal dan kekerasan, namun tidak mempengaruhi kristalinitas komposit HA-PEG. Kekerasan komposit HA-PEG hasil sintesis untuk lama maturasi 12, 24 dan 36 jam adalah 43,1, 71,2 dan 64,1 kg/mm2.

Uji mutu bata putih sampang dengan variasi campuran spesi sebagai alternatif material dinding bangunan / Dus Sukur

 

ABSTRAK Sukur, Dus. 2016. Uji Mutu Bata Putih Sampang Dengan Variasi Campuran Spesi Sebagai Alternatif Material Dinding Bangunan. Skripsi, Program Studi S1 Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Bambang Djatmiko, S.T., M.T. (II) Puput Risdanareni, S.T., M.T. Kata Kunci: Bata putihSampang, alternatif material dinding, kuat tekan Meningkatnya kebutuhan rumah sebagai tempat tinggal menyebabkan semakin bertambahnya jumlah pemakaian bahan bangunan.Hal ini mengakibatkan semakin bervariasinya bahan bangunan yang digunakan untuk memenuhi kebutuhan tersebut. Bata putih dari Kabupaten Sampang ini dipilih untuk diteliti karena sudah banyak dimanfaatkan sebagai bahan bangunan oleh masyarakat namun belum banyakdiketahui atau diteliti kualitasnya baik parameter-parameter dasarnya maupun kuat tekannya. Metode penelitian eksperimental semu post test bata putih dengan variasi campuran spesi sebagai variabel eksperimental dan kuat tekan bata beton ringan dengan variasi campuran spesi sebagai variabel kontrol. Uji Anova dilakukan untuk uji bersama dan uji Tukey untuk uji berpasangan. Variasi campuran spesi bata putih 1PC : 2PS (kelompok A), 1PC : 4PS (kelompok B), 1PC : 5PS (kelompok C) sebagai kelompok eksperimental; Variasi campuran spesi bata bata ringan 1PC : 2PS (kelompok D),1PC : 4PS (kelompok E),1PC : 5PS (kelompok F) sebagai kelompok kontrol. Benda uji masing-masing variasi campuran spesi berjumlah 20 buah. Berdasarkan analisis data diperoleh kesimpulan: (1)hasil pengujian penyerapan air bata putih Sampang adalah 7%, (2) hasil pengujian penyerapan air bata beton ringan adalah 14,766%, (3) hasil rerata kuat tekan bata putih dengan komposisi spesi 1PC : 2PS (kelompok A) menghasilkan rerata kuat tekan 89,9 kg/cm2 kelas mutu 50,(4) hasil rerata kuat tekan bata putih dengan komposisi spesi 1PC : 4PS (kelompok B) menghasilkan rerata kuat tekan 104,4 kg/cm2 kelas mutu 100, (5) hasil rerata kuat tekan bata putih dengan komposisi spesi 1PC : 5PS (kelompok C) menghasilkan rerata kuat tekan 78,2 kg/cm2 kelas mutu 50, (6) hasil rerata kuat tekan bata beton ringan dengan komposisi spesi 1PC : 2PS (kelompok D) menghasilkan rerata kuat tekan 105,3 kg/cm2 kelas mutu 100, (7) hasil rerata kuat tekan bata beton ringan dengan komposisi spesi 1PC : 4PS (kelompok E) menghasilkan rerata kuat tekan 72,5 kg/cm2 kelas mutu 50, (8) hasil rerata kuat tekan bata beton ringan dengan komposisi spesi 1PC : 5PS (kelompok F) menghasilkan rerata kuat tekan 61,5 kg/cm2 kelas mutu 50, (9) hasil uji Tukey kelompok A vs kelompok F, kelompok B vs kelompok C, kelompok B vs kelompok E, kelompok B vs kelompok F, kelompok C vs kelompok D, kelompok D vs kelompok E dan kelompok D vs kelompok F mengalami perbedaan yang signifikan dengan p-value = 0,000,(10) komposisi spesi 1PC : 4PS bata putih menghasilkan rerata kuat tekan optimum = 104,4 kg/cm2 kelas 100, (11) komposisi spesi 1PC : 2PS bata beton ringan menghasilkan rerata kuat tekan optimum = 105,3 kg/cm2 kelas 100.

Penerapan jurnal terbimbing dalam pembelajaran kooperatif tipe Team Assisted Individualization (TAI) untuk mendukung kemampuan komunikasi matematis siswa kelas VIII-A SMP Negeri 2 Malang / Anggraini Eka Pramestasari

 

ABSTRAK Pramestasari, Anggraini Eka. 2015. Penerapan Jurnal Terbimbing dalam Pembelajaran Kooperatif Tipe Team Assisted Individualization (TAI) untuk Mendukung Kemampuan Komunikasi Matematis Siswa Kelas VIII-A SMP Negeri 2 Malang. Skripsi. Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Abdul Qohar, M.T. Kata Kunci : Jurnal Terbimbing, Team Assisted Individualization,Komunikasi Matematis Berdasarkan observasi awal dan wawancara guru serta siswa pada tanggal 6Desember 2014 di SMP Negeri 2Malang diketahui bahwa beberapa siswa kelas VIII-Aberperan aktif selama pembelajaran namun mayoritas siswa memilih pasif selama pembelajaran. Selain itu, siswa juga jarang membuat catatan ketika pembelajaran sehingga hanya beberapa siswa yang menuliskan langkah-langkah pengerjaan soal dengan sistematis dan lengkap. Hal ini juga menyebabkan siswa kurang tepat dalam menuliskan simbol dan notasi matematika. Oleh karena itu diperlukan pembelajaran yang menuntut siswa untuk memperbaiki komunikasi matematis secara individu. Pembelajaran yang diterapkan adalah penerapan jurnal terbimbing pada pembelajaran kooperatif tipe team assisted individualization (TAI). Penelitian ini merupakan penelitian tindakan kelas (PTK) yang mendeskripsikan tentang langkah-langkah penerapan jurnal terbimbing pada pembelajaran kooperatif tipe team assisted individualization yang dapat mendukung kemampuan komunikasi matematis. Subjek penelitian adalah siswa kelas VIII-A SMP Negeri 2 Malang. Data yang dikumpulkan dalam penelitian ini meliputi: 1) hasil observasi selama proses pembelajaran yang berpedoman pada lembar observasi, 2) hasil catatan lapangan, 3) jurnal terbimbing, 4) kuis, dan 5)hasil tes akhir siklus. Penerapan jurnal terbimbing pada pembelajaraan kooperatif tipe team assisted individualization (TAI) pada materi sistem persamaan linier dua variabelyang dapat mendukung kemampuan komunikasi matematis siswa kelas VIII-A SMP Negeri 2 Malang dengan langkah-langkah sebagai berikut yaitu (1) placement test, (2) teams, (3) student creative, (4) team study method,(5) teaching groups, (6) whole-class units, (7) fact test.

Hubungan antara keterampilan metakognisi dengan hasil belajar konsep mol siswa kelas X SMA Negeri 2 Mejayan Madiun / Rini Wijayanti

 

ABSTRAK Wijayanti, Rini. 2015. Hubungan antara Keterampilan Metakognisi dengan Hasil Belajar Konsep Mol Siswa Kelas X SMA Negeri 2 Mejayan Madiun. Skripsi, Jurusan Pendidikan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. H. Suhadi Ibnu, M.A., Ph.D (II) Muntholib, S.Pd., M.Si. Kata kunci: keterampilan metakognisi, hasil belajar, konsep mol. Metakognisi adalah suatu kesadaran yang dimiliki oleh siswa mengenai apa yang mereka pikirkan dan apa yang dikerjakan pada saat proses pembelajaran maupun saat memecahkan masalah. Metakognisi memiliki dua komponen yaitu pengetahuan metakognisi dan pengalaman metakognisi (keterampilan metakognisi). Keterampilan metakognisi merupakan suatu kemampuan yang dimiliki oleh seseorang untuk melakukan perencanaan (planning skill), memonitor setiap kegiatan yang dilakukan (monitoring skill), dan menilai setiap apa yang teah dilakukan (evaluation skill). Adanya keterampilan metakognisi akan menyebabkan pikiran seseorang menjadi terstruktur dan lebih fungsional. Apabila ketiga komponen tadi dilaksanakan dengan baik maka hasil belajar siswa akan naik. Penelitian ini dilaksanakan untuk mengetahui 1) keterampilan metakognisi siswa, 2) hasil belajar siswa pada materi konsep mol, dan 3) hubungan antara kedua variabel. Penelitian ini juga berguna untuk melakukan verifikasi terhadap hasil penelitian terdahulu. Penelitian ini menggunakan desain korelasional, yang menghubungkan antara variabel keterampilan metakognisi dengan variabel hasil belajar. Data penelitian berupa data hasil belajar, dan data keterampilan metakognisi. Data hasil belajar diperoleh dari pengerjaan instrumen berupa soal uraian tentang konsep mol, sedangkan data keterampilan metakognisi diperoleh dari instrumen Metacognitive Awareness Inventory (MCI). Dari kedua data ini kemudian dicari hubungannya dengan person corelation dalam aplikasi SPSS 16.0. Hasil penelitian menunjukkan bahwa 1) nilai rata-rata keterampilan metakognisi siswa adalah 73,68, 2) nilai rata-rata hasil belajar siswa pada materi konsep mol adalah 58,87, dan 3) terdapat hubungan antara keterampilan metakognisi dengan hasil belajar dengan kategori cukup dan nilai person corelation sebesar 0,609. Evaluation skill memiliki pengaruh paling kuat terhadap hasil belajar dibandingkan planning skill dan monitoring skill.

Using the PQRST strategy to improve the reading comprehension ability of the tenth graders at SMA Negeri 1 Rogojampi / Dina Okta Kuslolyta

 

ABSTRAK Kuslolyta, Dina Okta. 2015. Menggunakan Strategi PQRST untuk Meningkatkan Kemampuan Memahami Bacaan pada Siswa Kelas X di SMA Negeri 1 Rogojampi. Skripsi, Pendidikan Bahasa Inggris, Jurusan Sastra Inggris, Universitas Negeri Malang. Pembimbing: (I) Dra. Sri Andreani, M.Ed., (II) Dr. Arwijati Wahyudi, Dip.TESL., M.Pd. Kata Kunci: PQRST strategy, reading comprehension Sebuah studi pendahuluan untuk melihat kemampuan membaca pemahaman siswa kelas X di SMA Negeri 1 Rogojampi menunjukkan hasil yang kurang memuaskan. Hasil penelitian menunjukkan bahwa sebagian besar siswa X MIA 4 memiliki masalah dengan pemahaman bacaan. Hal itu terlihat dari skor tes awal yang menunjukkan bahwa hanya 9 dari 40 siswa (23.68%) yang memenuhi kriteria minimal 75. Para siswa mengatakan bahwa mereka tidak mengenal strategi membaca dan mereka menganggap kegiatan belajar mereka selama ini monoton dan membosankan. Alasan-alasan ini menurunkan minat mereka dalam membaca. Penelitian Tindakan Kelas dilakukan untuk memecahkan masalah yang dialami oleh siswa kelas X MIA 4. Penelitian ini difokuskan pada peningkatan kemampuan siswa dalam memahami bacaan dengan menggunakan strategi PQRST. Strategi PQRST terdiri dari lima langkah yaitu Preview, Question, Read, Summarize, dan Test. Penelitian ini dilakukan dalam dua siklus. Setiap siklus terdiri dari dua pertemuan. Data yang dikumpulkan adalah nilai siswa dari tes pemahaman membaca serta respon siswa terhadap strategi PQRST. Data tersebut kemudian dibandingkan dengan kriteria keberhasilan yang telah ditetapkan yaitu: 1) 70% siswa bisa mencapai peningkatan setidaknya lima poin dalam skor mereka, dan skor akhir adalah sama dengan atau lebih dari 75 (nilai kelulusan minimum) dan 2) 70% siswa menunjukkan respon positif terhadap kegiatan memahami bacaan. Untuk mengumpulkan data, peneliti menggunakan pedoman wawancara, kuesioner, checklist pengamatan, catatan peneliti dan tes pemahaman bacaan. Para siswa dituntun untuk mengikuti sebuah prosedur yang telah dibuat oleh peneliti. Mereka diberi selembar kertas berisi langkah-langkah untuk menggunakan strategi PQRST. Mereka harus mengikuti dan mengisi lembaran tersebut saat mereka sedang membaca teks yang dilengkapi dengan daftar kata dan ilustrasi. Beberapa siswa masih mengalami kesulitan dalam menuliskan pertanyaan dan membut rangkuman, sehingga mereka ditugaskan untuk bekerja dalam kelompok. Hasil penelitian menunjukkan bahwa penerapan strategi PQRST berhasil meningkatkan kemapuan membaca pemahaman siswa. Hal ini dapat dilihat dari nilai kemapuan membaca siswa yang berangsur-angsur meningkat. Pada siklus I, 23 dari 39 siswa (58,97%) menunjukkan peningkatan skor setidaknya lima poin dan 26 dari 39 siswa (66,67%) memperoleh sama dengan atau lebih dari nilai kelulusan minimal 75. Pada Siklus II, dengan menggunakan strategi PQRST dalam kerja kelompok, nilai semua siswa menunjukkan peningkatan skor lebih tinggi dari lima poin dan 30 dari 34 siswa (88,24%) mencapai kelulusan minimal 75. Hasil penelitian juga menunjukan bahwa siswa secara aktif berpartisipasi dalam kegiatan membaca, berlatih menggunakan strategi PQRST serta bekerja dalam kelompok. Selain itu, para siswa dan guru bahasa Inggris memberikan tanggapan positif terhadap penggunaan strategi ini. Peneliti menyarankan guru bahasa Inggris untuk menggunakan strategi PQRST ini sebagai alternatif dalam mengajar memahami bacaan yang sesuai dengan kebutuhan dan minat siswa. Selain itu, disarankan bagi peneliti lain untuk meneliti efektivitas strategi PQRST untuk memecahkan masalah membaca pemahaman pada setting dan subjek yang berbeda. Akhirnya, hasil penelitian ini juga dapat digunakan sebagai acuan untuk penelitian lanjutan yang berkaitan dengan strategi PQRST.

Pengembangan pembelajaran model Dick dan Carey mata pelajaran sejarah nasional Indonesia dan umum kelas III pokok bahasan perjuangan mengembalikan Irian Barat di SLTPN 2 Megaluh Jombang
oleh Mokhammad Ikhsan

 

Problem based learning berbantuan link map untuk meningkatkan hasil belajar siswa pada materi program linear di kelas XI Farmasi SMK Bakti Indonesia Medika Jombang / Endang Suhartatik Prihartini

 

ABSTRAK Prihartini, Endang, Suhartatik. 2015. Problem Based Learning Berbantuan Link Map untuk Meningkatkan Hasil Belajar pada Materi Program Linear di Kelas XI Farmasi SMK BIM Jombang. Tesis, Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. I Nengah Parta, M. Si, (II) Dr. Hery Susanto, M.Si Kata kunci: Problem Based Learning Berbantuan Link Map, teori beban kognitif, hasil belajar Penelitian ini bertujuan untuk mendeskripsikan Problem Based Learning berbantuan Link Map pada materi program linear yang dapat meningkatkan hasil belajar siswa di Kelas XI Farmasi SMK Bakti Indonesia Medika Jombang. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) dengan data utama berupa data tentang tindakan guru. Analisis data yang digunakan adalah dengan mereduksi data, menyajikan data, dan menarik kesimpulan. Hasil penelitian ini menunjukkan bahwa Problem Based Learning berbantuan Link Map dapat meningkatkan hasil belajar siswa kelas XI Farmasi SMK Bakti Indonesia Medika Jombang. Problem Based Learning berbantuan Link Map memiliki langkah sebagai berikut: (1) Mengorientasikan siswa pada masalah, (2) mengorganisasikan siswa untuk belajar, (3) membimbing penyelidikan individu dan kelompok, (4) mengembangkan dan menyajikan hasil karya, (5) menganalisa dan mengevaluasi hasil belajar. Pada tahap membimbing penyelidikan individu dan kelompok, guru meminta siswa untuk menyusun Link Map tentang materi pembelajaran. Saran yang dapat disampaikan berdasarkan hasil penelitian ini, antara lain: (1) Bagi para guru, apabila menggunakan Problem Based Learning berbantuan Link Map hendaknya menguasai betul sintaksnya, (2) Sebaiknya guru lebih memperhatikan alokasi waktu yang digunakan dalam pembelajaran. Terutama pada tahap membimbing penyelidikan individu dan kelompok serta pada tahap mengembangkan dan menyajikan hasil karya. Pada tahap itu peran guru sebagai fasilitator sangat dibutuhkan terutama dalam pengelolaan waktu diskusi, (3) Bagi peneliti selanjutnya, apabila melakukan penelitian dengan menggunakan Problem Based Learning berbantuan Link Map dalam pembelajaran matematika hendaknya lebih memperhatikan materi, kompetensi yang harus dicapai, karakter, dan kemampuan siswa. Karena Problem Based Learning berbantuan Link Map membutuhkan peran aktif siswa dalam pembelajaran.

Hubungan antara persepsi siswa tentang kemampuan guru dalam memanfaatkan media dan penerapan metode pembelajaran dengan prestasi belajar bidang studi geografi siswa kelas I di MA Ihsanniat Kecamatan Ngoro Kabupaten Jombang oleh Suparwan

 

S"lahsatutrlgssseorangguruadslahmeagqiardandidalalkegiatanbelajar mengajar tersebut aoo tomirifasi antara gutu- Atoguq tit*9 lry komumikasi ters€but tidak hanya d;;rb.lir*" sci" yang u"ntiuat ketidakpastian siswa ,lcurangm inat danh r*;;ir;h-frhJ* ,purtoit inanfaatan mediad anp enerapsn metode pembelajaran yans sesual' -!-r-^- ^r^L L-r.a.r,ri fa Keberhasita*-n# ;;iam belajard i tet$uks otehb erbagai faktor' $alah satud i anrarbau bagafi" Gi i " .O.f.n fuftot psru. yangm eliputfia ktorin telektual dann oni ntelektuaSt.t kd;d'p"*"-i;i;"i.tdtt" tirtrtoin oni nt€lekhnl y-qg qspel mernpengerubheil ajaTsii*us. i.*i dangant aiand i atas perscpsyia ngd i maksud adalatr persepsi ,o*u'-tJilua"p pt^i'ora'r* media dan penerapan metode p'-e--mpb"iel"laftjtaiorai ngeograf i . r . i L- - - - - - - - .n6- ,? iii t rnjuatr unhrkm e*Ehhui bub*ngnnE ntsrap ffsepsts lswa tentangk emampuafni* ;"il-n1.ro"frutf."n mediad en pengrapon metode oembelaiuadne ngnpnr estasbie lqiabr idangs ordGi cogrefsi iswa kelasI semestct r irn no-inniaRt ejoagunNgg otoJ ombang- ' populasai "ru* p.i"fiti* i*g udf"t f"rrt**i*.t ini berjumls4b5 o rangd an sebagauim pcta ir*Uu ilJftiuai O".tp op"t ti Tetnikp angrrmpulan darap rimer yangb erupaP ersepsi.siswtean bngk emirnpuagnr u dd;m memanfaatkan media dan penerapa*n"d *il*[J"d* -a6"rr*-mEtod€ asgk€t,s edangkadna ta setund€yra ngb erupap .Jt*i n"iqi* diglnEkanm aodcd okumentasi' Analisisd atn aig"*t",it i"it sustlick orelastui nggaPl roductMoment' Berda5arka*nu }1.i';* -ffiioren nasif -Wnelitial sebagaibsihs: (l) Kemampuagnu ru *;;.f*tkun iit"Oig peta dalim pe'mbelajaran biang studi Geografbi erdasarkaffni" p;;il ryPi** qry prestasilelajsr siswa' dengnnd emikiant "r[*"pl* g-'ru dalamn. emangattanm ediap embelajaran terdapaht ubungayne ngf ;1itif *l*l presPi be&jars. iswad atam bidang studi Geografdi i MA rh*#"i N;;ro hinuaig. (2) eda hubrmesvsa ngp ositifa ntara persepssi rswate ntanilie;r?ry mctnOep-ix irtetqirnnt ethadap betajar siswad alamb idangrt fri O.ogtln 'siswkae lasI MA IhsanniatNgoJroom bang' 'BerdasarkanhasilpcnclitialLsarSny6ngdapatdiiukao"g]f.'(1)llasit penelitianin i ,Jiharapkai-Japat,ire*Uetiiao'suasutum bangan pemikirand alam pengembangsilnm u. geografi khrsrsn5n- *l* ups]o pengembangainlm u Derencanaparno *", *rgt inengaju,y an! netilrri nediuhm naodc pembe$aran drrr p.r#ffi ."aii p"rU.-frri"d l* efetif (2) U.tuf'.Suru' sebogdb ahtn koreksi diri unurk meningkatkans uu peopi.tin vg_g-b crhtbrmgand engan psn€rapmane todp€" ngal;ild* mcahr fooslirant il il-nn*.temlassse kolalt' sebagbtia 'ank oreksOi i *tuf reningkaikan;rtup en.iOUntang eyelesaikan ;"*?ffi; fi; ;'#ffi; ililtr.'t^ b"td's iryab j&Fssn 5c €osran' A;'U.r"k #CrtA; p"nOiOfi"poa ial i.h*tsnyad" anp merintah padatm umnya datamm enentrmrn.e Ui.iaiJ.aanftdrb ldandp endidiluor 1.inFpp endidikan di Indonesiad apu ditingXaiian* .*o optitof drn riranpuUusaing dcngnnp endidikan di negnra-negnlarain yangl ebihm aju'

Pengaruh komposisi (Kaolin, Feldspar, Kuarsa, Ball Clay) terhadap kuat tekan dan kosntanta dielektrik kramik porselen / Rofitoh Lailatul Fitriyati

 

Kata Kunci: Keramik Porselen, Kuat Tekan, Konstanta Dielektrik Porselen merupakan salah satu keramik yang telah banyak digunakan dalam industri elektronik. Salah satunya yaitu keramik dielektrik. Keramik dielektrik digunakan sebagai kapasitor. Tujuan dari penelitian ini adalah: (1) Untuk mengetahui bagaimanakah pengaruh komposisi bahan terhadap nilai kuat tekan dan (2) Untuk mengetahui bagaimanakah pengaruh komposisi bahan terhadap nilai konstanta dielektrik. Pada penelitian ini, akan dibuat variasi komposisi bahan penyusun keramik porselen (kaolin, feldspar, kuarsa, dan ball clay) yang disintesis menggunakan metode solid state reaction (reaksi padatan) dan disintering pada suhu 1300oC selama 3 jam. Setiap komposisi dibuat dua sampel untuk uji kuat tekan dan 3 sampel untuk uji konstanta dielektrik. Untuk mengetahui hasil uji, maka dianalisis dengan Analisis Varian (Anava). Uji Anava ini untuk mengetahui: (1) Adakah pengaruh variasi komposisi bahan penyusun terhadap nilai kuat tekan, (2) Adakah pengaruh variasi komposisi bahan penyusun terhadap nilai konstanta dielektrik. Hasil penelitian menunjukkan bahwa variasi komposisi berpengaruh pada nilai kuat tekan dan nilai konstanta dielektrik pada keramik porselen. Dari semua hasil uji sampel, nilai kuat tekan tertinggi ada pada variasi komposisi kaolin 35%, feldspar 25%, kuarsa 33%, dan ball clay 7% dengan nilai 57,64 Mpa. Nilai tertinggi konstanta dielektrik pada keramik porselen juga pada variasi komposisi kaolin 35%, feldspar 25%, kuarsa 33%, dan ball clay 7% dengan nilai 16,5.

Upaya meningkatkan prestasi belajar dalam pembelajaran fisika menggunakan metode demonstrasi disertai tugas individu dan metode eksperimen disertai tugas kelompok siswa kelas SMUN 5 Malang oleh Rusdiana, Sholikhati

 

ABSTRAK RusdianaS. holikhati.2 003.I iputtt lvk:ningkcttku['nre .slusBi eluiarD alum Pembelalaranl. -isik a MenggunakaMn etodeD emonstrasDi isertai T'ugas Indivtdud an lv:lelrtcl:ek sperimenD isertai TugasK elompokS i"swKcte lasI SMUN5 MALANG.S kripsi,J urusanP endidikanF isikaF MIPA UniversitaNs egerMi alang.P enbirnbing(:l ) Drs.E ddyS upramono(I,I ) Dra.H artatiekM, .Si. Kata kunci:m etoded. emernstraeski,s perimenp,r estasbi elaiar. Penelitianin i bertuluanu ntukm engetahupie rbedaapnr estasbi elajar antaras isway angm enggunakarn etoded emonstradsis ertatiu gasin dividud an metodee ksperimend isertait ugask elompok,y aitu padam aterif isika kelasI semeste2r p okokb ahasafnlu idat ak bergeradk anf luidabergerak. Metodep enelitiany angd ipakaia dalahe ksperimend enganra ncangan" Prat est-Pascteas tC ontrolG roupD esign" , sehinggpae nelilianin i melibatkan variablep erlakuayna itum etoded emonstradsi sertatiu gasin dividud anm etode eksperimedni sertatiu gask elompokp adap okokb ahasafnlu idat akb ergeradk an fluidab ergerakP. enelitianin i dilaksanakapna das emestelIr tahuna jaran 20021200y3a itup adab ulanM aret sampadi enganA pril bertempadt i SMUN 5 Malang.P opulasdi alamp enelitianin i adalahs iswak elasI SMLrN5 Malang tahunp elajaran2002120y0a3n gberjLunla1h7 0s iswa.S arrpedl alamp enelitian ini adalahs iswak elasI r danI r, yangb erjumlah8 5 siswaP. engambilasna mpel secaraa cakk elas,s ampepl enelitianr- nenjadiu ak elompoky angm asing-masing kelompokd iberi perlakuany angb erbedaS. ebelumd iberi perlakuante rlebih dahulud iukurk emampuana wal rnasing-rnasinkge lompokd enganm enggunakan tesa wal( pratest).S edangkapnr estasbi elajarf luida tak bergerakd anf luida bergeraks iswad iukur dengante sa khir (pascate st)s etelahs iswad iberip erlakuan. Untukm engetahupi erbedaapnr estasbi elajarf isika antaram asing-masing kelompokd igunakaann alisiss tatistikau ji-t Hasil penelitianm enunlukkanb ahwat erdapapt erbedaapnr estasbi elajar fisika antaras isway angm enggunakamn etoded emonstrasdii sertati ugasi ndividu dibandingkans isway angm enggunakamn etodee ksperimend isertati ugas kelompok.D ari hasilp erhitunganu ji-t menunjukkanb ahwas isway ang menggunakamn etoded emonstrasdii sertait ugasi ndividum emiliki prestasi belajarl ebih tinggi dibandingkanm etodee ksperimend isertati ugask elompok.

Tindak pembelajaran guru dalam menginternalisasi nilai-nilai karakter di SDN Kauman 1 Malang / Budiyanto

 

ABSTRAK Budiyanto, 2015. Tindak Pembelajaran Guru dalam Menginternalisasi Nilai-Nilai Karakter di SDN Kauman 1 Malang. Tesis, Program Studi Pendidikan Dasar Guru Kelas, Pascsarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Nyoman Sudana Degeng, M. Pd., (II) Prof. Dr. Hj. Ruminiati, M. Si. Kata kunci: tindak pembelajaran, internalisasi nilai karakter, sekolah dasar. Pendidikan mendorong siswa untuk mengembangkan diri sesuai potensi bakat yang dimilikinya. Pendidikan juga tidak hanya bertumpu pada pengembangan kecerdasan akal melainkan juga kecerdasan emosional dan spiritual, kemudian muncullah gagasan tentang pendidikan karakter. Dalam mengembangkan berbagai karakter terpuji siswa dibutuhkan tindak pembelajaran guru baik saat berada di dalam kelas maupun di luar kelas. Penelitian ini menggunakan rancangan penelitian deskriptif-kualitatif dengan metode studi kasus. Tujuan penelitian ini adalah untuk mendeskripsikan: 1) bentuk-bentuk tindak pembelajaran guru dalam menginternalisasi nilai-nilai karakter; 2) strategi tindakan guru dalam menginternalisasi nilai-nilai karakter; dan 3) alasan-alasan tindakan guru dalam menginternalisasi nilai-nilai karakter. Temuan penelitian secara umum menunjukkan bahwa bentuk tindakan guru dalam menginternalisasi nilai-nilai karakter di SDN Kauman 1 Malang antara guru kelas yang satu dengan lainnya bervariasi. Hal ini tentu sangat menguntungkan bagi siswa. Misalnya: 1) bentuk tindakan guru dalam mengingternalisasi nilai disiplin adalah guru datang tepat waktu di kelas, guru membiasakan diri menunggu dengan senyum dan sabar di pintu sekolah dan mengajak siswa untuk tidak datang terlambat, guru mengajak siswa melaksanakan tugas-tugas kelas yang menjadi tanggung jawabnya, antre sebelum masuk kelas, berpakaian rapi, dan menaati tata tertib sekolah, 2) bentuk tindakan guru dalam mengingternalisasi nilai religius adalah guru membiasakan diri dan memberi contoh saat berdoa dengan sikap khusuk dan tenang, selalu bersyukur karena banyak teman meski berlainan agama, mengajak siswa untuk selalu mendoakan orang tua, dan mengajak siswa mendoakan orang-orang yang berjasa. Strategi tindakan yang dilakukan guru dalam menginternalisasi nilai-nilai karakter di SDN Kauman 1 Malang adalah: 1) Mengenalkan siswa tentang nilai-nilai kebaikan (pengetahuan), 2) Menjadikan siswa mempunyai alasan dan keinginan dalam melakukan nilai-nilai kebaikan (perasaan), 3) membiasakan diri dan melakukan nilai-nilai kebaikan dalam kehidupan sehari-hari (psikomotorik), 4) guru bekerjasama dengan orang tua siswa dalam melakukan pemantauan nilai-nilai kebaikan pada diri siswa (habituasi). Adapun alasan-alasan tindakan guru dalam menginternalisasi nilai-nilai karakter di SDN Kauman 1 Malang adalah: 1) tuntutan keagamaan untuk membina perilaku seseorang, 2) sering terjadinya dekadensi moral di tengah masyarakat, 3) mulai merosotnya nilai-nilai kebaikan di tengah masyarakat, dan 4) profil individu yang baik sebagaimana yang diamanatkan dalam kandungan nilai-nilai Pancasila dan Pembukaan Undang-Undang Dasar 1945 serta (Undang-undang tentang sistem pendidikan nasional serta tentang guru dan dosen).

Pengembangan buku ajar mata pelajaran mekanika teknik program keahlian teknik pemesinan SMK PGRI 3 Malang / Ma'rifatun Nadhiroh

 

ABSTRAK Nadhiroh, Ma’rifatun. 2015. Pengembangan Buku Ajar Mata Pelajaran Mekanika Teknik Program Keahlian Teknik Pemesinan SMK PGRI 3 Malang. Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. H. Yoto, S.T., M.Pd., M.M., (II) Drs. Djoni Bangun, M.Pd. Kata Kunci: pengembangan, buku ajar, mekanika teknik, model Dick dan Carey Tahap awal implementasi Kurikulum 2013 banyak hal yang perlu disiapkan, salah satunya adalah penyusunan buku ajar Mata Pelajaran Mekanika Teknik. Buku ajar yang telah disiapkan oleh pemerintah sulit untuk dipahami dan buku ajar yang sesuai dengan Kurikulum 2013 di sekolah ataupun di toko-toko buku belum tersedia. Oleh karena itu, perlu dilakukan pengembangan buku ajar Mekanika Teknik yang mudah dipahami dan sesuai dengan kurikulum yang berlaku. Tujuan dari penelitian ini adalah mengembangkan, menyediakan buku ajar, dan menguji kelayakan Buku Ajar Mata Pelajaran Mekanika Teknik untuk siswa Program Keahlian Teknik Pemesinan Kelas X Sekolah Menengah Kejuruan PGRI 3 Malang yang sesuai dengan Kurikulum 2013. Metode pengembangan yang digunakan dalam pengembangan ini adalah model pengembangan Dick dan Carey yang terdiri dari 10 langkah. Langkah-langkah tersebut antara lain: (1) mengidentifikasi tujuan pembelajaran, (2) melakukan analisis instruksional, (3) menganalisis karakteristik siswa dan konteks pembelajaran, (4) merumuskan tujuan pembelajaran khusus, (5) mengembangkan instrumen penilaian, (6) mengembangkan strategi pembelajaran, (7) mengem-bangkan dan memilih bahan ajar, (8) merancang dan melaksanakan evaluasi formatif, (9) melakukan revisi terhadap program pembelajaran, dan (10) merancang dan mengembangkan evaluasi sumatif, namun dalam penelitian ini untuk langkah ke-10 tidak dilakukan karena keterbatasan waktu untuk melakukan seluruh kegiatan belajar dalam waktu satu semester. Hasil dari penelitian dan pengembangan ini telah melalui 3 tahap uji coba formatif, yaitu validasi ahli yang terdiri dari ahli materi mendapatkan persentase sebesar 70,35% dinyatakan cukup valid dan ahli teknologi pembelajaran mendapatkan persentase sebesar 91,55% dinyatakan sangat valid, uji coba kelompok kecil mendapatkan persentase sebesar 78,71% yang berarti sangat valid, dan uji coba kelompok besar mendapatkan persentase sebesar 85,15% yang berarti sangat valid. Oleh karena itu, dapat disimpulkan bahwa buku ajar Mekanika Teknik yang dikembangkan ini sangat valid dan dapat digunakan sebagai bahan (buku) ajar Mata Pelajaran Mekanika Teknik. Saran pemanfaatan buku ajar untuk guru dan siswa yaitu mempelajari panduan buku ajar terlebih dahulu supaya dapat menggunakan Buku Ajar Mekanika Teknik dengan baik. Penyebaran produk hendaknya dilakukan pada saat kegiatan pembelajaran Mata Pelajaran Mekanika Teknik. Saran untuk pengembangan produk lebih lanjut dapat dilakukan pada Buku Ajar Mekanika Teknik semester 2 dan pengembangan buku ajar pada Mata Pelajaran lain yang sesuai dengan kurikulum 2013.

Analisis fluiditas dan kualitas hasil pengecoran logam paduan Al-Si berdasarkan variasi bahan pengikat pada cetakan berbahan dasar pasir sungai Brantas / Wegi Febri Mangku Risky

 

ABSTRAK Risky, Wegi Febri Mangku. 2015. Analisis Fluiditas Dan Kualitas Hasil Pengecoran Logam Paduan Al-Si Berdasarkan Variasi Bahan Pengikat Pada Cetakan Berbahan Dasar Pasir Sungai Brantas. Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. H. Putut Murdanto, S.T., M.T., (II) Rr. Poppy Puspitasari, S.Pd., M.T. Ph.D. Kata kunci:pasir sungai brantas, fluiditas dan kualitas coran Pengecoran merupakan proses peleburan bahan logam dan dituangkan kedalam cetakan. Ada beberapa proses yang diperlukan untuk mencapai hasil yang diinginkan. Pasir merupakan produk dari hancurnya batu-batuan dalam jangka waktu lama. Alasan pemakaian pasir sebagai bahan cetakan adalah karena murah dan ketahanannya terhadap temperatur tinggi. Hasil pengecoran dapat diketahui berdasarkan fluiditas dan kualitas logam. Penelitian ini bertujuan untuk mengetahui pengaruh penggunaan pasir sungai Brantas sebagai pasir cetak coran terhadap kekuatan pasir cetak dan fluiditas hasil pengecoran logam paduan Al-Si. Selain itu juga bertujuan untuk mengetahui pengaruh pasir sungai Brantas terhadap kekerasan permukaan dan cacat coran pada logam paduan Al-Si. Metode penelitian yang digunakan dalam penelitian ini adalah metode eksperimental yang melihat hasil dari sebuah perlakuan terhadap suatu kelompok spesimen. Setelah diberikan perlakuan, spesimen akan dianalisa kekuatan pasir cetak, kecacatannya dan kemampuan alir logam cor (fluiditas). Selain itu dilakukan pula pengujian kekerasan permukaan, dan foto mikro dan foto makro untuk melihat cacat yang terjadi secara detail. Berdasarkan hasil penelitian yang diperoleh dari uji fluiditas menunjukan spesimen pasir sungai Brantas dengan variasi semen portland10% memiliki fluiditas yang paling baik, dengan panjang total 584,72 mm, lebar total 85,4 mm, dan tebal total22 mm. Kekerasan terbesar dimiliki oleh spesimen pasir sungai Brantas dengan variasi semen portland 15% yaitu sebesar 94,92 HV. Adapun data hasil kualitas yang diperoleh dari foto mikro dan foto makro menunjukkan bahwa spesimen pasir sungai Brantas dengan variasi semen portland 15% memiliki ukuran cacat lubang jarum yang paling kecil dan berjumlah 0 buah dan cacat struktur butir terbuka sedikit, yakni ± 13 buah. Dengan demikian pasir sungai Brantas dapat menjadi alternatif pasir cetak untuk industri pengecoran logam.

Pemberian tindak demontrasi dalam proses belajar mengajar fisika untuk meningkatkan prestasi belajar fisika siswa kelas I Madrasah Aliyah Al-Islamiyah II Bujudan Pamoroh Kadur Pamekasan oleh Achmad Sugiarto

 

Pengaruh djenis beras terhadap cyclus hidup Sitophilus Oryza L / J.G. Seumahu

 

Pengaruh metode pembelajaran berbasis intranet menggunakan moodle dan metode konvensional terhadap prestasi dan motivasi belajar siswa kelas X pada mata pelajaran menggambar teknik paket keahlian teknik permesinan SMKN 03 Boyolangu Tulungagung / Boby Cahyo Saputro

 

ABSTRAK Saputro, BobyCahyo. 2015. PengaruhMetodePembelajaran E-learning Berbasis Intranet Mengunakan Moodle danMetodeKonvensionalTerhadapMotivasidanPrestasiBelajarSiswaKelas X pada Mata PelajaranMenggambarTeknikPaketKeahlianTeknikPermesinan SMKN 03 BoyolanguTulungagung. Skripsi,Program StudiPendidikanTeknikMesin, JurusanTeknikMesin, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: (1) Dr. H. DwiAgusSudjimat, S.T., M.Pd(2) Drs. H. Suwarno,M.Pd. Kata Kunci:metodee-learning, metodekonvensional, motivasibelajar, prestasibelajar. Pengembangankonsepmetodepembelajaranmerupakansalahsatucarauntukmeningkatkanmutupendidikan. Denganmemanfaatkanteknologidanperkembangankomunikasi, konsepmetodepembelajarandapatdikembangkanmenjadisistemonlinedimanadiharapkandapatmeningkatkanmotivasidanprestasibelajarsiswadibandingkanmetodepembelajarankonvensional. Penelitianinitergolongkuasieksperimental yang bertujuanuntukmengetahuiperbedaanpengaruhdaripemanfaatane-learningdanmetodekonvensional di dalam proses pembelajaran. Subyekpenelitianiniadalahsiswakelas X TeknikPermesinan SMKN 03 BoyolanguTulunggung.Pengumpulan data dilakukandenganmenggunakanmetodetesdanangket.Data yang diperolehkemudiandianalisisdenganteknik t-testuntukmengetahuiadatidaknyaperbedaanantaraprestasidenganmotivasibelajarsiswa yang diajarmenggunakanmetodepembelajarane-learningdanmetodekonvensional. Hasilpenelitianmenunjukanbahwa(1) adaperbedaan yang signifikanantaraprestasibelajar yang diajarmenggunakane-learningdanprestasibelajar yang diajarmenggunakanmetodekonvensionaldalamrerata. Hasilpenelitianmenunjukanbahwa (2) adaperbedaanyang signifikanantaramotivasibelajar yang diajarmenggunakane-learningdanmotivasibelajar yang diajarmenggunakanmetodekonvensionaldalamrerata. Berdasarkanhasilpenelitiantersebutdiajukan saran kepadakepalasekolah SMKN 03 BoyolanguTulungagung agar penelitianinidapatdijadikansebagaimasukan yang obyektifuntukperkembangankedepan, dankepadabapakdanibu guru bisamenjadikanpenelitianinisebagaiacuandanpedomanuntuklebihmeningkatkandanmengembangkandiridengancaramengajar yang lebihinovatifgunameningkatkanmotivasisiswadalambelajardanprestasibelajarsiswa.

Pengaruh debit gas argon terhadap kekerasan dan struktur mikro pada sambungan aluminium AlMg 5083 dengan las gmaw posisi pengelasan 1G / Chandra Sadu Aribowo

 

ABSTRAK Aribowo, Chandra Sadu. 2014. Pengaruh Debit Gas Argon Terhadap Kekerasan dan Struktur Mikro pada Sambungan Aluminium ALMg 5083 dengan Las GMAW Posisi Pengelasan 1G. Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs.H. Sunomo,M.Pd. , (II) Drs.Wahono, S.ST, M.Pd. Kata Kunci: Kekerasan, Struktur Mikro,Debit Gas Argon, Las GMAW, Aluminium 5083, Posisi 1G Pengelasan GMAW banyak digunakan untuk pengelasan baja-baja kualitas tinggi salah satunya stainless steel. Stainless steel banyak digunakan antara lain untuk tangki-tangki bahan kimia, sudu turbin uap, tangki penyimpanan susu dan alat-alat rumah tangga. Dalam pengelesan GMAW sering ditemui adanya pengaruh arus listrik dan aliran gas (gas flow rate) yang berpengaruh tehadap baik buruknya mutu dari hasil pengelasan. Arus las dan gas flow rate akan berpengaruh masukan panas yang terjadi. Hal ini akan mempengaruhi struktur akhir yang terbentuk pada HAZ maupun logam las sehingga berpengaruh pada tingkat kekerasan dan struktur mikro hasil pengelasan. Tujuan penelitian ini yaitu untuk mengetahui pengaruh debit gas argon yang digunakan dalam pengelasan terhadap kekerasan dan struktur mikro pada sambungan aluminium dengan las GMAW posisi pengelasan 1G Metode penelitian yang digunakan dalam penelitian ini ialah rancangan Infirensial kausalitas. Jenis pendekatan yang digunakan dalam penelitian ini adalah penelitian kuantitatif. Rancangan penelitian yang digunakan dalam penelitian ini adalah rancangan penelitian faktorial yaitu tiga variasi debit gas argon dan penggunaan arus tetap.. Teknik analisis data menggunakan analisis regresi. Analisis statistik tersebut digunakan untuk pengujian dan membuktikan hipotesis. Objek penelitian ini adalah aluminium AlMg 5083 yang kemudian diberi perlakuan yakni pengelasan dengan tetapan kuat arus dan variasi debit gas argon kemudian dilakukan pengujian kekerasan dan analisis struktur mikro. Hasil penelitian diperoleh dari variasi debit gas argon memberikan pengaruh terhadap kekerasan aluminium AlMg 5083. Debit gas argon 14 L/m memberikan hasil uji kekerasan tertinggi yaitu sebesar 31,63 HB pada daerah HAZ ,27, 95 HB pada base metal, dan 11,98 HB pada daerah weld metal. Nilai kekerasan terrendah terjadi pada variasi 18L/m dengan nilai kekerasan 22, 84 HB pada daerah HAZ, 26,69 HB pada daerah base metal dan 9,02 pada daerah weld metal. Untuk hasil struktur mikro yang dapat dianalisis yaitu cacat lasan. Logam lasan dengan variasi debit gas 14L/m memiliki cacat terbanyak jika dibandingkan dengan variasi debit gas argon 16L/m dan 18L/m. Sedangkan cacat paling sedikit terjadi pada spasimen dengan variasi debit gas 18L/m.

Penerapan model problem based learning untuk meningkatkan motivasi dan hasil belajar siswa pada mata pelajaran Menggunakan Hasil Pengukuran (MHP) kelas X-TIPTL SMK Negeri 2 Probolinggo / Muhammad Andi Bahtiar

 

ABSTRAK Bahtiar, Muhammad Andi. 2015. Penerapan Model Problem Based Learning UntukMeningkatkanMotivasidanHasilBelajarSiswapada Mata PelajaranMenggunakanHasilPengukuran (MHP) Kelas X-TIPTL SMK Negeri 2 Probolinggo. Skripsi. Program StudiPendidikanTeknikElektro, JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing : (1) Dr. Ir. H. SyaadPatmanthara, M.Pd. (2) YuniRahmawati, S.T., M.T. Kata Kunci : Model Problem Based Learning (PBL), MotivasiBelajardanHasilBelajar. Model pembelajaranProblem Based Learning (PBL) merupakansalahsatu model pembelajaran yang membuatsiswabelajarmelaluipenyelesaianpermasalahandunianyatasecaraterstrukturuntukmengonstruksipengetahuansiswa. Di SMK Negeri 2 Probolinggo ada berbagai mata pelajaran umum dan mata pelajaran produktif. Khususnya pada jurusan Teknik Listrik terdapat beberapa mata pelajaran dasar yang wajib ditempuh oleh siswa kelas X Teknik Instalasi dan Pemanfaatan Tenaga Listrik (TIPTL). Salah satu mata pelajaran dasar yang membutuhkan pemahaman lebih dari siswa yaitu mata pelajaran Menggunakan Hasil Pengukuran (MHP). Model yang digunakan pada saat proses pembelajaran adalah masih berpusat pada guru. Sehinggamembuatsiswakurangtermotivasidalampembelajarandanberdampakpadahasilbelajarsiswa yang masihbelumtuntas. Dalampenelitianini, telahditerapkan model Problem Based Learning (PBL) untukmeningkatkanmotivasidanhasilbelajarsiswa. Metodepenelitiankelas yang digunakanadalah model Kemmis&Mc.Taggart yang memanfaatkansiklussebagaitolakukurpenelitian. Padasetiapsiklusberisikantahapan-tahapanyaitu :perencanaan, tindakan, pengamatan, danrefleksi. Padapenelitianinidilaksanakansebanyak 2 siklusdengansubjekpenelitianadalahsiswakelas X TIPTL-2 SMKN 2 Probolinggo. Hasilpenelitian yang telahdilaksanakandiperoleh model keterlaksanaanpembelajaranpadasiklus I sebesar 74,16 %, meningkatpadasiklus II sebesar 89,99 %. Kemudianhasilbelajarsiswa yang tuntaspadasiklus I sebesar 70,37 %, lalumeningkatpadasiklus II sebesar 100 %. Tingkat motivasibelajarsiswapadasaat proses pembelajaranmenggunakan model Problem Based Learning (PBL)memilikipersentase rata-rata sebesar 84,25 % dengankualifikasi “Termotivasi”. Hasiltersebutmenunjukkankeberhasilanpenerapan model Problem Based Learning (PBL)yang telahdilaksanakanbermanfaatuntukmenjadikansiswalebihaktifdankomunikatifdalam proses pembelajaran. Serta dapatmeningkatkanhasilbelajardanmotivasibelajarsiswa.

Pengaruh arang aktif tempurung kelapa pada proses pemucatan minyak terhadap mutu minyak kelapa / oleh Maftuhah

 

Aranga ktif dalamb idangi ndustrim inyakd igunakans ebagabi ahanp emucat karenam ampum engadsorpswi amap adam inyak.U ntuk itu dicobad ibuata rang aktif dari tempurungk elopad engana ktivatorC aCl2je nuh danN aOH I M. Penelitian ini bertujuanm engetahumi utu aranga klif, pengaruhp enambahaanr anga klifpada prosesp emucatanm inyakk elapas ertam utu minyakk elapa. Tempurunkge lapac liarangkapna das uhu3 15o Cs elama1 ,5j am setelahit u diaktivasdi engana ktivator( l). CaCl:j enuh dimanal grama rangd itambah1 0g ram larutanC aCl2je nuhl alu dididihkans elama1 ,5j am setelahd ingind ipanaskadna lam tanurp adas uhu7 00 "C dengank enaikan5 'C / detik (2) NaOH I M sebanya2k 50 mL ditambahl 0 grama rangt empurungk elapas etelahit u dibiarkans elama2 4j am. Selanjutnyaar anga ktiftempurungk elagnd ana ranga ktif komersiadl ikarakteristimk elalui penentuakna dara ir; kadara bu,b eratjenisd, and ayas erapte rhadap1 2D. isamping itu dilakukanp embuatamn inyakk elapad enganc arap €ngambilasna ntanla lup roses pemucatamn inyakk elapad ilakukand enganc ara1 00m L minyakd ipanaskatne,p at padas uhu8 0 'C ditambahkana ranga ktifsebanyak0 ,2 gram,s uhup emanasan dipertahankapna das uhu1 05o C selama1 j am sambild ipanaskand iadukl alu disarings ehinggad iperolehf iltrat minyakk elapay angt elahd ipucatkant. angkah selanjutny5a gramm inyakk elapat ersebudt jencerkand enganp elaruti so hexana sampa1i 00m L dand itentukana bsorbansinypaa dap anjangg elomban4g5 0n m langkah terakhiyr aitud ilakukanu ji mutum inyakk elapam eliputip enentuakna dara ir,k otoran, bilanganio d, bilanganp enyabunanb,i langanp eroksidad, ana saml emakb ebas. Hasil penelitianm enuqjukkanb ahwam utu aranga ltif komersiald ant empurung kelapam emenuhSi II mutua ranga hil penambahaanr anga ktif komesiald ant empwwrg kelapab erpengarupha dap rosesp emucatanm inyakk elapas ertam utu minyaky ang dipucatkamn asihm emenuhSi II mutum inyak.D ari pembuataanr anga ktif tempurung kelapad engana ktivatorc acl2j enuhl ebihb aik mutunyab ila digrrnakapna dap roses p€mucatanm inyakk elapad aripadad engana ktivatorN aOH I M

Pengembangan multimedia pembelajaran interaktif aksara Jawa bagi tunagrahita di SMPLB Putra Jaya Kota Malang / Riza Ilmana Harir

 

ABSTRAK Ilmana, Riza. 2016. Pengembangan Multimedia Pembelajaran Interaktif Aksara Jawa bagi Tunagrahita di SMPLB Putra Jaya Kota Malang. Skripsi, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Abdul Huda, M.Pd, (II) dr. Agung Kurniawan, M.Kes. Kata Kunci: Aksara Jawa, multimedia pembelajaran interaktif, tunagrahita Mata pelajaran Bahasa Jawa kurang diminati siswa tunagrahita di SMPLB Putra Jaya Kota Malang karena proses belajar mengajar hanya menggunakan cara ceramah tanpa menggunakan suatu media. Penggunaan multimedia pembelajaran interaktif diduga bisa menjadi salah satu alternatif untuk menyelesaikan masalah tersebut. Tujuan penelitian dan pengembangan ini adalah membuat produk berupa multimedia pembelajaran interaktif dengan materi belajar Aksara Jawa bagi siswa tunagrahita hingga layak digunakan. Pengembangan produk dilaksanakan dengan metode dari Lee dan Owens yang mempunyai empat tahap pengembangan, yaitu (1) analisis, (2) desain, (3) pengembangan dan implementasi, serta (4) evaluasi. Validasi produk dilakukan melalui ahli media, ahli materi dan praktisi. Uji coba dilaksanakan dengan sasaran siswa tunagrahita di SMPLB Putra Jaya. Instrumen pengumpulan data adalah angket untuk validasi dan tes untuk uji coba. Hasil pengembangan telah menunjukkan bahwa produk berupa multimedia pembelajaran interaktif Aksara Jawa bagi tunagrahita di SMPLB Putra Jaya Kota Malang layak digunakan. Hasil pengembangan diperoleh melalui angket validasi dengan skor maksimal 4 dan skor minimal 1. Skor validasi ahli media adalah 3.87 (layak digunakan). Skor validasi ahli materi adalah 3.70 (layak digunakan). Skor validasi praktisi menghasilkan nilai 3.30 (menarik). Hasil implementasi menyebutkan skor seluruh anak pada post-tes adalah 87.5 dan pre-tes adalah 75.0 sehingga produk yang dikembangkan sudah efektif untuk digunakan. Saran untuk guru diharapkan agar media bisa digunakan pada setiap pembelajaran materi Aksara Jawa. Saran untuk siswa, media bisa dimanfaatkan sebagai sarana belajar di dalam kelas dan di tempat lain. Saran bagi sekolah, media ini bisa dijadikan sebagai alternatif kegiatan belajar mengajar untuk mencapai tujuan pembelajaran di SMPLB Putra Jaya. Saran diseminasi produk yaitu untuk sekolah luar biasa lain yang memiliki karakteristik sasaran yang sama dengan penelitian dan pengembangan ini.

Hubungan antara minat dan kompetensi keahlian dengan kesiapan melaksanakan PPL mahasiswa S1 PTI angkatan 2012 Jurusan Teknik Elektro Universitas Negeri Malang / Anys Luthfia Ulfa

 

ABSTRAK Ulfa, Anys Luthfia. 2015. Hubungan antara Minat dan Kompetensi Keahlian dengan Kesiapan Melaksanakan PPL Mahasiswa S1 PTI Angkatan 2012 Jurusan Teknik Elektro Universitas Negeri Malang. Skripsi, Jurusan TeknikElektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs. Wahyu Sakti Gunawan Irianto, M.Kom, (2) M. Zainal Arifin, S.Si., M.Kom. Kata Kunci:minat, kompetensi keahlian, kesiapan melaksanakan PPL, mahasiswa PTI Mahasiswa program studi S1 PendidikanTeknikInformatika (PTI) Angkatan 2012 akanmelaksanakan PPL pada semester gasal 2015/2016. Untukmelaksanakan PPL, tentumahasiswamemerlukankesiapan.Kesiapandalamkamuspsikologidiartikansebagaisuatutitikkematanganuntukmenerimaataumempraktekantingkahlakutertentu.Adapun yang dapatmempengaruhikesiapandiantaranyaadalahfaktorminatdankompetensikeahlianseseorang. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal, yang mencakup seberapa tinggi minat, seberapa tinggi kompetensi keahlian, seberapa tinggi kesiapan melaksanakan PPL, hubungan antara minat dengan kesiapan melaksanakan PPL, hubungan antara kompetensi keahlian dengan kesiapan melaksanakan PPL dan hubungan antara minat dan kompetensi keahliansecara simultan dengankesiapan melaksanakanPPL mahasiswa PTI Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Penelitian ini menggunakan pendekatankuantitatifdenganmenggunakanrancanganpenelitiandeskriptifkorelasional. Penarikan sampel pada penelitian ini dengan teknik proportional random sampling. Sebagai sampel dalam penelitian ini adalah 51 orang mahasiswa PTI Angkatan 2012 Jurusan Teknik Elekro Universitas Negeri Malang. Dalam penelitian ini, digunakan instrumen kuesioner/angket untuk mengukur minat dan kesiapan melaksanakan PPL, sedangkan untuk mengukur kompetensi keahlian mahasiswa, digunakan instrumen dokumentasi berupa daftar/tabel. Cara yang digunakan untuk menguji instrumen tersebut ada dua, yaitu uji validitas dan uji reliabilitas. Hasil dari penelitian ini adalah: 1) Tingkat minatmahasiswa S1 PTI Angkatan 2012 JurusanTeknikElektroUniversitasNegeri Malang beradapadakategoritinggiyaitusebanyak 31 responden (60,8%); 2) Tingkat kompetensikeahlianmahasiswa S1 PTI Angkatan 2012 JurusanTeknikElektroUniversitasNegeri Malang beradapadakategorisangattinggiyaitusebanyak 49 responden (96,1%); 3) Tingkat kesiapanmelaksanakan PPL mahasiswa S1 PTI Angkatan 2012 JurusanTeknikElektroUniversitasNegeri Malang beradapadakategoritinggiyaitusebanyak 29 responden (56,9%); 4) Ada hubungan yang positifdansignifikanantaraminatdengankesiapanmelaksanakan PPL mahasiswa S1 PTI Angkatan 2012 JurusanTeknikElektroUniversitasNegeri Malang sebesar 0,398 denganprobabilitasphitungFtabelyaitu 7,594 > 3,19 danprobabilitasphitung

Analisis bentuk, faktor penyebab, dan fungsi alih kode di Desa Klampok, Kecamatan Tongas, Kabupaten Probolinggo / Ratih Kumalasari

 

ABSTRAK Kumalasari, Ratih. 2014. Analisis Bentuk, Faktor Penyebab, dan Fungsi Alih Kode di Desa Klampok, Kecamatan Tongas, Kabupaten Probolinggo. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Abdus Syukur Ghazali, M.Pd, (II) Musthofa Kamal, S.Pd, M.Sn. Kata Kunci: bentuk, faktor penyebab, fungsi, alih kode Alih kode adalah penggantian bahasa, yang dipengaruhi oleh penutur, situasi tutur, dan tujuan tutur. Masyarakat dengan budaya dan bahasa yang beragam mungkin menggunakan dua bahasa bahkan lebih. Adanya kemampuan penggunaan dua bahasa yang dinamakan bilingual (dwibahasa) atau tiga bahasa atau multilingual (multibahasa), dapat menimbulkan gejala alih kode maupun campur kode. Tujuan penelitian ini adalah untuk mengetahui: (a) bentuk alih kode dalam percakapan yang terjadi di desa Klampok, (b) faktor apa yang menjadi penyebab terjadinya alih kode di desa Klampok, dan (c) untuk mengetahui fungsi interaksi alih kode dalam percakapan yang terjadi di desa Klampok. Metode penelitian yang digunakan dalam penelitian ini adalah metode penelitian deskriptif kualitatif. Data penelitian ini adalah percakapan di Desa Klampok Kecamatan Tongas Kabupaten Probolinggo. Pengumpulan data dilakukan dengan menggunakan teknik simak libat cakap, teknik elisitasi/pemancingan, teknik rekam, dan teknik catat. Dalam penelitian ini peneliti sebagai instrumen utama yang merencanakan, melaksanakan, menafsirkan, dan menyimpulkan data. Aktivitas analisis data penelitian ini meliputi identifikasi data, penyajian data, dan penarikan simpulan. Data yang diperoleh dianalisis dengan menggunakan SPEAKING yang terdiri atas: (a) setting and scene (latar), (b) participants (peserta), (c) ends of communications (maksud dan tujuan penuturan), (d) act Sequence (bentuk dan isi ujaran), (e) key emotions (nada, cara, dimana suatu pesan disampaikan), (f) instrumentalities (jalur bahasa yang digunakan), (g) Norm of interaction and interpretation (norma atau aturan dalam berinteraksi), dan (h) genres (jenis bentuk penyampaian). Hasil dari penelitian ini, menghasilkan bentuk alih kode sebagai berikut: (1) alih kode dengan kode dasar bahasa Jawa beralih kode ke BI atau BM (BJ—BI dan BJ—BM ); (2) alih kode dengan kode dasar bahasa Madura (BM—BJ dan BM—BI); (3) alih kode dengan kode dasar bahasa Indonesia (BI—BJ dan BI—BM); dan (4) alih kode antar tingkat tutur bahasa (BJN—BJK dan BJK—BJN). Bentuk variasi tersebut muncul pada aktivitas kehidupan sehari-hari dalam berbagai ranah bahasa, ranah profesi, keluarga, ketetanggaan, dan sebagainya. Faktor-faktor penentu alih kode dalam masyarakat tutur multibahasa di Kabupaten Probolinggo, yaitu (1) partisipan, (2) setting, (3) situasi dan (4) pokok pembicaraan. Pertama, partisipan yaitu: profesi, umur, hubungan darah, latar belakang bahasa, kedudukan, dan latar belakang pendidikan. Kedua, setting merupakan tempat dan waktu. Ketiga, situasi yaitu: tingkat keformalan, hadirnya orang ketiga, tingkat keakraban. Terakhir, pokok pembicaraan berkaitan dengan: topik dan kosa kata yang digunakan. Kemudian, fungsi alih kode yang terjadi di Desa Klampok Kecamatan Tongas Kabupaten Probolinggo yaitu: (1) untuk meminta tolong, (2) untuk menjalaskan dan memberikan informasi, (3) untuk mengakrabkan suasana, (4) untuk menawarkan sesuatu, (5) untuk menyampaikan rasa humor, dan (6) untuk menghindari pertengkaran. Terakhir, adanya kekhasan dalam penelitian Analisis Bentuk, Faktor Penyebab, dan Fungsi Alih Kode di Desa Klampok Kecamatan Tongas Kabupaten Probolinggo yakni: (1) keberagaman alih kode, (2) keakraban, (3) power and solidarity, (4) tua muda, (5) norma interaksi, (6) setting tidak mempengaruhi alih kode, dan (7) topik pembicaraan.

Evaluasi sistem akuntansi pengeluaran kas pada CV. Elang Multi Emas / Galih Mahaputra Dio Pradana

 

ABSTRAK Mahaputra Dio Pradana, Galih. 2016. Evaluasi Sistem Akuntansi Pengeluaran Kas ………….pada CV. Elang Multi Emas. Tugas Akhir, Jurusan Akuntansi, Fakultas ………….Ekonomi, Universitas Negeri Malang. Pembimbing: Diana Tien ………….Irafahmi, S.Pd., M.Ed. Kata Kunci: Sistem Akuntansi Pengeluaran Kas, Sistem Pengendalian Internal CV. Elang Multi Emas merupakan sebuah perusahaan yang bergerak di bidang jasa supply, fabrikasi, dan service conveyor system serta mesin-mesin untuk industri. Penulisan Tugas Akhir ini bertujuan untuk menjelaskan pelaksanaan unsur pengendalian internal terhadap sistem akuntansi pengeluaran kas, serta memberikan rekomendasi terhadap sistem akuntansi pengeluaran kas sesuai dengan unsur pengendalian internal. Metode penelitian yang digunakan dalam penulisan Tugas Akhir ini antara lain metode wawancara dan dokumentasi. Data yang diperoleh dari metode wawancara ialah informasi mengenai sumber pengeluaran kas apa saja yang terjadi di perusahaan, bagaimana prosedur pengeluaran kas, fungsi atau bagian karyawan, dokumen, dan catatan yang berhubungan dalam transaksi pengeluaran perusahaan. Sedangkan dari metode dokumentasi, diperoleh data berupa dokumen-dokumen yang berhubungan dengan transaksi pengeluaran kas. Hasil yang diperoleh dari penulisan Tugas Akhir ini ialah pelaksanaan unsur pengendalian internal terhadap sistem akuntansi pengeluaran kas pada perusahaan masih belum berjalan dengan baik, karena sistem yang berjalan di perusahaan masih belum sepenuhnya memenuhi keempat unsur pengendalian internal seperti belum adanya pemisahan tugas di bagian keuangan, dokumen dan catatan yang digunakan masih belum lengkap, belum adanya badan pengawas intern dalam perusahaan, serta karyawan yang bekerja belum pernah diikutsertakan pelatihan diklat. Rekomendasi yang diberikan penulis ialah : (1) perlu dilakukan penambahan karyawan akuntansi yang semula hanya berjumlah satu karyawan ditambah menjadi 4 karyawan, (2) penambahan dokumen yaitu bukti kas keluar yang dibuat rangkap dan cek pada prosedur pembelian bahan baku material, (3) perlu dibentuk akuntansi dana kas kecil untuk pengeluaran pembelian perlengkapan kantor dan biaya operasional kantor, (4) prosedur pembayaran pajak PPN perusahaan sebaiknya dilakukan dengan cek.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |