Implicitness in textual mode of 9GAG instagram postings / Atikah Dewi

 

ABSTRAK Dewi, Atikah. 2015. Keimplisitan dalam Mode Tekstual pada Postingan 9gag Instagram. Skripsi. Jurusan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Aulia Apriana, S.S., M.Pd., dan Pembimbing: (II) Maria Hidayati, S.S., M.Pd. Kata Kunci: keimplisitan, implikatur, prinsip kooperatif, 9gag Instagram. Penelitian ini menampilkan 9gag Instagram, salah satu situs internet penyedia humor, yang kaya akan implikatur sebagai objek penelitian. Penelitian ini bertujuan untuk menginvestigasi tipe-tipe implikatur dan perwujudannya. Penelitian ini menggunakan pendekatan deskriptif kualitatif dengan peneliti sebagai instrumen utama dan dalam kerangka teori tentang pragmatik, prinsip kooperatif, dan implikatur. Dua puluh data dipilih dari 9gag Instagram— media berbagi foto dan video online. Diawali dengan pemilihan postingan berdasarkan beberapa kriteria, seperti yang menggunakan mode tekstual, yang mengandung lebih dari satu kata, serta yang diposting pada Juli 2014. Kemudian, data dianalisis dengan mengacu pada kerangka teori. Selanjutnya, data dipresentasikan berdasarkan klasifikasi dan tabulasi. Penelitian ini menghasilkan tiga tipe implikatur, yaitu (1) particularized conversational implicature (PCI) (45%), (2) generalized conversational implicature (GCI) (40%), dan (3) conventional implicature (CI) (15%). Selain itu, berdasarkan pada perwujudan implikatur dalam teks, enam bentuk manifestasi digunakan di postingan 9gag Instagram, antara lain: (1) bridging (27.5%), (2) thematic switch (20.7%), (3) assertion (20.7%), (4) figures of speech (13.8%), (5) obscurity (7.0%), dan (6) p and q order (10.3%). Hasil penelitian mengindikasikan bahwa (1) implikatur pada postingan 9gag Instagram cenderung berdasar pada konteks karena PCI yang memperoleh frekuensi paling tinggi merupakan implikatur yang terikat dengan konteks; (2) tipe-tipe dan manifestasi implikatur saling terkait. Dengan demikian, penelitian ini diharapkan bermanfaat bagi para penikmat linguistik sebagai referensi tentang analisis implikatur. Akan tetapi, para peneliti selanjutnya disarankan untuk tidak hanya mengambil teks humor sebagai objek penelitian implikatur, melainkan teks non-humor seperti debat politik, iklan, karya sastra, dan teks lainnya yang mungkin mengangkat isu-isu menarik.

Persepsi guru terhadap gaya kepemimpinan kepala sekolah dan hubungannya dengan motivasi kerja di Yayasan Perguruan Ardjuna Malang oleh Ahmad Nur Abadi

 

Kepemimpinane rat kaitannyad enganm otivasi. Sementarait u motivasi merupakania lah satuf ungsi dari manajemeny ang p€rannyac ukup besaru ntuk rnempengaruhdia n mendorongs eseorangu ntuk bekerja dan melaksanakantu gastugas; ya=dengabna ik. Penelitiani ni dirancangs ecarak uantitatifkorelasional,s esuai dengantu juan penelitiani ni adalahe xpost-factoy ang bertujuanu ntuk ln"ng*giupt an hubungans ebaba kibat antarav ariabel tanpam emanipulassi uatu varialet. Variabel bebas dalam penelitian ini adalah kepemimpinan kepala sekolah (X), sedangkavna riabelt erikatnyaa dalahm otivasi kerja guru (Y)' Penelitian ini bertujuan untuk mengetahui persepsi guru terhadap pelaksanaagna yak epemimpinank epalas ekolahd i YayasanP erguruanA rdjuna t tutang,u ntuk mengetahuki ondisi motivasi kerja guru di YayasanP erguruan Ardjuna Malang dan untuk mengetahui hubungan antara persepsi gUru terhadap pelaksanaagna yak epemimpinank epalas ekolahd an mOtivasik erja di Yayasan Per-g uruanA rdjuna Malang. Dalamp enelitianin i penelitim engambisl ampe4l 7%daipopulasi yang ada" karena sudah mewakili populasi yang melebihi 100 orang serta sesuai dengan pendagaAt rikunto, denganm engunakante knik acak.D ata yang sudaht erkumpul lemudiund icari prosentascm asing-masingv ariabel kemudiand ianalisisd enganu ji korelaspi roduct momenlu ntuk emngetahuhi ubungana ntarv ariabel. Temuan peneliiian menunjukkan bahwa persepsi guruterhadap gaya kepemimpinanke palas ekolah adalah5 9o/or espondente rmasukd alamk riteria sangat i;ggi,3To/o termasukd alam kriteria tinggq,4 Yot ermasukd alam kriteria sedangd, an 07oi ermasukd alam kriteria rendah.S edangkans kor rata-rataI 13, sehinggate rmasuk dalam kriteria sangat tinggi. Kondisi motivasi kerja guru di Yayasan Perguruan ArdjunaM alangt ermasukk riteria sangatti nggi adalah6 5yo,3l o/ote rmasukd alam hiteria tinggi, 4% termasuk dalam kriteria sedang, dan 0% termasuk dalam kriteria rendah.S edangkans kor rata-rata1 03,9,s ehinggat ermasukd alamk riteria sangat tinggi. Hasil penghitungand enganu ji korelasiP roduct Momenl menunjukkanb ahwa r":0,614 dengann ilai sig.(2-tailed)0 ,000,d engand emikiant ermasukd alam kriteria cukup tinggi. Hal ini menunjukkan bahwa ada hubungan yang sigrrifikan antarap ersepsgi uru terhadapg ayak epemimpinank epala sskolahd an motivasi kerjanyad i YayasanP erguruanA rdjuna Malang. Dari hasilp enelitianm akad isarankan(:l ) Kondisi gayak epemimpinan yang dipakai oleh kepala sekolah di Yayasan Perguruan Ardjuna harus tetap dipertahankan(,2 ) Mengingatp entingnyap eranang uru disekolahh endaknyad engan penuh kesadaran mau dan mampu meningkatkan motivasi kerjany4 (3) Sejalan denganit u penulism enaruhh arapank epadap embinad an pengawass ekolaht erutama pihakY ayasana gars ecaraa ktifmengupayakanp embinaand an peningkatante rhadap gayak epemimpinank epalas ekolahd an motivasi ke{a guru, (a) Untuk memperluas kajian tentang gaya kepemimpinan kepala sekolah dan motivasi kerja guru, perlu adanyap enelitianl ebih lanjut tentangk eduah al tersebuty angb elum sempatd iteliti olehp enelitianin i, (5) Bagi penelitil anjutan,d apatm enelitid enganm emakaoi bjek penelitians elaind i YayasanA rdjuna Malang.

Portrayal of psychophatic behavior and predatory traits in stoker / Disfira Ika Amelia

 

ABSTRAK Amelia, Disfira Ika. Gambaran Perilaku Psikopat dan Sifat-sifat Predator di Stoker. Skripsi, Bahasa dan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Moch. Nasrul Chotib, S.S., M.Hum., dan (II) Drs. Arif Subiyanto, M.A.. Kata kunci: perilaku psikopat, pengalaman masa kanak-kanak, sifat predator Kepribadian dan perilaku seseorang tidak terbentuk secara spontan. Akan selalu ada beberapa stimulan yang mempengaruhi dinamika perilaku tersebut yang akan terjadi secara berulang dan menjadi pola dalam berperilaku. Stimulan tersebut terbentuk dari pengalaman masa lalu saat kanak-kanak yang mempengaruhi perilaku di saat dewasa. Eksistensi, interaksi, kasih sayang, dan dukungan keluarga adalah beberapa contoh yang dialami pada pengalaman masa kanak-kanak. Pengaruh kuat dari perilaku buruk akan membuat seseorang menderita perilaku yang abnormal dan menyimpang. Salah satu perilaku menyimpang yang sangat mungkin dialami oleh siapa saja di masyarakat adalah psikopatik. Perilaku abnormal ini secara umum digambarkan sebagai makhluk anti-sosial yang memiliki penampilan menawan dan mampu memanipulasi keadaan. Karakter yang memberikan peran besar di film Stoker, Charlie Stoker, khususnya pola perliakunya sebagai seorang psikopat mencerminkan beberapa kesamaan dengan sifat-sifat hewan predator. Perlaku psikopatnya dianggap sebagai sosok predator yang mencari korban yang lebih lemah untuk dibunuh dan dimusnahkan. Selain itu, sebagai seorang predator, Charlie pun telah memilih area perburuannya, yaitu keluarga Stoker. Untuk menganalisa wacana psikopat dan pengaruh perilaku menyimpang tersebut, akan sangat penting untuk memahami lebih dalam dalam pengaplikasiannya. Beberapa teori mengenai pikiran dan perilaku manusia seperti psikoanalisa, perkembangan perliaku anak-anak dan psikopat dipilih sebagai dasarnya.

Percakapan dalam media sosial twitter / Lutfia Silviana

 

ABSTRAK Silviana, Lutfia. 2014. Percakapan dalam Media Sosial Twitter. Skripsi, Jurusan Bahasa dan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. A. Syukur Ghazali, M.Pd, (II) Dra. Hj. Ida Lestari, M.Si. Kata Kunci: percakapan, media sosial Twitter, SPEAKING, pola percakapan tulis dan tidak langsung Percakapan adalah kegiatan komunikasi yang melibatkan sedikitnya dua orang untuk menyampaikan maksud pribadi. Percakapan menjadi mudah karena didukung oleh teknologi yang menyediakan fasilitas berkomunikasi. Fasilitas tersebut adalah media sosial khususnya Twitter. Media sosial Twitter berkaitan dengan fenomena berkomunikasi pada saat ini. Percakapan dalam media sosial dikaitkan dengan komponen tutur dari aspek SPEAKING yaitu setting, participant, ends, act sequences, key emotions, instrumentalities, norm of interaction, dan genre. Penelitian ini bertujuan untuk mengetahui aspek SPEAKING dalam media sosial Twitter dan mengetahui pola-pola percakapan secara tertulis dan tidak langsung yang membedakan dari pola-pola percakapan secara lisan dan langsung. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif, dengan orientasi teoretis etnografi komunikasi. Peneliti mengamati percakapan dalam media sosial Twitter. Peneliti merancang instrumen penelitian sesuai kajian pustaka yang telah peneliti lakukan. Data berupa percakapan secara tertulis dalam media sosial Twitter. Sumber data adalah akun-akun pribadi dalam media sosial Twitter. Penelitian ini termasuk dalam penelitian lapangan, sebab peneliti melakukan observasi dan dokumentasi untuk memperoleh data. Analisis data dilakukan dengan mengidentifikasi, mengklasifikasi, dan membuat pengkodean. Berdasarkan analisis data dan pembahasan, diperoleh hasil penelitian bahwa kedelapan aspek SPEAKING, yaitu setting, participant, ends, act sequences, key emotions, instrumentalities, norm of interaction, dan genre digunakan pada percakapan dalam media sosial Twitter. Namun, tidak semua aspek tersebut tampak. Ditemukan aspek yang hilang yaitu setting dan key emotions. Pada aspek setting, latar tempat hilang digantikan dengan situasi. Pada aspek key emotions, perasaan tidak tampak jelas dan digantikan dengan aspek Instrumentalities. Ditemukan pula aspek yang bergeser yaitu ends, act sequences, dan norm of Interaction. Pada aspek ends lebih condong pada maksud tujuan daripada maksud hasil. Pada act sequences mengalami banyak ketidaksepadanan topik. Pada norm of interaction mengalami banyak negative face daripada positive face. Terdapat 6 pola percakapan yang ditemukan sesuai hubungan antar aspek SPEAKING. Antara lain participant- ends, participant-act sequences, participan – instrumentalities, participant- norm of interaction, participant –genre, dan key – intrumentalities. Dari masing-masing tersebut saling dikaitkan dan mendapatkan pola-pola yang lebih spesifik dari pola sebelumnya. Penelitian pada percakapan dalam media sosial Twitter yang dilihat berdasarkan aspek SPEAKING terdapat dua kesimpulan. Pertama, percakapan tulis tidak sebaik percakapan secara lisan dan langsung. Percakapan tulis dan tidak langsung terdapat aspek yang hilang seperti setting tempat dan key emotions. Dan aspek yang bergeser seperti ends, act sequences, dan norm of interaction. Kedua, berdasarkan data dan pola yang terbentuk, ditemukan banyak pola yang berhubungan dengan partisipan. Maka, pada percakapan tulis dan tidak langsung aspek participant berperan penting dalam tersampainya sebuah pesan tersebut. Penelitian ini disarankan pada 3 pihak antara lain calon peneliti, mahasiswa bahasa dan sastra, dan pemerhati bahasa. Pada calon peneliti, penelitian ini dapat digunakan untuk mengetahui perbedaan percakapan secara tulis dan tidak langsung dengan percakapan secara lisan dan langsung. Pada mahasiswa bahasa dan sastra, penelitian ini sebagai inspirasi penelitian berikutnya bahwa bahasa mengikuti fenomena dalam masyarakat. Fenomena media sosial Twitter dan bahasa yang digunakan, menjadi contoh bahwa penelitian bahasa tidak selesai pada satu generasi saja. Namun ada perubahan pada generasi yang akan datang dengan perubahan pada aspek bahasa pula. Pada pemerhati bahasa, sebagai acuan untuk melihat pergerakan bahasa dan masyarakatnya. Bahasa yang digunakan oleh masyarakat dapat diidentikkan dengan keadaan masyarakat itu sendiri. Maka dari itu, pemerhati bahasa dapat menyikapinya dari sisi kesopanan dan kedinamisan masyarakat pengguna bahasa khususnya dalam media sosial Twitter.

Peningkatan hasil belajar PKN dengan model experiential learning pada siswa kelas 5 SDN 2 Dandangan kota Kediri, /Dwi Ratna Bayu Kusuma

 

Kata kunci: Hasil belajar, PKn, Experiential learning. Pemilihan Penerapan Experiential Learning sebagai judul penenilitian dalam pembelajaran PKn adalah karena masih rendahnya hasil belajar PKn siswa kelas V SDN 2 Dandangan Kota Kediri. Selama beberapa pertemuan terakhir nilai rata – rata kelas kurang dari 65. Persentase ketuntasan siswa hanya 20%. Hal ini dikarenakan oleh beberapa hal, salah satunya adalah selama ini pembelajaran yang dilakukan guru hanya mengunakan metode ceramah tanpa menggunakan media apapun. Hal tersebut membuat motivasi siswa kurang dan berakibat pada rendahnya hasil belajar. Penulisan skripsi ini bertujuan untuk mendeskripsikan penerapan Experiential Learning pada pembelajaran PKN di kelas V semester ganjil tahun ajaran 2011 – 2012 SDN 2 Dandangan Kota Kediri. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) rancanan penelitian dirancang sebanyak dua siklus yang dilaksanakan pada siswa kelas V SDN 2 Dandangan Kota Kediri semester ganjil tahun ajaran 2011 – 2012. Setiap siklus terdiri atas tahap perencanaan, tindakan, observasi, dan refleksi. Kegiatan refleksi dilakukan setiap akhir siklus dan digunakan sebagai penentuan tindakan pada siklus berikutnya.Tahap penelitian dilakukan secara kolaboratif dengan guru kelas V sebagai observer Pengambilan data dilakukan dengan tes dan nontes. Alat pengambilan data yang digunakan berupa pedoman observasi, pedoman wawancara, dan dokumentasi. Analisis data dilakukan secara deskriptif kualitatif. Penerapan experiential learning dapat meningkatkan hasil belajar PKN kelas V SDN 2 Dandangan. Hal ini dapat dilihat dari nilai naiknya persentase ketuntasan pelaksanaan pembelajaran jika pada pra siklus persentase ketuntasan hanya 20% pada siklus I menjadi 70%. Sedangkan pada siklus II sebesar 93%. Persentase aktivitas guru dalam pembelajaran PKn dengan penerapan experiential learning mengalami peningkatan di tiap siklusnya, pada pra siklus persentase keaktifan guru hanya 14 % pada siklus I persentase aktivitas guru menjadi 61%, dan pada siklus II meningkat menjadi 92%. Berdasarkan pembahasan maka dapat disimpulkan bahwa penerapan Experiential Learning dapat meningkatkan hasil belajar PKn siswa kelas V SDN 2 Dandangan Kota Kediri hal ini terbukti dengan meningkatnya hasil belajar siswa baik secara individu ataupun kelompok. Dengan pembelajaran yang terkoordinasi dengan baik dari penyampaian informasi tentang materi pembelajaran kepada siswa, pembentukan kelompok yang hiterogen, pemberian tugas secara berkelompok, pelaksanaan langkah – langkah experiential learning dalam pembelajaran, serta dengan pengawasan dan bimbingan oleh guru pada kegiatan yang dilakukan siswa, maka pembelajaran akan dapat mencapai hasil yang lebih baik dan lebih maksimal.

Perancangan sistem auto switching berbasis arduino untuk pembangkit listrik tenaga surya / Syadidatul Fahmiah

 

ABSTRAK Fahmiah, Syadidatul. 2016. Perancangan Sistem Auto Switching Berbasis Arduino untuk Pembangkit Listrik Tenaga Surya . Tugas Akhir, Jurusan Teknik Elektro. Program Studi D3 Teknik Elektro, Fakultas Teknik. Universitas Negeri Malang. Pembimbing: Arif Nur Afandi, S.T., M.T., MIAEng, MIEEE, Ph.D. Kata Kunci : Auto Switching, Arduino, PLTS Auto switching adalah suatu alat yang berfungsi untuk mengatur proses pemindahan sumber energi listrik yang satu(utama) ke sumber listrik yang lain (cadangan) secara bergantian yang sesuai dengan perintah program. Dengan menggunakan alat ini, maka tidak diperlukan lagi menggunakan saklat Change Over Switch (COS) yang dilakukan secara manual dalam proses pengalihan antara sumber listrik untama ke sumber listrik cadangan. Bila dibandingkan dengan pengerjaan secara manual, sistem peralatan yang dikendalikan dengan otomatisasi akan memberikan keuntungan dalam efisiensi, keamanan, dan ketelitian. Sistem auto switching ini menggunakann mikrokontroler Atmega328P yang bertujuan untuk mempermudah pengendalian sistem. Tahapan dalam perancangan alat ini terdiri dari (1) blok diagram, (2) perencanaan hardware, (3) perencanaan software, dan (4) pengujian. Pengujian rancangan ini dilakukan dengan cara menguji tiap blok komponen dan pengujian sistem keseluruhan. Hasil pengujian menunjukkan bahwa pada saat sumber listrik utama PLN aktif maka beban akan dilayani oleh PLN, ketika PLN mengalami pemadaman, beban akan dilayani oleh PLTS. Proses pemindahan sambungan listrik terjadi disebabkan karena turunnya tegangan yang masuk dari sumber listrik utama maka secara relay otomatis memerintahkan pada sumber cadangan melakukan starting. Dengan demikian perancangan sistem auto switching yang dibuat dapat berfungsi dengan baik.

Penerapan model inkuiri terbimbing untuk meningkatkan keterampilan proses sains siswa pada materi fluida dinamis kelas XI MIA 2 SMA Negeri 1 Tumpang / Firmanilah Kamil

 

ABSTRAK Kamil, Firmanilah. 2015. Penerapan Model InkuiriTerbimbinguntukMeningkatkanKeterampilan Proses SainsSiswapadaMateriFluidaDinamisKelas XI MIA 2 SMANegeri 1 Tumpang. Skripsi, Program StudiPendidikanFisika, JurusanFisika, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pemimbing: (I) Dr. Parno, M.SI, (II) Drs. PuroSwasono, M.SI. Kata kunci:keterampilan proses sains, inkuiriterbimbing, fluidadinamis, penelitiantindakankelas Keterampilan proses sainssiswakelas XI MIA 2 SMA Negeri 1 Tumpangmasihrendah. Hal inidibuktikandenganhasilobservasi yang dilakukanpadakelasyang berjumlah 36 siswadengan 13 siswaputradan 23 siswaputriini. Saatpraktikumgerakharmonissederhana, keterampilan proses sains di kelas XI MIA 2 sebesar15,74% denganrinciansebagaiberikut: mengobservasi 0%, menentukanvariabel 0 %, menyusunhipotesis 0 %, melakukaneksperimen 36,1% (13 anak), mengukur 36,1 %(13 anak), menabelkan data 33,3%(12 anak), memproses data 27,78%(10 anak), menyimpulkan 5,56%(2anak), danmengkomunikasi 2,78%(1anak). Penelitianiniadalahpenelitiantindakankelas yang bertujuanuntukmendeskrispsikanpembelajarandengan model inkuiriterbimbinggunameningkatkanketerampilan proses sainssiswakelas XI MIA 2 SMA Negeri 1 Tumpang.Penelitianiniterdiridari 2 siklus, setiapsiklusterdiridariidentifikasimasalah, perencanaantindakan, pelaksanaantindakan, observasidanrefleksi. Data keterlaksanaanpembelajarandan data keterampilan proses sainssiswadiperolehdarilembarobservasi. Hasilpenelitianmenunjukkanbahwaterdapatpeningkatanketerampilan proses sainssiswadengan model pembelajaraninkuriterbimbingpadasetiapsikluspenelitian. Keterampilan proses sainsmengobservasipadasiklus I sebesar 64.26% meningkatmenjadi 82.83% padasiklus II dengankategoribaik. Keterampilanmenentukanvariabel 43.45% meningkatmenjadi 77.21% dengankategoribaik.Keterampilanmenyusunhipotesis 36.72% menjadi 72.98% dengankategoricukup.Keterampilanmelakukaneksperimen 69.47% menjadi 82.75% dengankategoribaik.Keterampilanmengukurdanataumenyusuntabel data 45.46% menjadi 85.61% dengankategoribaik.Keterampilanmemproses data 45.13% menjadi 85.14% dengankategoribaik.Keterampilanmenyimpulkan 9% menjadi 83.8% dengankategoribaik.Keterampilanmengkomunikasi 16.49% menjadi 85.1% dengankategoribaik.Berdasarkanpaparan data danpembahasan, dapatdisimpulkanbahwapenerapan model inkuiriterbimbingdapatmeningkatkanketerampilan proses sainssiswakelas XI MIA 2 SMA Negeri 1 Tumpangmaterifluidadinamis.

Pengaruh penggunaan media sejarah Islam Indonesia berbasis aplikasi android terhadap minat belajar siswa kelas X Ilmu-Ilmu Sosial (IIS) pada matapelajaran sejarah SMA Negeri 3 Jombang / Bunga Pahlawanita Fatmasari

 

ABSTRAK Fatmasari, BungaPahlawanita. 2016. PengaruhPenggunaan Media Sejarah Islam Indonesia BerbasisAplikasi Android TerhadapMinatBelajarSiswaKelas X Ilmu-IlmuSosial (IIS) Mata PelajaranSejarah SMA Negeri 3 Jombang, JurusanSejarah, FakultasIlmuSosial, UniversitasNegeri Malang.Pembimbing: (I) Drs. I WayanLegawa, M.Si, (II) Dr. R. Reza Hudiyanto, M. Hum. Kata Kunci: mediapembelajaran,Sejarah Islam Indonesia,android, minatbelajar Permasalahan yang dikajidalampenelitianiniadalahpengaruh media Sejarah Islam Indonesia berbasisaplikasiandroidterhadapminatbelajarsejarahsiswakelas X Ilmu-IlmuSosial (IIS) SMANegeri 3 Jombang. Berdasarkanpermasalahan yang dikajiadapunrumusanmasalahdalampenelitianiniadalahsebagaiberikut: (1) bagaimanaminatbelajarsiswakelas X Ilmu-IlmuSosial (IIS) SMA Negeri 3 Jombangtanpamenggunakan media Sejarah Islam Indonesia berbasisaplikasiandroid, (2) bagaimanaminatbelajarsiswakelas X Ilmu-IlmuSosial (IIS) SMA Negeri 3 Jombangdenganmenggunakan media Sejarah Islam Indonesia berbasisaplikasiandroid?, (3) bagaimanapengaruh media Sejarah Islam Indonesia berbasisaplikasiandroidterhadapminatbelajarsejarahsiswakelas X Ilmu-IlmuSosial (IIS) SMA Negeri 3 Jombang? PenelitianinimerupakanpenelitianeksperimendenganmenggunakanpendekatankuantitatifdenganbentukQuasy Experimental Design.JenisQuasy Experimental Design yang digunakandalampenelitianiniadalahNonequivalent Control Group Design.Teknikpengambilansampel yang digunakanadalahnonprobabilitysampling dantipe yang digunakanpurposive sampling.Sampeldalampenelitianiniadalahkelas X IIS 3 sebagaikelaseksperimendankelas X IIS 2sebagaikelaskontrol. Berdasarkanhasilanalisis, data penelitiandapatdisimpulkansebagaiberikut: (1) minatbelajarsiswatanpamenggunakan media Sejarah Islam Indonesia berbasisaplikasiandroidmemilikinilai rata-rata minatbelajarsiswasebelumperlakuan=56,06, sedangkannilai rata-rata minatbelajarsetelahperlakuan=63,77, (2) minatbelajarsiswadenganmenggunakan media Sejarah Islam Indonesia berbasisaplikasiandroidmemilikinilai rata-rata minatbelajarsiswasebelumperlakuan=56 , sedangkannilai rata-rata minatbelajarsetelahperlakuan=78,9, (3) perbedaanminatbelajarsiswa yang signifikanantarakelaseksperimendankelaskontrolsetelahdiberikanperlakuan media Sejarah Islam Indonesia berbasisaplikasiandroid.Hal tersebutdibuktikandenganhasilujithitunglebihbesarttabelyaitusebesar8,366>1,998.Ujistatistikgainscoredidapatkan rata-rata gainscoresiswakelaseksperimenadalah22,90dan rata-rata gainscorekelaskontroladalah 7,70. Makahipotesis H0 ditolakdan H1diterimakarenaadapengaruh media Sejarah Islam Indonesia berbasisaplikasiandroid terhadapminatbelajarsiswa. Saran dalampenelitianiniadalah(1) bagi guru, dapatmenggunakan media Sejarah Islam Indonesia berbasisaplikasiandroid dalam proses pembelajaransejarahuntukmenarikminatbelajarsiswa, (2) bagisiswa, dapatmencapaikeberhasilandalambelajar (3) bagipeneliti lain hendaknyamenggunakanmedia pembelajaranberbasisaplikasiandroidlainnya yang lebihbaikdalam proses pembelajaransejarahterutamaterhadapminatbelajarsiswadenganmenggunakan media Sejarah Islam Indonesia berbasisaplikasiandroid.

Pengaruh model pembelajaran problem based learning terhadap penguasaan konsep fisika siswa materi teori kinetik gas kelas XI MIA SMAN 6 Malang / Mida Ifrotul Ika

 

ABSTRAK Ika, Mida Ifrotul. 2015. Pengaruh Model Pembelajaran Problem Based Learning Terhadap Penguasaan Konsep Fisika Siswa Materi Teori Kinetik Gas Kelas XI MIA SMAN 6 Malang. Skripsi. Program Studi Pendidikan Fisika, Jurusan Fisika, Universitas Negeri Malang. Pembimbing: (1) Drs. Sutarman, M.Pd., (2) Drs. Agus Suyudi, M.Pd. Kata Kunci: Problem Based Learning, Penguasaan Konsep Penguasaan pengetahuan yang mendalam perlu ditingkatkan melalui kegiatan pembelajaran agar siswa tidak hanya sekedar menghafal materi, tetapi mampu memiliki penguasaan konsep yang baik. Penguasaan konsep dapat dilatihkan pada siswa dalam memecahkan masalah dengan cara mengumpulkan serangkaian konsep yang dirumuskan untuk menyelesaikan masalah tersebut. Salah satu cara untuk melatih siswa adalah dengan pemberian model pembelajaran sesuai kurikulum 2013 yang berbasis pemecahan masalah, yaitu model Problem Based Learning. Model Problem Based Learning menitikberatkan pada kemampuan siswa dalam memandang suatu permasalahan atau fakta sains menurut pengetahuan yang dimilikinya. Model ini mendekatkan siswa pada masalah dunia nyata sebagai suatu konteks untuk belajar untuk memperoleh pengetahuan dan konsep yang esensial dari materi pelajaran. Siswa yang belajar memecahkan suatu masalah akan menerapkan pengetahuan yang dimilikinya atau berusaha mengetahui pengetahuan yang diperlukannya. Pada pembelajaran Problem Based Learning, siswa mengintegrasikan pengetahuan secara relevan sehingga masalah-masalah dalam aplikasi suatu konsep atau materi akan mereka temukan sekaligus selama proses pembelajaran berlangsung. Tujuan penelitian ini adalah untuk mengetahui penguasaan konsep siswa yang belajar dengan model Problem Based Learning lebih tingi daripada siswa yang belajar secara konvensional. Jenis penelitian ini adalah Quasi Experimental Design dengan menggunakan Nonequivalent Control Group Design dengan pretest dan posttest. Model pembelajaran sebagai variabel bebas dan kemampuan penguasaan konsep sebagai variabel terikat. Populasi penelitian adalah empat kelas XI MIA SMAN 6 Malang. Sampel penelitian ini adalah dua kelas XI MIA, yaitu siswa kelas XI MIA 4 sebagai kelas eksperimen dan kelas XI MIA 3 sebagai kelas kontrol. Penguasaan konsep siswa diukur dengan tes objektif beralasan. Instrumen tes terlebih dahulu diuji validitas dan realibilitas. Sebagai uji prasyarat dilakukan uji normalitas dengan menggunakan uji Lilliefors dan uji homogenitas menggunakan uji Fisher. Uji hipotesis menggunakan uji-t dengan taraf signifikasi 5%. Hasil penelitian adalah penguasan konsep siswa yang belajar dengan menggunakan model pembelajaran Problem Based Learning lebih tinggi daripada siswa yang belajar secara konvensional.

Penerapan strategi "mind mapping" untuk meningkatkan pemahaman mahasiswa Jurusan Sastra Arab Universitas Negeri Malang dalam pembelajaran al-qira: 'ah al-ula: / Puteri Septia Rizki Handayani

 

ABSTRAK Handayani, Puteri Septia Rizki. 2016. Penerapan Strategi Mind Mapping untuk Meningkatkan Pemahaman Mahasiswa Jurusan Sastra Arab Universitas Negeri Malang dalam Pembelajaran Al-Qira:`ah Al-U:la:. Skripsi, Jurusan Sastra Arab, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (1) Dr. Irhamni, M.Pd, (2) Dra. Nur Anisah Ridwan. M.Pd. Kata kunci:strategi mind mapping, pemahamanmahasiswa,Qira:`ah Kegiatan membaca pada pembelajaran Al-Qira:`ah Al-U:la:di offering A 2014 tidak jarang dihadapkan pada berbagai masalah. Salah satu permasalahan yang dihadapiadalahpemahaman mahasiswa tentang isi suatu teks. Kemampuan mahasiswa dalam memahami teks cukup baik. Namununtuk lebih meningkatkan pemahaman mahasiswa menjadi lebih baik diperlukan strategi belajar yang dapat membantu memahami dengan baik materi yang dipelajari. Sehingga pembelajaran lebih efisisen dan efektif. Salah satunya adalah strategi mind mapping. Strategi mind mapping adalah strategi merangkum materi secara visual dan grafis dalam satu halaman penuh dengan topik inti di tengah dan subtopik sebagai cabangnya. Tujuan dalam penelitian ini adalah mendeskripsikan penerapan strategi mind mapping untuk meningkatkan pemahaman mahasiswa JSA-UM dalam pembelajaran Al-Qira:`ah Al-U:la:serta mendeskripsikan peningkatan pemahaman mahasiswa JSA UM dengan strategi mind mapping dalam pembelajaranAl-Qira:`ah Al-U:la:. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang terdiri atas dua siklus, tiap siklus dua pertemuan. Teknik pengumpulan data yang digunakan adalah observasi, wawancara, angket, tes, dan dokumentasi. Pada penelitian ini terdapat dua jenis data yaitu data kuantitatif dan data kualitatif. Data kuantitatif dianalisis menggunakan analisis data model Miles dan Huberman yang meliputi pengumpulan data dan pengecekan, reduksi data, penyajian data, dan penyimpulan. Hasil penelitian menunjukkan bahwa (1) penerapan strategi mind mappinguntuk meningkatkan pemahaman mahasiswa offering A 2014 dalam pembelajaran Al-Qira:`ah Al-U:la: berlangsung sangat efektif sebesar 73,24% pada siklus I dan 77,57% pada siklus II. (2) adanya peningkatan terhadap hasil belajar mahasiswa offering A 2014 dalam pembelajaran Al-Qira:`ah Al-U:la: setelah diterapkan strategi mind mappingdengan nilai rata-rata76.31 pada siklus I dan 87.71 pada siklus II. Berdasarkan hasil penelitian, disarankan kepada dosen Qira:`ah hendaknya menerapkan strategi mind mapping sebagai variasi dalam kegiatan pembelajaran untuk membantu mahasiswa belajar secara mandiri dan meningkatkan keterampilan berbahasa Arab terutama keterampilan membaca. Kepada mahasiswa hendaknya menggunakan berbagai macam strategi belajar salah satunya strategi mind mapping untuk meningkatkan keterampilan berbahasa Arab dan melatih diri untuk belajar secara mandiri. Kepada Peneliti selanjutnya, hendaknya melakukan penelitian sejenis dengan menerapkan jenis strategi belajar yang lain untuk membantu meningkatkan keterampilan berbahasa Arab mahasiswa.

The concept of politeness: study on English and Indonesian coordinated pronoun / Sarifah Rugayah Assgaf

 

ABSTRAK Assgaf, Sarifah Rugayah. 2015. Konsep Kesopanan: Studi Frasa endosentris koordinatif Ingggris dan Indonesia. Skripsi, Jurusan Bahasa dan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Dosen Pembimbing: Evynurul Laily Zen, SS, MA dan Dr. Hj. Emalia Iragiliati, M. Pd Kata Kunci: Endosentris koordinatif, kontrastif , kesopanan Tujuan dari penelitian ini adalah untuk mengeksplorasi variasi penggunaan endosentris koordinatif bahasa inggris dan bahasa Indonesia serta nilai kesopanaan dalam frasa tersebut. Studi korpus dilakukan untuk mengumpulkan penggunaan frasa endosentris koordinatif dalam dua bahasa. Kemudian data dari korpus tersebut (COCA dan SEAlang) dianalisis secara manual untuk menunjukan penggunaan endosentris koordinatif dalam posisi subjektif dan objectif. Setelah data korpus dihitung secara manual, masing-masing temuan dari ke dua korpus diidentifikasi. Daftar hasil diklasifikasikan dalam setiap variasi dan ditampilkan dalam analisis dan temuan. Di sini, penelitian ini ditunjukkan berdasarkan jumlah sumber dari penelitian sebelumnya dan buku linguistik. Temuan menunjukkan bahwa persamaan kedua frasa adalah frasa endosentris koordinatif Inggris dan Indonesia dapat meduduki posisi subjek dan objek. Selain itu kata ganti tunggal Inggris dan Indonesia juga dapat diletakkan di posisi pertama atau terakhir dalam frasa endosentris koordinatif. Perbedaannya adalah temuan menunjukkan bahwa variasi frasa endosentris koordinatif kata ganti orang pertama bahasa Inggris ada baik dalam posisi subjek dan objek, meskipun bentuk persepsi standar subjektif lebih menonjol daripada di posisi objek. Sementara itu pronomina pada frasa endosentris koordinatif Indonesia memiliki bentuk yang sama apakah itu dalam posisi subjek atau objek. Temuan juga menunjukkan frekuensi tertinggi datang dari varian X dan I untuk posisi subjektif dan varian Me dan X pada posisi objektif.Sementara Frasa kata ganti pertama endosentris koordinatif dalam bahasa Indonesia menunjukkan frekuensi tinggi Saya dan X dan Aku dan X yang berkontribusi pada posisi subjek. Namun posisi subject mendominasi dari kedua varian Aku dan X dan Saya dan X. Diketahui juga bahwa varian X and I dianggap bentuk sopan dari varian frasa endosentris terkoordinasi inggris, sementara di Indonesia, Saya dan X dan X dan Saya keduanya dianggap sopan karena penggunaan kata ganti tunggal formal (Saya) Kesimpulannya, hasil penelitian menunjukkan bahwa ada perbedaan yang jelas antara frasa endrosentris koordinatif Inggris dan Indonesia. Inggris memiliki aturan yang berbeda dalam penggunaan endrosentris koordinatif kata ganti (I/me) di wilayah subjektif dan objektif, tetapi masih ada beberapa pelanggaran aturan. Begitu juga dengan peletakan pronominal I pada frasa. Sementara itu kata ganti pertama endrosentrif koordinatif Indonesia tidak memiliki peraturan khusus dalam peletakan kata ganti pertama dalam frasa tersebut. Kata ganti terkoordinasi Indonesia hanya koordinator dari dua atau lebih variabel dengan status sintaksis yang sama. Akan tetapi diksi kata pengganti utama (Aku/Saya) berkonstribusi dalam penggunaan Frasa endrosentif koordinatif Indonesia. Hal tersebut menyankut teori persepsi kesopanan dalam bahasa Indonesia. Akhirnya peneliti menyarankan agar pembaca dapat lebih sadar akan perbedaan dan persamaan dari frasa endosentris koordinatif Inggris dan Indonesia. Hal ini akan membantu mereka menambah sensitivitas pada relativitas dua bahasa tersebut. Diharapkan jugapelajar bahasa Inggris dapat menambah ilmu mereka tentang relativitas budaya dan bahasa dalam frasa endrosentris koordinatif. Terakhir, harus ada penelitian lebih lanjut pada variasi dan nilai kesopanan kata ganti terkoordinasi..

A critical analysis of the English textbook for SMU based on the 1994 English curriculum published by penerbit IKIP MALANG / by Dwi Ningsih Setyowati

 

Hubungan kemampuan adversity dengan prestasi belajar siswa kelas VIII di SMP Negeri 3 Dambit Ponorogo / Anindita Danurdara

 

ABSTRAK Danurdara, Anindita. 2015. Hubungan Kemampuan Adversity dengan Prestasi Belajar Siswa Kelas VIII di SMP Negeri 3 Sambit Ponorogo. Skripsi, Jurusan Psikologi, Fakutas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing : (I) : Dra. Sri Weni Utami, M.Si. (II) Diantini Ida Viatrie, S.Psi., M.Psi. Kata kunci : kemampuan adversity, prestasi belajar, siswa SMP. Kemampuan adversity adalah kemampuan individu untuk bertahan dalam menghadapi segala macam kesulitan. Prestasi belajar adalah hasil usaha yang dilakukan dan menghasilkan perubahan yang dinyatakan dalam bentuk simbol untuk menunjukkan kemampuan pencapaian dalam hasil kerja dalam waktu tertentu. Individu yang memiliki adversity quotient akan memiliki ketangguhan yang lebih daripada mereka yang memiliki adversity quotient rendah. Memiliki ketangguhan akan menghasilkan respon positif dalam menghadapi proses belajar dengan bermacam tantangan, yang ditunjukkan dengan adanya sikap optimis sehingga mereka yakin dapat melewati tantangan tersebut. Rasa optimis itu akan membuat motivasi belajar mereka meningkat karena adanya keyakinan untuk menghasilkan prestasi belajar yang tinggi. Tujuan penelitian ini adalah untuk mengetahui: (1) kemampuan adversity pada siswa kelas VIII di SMP Negeri 3 Kecamatan Sambit Ponorogo, (2) prestasi belajar pada siswa kelas VIII di SMP Negeri 3 Kecamatan Sambit Ponorogo, (3) hubungan antara kemampuan adversity dengan prestasi belajar pada siswa kelas VIII di SMP Negeri 3 Kecamatan Sambit Ponorogo. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Pengumpulan data menggunakan angket kemampuan adversity dan dokumentasi prestasi belajar siswa kelas VIII. Try out dilakukan pada 43 siswa kelas VIII di SMP Negeri 3 Kecamatan Sambit Ponorogo. Validitas item untuk variabel kemampuan adversity terdiri dari 25 aitem dengan reliabilitas sebesar 0,844. Prestasi belajar diukur melalui penilaian guru dalam bentuk rapot, yaitu jenis tes sumatif. Hasil penelitian menunjukkan bahwa (1) siswa kelas VIII SMP Negeri 3 Kecamatan Sambit, Ponorogo sebagian besar memiliki tingkat kemampuan adversity yang cukup, (2) siswa kelas VIII SMP Negeri 3 Kecamatan Sambit, Ponorogo sebagian besar memiliki tingkat nilai prestasi belajar yang cukup, (3) tidak ada hubungan yang signifikan antara kemampuan adversity dengan prestasi belajar pada siswa kelas VIII SMP Negeri 3 Kecamatan Sambit Ponorogo. Hal tersebut bisa disebabkan oleh faktor-faktor di luar kemampuan adversity, yaitu faktor intern yang bersumber pada diri siswa dan faktor ekstern yang bersumber dari luar diri siswa. Berdasarkan hasil penelitian, disarankan bagi siswa agar meningkatkan kemampuannya dalam menghadapi tantangan yang dihadapi sebagai sarana untuk mengasah diri menjadi lebih baik sehingga bisa memaksimalkan prestasi belajarnya. Banyak faktor yang mempengaruhi prestasi belajar, sehingga diharapkan bagi peneliti selanjutnya untuk dapat meneliti hubungan antara variabel lain dalam peningkatan prestasi belajar siswa, terutama inteligensi dan motivasi.

Hubungan antara dukungan sosial dan depresi pada pensiunan PT. kereta api indonesia cabang Kepanjen Malang / Lila Firdausi

 

Kata Kunci : dukungan sosial, depresi, pensiunan PT. Kereta Api Indonesia Dukungan sosial merupakan merupakan bantuan dari orang lain baik secara verbal maupun nonverbal, dan bantuan tersebut bisa berupa dukungan instrumental, dukungan emosional, dukungan informasi, dan dukungan penghargaan. Setiap individu yang bekerja pasti akan mengalami masa pensiun dimana pada waktu itu seseorang dituntut untuk melakukan penyesuaian diri terhadap segala perubahan. Keberhasilan melakukan peyesuaian diri juga dipengaruhi oleh dukungan sosial. Individu yang melakukan penyesuaian diri dengan baik akan menghindarkannya dari depresi. Penelitian ini bertujuan untuk (1) mengetahui gambaran dukungan sosial pada pensiunan PT. Kereta Api Indonesia, (2) mengetahui gambaran depresi pada pensiunan PT. Kereta Api Indonesia, (3) mengetahui hubungan dukungan sosial dan depresi pada pensiunan PT. Kereta Api Indonesia. Jenis penelitian ini adalah deskriptif dan korelasional. Subyek 40 orang pensiunan anggota Forum Komunikasi Pensiunan Pegawai Kereta Api (FKPPKA) Cabang Kepanjen. Skala yang digunakan ada dua macam, yaitu Skala Dukungan Sosial dan Skala Depresi. Teknik analisis data gambaran dukungan sosial dan depresi adalah analisis deskriptif, sedangkan untuk mengetahui hubungan antara dukungan sosial dengan depresi dengan menggunakan analisis korelasi Product Moment Pearson. Hasil penelitian menunjukkan bahwa (1) pensiunan memiliki dukungan sosial yang sebagian besar tergolong sedang, (2) pensiunan yang memiliki depresi yang sebagian besar tergolong rendah, (3) terdapat hubungan negatif antara dukungan sosial dengan depresi pada masa pensiun (rxy = -0.368, sig.= 0.020 < 0.05). Artinya semakin tinggi dukungan sosial maka semakin rendah depresinya Berdasarkan hasil penelitian, dapat disarankan: (1) diharapkan dari pihak keluarga (istri/suami, anak) dan teman agar lebih memberikan dukungan sosialnya kepada individu selain itu tetap menghargai dan mendukung aktivitas yang telah dipilih untuk dilakukan dalam mengisi masa pensiun (2) individu diharapkan tetap membina hubungan baik dengan keluarga dan orang lain serta tetap menekuni aktivitas yang diminati untuk mengisi waktu luang (3) peneliti selanjutnya dapat mengadakan penelitian dengan subyek yang lebih luas sehingga dapat melengkapi penelitian sebelumnya atau menggunakan metode penelitian lain, misalnya dengan pendekatan kualitatif atau metode eksperimen serta menjadikan hasil penelitian ini sebagai masukan bagi penelitian selanjutnya.

Perencanaan dinding penahan dengan konstruksi beton bertulang berbasis software di proyek Holland Park Condotel Batu Jawa Timur / Ayu Surya Arsinta

 

ABSTRAK Arsinta, Ayu Surya. 2016. Perencanaan Dinding Penahan dengan Konstruksi Beton Bertulang Berbasis Software di Proyek Holland Park Condotel Batu Jawa Timur. Skripsi, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Ir. I Wayan Jirna, M.T., (II) Drs. Eko Setyawan, S.T., M.T. Kata kunci: dinding penahan tanah, konstruksi beton bertulang, perencanaan berbasis software Perkembangan teknologi pada jaman sekarang ini sudah maju sangat pesat. Banyak diciptakan software yang mempermudah kerja manusia, termasuk software dalam bidang konstruksi. Kecepatan, ketelitian dalam menghitung serta meminimalisir kesalahan pada saat menghitung dinding penahan tanah dapat dibantu dengan berbagai macam software, salah satunya Geo5. Tujuan penelitian ini adalah untuk mengetahui analisis perhitungan dinding penahan tanah di proyek Holland Park Condotel Batu Jawa Timur menggunakan program Geo5. Rancangan penelitian ini bersifat kuantitatif. Data penelitian disajikan dalam bentuk tabel. Stabilitas yang dikontrol adalah stabilitas geser, stabilitas guling dan stabilitas keruntuhan kapasitas dukung tanah. Pada hasil perhitungan diperoleh nilai stabilitas geser 0,47<1,5 (tidak aman), nilai stablitas guling 0,21<1,5 (tidak aman) dan nilai stabilitas keruntuhan kapasitas dukung tanah 0,00<1,5 (tidak aman). Saran yang dapat diberikan adalah jika akan merencanakan dinding penahan tanah sebaiknya perhatikan karakteristik dari tanah, dimensi dari dinding penahan tanah yang direncanakan harus memenuhi dimensi proporsional.

Dunia gemerlap sebagai gaya hidup mahasiswa dan mahasiswi di Kota Malang / Diah Ayu Kusuma Ratri

 

ABSTRAK Ratri, Kusuma. 2016. Dunia Gemerlap Sebagai Gaya Hidup Mahasiswa Dan Mahasiswi Di kota Malang (Sebuah Konstruksi sosial). Skripsi, Jurusan Pendidikan Ilmu Pengetahuan Sosial, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) I Dewa Putu Eskasasnanda, S.Ant, M.A (2) Dr. I Nyoman Ruja, S.U, Kata Kunci : Dunia Gemerlap, Gaya hidup, remaja. Kota Malang atau yang disebut dengan kota pelajar memiliki keberagaman universitas baik negeri maupun swasta yang sangat diminati para pelajar untuk meneruskan study di sebuah Universitas. Banyaknya urbanisasi yang berada di Malang, memunculkan sarana kos dan kontarakan untuk para mahasiswa sebagai tempat tinggal sementara. Keberadaan kos dan kontrakan menjadikan hal baru terhadap mahasiswa, tidak adanyanya kontrol orang tua secara langsung dan kebebasan yang mereka miliki dapat mengakibatkan pengaruh yang cukup buruk bagi mahasiswa, terlebih lagi mahasiswa merupakan golongan remaja yang masih rentan terpengaruh dengan hal-hal yang bersifat negatif. Rumusan masalah dalam penelitian ini adalah : (1) Apa motivasi mahasiswa dan mahasiswi melakukan kegiatan Dugem? (2) Apa saja kegiatan yang dilakukan mahasiswa dan mahasiswi saat dugem? (3) bagaimana dampak yang ditimbulkan mahasiswa dan mahasiswi yang memiliki gaya hidup dugem? (4) Apa makna dugem bagi mahasiswa dan mahasiswi? Tujuan dari penelitian ini mendeskripsikan penyebab maupun pengaruh Mahasiswa dan Mahasiswi memasuki dunia gemerlap di Kota Malang. Penelitian ini menggunakan pendekatan dan jenis penelitian kualitatif deskriptif. Kehadiran peneliti sebagai instrumen kunci. Sumber data yang digunakan yaitu sumber data primer dan sumber data sekunder, dengan subjek dan informan penelitian terbagi menjadi informan kunci dan informan pendukung yang dipilih secara purposif. Prosedur pengumpulan data yang digunakan adalah observasi, wawancara, dan dokumentasi. Analisis data menggunakan model Miles and Huberman terdiri dari pengumpulan data, reduksi data, penyajian data dan verifikasi. Pengecekan keabsahan temuan menggunakan ketekunan pengamatan dan triangulasi. Tahap-tahap penelitian yang dilakukan ialah tahap persiapan, tahap rancangan penelitian, tahap pelaksanaan, dan tahap pelaporan. Hasil penelitian dapat disimpulkan bahwa penyebab mahasiswa dan mahasiswi memasuki dugem dikarenakan motivasi ajakan teman, sehingga membentuk 2 (dua) motivasi yakni internal meliputi melepas kepenatan dan rasa jenuh, rasa penasaran dan keinginan untuk mencoba, serta untuk menjadi manusia yang modern dan gaul. untuk eksternal ajakan teman,tugas kuliah yang menyita waktu bermain, serta adanya iklan event club malam. Kurangnya komunikasi dengan orang tua mengakibatkan remaja merasa bebas tanpa adanya kontrol dari orang tua, selain itu keberadaan teman sebaya menjadikan faktor remaja mudah terpengaruh hal negatif.Salah satu hal negatif di dalam pergaulan remaja adalah mengunjungi tempat dugem atau yang disebut dunia gemerlap. Remaja yang mengikuti arus dunia gemerlap hanya sekerdar untuk mencari hiburan. Berdasarkan hasil penelitian yang telah dilakukan, saran yang bisa diberikan bagi peneliti selanjutnya adalah bagi penelitian selanjutnya yang hendak maupun mengembangkan penelitian serupa, disarankan untuk melakukan penelitian mengenai dunia gemerlap dengan menggunakan subjek yang lebih beragam dengan menggunakan interaksi simbolik.

Rancang bangun mesin injection molding untuk pembuatan asesoris pin / Dimas Aditya Putra S., Wildanun Nafis, Yanuar Fatchullah

 

ABSTRAK Dimas Aditya Putra Sudirman. Wildanun Nafis. Dan Yanuar Fatchullah. 2013. Rancang Bangun Mesin Injection Molding untuk Pembuatan Asesoris Pin. Tugas Akhir, Program Studi D3 Teknik Mesin, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: Drs. Imam Sudjono, M.T Kata Kunci: silinder pneumatik, injection molding, asesoris pin. Asesoris pin merupakan jenis asesoris yang terbuat dari bahan plastik banyak diminati sebagai cindera mata, ciri khas instansi dan variasi untuk busana. Proses pembuatan bahan asesoris pin menggunakan proses injection molding. Salah satu cara untuk mempermudah penjual dalam memproduksi pin sendiri adalah dengan cara membuat mesin injection molding dengan desain baru yang memiliki dimensi yang lebih kecil dari mesin injection molding yang telah ada dan sumber tenaga yang lebih efisien dalam mesin tersebut. Salah satu sistem yang sudah banyak digunakan dalam dunia industri yaitu sistem pneumatik. Oleh karena itu dirancang Mesin Injection Molding untuk Pembuatan Asesoris Pin. Mesin ini menggunakan sistem kerja silinder piston pneumatik, motor dc, pemanas elektrik, dan mikro kontrol. Proses pencairan plastik diatur dengan suhu 230° sampai 250° yang sesuai dan didorong oleh screw lalu diinjeksikan dengan silinder piston pneumatik ke dalam cetakan. Dalam hal ini suhu dan waktu motor dibatasi oleh komponen mikro kontrol. Penggunaan sistem pneumatik sebagai media proses injection molding diharapakan dapat membantu meringankan kerja dan menjadi sarana untuk mempermudah pekerjaan para pelaku usaha dibidang pembuatan asesoris pin. Mesin Injection Molding untuk Pembuatan Asesoris Pin ini sangat efisien karena memiliki dimensi yang kecil, tidak membutuhkan banyak tenaga, perawatan yang mudah, namun memiliki hasil yang baik dan mudah dalam pengoperasiannya.

Pengaruh penerapan model inkuiri terbimbing terhadap hasil belajar dan keterampilan proses sains siswa kelas XI MIA pada materi asam-basa di SMA Negeri 1 Situbondo / Nur Mu'izzah

 

ABSTRAK Mu’izzah, Nur. 2016.Pengaruh Penerapan Model Inkuiri Terbimbing Terhadap Hasil Belajar dan Keterampilan Proses Sains Siswa Kelas XI MIA Pada Materi Asam-Basa di SMA Negeri 1 Situbondo. Skripsi, Jurusan Kimia, FMIPA, Universitas Negeri Malang. Pembimbing: (I) Dr. Hj. Endang Budiasih,M.S., (II) Dr. Siti Marfuah,M.S. Kata Kunci : inkuiri terbimbing, hasil belajar, keterampilan proses sains, asam-basa Kimia termasuk Ilmu Pengetahuan Alam (IPA) yang mempelajari materi dari segi struktur, susunan, perubahan susunan dan mekanisme perubahan susunannya. Bahasan dalam ilmu kimia umumnya bersifat abstrak, dan asam-basa merupakan salah satu materi sulit untuk dipahami oleh siswa SMA Negeri 1 Situbondo. Hal ini dibuktikan dengan rata-rata nilai ulangan harian asam-basa di SMA Negeri 1 Situbondo Tahun Pelajaran 2013/2014 dan 2014/2015 adalah 72,35 dan 70,00, rata-rata tersebut berada dibawah nilai KKM yaitu 75. Kondisi ini perlu diatasi dengan membelajarkan siswa dengan menggunakan model pembelajaran yang lebih baik, agar bisa meningkatkan hasil belajar siswa. Model pembelajaran yang dicobakan adalah inkuiri terbimbing. Dalam model ini siswa dituntut untuk menemukan sendiri pengetahuannya melalui keterampilan proses sains. Keterampilan proses sains bersifat penting dalam pembelajaran dikarenakan membuat siswa memiliki pemahaman konsep yang baik, sehingga selain meningkatkan hasil belajar siswa, juga dapat melatih keterampilan proses sains siswa. Penelitian ini bertujuan untuk mengetahui pengaruh model pembelajaran inkuiri terbimbing terhadap hasil belajar dan keterampilan proses sains siswa. Penelitian ini menggunakan rancangan penelitian eksperimental semu dengan model post test only control group design. Populasi dalam penelitian ini adalah seluruh siswa kelas XI MIA SMA Negeri 1 Situbondo. Pengambilan sampel dilakukan dengan teknik cluster random sampling. Kelas XI MIA 1 terpilih sebagai kelas eksperimen yang dibelajarkan dengan inkuiri terbimbing, dan kelas XI MIA 2 sebagai kelas kontrol yang dibelajarkan dengan model ekspositori. Instrumen pengukuran yang digunakan dalam penelitian ini tes hasil belajar kognitif, lembar observasi afektif, psikomotor, dan keterampilan proses sains. Hasil uji coba tes menghasilkan 24 soal valid dan memiliki reliabilitas sebesar 0,833. Analisis data penelitian dilakukan dengan analisis statistik kuantitatif dan analisis deskriptif. Data hasil belajar kognitif siswa dianalisis secara kuantitatif yang meliputi uji normalitas, uji homogenitas, dan uji-t dua pihak dengan taraf signifikansi 0,05, sedangkan data keterlaksanaan pembelajaran, hasil belajar afektif, psikomotor, dan keterampilan proses sains dianalisis secara deskriptif. Hasil penelitian menunjukkan bahwa: (1) terdapat perbedaan hasil belajar kognitif antara siswa yang dibelajarkan dengan model pembelajaran inkuiri terbimbing (rata-rata 81,85) dan siswa yang dibelajarkan dengan model pembelajaran ekspositori (rata-rata 73,90); (2) hasil belajar afektif siswa yang dibelajarkan dengan model pembelajaran inkuiri terbimbing (rata-rata 97,10), kriteria sangat baik) lebih tinggi daripada siswa yang dibelajarkan dengan model pembelajaran ekspositori (rata-rata 87,30); (3) hasil belajar psikomotor siswa yang dibelajarkan dengan model pembelajaran inkuiri terbimbing (rata-rata 97,10, kriteria sangat baik) lebih tinggi daripada siswa yang dibelajarkan dengan model pembelajaran ekspositori (90,70, kriteria sangat baik); (4) keterampilan proses sains siswa yang dibelajarkan dengan model pembelajaran inkuiri terbimbing (90,39, kriteria sangat baik) lebih tinggi daripada siswa yang dibelajarkan dengan model pembelajaran ekspositori (83,28, kriteria baik). Berdasarkan hasil tersebut dapat disimpulkan bahwa penerapan model pembelajaran inkuiri terbimbing memberikan pengaruh yang lebih baik terhadap hasil belajar dan keterampilan proses sains siswa daripada model pembelajaran ekspositori.  

Prototipe loker penyimpanan berbasis arduino dan RFID / Wahyu Adi Wicaksono

 

ABSTRAK Wicaksono, Wahyu Adi. 2016. PrototipeLoker PenyimpananBerbasis Arduino dan RFID.Tugas Akhir, Program Studi D3 Teknik Elektronika,Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pebimbing: Heru Wahyu Herwanto, S.T., M.Kom. Kata Kunci: Loker, RFID, Arduino. Dewasa ini, mikrokontroller mulai sering digunakan untuk membuat suatu prototype dalam dunia teknologi. Dimana salah satu keluarga mikrokontroler yang sering digunakan adalah arduino. Arduino merupakan mikrokontroler yang bersifat open source dengan prosesor Atmel AVR yang memiliki software pemrograman dan bahasa pemrograman sendiri. Dengan sifat open source tersebut, arduino menjadi mudah digunakan karena arduino dapat dikembangkan tanpa batasan apapun. Mulai dari memadukan arduino dengan LCD, motor servo, hingga RFID.Dalam penggunaan RFID terdapat berbagai reader dan kartu yang memiliki frekuensi berbeda. Pada pembuatan prototipe loker penyimpanan ini akan digunakan reader/writer MFRC522 dan kartu berfrekuensi 13,56 MHz. Kedua komponen tersebut dipilih karena MFRC522 selain dapat membaca kartu RFID juga dapat menulis data pada kartu RFID, sedangkan pemilihan kartu tersebut berdasarkan fungsinya yang lengkap yaitu dapat dibaca dan ditulis serta kapasitas memori yang besar. Loker penyimpanan ini mengkombinasikan password dan RFID untuk membuka loker. RFID digunakan sebagai pemilih loker yang digunakan dan password sebagai kunci loker untuk membuka pintu loker yang dipilih tersebut. Dari pengujian yang telah dilakukan diperoleh hasil sebagai berikut: (1) MFRC522 dapat membedakan data transponder yang ditandai dengan perbedaan kedipan LED ketika transponder yang berbeda dibaca serta dapat bekerja dengan jarak 0-2,5 cm; (2) pada pengujian keypad 4x3 dan LCD diketahui bahwa karakter atau tombol 0-9 digunakan sebagai karakter password, tombol “*” digunakan untuk memasukkan password yang ditulis, dan tombol “#” digunakan untuk mereset password; (3) pada pengujian servo, kedua servo akan menguci loker ketika berputar 0° dan membuka loker ketika servo 1 berputar 70° untuk loker 1 dan servo 2 berputar 105° untuk loker 2. Sehingga pengujian keseluruhan sistem prototipe loker penyimpanan berbasis arduino dan RFID bekerja sesuai perencanaan (100%).

Memahamkan konsep kesebangunan melalui pembelajaran berbasis proyek / Mohamad Isnaiyulian Mudsaputro

 

Kata kunci: Kesebangunan, Pembelajaran Berbasis Proyek. Kesebangunan mempunyai peranan yang penting dalam bidang matematika dan banyak digunakan dalam kehidupan sehari-hari. Oleh karena itu, pemahaman terhadap konsep kesebangunan perlu ditekankan pada peserta didik sejak dini. Meskipun demikian, kenyataan di lapangan menunjukkan bahwa pemahaman peserta didik terhadap kesebangunan masih rendah. Peserta didik cenderung menghafal aturan-aturan yang ada dalam kesebangunan. Peserta didik tidak diberi kesempatan untuk memahami lebih jauh mengenai materi tersebut. Oleh sebab itu, diperlukan usaha yang serius dalam memberikan pemahaman peserta didik terhadap kesebangunan dengan model pembelajaran berbasis proyek. Penelitian ini bertujuan untuk mendeskripsikan pembelajaran yang dapat memahamkan peserta didik kelas IX SMP tentang kesebangunan dengan diterapkan pembelajaran berbasis proyek. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan penelitian tindakan kelas. Penelitian dilaksanakan pada peserta didik kelas IXA SMP Bustanul Makmur Genteng Banyuwangi. Untuk mendapatkan informasi dari peserta didik mengenai pembelajaran yang dilaksanakan, maka dipilih 4 subjek wawancara yang terdiri dari 1 peserta didik berkemampuan rendah, 2 peserta didik berkemampuan sedang, dan 1 peserta didik berkemampuan tinggi. Pemilihan subjek wawancara berdasarkan hasil tes awal dan dengan pertimbangan bahwa keempat peserta didik tersebut mudah diajak komunikasi. Berdasarkan hasil penelitian diperoleh bahwa model pembelajaran berbasis proyek yang dapat memberikan pemahaman kepada peserta didik kelas IXA SMP Bustanul Makmur Genteng Banyuwangi mengenai materi kesebangunan terbagi dalam tiga tahap pembelajaran, yaitu: (1) tahap awal meliputi menyampaikan tujuan pembelajaran, memotivasi peserta didik tentang pentingnya kesebangunan, mengingat kembali materi prasyarat, pembentukan kelompok, dan pemberian lembar kerja proyek, (2) tahap inti meliputi pengerjaan proyek oleh setiap kelompok dan presentasi hasil kerja proyek, (3) tahap akhir meliputi membuat kesimpulan dan evaluasi. Hasil belajar peserta didik dalam penelitian ini sudah baik pada konsep kesebangunan melalui model pembelajaran berbasis proyek. Hal ini dapat dilihat bahwa hasil tes akhir diperoleh nilai dengan rata-rata 89 dan hasil cek pemahaman yang dilakukan pada saat penyelesaian proyek, pemahaman peserta didik dalam penyelesaian masalah yang berkaitan dengan kesebangunan sudah baik. Berdasarkan penelitian ini, disarankan kepada peneliti lain yang berminat mengadakan penelitian serupa hendaknya melakukan pada sekolah lain, sehingga akan diperoleh gambaran lebih lanjut mengenai model pembelajaran berbasis proyek. Bagi guru yang menerapkan pembelajaran berbasis proyek, hendaknya memberikan bimbingan kepada peserta didik secara efektif.

Pengembangan modul ajar dan jobsheet dengan model project bassed learning pada mata pelajaran teknik elektronika dasar untuk SMK Muhammadiyah 7 Gondanglegi kelas X Program Keahlian Ototronik berbasis kurikulum 2013 / Mohammad Huzaini

 

ABSTRAK Huzaini, Mohammad. 2016. Pengembangan Modul Ajar dan Jobsheet dengan Model Project Based Learning pada Mata Pelajaran Teknik Elektronika Dasar untuk SMK Muhammadiyah 7 Gondanglegi Kelas X Program Keahlian Ototronik Berbasis Kurikulum 2013. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Suwasono, M.T. (II) I Made Wirawan, S.T., S.S.T., M.T. Kata Kunci : Pengembangan,Modul,Teknik Elektronika Dasar, Project Based Learning Mata pelajaran Teknik Elektronika Dasar merupakan mata pelajaran yang wajib ditempuh oleh siswa kelas X, termasuk dalam kelompok mata pelajaran produktif pada program keahlian Ototronik. Permasalahan yang terjadi pada mata pelajaran Teknik Elektronika Dasar adalah tidak tersedianya modul ajar yang sesuai dengan kurikulum yang digunakan, yaitu Kurikulum 2013. Tidak tersedianya modul ajar Teknik Elektronika Dasar merupakan salah satu penyebab rendahnya hasil belajar siswa. Berkaitan hal tersebut, maka dilakukan pengembangan modul ajar mata pelajaran Teknik Elektronika Dasar dengan model project based learning. Tujuan pengembangan modul ajar ini adalah (1) Merancang modul ajar Teknik Elektronika Dasar dengan model project based learning berbasis Kurikulum 2013, (2) Merancang jobsheet Teknik Elektronika Dasar, (3) Menguji kelayakan modul ajar Teknik Elektronika Dasar dengan model project based learning berbasis Kurikulum 2013, (4) Menguji kelayakan jobsheet Teknik Elektronika Dasar. Prosedur penelitian dan pengembangan yang digunakan adalah model pengembangan Sadiman dengan langkah sebagai berikut: (1) Identifikasi kebutuhan, (2) Perumusan tujuan, (3) Perumusan butir-butir materi, (4) Perumusan alat pengukur keberhasilan, (5) Penulisan naskah media, (6) Tes/ujicoba, (7) Revisi, dan (8) Naskah siap produksi. Dalam proses tes/ujicoba terdapat beberapa kegiatan yaitu validasi dari ahli dan ujicoba pada siswa. Validasi dilakukan untuk mengetahui validitas produk sebelum diujicobakan. Sedangkan ujicoba dilakukan untuk mengetahui kelayakan produk. Proses validasi dilakukan sebanyak dua kali dikarenakan pada tahap pertama masih terdapat revisi. Hasil akhir validasi ahli media untuk modul sebesar 100% dan untuk jobsheet sebesar 100%, validasi ahli materi 1 untuk modul sebesar 93.12% dan untuk jobsheet sebesar 93.5%, validasi ahli materi 2 untuk modul sebesar 95.08% dan untuk jobsheet sebesar 95.08%, ujicoba satu lawan satu untuk modul sebesar 98.13% dan untuk jobsheet sebesar 97.69%, ujicoba kelompok kecil untuk modul sebesar 97.14% dan untuk jobsheet sebesar 97.34%, ujicoba lapangan untuk modul sebesar 98.08% dan untuk jobsheet sebesar 98.4%. Hasil validasi dan ujicoba menunjukkan bahwa modul ajar dan jobsheet Teknik Elektronika Dasar sangat valid dan sangat layak digunakan dalam pembelajaran.  

Keefektifan teknik konseling Rational Emotive Behavior Therapy (REBT) untuk meningkatkan kepercayaan diri siswa Sekolah Menengah Pertama / Veronika Rina

 

ABSTRAK Rina, Veronika. 2016. Keefektifan Teknik Konseling REBT untuk Meningkatkan Kepercayaan Diri Siswa Sekolah Menengah Pertama, Skripsi, Jurusan Bimbingan dan Konseling, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Carolina Ligya Radjah, M.Kes., (II) Dr. Dany M. Handarini, M.A. Kata kunci: konseling REBT, kepercayaan diri Kepercayaan diri merupakan keyakinan akan kemampuan yang dimiliki untuk mencapai tujuan hidup sesuai dengan yang diharapkan. Individu yang memiliki kepercayaan diri rendah kurang mengenal kemampuan yang ada dalam diri, tidak bisa berpikir positif tentang dirinya, kurang mandiri, tidak berani tampil di depan umum, dan tidak berani mengungkapkan pendapat. Individu yang tidak memiliki kepercayaan diri cenderung berpikir irasional sehingga menghambat kehidupan sehari-hari dan mempengaruhi emosi serta perilaku. Gejala di atas ditemui di SMP Katolik Cor Jesu Malang. Rumusan masalah pada penelitian ini adalah apakah teknik konseling rational emotive behavior therapy dapat meningkatkan kepercayaan diri. Tujuan penelitian untuk mengetahui keefektifan Konseling Rational Emotive Behavior Therapy dalam meningkatkan kepercayaan diri siswa kelas VIII SMP. Penelitian ini menggunakan eksperimen One group pre-test dan post-test design. Analisis data dilakukan dengan menggunakan statistik inferensial nonparametrik pada siswa yaitu uji Wilcoxon Signed Ranks Test untuk mengetahui adanya tingkat perbedaan sebelum dan sesudah mendapat treatment konseling rational emotive behavior therapy. Subyek dalam penelitian ini adalah 6 orang siswa kelas VIII SMP. Hasil penelitian menunjukkan adanya perbedaan tingkat kepercayaan diri dari kategori rendah menjadi tinggi. Hal ini menunjukkan bahwa teknik Konseling Rational Emotive Behavior Therapy efektif untuk meningkatkan kepercayaan diri. Berdasarkan hasil tersebut, disarankan kepada: (1) Sekolah memberi kesempatan kepada konselor menerapkan teknik Konseling Rational Emotive Behavior Therapy untuk membantu meningkatkan kepercayaan diri, (2) Peneliti selanjutnya dapat menggunakan penelitian ini untuk bahan rujukan lain, dan (3) Penelitian ini dapat digunakan untuk jenjang pendidikan sekolah yang berbeda (kelas VIII dan XI ). v

Analisis strategi pengembangan usaha pada Usaha Mikro Kecil dan Menengah (UMKM) Batik Malangan di kota Malang / Nurul Erfinah

 

Erfinah, Nurul. 2016. Analisis Strategi PengembanganUsahapadaUsahaMikro Kecil dan Menengah (UMKM) Batik Malangandi KotaMalang. Skripsi, Jurusan Ekonomi Pembangunan.Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing: (I)Dr. FaridaRahmawati,S.E., M.E, (II)Dr. GrisviaAgustin, S.E., M.Sc. KataKunci:UMKMBatik Malangan, Prioritas strategi Berdasarkan datadari Dinas Koperasi dan UMKM KotaMalangsalah satu UMKMyangdapat dikembangkanyaitu UMKMBatik Malangandikarenakan UMKM Batik Malanganmenempati urutan ke6 dari 33 unit usahayangterdapat di KotaMalang. Hasil dari observasi awalpenelitimenemukan 2 permasalahan utamayangdihadapi pemilik Batik Malanganyakni kesulitan dalam mencari tenagakerjadan bersaingdengan batik printingoleh karena itu diperlukanstrategi yangtepat dalam pengembangan usahaBatik Malangan.Untuk menyusunstrategi pengembanganyangtepatmakapeneliti menggunakan 5 alatanalisisyaituMatrik IFAS(InternalFactors Analysis Strategic), Matrik EFAS(External Factors Analysis Strategic), MatrikIE(Internal External),Matrik SWOT (Strenghts Weaknesses Opportunities Treaths), Matrik QSP(QuantitativeStrategic Planning). Penelitian ini dilaksanakan dengan tujuan untukmengetahuiprioritas strategi pengembanganyangtepatpadaUMKMBatik Malangan di KotaMalang. Penelitian ini menggunakan rancangan penelitiankualitatifdeskriptif. Data penelitian berupahasil wawancaradari Dinas Koperasi dan UMKM KotaMalang, pemilik UMKM BatikMalangan sedangkan pengisian kuisionerberasaldari pemilik UMKM Batik Malangan. Untuk menyusun prioritas strategi pengembanganyangtepat peneliti menggunakan matrik QSP, dimanamatrik QSPdiperoleh darimatrikIFAS, Matrik EFAS, MatrikIEdan Matrik SWOT. Berdasarkan hasil analisis matrik IFASdiketahui kekuatandan kelemahan UMKMBatik Malangan.Berdasarkan hasilanalisis matrik EFASdiketahuipeluangdanancamanUMKM Batik Malangan.Berdasarkanhasil analisis matrikIE diketahui posisi UMKM Batik Malangan.Berdasarkanhasil analisis matrik SWOT diketahui alternatifstrategi pengembangan.Berdasarkan hasil analisis matrik QSP diketahui prioritas strategi pengembanganyangtepat padaUMKMBatik Malanganyaitu 1)Menghasilkan produkyangsesuai dengan pesanan konsumen.2)meningkatkan promosi melalui pameran-pameran ditawarkan keorang-orangbaiksecaralangsungmaupun online.

Die anwendungdes audiomediums langsam gesprochene nachrichten zum hoverstandnisstraining im kurs deutsch iv an der staatlichen Universitat Malang / Siti Nuraini Azizah

 

ABSTRAK Azizah, Siti Nuraini. 2016. Penggunaan Media Audio Langsam Gesprochene Nachrichten untuk melatih keterampilan menyimak pada Matakuliah Deutsch IVdi Universitas Negeri Malang.Skripsi, Jurusan Sastra Jerman Fakultas Sastra, Universitas Negeri Malang. Pembimbing: Iwa Sobara, S.Pd., M.A. Kata Kunci:media pembelajaran, keterampilan menyimak,media audio, Langsam Gesprochene Nachrichten Sebagian besar mahasiswa Sastra Jerman Universitas Negeri Malang mengalami kesulitan dalam menyimak bahasa Jerman. Salah satu alasan mengapa mereka mengalami kesulitan dalam menyimak adalah karena sebagian besar teks yang diperdengarkan terlalu cepat. Oleh karena itu, mahasiswa seharusnya lebih banyak berlatihuntuk mengatasi kesulitan tersebut. Langsam Gesprochene Nachrichten adalah media audio yang dibuat oleh Deutsche Welle untuk melatih keterampilan menyimak bahasa Jerman. Media audio ini diperdengarkan dengan jelas dan pelan, sehingga mahasiswa dapat melatih keterampilan menyimak dengan mudah. Penelitian ini bertujuan untuk mendeskripsikan penggunaan dan hasil penggunaan media audio Langsam Gesprochene Nachrichten untuk keterampilan menyimak bahasa Jerman pada matakuliah Deutach IV.Penelitian ini menggunakan metode penelitian kualitatif dan kuantitatif. Metode penelitian kualitatif digunakan untuk memaparkan data hasil observasi dan wawancara, sedangkan metode penelitian kuantitatif digunakan untuk memaparkan data hasil tes. Sementara itu, sumber data dalam penelitian ini adalah mahasiswa jurusan sastra Jerman angkatan 2014 yang sedang menempuh matakuliah Deutsch IV. Berdasarkan hasil penelitian diketahui bahwapenggunaan media audio Langsam Gesprochene Nachrichtentidak berjalan dengan lancar. Meskipun media audio tersebut diperdengarkan dengan pelan dan jelas, mahasiswa masih mengalami banyak kesulitan dalam menggunakan median tersebut. Hasilnya adalah banyak mahasiswa tidak lulus karena nilainya dibawah 60. Berdasarkan hasil tersebut dapat dikatakan bahwa penggunaan media audio langsam gesprochene Nachrichten ini belum bisa menghasilkan pengaruh yang baik untukmelatih keterampilan menyimak mahasiswa. Hal tersebut karena penggunaan media audio Langsam Gesprochene Nachrichten hanya dilakukan satu kali, sedangkan mahasiswa belum terbiasa mendengarkan berita dalam bahasa Jerman.

Analisis keseusian penyusunan dan pengoolongan indikator kinerja dengan konsep Balanced Scorecard : studi di RSU Ngudi Waluyo Wlingi / oleh Lailu Sangadah

 

Penggunaan model pembelajaran time token untuk meningkatkan motivasi belajar siswa pada mata pelajaran sejarah kelas XI IPS 2 SMA N 1 Ngraho Bojonegoro tahun pelajaran 2015-2016 / Novia Isniyawati

 

ABSTRAK Isniyawati, Novia . 2016. Penggunaan Model Pembelajaran Time Tokenuntuk Meningkatkan Motivasi Belajar Siswa pada Mata Pelajaran Sejarah Kelas XI IPS 2 SMAN 1 Ngraho Bojonegoro. Tahun Pelajaran 2015-2016. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang.NajibJauhari, S.Pd.,M.Hum. Drs. Mashuri, M.Hum. Drs. Marsudi, M.Hum. Kata Kunci: pembelajaran sejarah, model time tokenatau kupon berbicara, motivasi belajar, SMAN 1 Ngraho. Model pembelajaranmerupakanbentukpembelajaran yang bergambardariawalsampaiakhir yang disajikansecarakhasoleh guru. Guru dalammenyampaikanmateridiperlukan model pembelajaransebagaisaranauntukmenyampaikantujuanpembelajaran yang akandicapai. Penggunaan model pembelajaraninovatif di SMAN 1 Ngrahomasihjarangdigunakan. Berdasarkanobservasi di lapanganyang dilakukanpeneliti di kelas XI IPS 2 padatanggal 26 September 2015 dan20 Januari 2016, penelitimenemukanbahwaselamainimetodepembelajaran yang digunakanmasihberpusatpada guru denganmenggunakanmetodeceramah. Kegiatan pembelajaran lebih didominasi dengan kegiatan ceramah dan mengerjakan LKS. Dari hasil observasi awal peneliti melihat motivasi belajar siswa kelas XI IPS 2 sangat rendah. Hal ini dapat dilihat ketika kegiatan pembelajaran banyak siswa yang tidak memperhatikan pelajaran, mengantuk, berbicara dengan teman lainnya bahkan ada yang tertidur. Siswa terlihat kurang bersemangat ketika pembelajaran. Siswa kurang antusias dan diam ketika guru memberikan pertanyaan. Siswa kurang tekun ketika mengerjakan tugas, hal ini terlihat siswa selalu telat saat mengumpulkan tugas. Permasalahan yang dikajidalampenelitianiniyaitubagaimanameningkatkanmotivasibelajarsiswamelaluipenggunaan model pembelajaranTime Tokenpadamatapelajaransejarahkelas XI IPS 2 SMAN 1 NgrahoBojonegorotahunpelajaran 2015-2016?.Penggunaan model pembelajaran yang tepat serta menarik sangat dibutuhkan agar tujuan pembelajaran dapat tercapai.Penggunaan model pembelajaranTime Tokenataukuponberbicaramerupakansolusiuntukmeningkatkanmotivasibelajarsiswakelas XI IPS 2 SMAN 1 Ngraho. Tujuan dilaksanakannyapenelitian ini untuk meningkatkan motivasi belajar siswa kelas XI IPS 2 SMAN 1 Ngraho melalui penggunaan model pembelajaran time token atau kupon berbicara dalam pembelajaran sejarah. Pendekatan penelitian ini adalah Penelitian Tindakan Kelas. Subjek dalam penelitian ini ialah siswa kelas XI IPS 2. Pengumpulan data diperoleh dengan menggunakan observasi, wawancara dan angket. Teknis analisis data yang dipakai menggunakan model Miles & Hubermen dimulai dari data reduction, data display, dan conclusion drawing/verification. Penelitian ini dilaksanakan dalam dua siklus yaitu siklus I dan siklus II. Hasil penelitian menunjukkan bahwa penggunaan model pembelajaran time token atau kupon berbicara dalam pembelajaran sejarah kelas XI IPS 2 SMAN 1 Ngraho dapat meningkatkan motivas belajar siswa. Peningkatan dapat dilihat dari hasil observasi dari aspek minat, perhatian, konsentrasi dan ketekunan siswa kelas XI IPS 2 dari siklus I ke siklus II mengalami peningkatan. Hal ini didukung oleh hasil angket bahwa rata-rata keseluruhan aspek motivasi belajar dari siklus I sebesar 57,9% dan meningkat pada siklus II menjadi 72,7%. Prosentasepeningkatandarisiklus I kesiklus II sebesar 14,8%. Jadi dapat disimpulkan bahwa motivasi belajar siswa kelas XI IPS 2 dengan menggunakan model pembelajaran time tokenatau kupon berbicara mengalami peningkatan. Saran dalampenelitianiniadalah : (1) Kepada Guru sejarah SMAN 1 Ngraho, agar selalu menggunakan model pembelajaran yang menarik, kreatif dan inovatif agar siswa antusias mengikuti pembelajaran sejarah. (2) Kepada Peneliti, agar dapat mengembangkan serta memodifikasi model pembelajaran Time Token atau kupon berbicara menjadi lebih menarik terutama untuk meningkatkan motivasi belajar melalui kemampuan kecakapan berbicara. (3) Kepada siswa, dapat menggunakan model pembelajaran Time Token atau kupon berbicara dengan baik sehingga motivasi belajar dapat meningkat terutama kemampuan berbicara dengan bertanya maupun berpendapat.

Studi tentang konsep tata ruang pada interior Cafe Pier 88 di Jalan Yos Sudarso No. 165B Kediri / Avi Noviana Widyaningrum

 

ABSTRAK Widyaningrum, Avi Noviana. 2016. Studi Tentang Konsep Tata Ruang Cafe Pier 88 di Jalan Yos Sudarso No 165 B Kediri. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Tjitjik Sriwardhani, M.Pd, (II) Rudi Irawanto, S.Pd, M.Sn. Kata Kunci: konsep, tata ruang, Cafe Pier 88, Kediri. Cafe Pier 88 merupakan cafe terkenal di kota Kediri yang menampilkan penataan berbeda, karena ditinjau dari penampilan dekorasinya menggunakan benda-benda bekas yang dimanfaatkan untuk dekorasi yaitu dari tutup drum, kayu palet bekas, foam, dan tanaman kering berupa ranting pohon. Penataan cafe Pier 88 dalam eksistensinya memiliki ciri khas tersendiri, antara lain pernak-pernik pendukung suasana alam yaitu laut untuk lantai pertama dan secret garden (taman) dengan dekorasi wedding. Oleh karena itu bagaimana visualisasi tata ruang dan bagaimana konsep penataannya yang menyajikan beberapa elemen dasar dan elemen estetis ingin diungkap lebih dalam.Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan konsep penataan ruang dan visualisasi tata ruang cafe Pier 88. Penelitian ini menggunakan rancangan penelitian dekriptif dengan pendekatan kualitatif. Berlokasi di jalan Yos Sudarso No 165 B Kediri dengan menggunakan data yang berasal dari berbagai sumber dengan menggunakan teknik wawancara dengan seorang owner, observasi dan dokumentasi. Dalam hal ini peneliti sebagai instrumen utama, sedang untuk menjaga keabsahan data dilakukan triangulasi. Kegiatan analisis data menggunakan analisis mengalir yaitu reduksi data, sajian data dan simpulan verifikasinya. Berdasarkan hasil analisis data tersebut, diperoleh dua simpulan penelitian sebagai berikut. Pertama, konsep yang digunakan pada cafe ini menggunakan beberapa gaya dalam tata ruangnya yaitu rustik dan shabby chic. Warna elemen dasar tata ruang dan dekorasi memperkuat konsep ini. Perpaduan yang kontras tersebut sering dikatakan bahwa konsep tata ruang cafe Pier 88 yaitu konsep Eklektik. Kedua, visualisasi cafe Pier 88 terdapat empat bagian ruang yaitu (1) lantai pertama menggunakan konsep alam dengan mengusung tema laut atau sailor; (2) lantai kedua menggunakan konsep yang sama bernuansa alam namun dengan tampilan yang berbeda yaitu tumbuhan dengan tema secret garden (taman) dengan dekorasi wedding; (3) dapur dengan penataan yang sederhana dan berbahan material modern; (4) beranda, ruang duduk dengan menggunakan furnitur tahan akan panas dan hujan. Berdasarkan hasil penelitian, dapat disarankan bagi cafe Pier 88 untuk lebih menyamakan konsep antara lantai satu dengan lantai dua agar sesuai dengan brand cafe yang memiliki arti dermaga, dan menambahkan berbagai aksesoris lagi untuk mendukung konsep tata ruangnya. Sedangkan untuk visualisasi tata ruangnya pada setiap satu bulan sekali agar melakukan rolling agar tidak memunculkan rasa bosan terhadap pengunjung.

Pengaruh respon iklan, pemahaman ekonomi dan kecerdasan emosional terhadap perilaku konsumsi siswa kelas X IIS di SMA Brawijaya Smart School Malang / Afief Hidayatullah Alfarisi

 

ABSTRAK Alfarisi, Afief Hidayatullah. 2016. Pengaruh Respon Iklan, Pemahaman Ekonomi, dan Kecerdasan Emosional Terhadap Perilaku Konsumsi Siswa Kelas X IIS SMA Brawijaya Smart School. Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. Prih Hardinto, M.Si., (II) Drs. Mardono, M.Si Kata Kunci: Respon Iklan, Pemahaman Ekonomi, Kecerdasan Emosional, Dan Perilaku Konsumsi Siswa. Pada era globalisasi ini banyak remaja yang terjebak dalam perilaku konsumsi yang tidak rasional. Maraknya iklan di berbagai media menyebabkan remaja khusunya siswa Sekolah Menengah Atas menjadi melakukan konsumsi tidak sesuai dengan kebutuhanya. Agar siswa dapat melakukan konsumsi yang rasional harus memiliki pengetahuan ekonomi yang tinggi utumanya topik tentang perilaku konsumen. Selain itu, ketika siswa atau remaja melakukan konsumsi dengan emosional juga akan menyebabkan siswa melakukan konsumsi dengan tidak rasional atau tidak sesuai kebutuhanya. Penelitian ini bertujuan untuk mengetahui: (1) Pengaruh respon iklan terhadap perilaku konsumsi siswa, (2) Pengaruh Pemahaman ekonomi terhadap perilaku konsumsi siswa, (3) Pengaruh kecerdasan emosional terhadap perilaku konsumsi siswa, (4) Pengaruh respon iklan, pemahaman ekonomi, dan kecerdasan emosional terhadap perilaku konsumsi siswa. Penelitian ini termasuk penelitian kuantitatif yang bersifat asosiatif. Populasi dalam penelitian ini adalah siswa kelas X IIS SMA Brawijaya Smart School yang berjumlah 56. Pengumpulan data menggunakan angket dan tes. Data dianalisis dengan program SPSS 21.00 for Windows. Hasil penelitian ini menunjukkan bahwa: (1) Terdapat pengaruh yang signifikan antara respon iklan terhadap perilaku konsumsi siswa kelas X IIS SMA Brawijaya Smart School, (2) Terdapat pengaruh yang signifikan antara pemahaman ekonomi terhadap perilaku konsumsi siswa kelas X IIS SMA Brawijaya Smart School, (3) Terdapat pengaruh yang signifikan antara kecerdasan emosional terhadap perilaku konsumsi siswa kelas X IIS SMA Brawijaya Smart School, (4) Terdapat pengaruh yang signifikan antara respon iklan, pemahaman ekonomi, dan status sosial ekonomi terhadap perilaku konsumsi siswa kelas X IIS SMA Brawijaya Smart School. Saran yang dapat diberikan penulis dalam penelitian ini adalah: (1) Bagi guru ekonomi, hendaknya guru mampu mengoptimalkan pembelajaran ekonomi sehingga siswa dapat memiliki pemahaman ekonomi yang tinggi, (2) Bagi siswa, siswa diharapkan mampu mengontrol emosi serta respon iklanya agar mampu melakukan konsumsi secara rasional. Bagi peneliti selanjutnya, apabila hendak melakukan penelitian dengan topik yang sama hendaknya melakukan penelitian dengan mengembangkan ketiga variabel bebas yang telah diteliti serta dapat menemukan variabel lain yang belum diteliti.

Analisis kesalahan siswa dalam penulisan karangan deskripsi di kelas V SDN Kedungkandang 2 kota Malang / Hamka

 

ABSTRAK Hamka . 2016. Analisis Kesalahan Siswa dalam Penulisan Karangan Deskripsi di Kelas V SDN Kedungkandang 2 Kota Malang. Skripsi, Program StudiPendidikan Guru SekolahDasar, JurusanKependidikanSekolahDasardanPrasekolah, FakultasIlmuPendidikan, UniversitasNegeri Malang. Pembimbing: (I)Drs. M. Thoha. A.R, S.Pd., M.Pd (II) Dr. Suharjo, M.S., M.A. Kata kunci: Kesalahan penulisan, Karangan Deskripsi, EYD Bahasamerupakansuatukomponenpentingdalamkehidupanmanusia.Hal inidikarenakanbahasamerupakanalatkomunikasiutamabagimanusiadarilahirhinggameninggal.Bahasadalamkegiatanbelajarmengajardibedakanmenjadiduajenisyaitubahasalisandanbahasatulis.Penguasaanragambahasalisandantulissangatlahpentingbagisiswasekolahdasar.Padapenelitianini yang difokuskanadalahpenguasaanragambahasatulisyaitupadakemampuanmenulissiswa.Menuliskarangan di sekolahdasarmerupakankegiatan yang dianggap paling menyenangkanolehsiswakarenadenganmengarangsiswadapatmencurahkansegalaisihatidanpikirannya. Penelitianinimenggunakanpendekatankuantitatifdenganmetodepenelitiandeskriptif.Sumber data dalampenelitianiniadalahkelas V SDN Kedungkandang 2 Kota Malang yang terdiridari 33 siswakelas VA dan 34 siswakelas VB.Penelitian ini menghasilkan temuan bahwa terdapat kesalahan penggunaan kaidah EYD pada penulisan karangan deskripsi siswa kelas V SDN Kedungkandang 2 Kota Malang. Kesalahan tersebut terdiri dari 915 kesalahan penulisan huruf kapital dari 592 penulisan huruf kapital yang benar dengan presentase sebesar 154,559% (Sangat Banyak). Pada penulisan kata depan terdapat 154 kesalahan penulisan dari 298 penulisan kata depan yang benar dengan presentase sebesar 51,677% (Banyak). Sementara itu, pada penulisan tanda titik terdapat 202 kesalahan dari 483 penulisan tanda titik yang benar atau dengan presentase sebesar 41,821% (sedang). Pada penulisan tanda koma terdapat 231 kesalahan penulisan dari 258 penulisan yang benar atau dengan presentase sebesar 89,534% (sangat banyak) dan pada penulisan tanda hubung terdapat 146 kesalahan penulisan dari 134 penulisan tanda hubung yang benar dengan presentase sebesar 108,995% (sangat banyak). Total kesalahan penggunaan kaidah EYD pada karangan deskripsi siswa kelas V SDN Kedungkandang 2 Kota Malang sebesar 93,371% yang artinya sangat banyak terdapat kesalahan penulisan. Berdasarkan hasil temuan penelitian yang diperoleh, maka peneliti menyarankan bagi siswa agar lebih cermat, teliti, dan memahami penggunaan kaidah EYD yang benar baik dalam penulisan maupun pengucapan. Sedangkan bagi guru diharapkan agar dapat membiasakan penggunaan kaidah EYD dan lebih sering memperlihatkan penulisan yang salah kepada siswa agar mereka mampu untuk memperbaiki kesalahannya di masa yang akan datang. Sementara itu, bagi peneliti selanjutnya diharapkan dapat mengembangkan penelitian yang serupa dengan objek dan jenis karangan yang berbeda.

Studi tentang upaya pelestarian kesenian mamanda dikampung Melak Ulu Kecamatan Melak Kabupaten Kutai Barat Kalimantan Timur oleh Budi Yulandi

 

Penerapan metode pembelajaran drill and practice untuk meningkatkan akativitas dan hasil belajar siswa (study pada kelas XI Pemasaran di SMK Islam Batu) / Prayogi Yuda Permana

 

ABSTRAK Permana, Prayogi Yuda. 2016. Penerapan Metode Pembelajaran Drill and Practice Untuk Meningkatkan Aktivitas dan Hasil Belajar Siswa. (Studi Pada Siswa Kelas XI Pemasaran di SMK Islam Batu). Skripsi, Jurusan Manajemen, Program Studi S-1 Pendidikan Tata Niaga, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Hj. Madziatul Churiyah S.Pd., M.M., (II) Handri Dian Wahyudi S.Pd., S.E., M.Sc Kata Kunci: Drill And Practice, Aktivitas Belajar, Hasil Belajar. Model pembelajaran Drill And Practice adalah strategi pembelajaran yang menggunakan metode berupa latihan yang relevan sebelum melakukan praktek yang sesungguhnya. Metode ini pada dasarnya adalah melatih siswa untuk mendapatkan keterampilan maupun pengetahuan yang dilakukan secara berulang-ulang agar mendapatkan hasil yang terbaik. Penelitian ini bertujuan untuk menguji penggunaan metode Drill And Practice dalam meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran melakukan pemasaran barang dan jasa siswa kelas XI pemasaran SMK Islam Batu. Penelitian ini dilaksanakan dalam dua siklus, dimana setiap siklus terdiri dari empat tahap yaitu : perencanaan, pelaksanaan, pengamatan, dan refleksi. Penelitian ini menggunakan metode Drill And Practice dimana peneliti mengukur aktivitas siswa dan hasil belajar siswa pada ranah kognitif dan psikomotor dengan metode praktek secara langsung setelah siswa melakukan latihan yang relevan. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian yaitu penelitian tindakan kelas. Hasil penelitian menunjukkan bahwa terjadi peningkatan aktivitas belajar siswa pada siklus I ke siklus II cukup baik. Sedangkan hasil belajar juga mengalami peningkatan. Hasil belajar aspek kognitif membandingkan hasil nilai guru dan post-test pada setiap siklus. Hasil penelitian menunjukkan terjadi peningkatan hasil belajar siswa dari siklus I ke siklus II sebesar secara signifikan khususnya dalam aspek aktivitas siswa yang didalamnya terdapat praktek langsung sehingga siswa lebih tertarik mengikuti pembelajaran yang berdampak positif pada hasil belajar siswa. Sehingga dengan adanya aktivitas siswa berupa praktek langsung maka dapat meningkatkan hasil belajar siswa. Saran yang diberikan peneliti dari penelitian yang telah dilakukan ini adalah: Bagi guru dapat menjadikan metode pembelajaran Drill And Practice pada kompetensi dasar dan materi-materi lain yang memiliki karakter sama dengan materi yang diterapkan oleh peneliti sebagai alternatif pilihan dalam praktik pembelajaran; Bagi siswa hendaknya melakukan persiapan sebelum pelaksanaan pembelajaran dengan membaca materi, diharapkan dapat ikut berperan aktif dalam proses pembelajaran, dan mampu menumbuhkan kemampuan dan keterampilan, sehingga mampu menyikapi berbagai situasi apapun dengan cara yang tepat; Bagi peneliti lanjut agar lebih kreatif dan inovatif dalam penerapan metode pembelajaran Drill And Practice dan lebih memperhatikan penggunaan waktu agar penelitian berjalan sesuai rencana.

Pola alokasi dana remitansi di lingkungan keluarga Tenaga Kerja Wanita (TKW) Kabupaten Ponorogo / Wahyu Prasetiya Dila

 

ABSTRAK Dila, Wahyu Prasetiya. 2016. Pola Alokasi Dana Remitansi di Lingkungan Keluarga Tenaga Kerja Wanita (TKW) Kabupaten Ponorogo. Skripsi. Jurusan Ekonomi Pembangunan. Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing (1) Dr. Farida Rahmawati, S.E., M.E., (2) Dr. Nasikh, S.E., M.P., M.Pd. Kata Kunci :Remitansi, Sustainable Development Goals (SDGs) ,Pembangunan Ekonomi Komunitas Pengalokasian remitansi oleh pekerja migran atau keluarganya dapat dibedakan menjadi dua bentuk yaitu produktif dan konsumtif. Pengelolaan konsumtif jika alokasi pendapatan tidak dapat memperbesar output atau keluaran dan penghasilan di kemudian hari. Pengelolaan produktif apabila pendapatan (remitansi ekonomi) dapat digunakan untuk menciptakan kemandirian ekonomi. Pengelolaan remitansi dapat memberikan pengaruh kepada keluarga TKW atau pada masyarakat sekitar. Apabila dimanfaatkan secara produktif akan dapat membantu mengurangi pengangguran di daerah asal dan menciptakan multiplier effect. Misalnya dengan membuka suatu usaha dengan remitansi sebagai modalnya maka dapat menciptakan lapangan pekerjaan. Tujuan dari penelitian ini adalah untuk mengetahui pola alokasi dana remitansi di lingkungan keluarga TKW Kabupaten Ponorogo dan mengetahui implikasi remitansi terhadap pembangunan ekonomi komunitas. Penelitian ini menggunakan pendekatan kualitatif dengan data kuantitatif dengan eksploratoris.Sumber dataprimer diperolehmelaluiwawancaradenganinformanmenggunakandata dari Dinas Sosial, Ketenagakerjaandan TransmigrasiKabupatenPonorogomengenai nama,alamat asal dan negara tujuan TKW. Teknik pengumpulan data dengan melakukan observasilapangan dan wawancara mendalam semi terstruktur. Hasil penelitian menunjukkan bahwa pola alokasi dana remitansi di lingkungan keluarga TKW Kabupaten Ponorogo ada dua, yaitu alokasi produktif dan alokasi konsumtif. Alokasi produktif adalah investasi dalam bentuk uang yang disimpan di bankuntukdiambil di masadepan, membeli sawah dan untuk membangun atau merenovasi rumah. Alokasi konsumtif adalah untukmemenuhi biaya kebutuhan sehari-hari, biaya berobat, biaya pendidikan dan biaya membayar hutang. Dengan adanya pengalokasian dana remitansi dapat meningkatkan pendapatan masyarakat daerah sekitar maupun masyarakat luar daerah sehingga dapat meningkatkan pembangunan ekonomi daerah dan meningkatkan pembangunan ekonomi di komunitas lingkungan keluarga TKW. Berdasarkan hasil penelitian ini maka saran untuk Pemerintah Daerah Kabupaten Ponorogo adalah pemerintah seharusnya memberikan pelatihan kepada masyarakat membuka suatu usaha yang kreatif dan berinovasi dengan memanfaatkan remitansi sebagai modal usaha. Bagi keluarga TKW adalah seharusnya keluarga TKW dapat mengelola remitansi dengan baik, bukan hanya digunakan untuk jangka pendek tetapi juga untuk jangka panjang, sehingga dapat digunakan sebagai jaminan nanti setelah pulang bekerja dari luar negeri.

A comparison between illocutionary acts in Jokowi's and SBY's institutional speech during Asian-African Conference 2015 / Marine Mega Provita

 

ABSTRAK Provita, M.P. 2016. Perbandingan Tindak Ilokusi antara Pidato Institusional Jokowi dan SBY di Konferensi Asia Afrika 2015. Jurusan Sastra Inggris. Fakultas Sastra, Universitas Negeri Malang. Pembimbing I: Dr. Hj. Emalia Iragiliati, M.Pd, Pembimbing II: Evynurul Laily Zen,S.S, M.A Kata Kunci: Tindak ilokusi, Penelitian komparatif, pidato institutional, Jokowi dan SBY, KAA 2015 Makna tersirat yang ada dalam latar institutional khususnya pidato politik memiliki peranan penting yang menunjukkan maksud dan tujuan dari pembicara kepada hadirin. Makna tersirat menyampaikan maksud dan tujuan pembicara kepada pendengar. Pidato yang disampaikan Jokowi dan SBY pada konferensi Asia Afrika 2015 menyedot perhatian banyak orang tentang bagaimana mereka menyampaikan pidato khususnya maksud yang Jokowi dan SBY sampaikan. Karenanya, penelitian ini fokus kepada penggunaan tindak ilokus dalam pidato Jokowi dan SBY di KAA 2015. Penelitian ini juga fokus ke perbandingan dari kedua pidato tersebut. Pendekatan deskriptif kualitatif digunakan sebagai desain dari penelitian ini. Instumen yang digunakan adalah satu pidato transkripsi pidato Jokowi dan satu transkripsi pidato SBY di KAA 2015. Setiap transkripsi pidato kemudian diklarifikasikan berdasarkan lima tipe tindak ilokusi yang diusulkan oleh Searle (1975) diantaranya: 1) Representatif 2) Direktif 3) Komisif 4)Ekspresif 5) Deklarasi, serta teori latar instituonal yang diusulkan oleh Drew dan Heritage (1992). Hasil dari penelitian ini menunjukkan bahwa Jokowi menggunakan lima tipe tindak ilokusi, diantaranya: Representatif (59.86%), Direktif (22.7%), Ekspresif (11.37%), Komisif (4.25%) dan Deklaratif (1.42%), dalam menggunakan ke inti topik pembicaraan, menggunakan kata-kata provokatif dalam memberikan saran dan cenderung menonjolkan kesulitan dan rintangan yang dihadapi negara Asia Afrika. Sementara itu, SBY menggunakan tiga tipe tindak ilokusi, diantaranya: representatif (69.12%), Ekspresif (17.61%) dan direktif (13.24%), dalam menggunakan tindak ilokusi SBY sangat berhati-hati dalam menyampaikan pidato dengan menggunakan kata-kata yang sopan, berbasa-basi, menggunakan topik aman dan lebih memilih untuk membicarakan tentang prestasi yang dicapai Asia-Afrika. Kedua presiden memiliki beberapa persamaan. Mereka menggunakan kata ganti “kita” dalam melakukan tindak direktif, melakukan penggulangan dalam memberikan saran berupa poin dan lebih cenderung mengajak daripada memberi perintah. Karenanya, hasil penelitian ini mendukung teori Searle (1975) tentang tindak ilokusi dan teori Drew dan Heritage (1992) tentang pidato berlatar institusi. Penggunaan tindak ilokusi dalam pidato politik memberikan gambaran yang jelas bagaimana tindak ilokusi menunjukkan makna tersirat yang berbeda-beda. Namun, para peneliti selanjutnya disarankan untuk melakukan penelitian lebih lanjut terkait topik ini guna memperkaya khasanah ilmu dari cabang ilmu prakmatik ini.

Analisis tingkat efektivitas dan kotribusi penerimaan pajak hotel pada Dinas Pendapatan Kota Batu dan Kabupaten Pasuruan / Herlambang Cahyo Prihastoto

 

ABSTRAK Prihastoto, Herlambang Cahyo. 2016.Analisis Tingkat Efektivitas, Kontribusi dan Potensi Penerimaan Pajak Hotel Pada Dinas Pendapatan Kota Batu dan Kabupaten Pasuruan.Skripsi, JurusanAkuntansi, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (1) Dr. Dodik Juliardi , S.E., M.M., Ak. (2) Diana Tien Irafahmi, S.Pd., M.Ed. Kata Kunci: Pajak Hotel, Efektivitas, Kontribusi Pajakdaerahmerupakan PAD yang potensial. Salah satupospajakdaerah yang merupakansumber PAD adalahpajak hotel, biladilihatperkembangannyadaritahunketahunpeningkatanjumlah hotel di kotamaupunkabupaten di JawaTimurmengalamikenaikandenganbertambahnyajumlah hotel di setiapkotadankabupaten. Terdapat beberapa kriteria pengukuran terhadap penerimaan pajak hotel yaitu dapat diukur dari tingkat efektivitas, kontribusi, dan potensi dari pajak hotel. Penelitianiniakanmenghasilkan data berupatingkatefektivitas, kontribusidanpotensipenerimaanpajak hotel Kota BatudanKabupatenPasuruan. Dari data hasilpenelitiantersebutdapat di ketahuitingkatefektivitasdankontribusipenerimaanpajak hotel Kota BatudanKabupatenPasuruan. Kota dengantingkatefektivitasdankontribusipenerimaan pajak hotel yang tinggidiharapkandapatmenjadiacuanbagikota-kota lain untukmenggalipotensipajak hotel, sehinggatingkatkontribusipajakdaerahterhadapPendapatanAsli Daerah (PAD) dapat di tingkatkan. Data yang digunakan dalam penelitian ini adalah data sekunder yang di dapat dari Dinas Pendapatan Kota Batu dan Kabupaten Pasuruan. Hasil penelitian menunjukkan bahwa tingkat efektivitas Kota Batu dan Kabupaten Pasuruan mengalami fluktuatif dari tahun 2010 hingga tahun 2014, Namun tingkat efektivitas penerimaan pajak hotel Kota Batu pada tahun 2014 terdapat kenaikan yang sangat signifikan sebesar 83% dari tahun 2013. Kontribusi penerimaan pajak hotel kota batu terbilang sedang dari tahun 2010 hingga 2014 dengan kisaran 14% sampai 28%, sedangkan kontribusi penerimaan pajak hotel Kabupaten Pasuruan terbilang sangat kurang dengan rata-rata 3,18%. Adapun keterbatasan dalam penelitian ini antara lain: (1) Nilaipotensihanyadihitungdaritarif rata-rata sewakamarsedangkanmasing-masing hotel memilikitarifkamar yang berbeda, (2) Penelitianinitidakmampuuntukmenjelaskanfenomena-fenomenapenting yang terjadi, (3) Penelitianinitidakadanyaalasanakurat yang mendukungpeningkatanmaupunpenurunantingkatefektivitasdankontribusipenerimaanpajak hotel yang terjadi, (4) Penelitianinihanyamendeskripsikan data hasilpenelitian yang sudahdilakukandanbelumdapatuntukmembandingkankinerjapemungutanpajakdaerahdariduakota yang diteliti, (5) Penelitianinihanyamenggunakansatusampelyaituhanyamengukurpenerimaandaripajak hotel sehinggamemungkinkan data yang dihasilkankurangberagam. Oleh sebab itu penelitian diharapkan untuk menambah sampel penelitian dan diharapkan dapat membandingkan kinerja pemungutan pajak dari dua kota yang diteliti serta memberikan alasan yang akurat terkait dengan fenomena-fenomena penting yang terjadi.

Keterlaksanaan affective assessment pada pembelajaran fisika kurikulum 2013 di MAN kota Malang / Achmad Hidayat

 

ABSTRAK Hidayat, Achmad. 2016. Keterlaksanaan Affective Assessment pada Pembelajaran Fisika Kurikulum 2013 di MAN Kota Malang. Skripsi, Jurusan Fisika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (1) Sugiyanto S.Pd., M.Si, (2) Drs. Sumarjono, M.Pd. Kata Kunci: Keterlaksanaan, Affective Assessmen, Kurikulum 2013 Asesmen berdasarkan Kurikulum 2013 pada kenyataannya di awal penerapan masih belum terlaksana sepenuhnya sebagaimana diharapkan. Berdasarkan hasil monitoring dan evaluasi yang dilakukan di satuan pendidikan pelaksana Kurikulum 2013, teridentifikasi bahwa permasalahan utama dalam implementasi Kurikulum 2013 adalah asesmen hasil belajar peserta didik. Asesmen pada kognitif dan psikomotor oleh pendidik tidak mengalami kesulitan untuk diterapkan, seperti teknik asesmen pada portofolio dan proyek, sedangkan teknik yang digunakan oleh pendidik pada affective assessment khususnya sikap spiritual dan social sulit dilakukan, karena untuk setiap Kompetensi Dasar (KD) tiap peserta didik diasumsikan harus dinilai menggunakan berbagai teknik (observasi, jurnal, penilaian diri, dan penilaian teman sejawat). Teknik affective assessment pada Kurikulum 2013 dikatakan kompleks dengan harus menerapkan empat teknik penilaian di tiap KD. Memperhatikan kondisi tersebut di atas, makapenelitian ini dilakukan sebagai salah satu upaya untuk meningkatkan mutu Kurikulum 2013. Tujuan penelitian ini yaitu untuk: (1) mendeskripsikan perencanaan affective assessment (2) mendeskripsikan pelaksanaan affective assessment (3) mendeskripsikan pelaporan affective assessment, yang dilakukan oleh pendidik mata pelajaran Fisika di MAN Kota Malang. Penelitian ini termasuk dalam jenis penelitian deskriptif kualitatif. Subjek penelitian ini adalah pendidik kelas XI mata pelajaran Fisika di MAN 1 Malang, MAN 2 Malang, MAN 3 Malang. Teknik yang digunakan untuk mengumpulkan data penelitian meliputi angket, wawancara, dan dokumentasi. Analisis data yang digunakan dalam peneitian ini adalah deskriptif kuantitatif. Hasil penelitian menunjukkan bahwa keterlaksanaan affective assessment Kurikulum2013 sebesar 68% dengan katagori baik. Pada tahap perencanaan affective assessment terlaksana dengan baik (66%), tahap pelaksanaan affective assessment terlaksana dengan baik (67%), tahap pelaporan affective assessment terlaksana dengan baik (71%). Hal ini masih belum terlaksana secara sempurna karena terdapat beberapa hal yang perlu diperbaiki dan ditingkatkan sejalan dengan pedoman yang telah ditetapkan pada Kurikulum 2013.

Perbedaan rerata hasil belajar mata pelajaran jaringan dasar antara model pembelajaran kooperatif tipe make a match dan tipe think pair share pada siswa kelas X TKJ SMK Negeri 2 Singosari / Wulan Indah Purnamasari

 

ABSTRAK Purnamasari, Wulan Indah. 2016.Perbedaan Rerata Hasil Belajar Mata Pelajaran Jaringan Dasar antara Model Pembelajaran Kooperatif Tipe Make a Match dan Tipe Think Pair Share pada Siswa Kelas X TKJ SMK Negeri 2 Singosari.Skripsi, JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: (I) Drs. Wahyu Sakti G. I., M. Kom (II) Drs. Dwi Prihanto, S.S.T., M. Pd Kata kunci: Make a Match, Think Pair Share, rerata hasilbelajar Jaringan Dasar Pembelajaran Jaringan Dasar kelas X TKJ di SMK Negeri 2 Singosari masih menggunakan model konvensional, model ini tidak memfasilitasi siswa untuk aktif dalam mengembangkan pengetahuannya melalui pemecahan masalah, mereka juga kurang diberikan kesempatan untuk mengemukakan pendapat. Hal tersebut berdampak pada rendahnya hasil belajar yang diperoleh siswa. Sehubungan dengan permasalahan tersebut, maka peneliti menerapkan model pembelajaran Make a Match dan Think Pair Share. Penelitianini bertujuan untuk mengetahui adakah perbedaan rerata hasil belajar mata pelajaran Jaringan Dasar antara model pembelajaran Make a Match dan model Think Pair Share. Penelitian ini termasuk dalam jenis penelitian eksperimen. Rancangan penelitian menggunakan metode Quasi Experimental dengan desain penelitian NonequivalentControl Group Design. Dengan subjek penelitian kelas X TKJ 1 sebagai kelas eksperimen 1 menggunakan model Make a Match dan X TKJ 2 sebagai kelas eksperimen 2 dengan menggunakan model Think Pair Share. Untuk penarikan kesimpulan digunakan uji independent sample t test untuk melihat perbedaan rata-rata nilai posttest dan rata-rata nilai gain. Hasil analisis penelitian ini didapatkan ada hasil belajar tiga ranah (pengetahuan, sikap, dan keterampilan). Hasil analisis posttest diketahui bahwa terdapat perbedaan rerata hasil belajar sebelum dan sesudah perlakuan baik pada kelas ekseperimen 1 dan kelas eksperimen 2 dengan nilai signifikansisebesar 0,03< 0,05, terdapat perbedaan nilai gain antara kelas eksperimen 1 dan kelas eksperimen 2 dengan nilai signifikansi sebesar 0,19 < 0,05.Dari analisis penelitian dapat disimpulkanbahwa (1) terjadi peningkatan hasil belajar Jaringan Dasar pada siswa kelas eksperimen 1, (2) terjadi peningkatan hasil belajar Jaringan Dasar pada siswa kelas eksperimen 2, (3)terdapat perbedaan hasil belajar mata pelajaran Jaringan Dasar antara model Make a Match dan model Think Pair Share, dan (4)model pembelajaran kooperatif tipe Think Pair Share lebih baik dibandingkan dengan tipe Make a Match.

Peranan elite nahdlatul wathan terhadap perilaku politik masyarakat Lombok Timur (1998-2008) / Panca Nugroho

 

Skripsi. Jurusan Sejarah. Fakultas Ilmu Sosial Universitas Negeri Malang. Pembimbing: (I) Drs. Dewa Agung Gede Agung, M.Hum; (II) Najib Jauhari, S.Pd, M.Hum. Kata kunci: Elite Nahdlatul Wathan, Perilaku Politik, Lombok Timur, 1998-2008 Bergulirnya reformasi 1998 sekaligus menandakan runtuhnya rezim pemerintahan Soeharto. Kondisi ini memberikan peluang yang sangat besar bagi kebebasan politik di Indonesia, tidak terkecuali umat Islam. Berangkat dari kebebasan itulah umat Islam mulai melakukan manuver politik. Salah satu jalan yang ditempuh adalah dengan mendirikan partai politik yang menggunakan Islam sebagai identitas, ideologi, atau hanya sebagai simbol. Seiring dengan itu, elite-elite organisasi keagamaan di Indonesia juga mulai berkecimpung dalam dunia politik praktis. Keteralibatan elite agama dalam ranah politik semakin meramaikan kompetisi politik yang terjadi di tingkat nasional ataupun lokal. Pengaruh kekuatan elite agama dalam politik di Indonesia setelah terjadinya reformasi 1998 lebih dominan ditemukan pada masyarakat yang bersifat paternalistik. Kecendrungan politik yang ditunjukkan para elite organisasi keagamaan ini memberikan pengaruh yang tidak kecil terhadap perilaku politik masyarakat yang ada di daerahnya. Sehingga keberadaan mereka memberikan corak politik yang berbeda dibandingkan sebelumnya. Penelitian ini termasuk dalam kajian sejarah lokal, dimana penelitian ini dilakukan di daerah Kabupaten Lombok Timur, Provinsi Nusa Tenggara Barat. Penelitian ini mencoba menguraikan beberapa permasalahan dalam kajian sejarah politik di tingkat lokal setelah terjadinya pergeseran orientasi politik pasca pemerintahan Orde Baru. Beberapa permasalahan yang ingin di uraikan antara lain: (1) Bagaiman kondisi sosial politik Nahdlatul Wathan (NW) di Lombok Timur periode 1998-2008? (2) Bagaimana peranan elite Nahdlatul Wathan (NW) terhadap perilaku politik Masyarakat Lombok Timur periode 1998-2008? Tujuan penelitian ini adalah (1) Mendeskripsikan kondisi sosial politik Nahdlatul Wathan (NW) di Lombok Timur periode 1998-2008. (2) Mengetahui peranan elite Nahdlatul Wathan (NW) terhadap perilaku politik Masyarakat Lombok Timur periode 1998-2008. Penelitian ini menggunakan pendekatan kualitaif. Metode yang digunakan adalah metode historis analisis deskriptif, yaitu mengkonstruksi masa lampau secara sistematis dan objektif dengan cara mengumpulkan, menganalisa dan melakukan sintesis terhadap fakta. Sumber yang digunakan adalah dengan memanfaatkan sumber tertulis berupa data dokumentasi dari surat kabar, dokumen organisasi, buku dan sumber lisan yang berupa wawancara. Hasil penelitian menunjukkan bahwa keterlibatan elite NW dan Tuan Guru dalam politik formal di Lombok Timur memberikan pengaruh terhadap perilaku warga NW dalam menentukan arah politiknya. Pemberian dukungan warga NW ini menunjukkan bahwa Tuan guru dan elite NW masih memiliki karisma meskipun terjun ke dalam dunia politik. Hal tersebut merupakan salah satu bentuk ketaatan masyarakat terhadap ulama. Dengan kata lain ulama tidak hanya mampu berperan sebagai penasihat spiritual masyarakat, akan tetapi juga mampu berperan sebagai panutan dalam kehidupan politik. Peran tersebut menunjukkan bahwa medan kharisma ulama di Lombok Timur bukan hanya berada pada wilayah keagamaan saja, akan tetapi sudah merambah ke semua lini kehidupan masyarakat, termasuk kehidupan politik. Hal tersebut berbeda dengan hasil temuan penelitian Maliki (2004) yang menunjukkan bahwa medan kharisma ulama akan mengalami penyusutan dengan terlibat ke dalam wilayah politik formal. Salah satu penyebabnya adalah sifat praktis dan pragmatisme masyarakat yang semakin tinggi, dimana ulama tidak mampu untuk memenuhi kebutuhan tersebut. Sehingga konsep sosial-politik yang semula merupakan terjemahan langsung dari kaidah nilai keagamaan mulai bergeser kearah konsep sosial-politik yang didasarkan pada kepentingan sosial-ekonomi. Faktor lain adalah kekeliruan pemahaman masyarakat tentang konsep politik dalam Islam, mereka melihat bahwa ulama hanya memiliki kepentingan dengan urusan keagamaan dan sosial, bukan pada tataran politik formal. Hal tersebut berbeda dengan masyarakat Lombok Timur yang masih memberikan loyalitas kepada ulama, karena mereka melihat bahwa antara ulama dan politik adalah satu kesatuan, dimana dunia politik merupakan salah satu sarana dalam mengemban misi keagamaan. Selain itu, ikatan emosional yang merupakan basis solidaritas masyarakat masih kental, sehingga kesatuan sosial antara ulama dan masyarakat masih terjalin dengan baik.

Pengaruh metode small sided games dan metode bagian terhadap hasil belajar passing-control peserta ekstrakulikuler sepakbola putra MTs Negeri Srono kabupaten Banyuwangi usia 13-15 tahun / Dyo Rizky Hadi Soekirno

 

ABSTRAK Rizky, Dyo. 2016. Pengaruh Metode Small Sided Games dan Metode Bagian terhadap Hasil Belajar Passing-Control Peserta Ekstrakurikuler Sepakbola Putra MTs Negeri Srono Kabupaten Banyuwangi Usia 13-15 Tahun. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Dr. Hariyoko, M.Pd, (II) I Nengah Sudjana, S.Pd, M.Pd. Kata kunci: metode small sided games, metode bagian, passing-control. Sepakbola merupakan olahraga yang dimainkan oleh dua tim di lapangan, yang bertujuan memasukkan bola ke gawang. Ada beberapa teknik dasar untuk bermain sepakbola, salah satunya adalah passing-control. Cara melakukan passing-control sepakbola yang dilakukan oleh peserta ekstrakurikuler sepakbola putra MTs Negeri Srono Kabupaten Banyuwangi usia 13-15 tahun menunjukkan adanya masalah yaitu arah bola passing-control sepakbola kurang tepat sasaran, hal tersebut disebabkan kurangnya penguasaan teknik dasar passing-control bola. Untuk meningkatkan hasil belajar passing-control sepakbola dengan menggunakan metode small sided games dan metode bagian. Tujuan dari penelitian ini adalah untuk mengetahui perbedaan pengaruh metode small sided games dan metode bagian terhadap hasil belajar passing-control peserta ekstrakurikuler sepakbola putra MTs Negeri Srono Kabupaten Banyuwangi usia 13-15 tahun. Rancangan penelitian yang dipakai adalah eksperimen kuasi yang dilakukan kepada peserta ekstrakurikuler sepakbola putra MTs Negeri Srono Kabupaten Banyuwangi usia 13-15 tahun. Jumlah sampel 24 siswa dan dibagi dalam dua kelompok dengan teknik ordinal pairing matching. Instrumen tes yang digunakan adalah tes passing-control sepakbola menggunakan papan pantul. Teknik analisis data yang digunakan adalah Analisis Varian (ANAVA) satu jalur. Berdasarkan hasil analis data, diperoleh tiga simpulan hasil penelitian sebagai berikut: 1) Metode small sided games memberikan pengaruh yang signifikan terhadap hasil passing-control peserta ekstrakurikuler sepakbola. (Fhitung = 14,93 > Ftabel 4,30). 2) Metode bagian juga memberikan pengaruh yang signifikan terhadap hasil belajar passing-control peserta ekstrakurikuler sepakbola (Fhitung = 27, 88 < Ftabel 4,30). 3) Metode small sided games memberikan pengaruh yang signifikan, sedangkan metode bagian memberikan pengaruh yang lebih signifikan terhadap hasil belajar passing-control peserta ekstrakurikuler sepakbola putra (Fhitung = 391,32 > Ftabel 4,30). Metode small sided games (mean = 21,91 dan SD = 1,31) memberikan pengaruh terhadap hasil belajar passing-control sepakbola. Metode bagian (mean = 22,41 dan SD = 1,16) memberikan pengaruh terhadap hasil belajar passing-control sepakbola. Saran kepada pembina ekstrakurikuler sepakbola, sebaiknya menggunakan metode metode bagian untuk meningkatkan hasil belajar passing-control, karena perolehan hasil penelitian yang telah dilakukan, metode metode bagian lebih memberikan pengaruh yang baik dibandingkan metode small sided games terhadap hasil belajar passing-control peserta ekstrakurikuler sepakbola putra MTs Negeri Srono usia 13-15 tahun. i

Perencanaan partisipatif dalam peningkatan profesionalisme guru pada sekolah berprestasi (studi multi kasus pada SMKN 5 Banjarmasin, MAN 2 Banjarmasin, dan SMAN 7 Banjarmasin) / Metroyadi

 

ABSTRAK Metroyadi,2015.Perencanaan Partisipatif Peningkatan Profesionalisme Guru pada Sekolah Berprestasi (Studi Multi Kasus di SMAN 7 Banjarmasin, MAN 2 Model Banjarmasin dan SMKN 5 Banjarmasin). Disertasi. Program Studi Manajemen Pendidikan, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof.Dr.Bambang Budi Wiyono, M.Pd (2) Dr.H.Imron Arifin, M.Pd, dan (3) Drs.Ahmad Suriansyah,M.Pd., Ph.D. Kata kunci : perencanaan partisipatif, profesionalisme guru, sekolah berprestasi Kebutuhan dan tuntutan mutu pendidikan semakin meningkat seiring dengan era globalisasi, dan perkembangan informasi serta ilmu pengetahuan dan teknologi yang semakin pesat, untuk itu guru harus profesional. Profesionalisme guru merupakan tanggung jawab bersama warga sekolah dimulai dari perencanaan yang matang. Keterlibatan warga sekolah dalam perencanaan peningkatan profesionalisme guru akan menghasilkan putusan yang berkualitas serta mendorong munculnya inisiatif, kreatifitas dan tanggung jawab terhadap sekolah. Penetian ini bertujuan untuk mengetahui, dan mendeskripsikan tentang; (1) kegiatan perencanaan dengan melibatkan warga sekolah, (2) keterlibatan warga sekolah dalam perencanaan, (3) bentuk keterlibatan warga sekolah dalam perencanaan, (4) tingkat keterlibatan warga sekolah dalam perencanaan, (5) dasar penyusunan perencanaan partisipatif, dan (6) proses perencanaan partisipatif. Penelitian ini menggunakan pendekatan kualitatif jenis fenomenologi dengan rancangan studi multi kasus.Dalam penelitian ini peneliti sebagai instrumen kunci hadir langsung di lapangan. Data dikumpulkan dengancara wawancara mendalam, dokumentsi dan observasi. Lokasi penelitian ini adalah tiga kasus yaitu kasus 1 SMAN 7 Banjarmasin, kasus 2 MAN 2 Banjarmasin dan kasus 3 SMKN 5 Banjarmasinberdasarkan latar perbedaan karakteristik sekolah. Analisis data dilakukan dua tahap yakni: (1) analisis data kasus invidual dan (2) analsis data lintas kasus, dengan teknik siklus komparatif konstan. Pengecekan keabsahan data dilakukan dengan credibility (derajat kepercayaan) dependability (ketergantungan) danconfirmability (kepastian). Tahap-tahap perencanaan ini dilakukan melalui: perencanaan, memasuki lapangan, pengumpulan data, analisis data, menarik diri, dan penulisan laporan. Temuan penelitian ini sebagai berikut: pertama, kegiatan penyusunan aspek-aspek perencanaan yang melibatkan warga sekolah meliputi; workshop kurikulum, strategi dan media pembelajaran, pelatihan penilaian kinerja guru, pelatihan penulisan karya tulis ilmiah, Musyawarah Guru Mata Pelajaran (MGMP), seminar, pembelajaran berbasis Informasi Teknologi, pendidikan ke S2, pelatihan berbahasa inggris. Kedua, keterlibatan warga sekolah dalam perencanaan dilakukan secara langsung dan tidak langsung, secara langsung kepala sekolah, wakil kepala sekolah, ketua program,kepala laboratorium, kepala bengkel, kepala perpustakaan, kepala Pusat Sumber Belajar, dewan guru, tata usaha, komite sekolah dan warga sekolah lainnya, keterlibatan secara tidak langsung oleh Dunia Usaha dan Industri (DUDI) dan orang tua siswa. Ketiga, bentuk keterlibatan warga sekolah dalam perencanaan, (a) sumbangan tenaga, meliputi pembimbingan dari instruktur, nara sumber, praktik magang dan bengkel, guru tamu dari DUDI, (b)sumbangan pemikiran, berupa saran, ide, pemikiran dan gagasan implementasi kurikulum, pembelajaran dan inovasi pembelajaran, (c) sumbangan moral, dari ustadz, alumni dan tokoh masyarakat (d) sumbangan dana, komite sekolah, infak, sumbangan pendidikan. Keempat, tingkat keterlibatan warga sekolah dalam perencanaan: terlibat menghadiri penyusunan visi, misi, renstra, Rencana Kegiatan Anggaran Sekolah (RKAS) dan program tahunan, komite sekolah aktif dalam pengawasan perencanaan program sekolah, memfasilitasi kerjasama dengan orang tua siswa dan DUDI, Kelima,penyusunan perencanaan partisipatif, didasarkanpada peraturan dan perundang-undangan, standar nasional pendidikan, kebijakan pemerintah dan pemerintah daerah, visi, misi, renstra dan RKAS, Evaluasi Diri Sekolah (EDS), moto sekolah dan Daftar Isian Pelaksanaan Anggaran (DIPA). Keenam, proses perencanaan partisipatif, dibuat secara bertahap yaitu; (a) penjaringan data kepada semua warga sekolah, (b) membuat draft perencanaan,(c) sidang pleno sekolah, dan (d) sosialisasi kepada orang tua siswa dan warga sekolah. Berdasarkan hasil temuan penelitian ini disarankan: (1) Kepala Dinas Pendidikan dan Kepala Kantor Kementerian Agama, dapat dijadikan salah satu referensi dalam pengambilan kebijakan, dan disosialisasikan kesekolah lain yang berada di wilayahnya, sebagai bahan masukan bagi sekolah dalam penyusunan perencanaan. (2) Bagi Pengawas Sekolah, sebagai bahan membina sekolah-sekolah dalam membuat perencanaan di sekolah. (3) Kepada Kepala Sekolah, mempertahankan dan meningkatkan (a) peran aktif keikutsertaan warga sekolah dalam perencanaan, (b) bentuk keterlibatan warga sekolah, (c) kerjasama perencanaan dengan DUDI dan tokoh agama, (d) kepada guru, hendaknya dapat meningkatkan keterlibatannya dan berperan lebih aktif dalam perencanaan (4) Kepada peneliti lainhendaknya dapat mengkaji, mengembangkan dan menggali lebih mendalam aspek-aspek berkaitan dengan keterlibatan warga sekolah dalam perencanaan peningkatan profesionalisme guru dengan pendekatan, subyek, lokasi, tema atau variabel lain.

Keputusan hakim atas sengketa waris di Pengadilan Agama dan Pengadilan Negeri Malang / oleh Siti Khoiriyah

 

Penerapan model quantum writing untuk meningkatkan keterampilan menulis narasi pada pembelajaran Bahasa Indonesia siswa kelas IV SDN Slamet 01 Kecamatan Tumpang Kabupaten Malang / D. Ramos

 

PENERAPAN MODEL QUANTUM WRITING UNTUK MENINGKATKAN KETERAMPILAN MENULIS NARASI PADA PEMBELAJARAN BAHASA INDONESIA SISWA KELAS IV SDN SLAMET 01 KECAMATAN TUMPANG KABUPATEN MALANG D. RAMOS Kata Kunci:KeterampilanMenulis, Narasi, danQuantum Writing AbstrakBerdasarkanperolehanhasilnilai semester I padatahun 2015/2016dapatdisimpulkanbahwaprestasibelajarmenuliskarangandeskripsiadalah 65, sedangkanKKM yang harusdicapaiadalah 70. Olehkarenaitu, untukmeningkatkanketerampilanmenulisnarasisiswakelas IV SD NegeriSlamet 01 Tumpangperludigunakan model Quantum Writing. Rumusanmasalah yang akandibahasdalampenelitianiniadalahBagaimanakahpenerapan model Quantum Writing dalampembelajaranmenulisnarasisiswakelas IV SD NegeriSlamet 01KecamatanTumpangKabupaten Malang, Rumusanmasalah yang keduaadalahBagaimanakahketerampilanmenulisnarasimelaluipenerapan model Quantum Writing kelas IV SD NegeriSlamet 01KecamatanTumpangKabupaten Malang. Penelitianinimenggunakandesainpenelitiantindakankelas yang dilakukandalamduasiklusyaituSiklus I, danSiklus II dengansubjekpenelitian siswakelas IV SD NegeriSlamet 01 KecamatanTumpangKabupaten Malang. Pengumpulan data siklus I dansiklus II denganmenggunakantekniktesdannontes. Tekniktes yang digunakan berupatesesai. Tekniknontesberupaobservasisiswadan.Teknikanalisis data dalampenelitianinimenggunakanduateknik. Keduatekniktersebutdianalisisdenganmembandingkanhasilprasiklusdengansiklus I dansiklus II. Hasilpeneltianmenunjukkanadanyapeningkatandarisiklus I, dansiklus II, baikhasiltesmaupunhasilnontes. Dari hasiltesdapatdiketahuipeningkatan nilaimenuliskarangannarasidenganmenggunakan model Quantum Writingpadasiklsus I sebesar 70, padasiklus II naikmenjadi 75. Hal tersebutmembuktikanbahwapenggunaan model Quantum Writingdalammenuliskarangannarasidapatmeningkatkanketerampilansiswadalammenuliskarangannarasi. Perubahansikapdanperilakusiswakelas IV SD NegeriSlamet 01 KecamatanTumpangKabupaten Malang menunjukkanperubahan yang positif, siswalebihtertarikdanantusiasdalampembelajaranmenulisnarasidengan model Quntum Writing. Simpulanpenelitiadalahmenulisnarasisiswakelas IV SDNegeriSlamet 01 KecamatanTumpangKabupaten Malangmeningkatsetelahmenggunakan modelQuantum Writing. Saran bagisekolahhendaknyamemberikesempatanguru untukmenyediakanpembelajaran. Bagi guru, hendaknyadapatberpikirkreatif, inovatif, danmenggunakan model Quantum Writingdalampembelajaranmenuliskarangannarasi.

Pengaruh sistem pembelajaran moving class terhadap hasil belajar siswa melalui motivasi belajar siswa pada mata pelajaran ekonomi kelas X IIS SMA Negeri 9 Malang / Achmat Munir

 

ABSTRAK Munir, Achmat. 2016. Pengaruh Sistem Pembelajaran Moving Class Terhadap Hasil Belajar Siswa melalui Motivasi Belajar Siswa Pada Mata Pelajaran Ekonomi Kelas X IIS SMA Negeri 9 Malang. Skripsi. Program Studi Pendidikan Ekonomi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang, Pembimbing: (I) Drs. Sapir, S.Sos, M.Si (II) Drs. Achmad Ali Wafa, M.Pd. Kata Kunci: Sistem Pembelajaran Moving Class, Motivasi Belajar, Hasil Belajar. Penelitian ini dilatar belakangi bahwa SMA Negeri 9 Malang salah satu sekolah negeri di kota malang yang telah menerapkan SKS (Sistem Kredit Semester) sebagai pendukungnya juga telah diterapkannya moving class. Konsep moving class itu sendiri mengacu pada pembelajaran kelas yang berpusat pada anak untuk memberikan lingkungan yang dinamis sesuai dengan bidang yang dipelajarinya. Pada pelaksanaan kegiatan belajar mengajar di SMA Negeri 9 Malang, peneliti melihat beberapa bentuk penyimpangan yang dilakukan oleh beberapa siswa, diantaranya yaitu sering terjadi keterlambatan siswa tertentu dalam mengikuti pelajaran bahkan ada juga siswa yang meninggalkan kegiatan belajar mengajar pada mata pelajaran ekonomi. Hal itu terjadi ketika proses perpindahan kelas. Untuk itu perlu diadakannya penelitian sebagai upaya untuk mengetahui pengaruh sistem pembelajaran moving class terhadap hasil belajar siswa melalui motivasi belajar siswa pada mata pelajaran ekonomi kelas X IIS SMA Negeri 9 Malang. Penelitian ini menggunakan rancangan penelitian kuantitatif deskripstif serta menggunakan jenis penelitian expost facto. Populasi dalam penelitian ini diambil dari keseluruhan subjek yang akan diteliti. Subyek dalam penelitian ini adalah seluruh siswa kelas X IIS SMA Negeri 9 Malang tahun ajaran 2015/2016 semester genap. Seluruh populasi dijadikan sebagai sampel penelitian. Penelitian ini dilakukan pada bulan April 2016. Berdasarkan hasil penelitian bahwa tingkat pengelolaan sistem pembelajaran moving class berpengaruh positif secara langsung terhadap motivasi belajar siswa pada mata pelajaran ekonomi kelas X IIS SMA Negeri 9 Malang. Motivasi belajar berpengaruh positif secara langsung terhadap hasil belajar siswa pada mata pelajaran ekonomi siswa kelas X IIS SMA Negeri 9 Malang. Sistem pembelajaran moving class berpengaruh positif secara tidak langsung terhadap hasil belajar siswa yang diperantarai oleh motivasi belajar siswa pada mata pelajaran ekonomi kelas X IIS SMA Negeri 9 Malang. Penelitian ini disarankan kepada pihak sekolah untuk melengkapi sarana pembelajaran yang diperlukan dalam proses pembelajaran sesuai dengan yang diperlukan masing-masing mata pelajaran. Sedangkan untuk guru hendaknya mengoptimalkan sarana pembelajaran yang ada. Dan untuk peneliti selanjutnya disarankan untuk memperluas sampel dan populasi penelitian, selain itu hendaknya menambah variabel penelitian lain yang bersangkutan dengan moving class, salah satunya yaitu SKS (Satuan Kredit Semester).

Pengaruh penggunaan ladder drills terhadap prestasi keterampilan menggiring bola siswa SSB Arema Domhils Kota Malang / Yusuf Rismawan

 

ABSTRAK Rismawan, Yusuf. 2015. Pengaruh Penggunaan Ladder Drills terhadap Prestasi Keterampilan Menggiring Bola Siswa SSB Arema Domhils Kota Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Dr. Hariyoko, M.Pd, (II) I Nengah Sudjana, S.Pd, M.Pd Kata kunci: ladder drills, keterampilan menggiring sepakbola. Sepakbola adalah permainan yang dimainkan oleh dua tim, setiap tim terdiri dari sebelas pemain. Ada beberapa teknik dasar untuk bermain sepakbola, salah satunya teknik dasar menggiring bola. Pengamatan proses latihan siswa SSB Arema Domhils Kota Malang, menunjukkan adanya masalah yaitu, kemampuan menggiring bola yang kurang dan tidak adanya variasi latihan yang fungsinya untuk meningkatkan kemampuan menggiring bola. Salah satu cara untuk meningkatkan keterampilan menggiring bola adalah dengan menggunakan latihan ladder drills yang unsur latihan di dalamnya mengandung kecepatan, kelincahan, keseimbangan dan koordinasi gerak kaki yang dibutuhkan dalam menggiring bola. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui pengaruh penggunaan latihan ladder drills terhadap prestasi keterampilan menggiring bola siswa SSB Arema Domhils Kota Malang. Rancangan penelitian yang dipakai adalah eksperimen matching pretest-posttest control group design. Data diambil dari 26 siswa SSB Arema Domhils Kota Malang sebagai sampel dan dibagi dalam dua kelompok dengan teknik ordinal pairing matching. Pengambilan sampel dengan menggunakan teknik sistimatic random sampling. Instrumen yang digunakan untuk mengumpulkan data adalah tes dribbling sepakbola. Teknik analisis data yang digunakan adalah Analisis Varian (ANAVA) satu jalur. Berdasarkan hasil analisis data, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, tidak ada perbedaan pengaruh yang signifikan antara latihan penggunaan ladder drills dengan latihan konvensional terhadap prestasi keterampilan menggiring bola siswa SSB Arema Domhils Kota Malang (Fhitung = 3,8747 < Ftabel 4,26). Kedua, penggunaan latihan ladder drills memberikan pengaruh yang signifikan terhadap prestasi keterampilan menggiring bola siswa SSB Arema Domhils Kota Malang (Fhitung =13,57 > Ftabel 4,26). Ketiga, latihan konvensional tidak memberikan pengaruh yang signifikan terhadap prestasi keterampilan menggiring bola siswa SSB Arema Domhils Kota Malang (Fhitung = 41904 < Ftabel 4,26). Penggunaan latihan ladder drills (mean = 25,59 dan SD = 2,12) memberikan pengaruh yang lebih baik terhadap prestasi keterampilan menggiring bola dari pada latihan konvensional (mean = 26,94 dan SD = 1,57). Saran yang dapat diberikan kepada pelatih SSB Arema Domhils Kota Malang, hendaknya menggunakan latihan ladder drills sebagai bentuk latihan untuk meningkatkan prestasi keterampilan menggiring bola, karena perolehan hasil penelitian yang telah dilakukan ternyata latihan menggunakan ladder drills memberikan pengaruh yang lebih baik terhadap prestasi keterampilan menggiring bola siswa SSB Arema Domhils Kota Malang.

Pengembangan variasi latihan multilateral tenis lapangan untuk meningkatkan motorik atlet junior dalam bentuk video di Klub Tenis Soemardi Kota Blitar / Ones Permana

 

ABSTRAK Permana, Ones. 2015.PengembanganVariasi Latihan Multilateral Tenis Lapangan untuk Meningkatkan Motorik Atlet Junior dalam Bentuk Video di Klub Tenis Soemardi Kota Blitar.Skripsi, JurusanPendidikanJasmanidanKesehatan, FakultasIlmuKeolahragaanUniversitasNegeri Malang.Pembimbing: (I) Drs. Mulyani Surendra, M.S. (II) Drs. Supriatna, M.Pd. Kata Kunci: latihan mutilateral, tenis lapangan, atlet tenis lapangan Berdasarkan observasi awal yang dilakukan peneliti terhadap atlet di Soemardi Tenis Klub kota Blitar pada tanggal 16 Desember 2014, latihan multilateral pernah diberikan tapi hanya memantul-mantulkan bola dengan raket, sehingga latihan yang diberikan terlalu monoton. Pada penelitian awal melalui penyebaran angket analisis kebutuhan (need assessment) kepada 10 atlet dan 1 pelatih di Klub Tenis Soemardi Kota Blitar, dengan hasil sebagai berikut: 1) 100% atlet menjawab perlu adanya variasi latihan multilateral sebagai latihan dasar untuk mempermudah mempelajari teknik dasar dalam tenis lapangan, 2) 90% atlet dan pelatih menjawab sangat membutuhkan variasi latihan multilateral dan sisanya 10% atlet menjawab membutuhkan adanya variasi latihan multilateral, 3) 100% atlet dan pelatih menjawab variasi latihan multilateral lebih setuju menggunakan video. Untuk mengatasi masalah tersebut, maka peneliti mencoba memecahkan masalah dengan mengembangkan variasi latihan multilateral untuk atlet junior di Klub Tenis Soemardi Kota Blitar yang dikemas dalam bentuk video. Penelitian ini bertujuan untuk membantu dan mempermudah atlet dalam melakukan latihan dasar sebelum kelatihan teknik-teknik dalam tenis lapangan yaitu dengan mengembangkan variasi latihan multilateral dalam bentuk video. Penelitian yang dilaksanakan pada atlet di KlubTenisSoemardi Kota Blitar ini termasuk penelitian dan pengembangan yang mengacu pada model pengembangan Borg and Gall (1983:775)yaitu: 1) analisis kebutuhan, 2) pembuatan rancangan produk, 3) evaluasi para ahli, 4) revisi dari evaluasi para ahli, 5) uji coba kelompok kecil, 6) uji coba kelompok besar, 7) hasil akhir. Hasil pengembangan variasi latihan multilateral untuk atlet junior di KlubTenisSoemardiKota Blitar diperoleh data sebagai berikut: 1) hasil evaluasi ahli kepelatihan tenis lapangan yaitu 75-100%dengan rata-rata 82%(sangat baik), 2) hasil evaluasi ahli media yaitu 50-75% dengan rata-rata73,08%(baik), 3) hasil uji coba kelompok kecil yaitu 75-91,7% dengan rata-rata 84% (sangat baik), 4)hasil uji coba kelompok besar yaitu 79,7-96,8% dengan rata-rata 89,3% (sangat baik). Sehingga variasi latihan multilateral untuk meningkatkan motorik atlet junior dalam bentuk video di KlubTenisSoemardi Kota Blitar dapat digunakan. Dari hasiltersebutdiharapkanvariasi latihan multilateral tenis lapangan untuk meningkatkan motorik atlet junior dalam bentuk video di KlubTenisSoemardi Kota Blitarinibisamenjadi alternatif pelatihan agar proses latihan lebih menarik, bervariasi dan bermanfaat untuk atlet.

Pengembangan metode latihan teknik kuntul tingkat keluarga strip putih hijau Perguruan Kelatnas Indonesia Perisai Diri cabang Malang / Aryo Adi Nugroho

 

ABSTRAK Nugroho, AryoAdi. 2016. Pengembangan MetodeLatihan Teknik Kuntul Tingkat Keluarga Strip PutihHijauPerguruanKelatnas Indonesia Perisai Diri CabangMalang. Skripsi,JurusanPendidikan Jasmani dan Kesehatan, FakultasIlmuKeolahragaan, UniversitasNegeri Malang. Pembimbing: (1) Dr. SitiNurrochmah, M.kes (2) Kurniati Rahayuni, S.Psi., M.Psi. Kata kunci:metodelatihan, teknik kuntul, siswa tingkat keluarga strip putihhijau, Kelatnas Indonesia PerisaiDiriCabangMalang Berdasarkanpenelitianawalmelaluipenyebaranangketanalisiskebutuhanpada 15 siswatingkat keluarga strip putihhijauyang menunjukkanbahwa80% rangkaianteknikkuntul yang diberikan oleh pelatih kurang mudahdipahami dan sulit dilakukan, dapatdibuktikanpadasaatmelakukangerakanteknikaslikuntulpadasaatlatihan. TeknikKuntulharusdikuasaisiswapadatingkatankeluarga strip putihhijau.Siswadiharuskanmampumelaksanakanrangkaianteknikkuntuldenganbenarsebagaisalahsatumateriwajibdalamujiankenaikantingkat. Tujuan penelitiandanpengembangan ini adalah untuk menemukan solusi dari permasalahan, yaitu dengan mengembangkanmetodelatihan teknik kuntul yangmudah dipelajari, mudah dipahamidanmenarikjugasebagaisumberbelajarsiswakeluargatingkat strip putihhijau. Model yang digunakandalampenelitianiniberupa model proseduraldenganlangkah-langkahpengembanganmerujukpendapat Borg and Gall. Langkahpengembangandalam penelitian ini menggunakan 7langkah. Subjek uji coba meliputitiga orang ahli, pelatihPerisaiDiri, dan siswakeluargatingkat strip putihhijau. Jenis data berupa data kualitatif, data kuantitatif,dan instrumen yang digunakan berupa angket. Tehnikanalisis data berupaanalisisdeskriptifkualitatifdankuantitatif. Produkpengembangan yang dihasilkanberupametodelatihanteknikaslikuntul yang disajikandalambentukbukupanduan yang didalamnya terdapatgambarrangkaiangerakdancarapelaksanaannya. Dari hasil evaluasi ahli PerisaiDiri diperoleh persentase 90,17%, ahlikepelatihan pencak silatdiperolehpersentase89,81%,dan ahli mediadiperolehpersentase81,25% dan uji tahap I (8 siswa) diperoleh persentase 87,6% , dan pada uji tahap II (32 siswa) diperoleh persentase 89,56% sehinggaprodukpengembanganmetode latihan teknik kuntul tingkat keluarga strip putihhijau perguruanKelatnas Indonesia Perisai Diri CabangMalangdalambentukbukupanduandinyatakan validdan dapat digunakan. Kesimpulan dari penelitian dan pengembangan, bahwa hasil evaluasi ahli media dan uji coba kelompok besar menyatakan metode latihan teknik kuntultepat digunakan untuk siswa keluarga tingkat strip putih hijau Kelatnas Indonesia Perisai Diri Cabang Malang. Saran untuk pelatih dapat dijadikan bahan materi dalam melatihteknikaslikuntul, selainitudiharapkansiswakeluargatingkat strip putihhijaumampumeningkatkanminatsekaligussebagaisumberbelajardanlatihandalammenguasairangkaianmateriteknikaslikuntulsecarabenardanpaham. Dalampenyebarluasanprodukdiharapkantidakhanya di Cabang Malang, tapijuga di cabang-cabangKelatnas Indonesia PerisaiDiri yang lain.

Peningkatan keterampilan quick smash bolavoli dengan metode part and whole pada tim bolavoli putri Klub Binayuda Rowokangkung Kabupaten Lumajang / Kharisma Wahyu Atmaja

 

ABSTRAK Atmaja, Kharisma Wahyu. 2015. “Peningkatan Keterampilan Quick Smash Bolavoli Dengan Metode Part and Whole Pada Pemain Tim Bolavoli Putri Klub Binayuda Rowokangkung Kabupaten Lumajang”. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. M.E. Winarno, M.Pd, (II) Dra. Sri Purnami, M.Pd. Kata Kunci: quick smash, part and whole Permainan Bolavoli adalah suatu permainan yang dimainkan oleh dua tim dalam satu lapangan di mana setiap tim terdiri dari enam orang dan terpisah oleh net. Salah satu keterampilan teknik dasar yang sering digunakan pada saat penyerangan dalam permainan bolavoli adalah smash. Dalam permainan bolavoli smash mempunyai beberapa macam, salah satunya yaitu quick smash. Dari hasil observasi awal didapatkan persentase tingkat keberhasilan pemain pada gerakan awalan sebesar 88,23%; gerakan tolakan sebesar 76,48%; gerakan meloncat sebesar 70,59%; gerakan perkenaan bola sebesar 35,29%; dan gerakan mendarat sebesar 82,35%. Data tersebut menunjukkan bahwa pemain masih melakukan banyak kesalahan. Oleh karena itu, diperlukan suatu alternatif pemecahan, salah satunya dengan menggunakan metode part and whole di dalam latihan keterampilan quick smash permainan bolavoli. Tujuan penelitian ini adalah untuk meningkatkan keterampilan quick smash permainan bolavoli dalam latihan pada Tim Bolavoli Putri Klub Binayuda Rowokangkung Kabupaten Lumajang dengan menggunakan metode Part and Whole. Penelitian ini merupakan penelitian tindakan kelas dengan pendekatan deskriptif kualitatif dan deskriptif kuantitatif. Penelitian tindakan kelas ini dilakukan dengan menggunakan dua siklus dan setiap siklus terdiri dari 4 tahap yaitu: (1) perencanaan, (2) pelaksanaan, (3) pengamatan (observasi), dan (4) refleksi. Subjek dalam penelitian ini adalah 17 pemain putri Klub Bolavoli Binayuda Rowokangkung Kabupaten Lumajang. Hasil dari penelitian menunjukkan terjadi peningkatan keterampilan pemain dalam melakukan quick smash setelah dilakukan latihan dengan menggunakan metode part and whole. Penelitian ini dilakukan dalam dua siklus, yaitu tiga minggu dengan sembilan pertemuan di siklus 1, dan dua minggu dengan 6 pertemuan di siklus 2. Tingkat keberhasilan pemain pada siklus 1 pertemuan 1 sampai pertemuan 3 pada minggu pertama, pertemuan 4 sampai pertemuan 6 pada minggu kedua, pertemuan 7 sampai pertemuan 9 pada minggu ketiga yaitu dari awalan di minggu pertama 87,06%, 94,68% di minggu kedua, dan 100% di minggu ketiga. Tolakan di minggu pertama 69,80%, 83,53% di minggu kedua, dan 90,20% di minggu ketiga. Meloncat di minggu pertama 63,14%, 76,86% di minggu kedua, dan 83,92% di minggu ketiga. Perkenaan bola di minggu pertama 55,29%, 67,85% di minggu kedua, dan 78,04% minggu ketiga. Mendarat di minggu pertama 80%, 92,94% di minggu kedua, dan 96,86% di minggu ketiga. Pada siklus 2 jumlah persentase gerakan yang benar yaitu mulai pertemuan 1 sampai pertemuan 6 atau mulai minggu 1 sampai minggu 2 mengalami peningkatan. Tingkat keberhasilan mulai dari awalan di minggu pertama 100% dan tetap sebesar 100% di minggu kedua. Tolakan di minggu pertama 94,51% dan 98,04% di minggu kedua. Meloncat di minggu pertama 90,59% dan 93,73% di minggu kedua. Perkenaan bola di minggu pertama 85,88% dan 90,98% di minggu kedua. Mendarat di minggu pertama sebesar 97,26% dan tetap 97,26% di minggu kedua. Kesimpulannya adalah dengan penggunaan metode part and whole dalam latihan dapat meningkatkan keterampilan quick smash pemain Tim Putri Bolavoli Klub Binayuda Rowokangkung Kabupaten Lumajang.

Pengembangan permainan kartu kuartet sebagai media pembelajaran IPS materi jual beli untuk siswa kelas III semester 2 SD Gugus II Kecamatan Kedungkandang Kota Malang / Meita Candra Dewi

 

ABSTRAK Dewi, Meita Candra. 2015. Pengembangan Permainan Kartu Kuartet Sebagai Media Pembelajaran IPS Materi Jual Beli Untuk Siswa Kelas III Semester 2 SD Gugus II Kecamatan Kedungkandang Kota Malang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. I Made Suardana, S.Pd., M.Pd, (II) Drs. Sutrisno, S.Pd., M.Pd. Kata Kunci : Pengembangan, media permainan kartu kuartet, IPS materi jual beli Berdasarkan hasil wawancara diperoleh data bahwa belum menggunakan media untuk IPS materi jual beli pada kurikulum KTSP 2006. Selain itu, untuk pembelajaran diperlukan media yang praktis, efisien, menarik dan efektif. Terkait dengan hal tersebut tujuan penelitian dan pengembangan ini yakni untuk mengha-silkan media kartu kuartet, buku petunjuk untuk siswa dan guru, dan RPP untuk pembelajaran IPS materi jual beli yang praktis, efisien, menarik dan efektif. Media permainan kartu kuartet yang dipakai sebagai media jual beli yakni permainan kartu yang telah diganti isinya yang semula hanya bersifat hiburan menjadi materi IPS jual beli. Pemilihan media belajar harus ditentukan oleh tujuan pembelajaran yang dicapai dan karakteristik siswa. Siswa kelas III dalam teori Piaget termasuk dalam tahap operasional konkret. Pembelajaran bermakna, apalagi permainan yang bersifat menyenangkan cocok untuk memotivasi belajar siswa. Prosedur penelitian dan pengembangan ini memakai prosedur Borg dan Gall (dalam Sukmadinata, 2005:169-170). Berikut prosedur yang dilalui peneliti (1) penelitian dan pengumpulan data, (2) perencanaan, (3) pengembangan draf produk, (4) uji evaluasi ahli, (5) revisi produk hasil evaluasi ahli, (6) uji coba la-pangan kelompok kecil, (7) revisi produk hasil uji lapangan kelompok kecil, (8) uji coba lapangan kelompok besar, dan (9) revisi produk hasil uji lapangan kelompok besar sekaligus sebagai produk akhir. Instrumen yang dipakai adalah kuisioner, tes, dan observasi. Jenis data merupakan data kuantitatif dan kualitatif. Setelah uji evaluasi oleh para ahli terhadap media kartu kuartet jual beli, hasil dari ahli materi IPS memperoleh hasil 81,2% dan termasuk kriteria valid, sedangkan oleh ahli media memperoleh 81% dan termasuk kriteria valid. Aspek kepraktisan oleh guru kelas memperoleh 85,6% dan termasuk kriteria praktis. Pada uji kelompok kecil, kepraktisan menurut siswa memperoleh hasil 87,7% dan termasuk kriteria praktis. Sedangkan pada uji kelompok besar memperoleh 88,3% dan termasuk kriteria praktis. Aspek keefisienan media menurut guru memperoleh 88,8%, dan termasuk kategori efisien. Aspek kemenarikan menurut siswa media pada uji kelompok kecil memperoleh 90% dan termasuk dalam kriteria menarik. Sedangkan, pada uji kelompok besar memperoleh rata-rata 88,2% dan termasuk dalam kriteria menarik. Media termasuk media yang efektif karena setelah uji coba kelompok kecil siswa yang tuntas 77,7%, sedangkan pada uji kelompok besar ketuntasan mencapai 75 %. Dari hasil penelitian ini dapat disimpulkan bahwa kar-tu kuartet jual beli valid, efisien, praktis, menarik, dan efektif untuk digunakan dalam pembelajaran IPS materi jual beli kelas III di SD Gugus II Kecamatan Ke-dungkandang Kota Malang. Adapun saran dari ahli materi, gambar yang digunakan hendaknya memilih gambar yang tepat, utuh dan mudah dipahami siswa. Sedangkan, saran dari ahli media ialah untuk memperbesar buku petunjuk penggunaan bagi siswa.

Pengembangan media pembelajaran CD interaktif sub tema cara hidup manusia, hewan, dan tumbuhan untuk kelas VB SDN Lesanpuro 03 Kota Malang / Fera Yanurita

 

ABSTRAK Yanurita, Fera. 2015. Pengembangan Media Pembelajaran CD Interaktif Sub Tema Cara Hidup Manusia, Hewan dan Tumbuhan untuk Kelas VB SDN Lesanpuro 03 Kota Malang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Suharjo, M.S, M.A., (II) Dr. I Made Suardana, S.Pd., M.Pd. Kata Kunci: Pengembangan, Media, CD Interaktif. CD interaktif adalah media yang memuat suatu materi pembelajaran yang disajikan mengenai kombinasi teks, suara, gambar video dan grafis. Dari hasil observasi dan wawancara pada bulan Desember 2014, di kelas VB SDN Lesanpuro 03 menunjukkan ketuntasan hasil belajar siswa yang mencapai KKM hanya 40 % siswa dan siswa selalu ramai sendiri saat pembelajaran. Penggunaan media pembelajaran CD Interaktif di SDN Lesanpuro 03 belum pernah digunakan dan guru kelas setuju untuk digunakan karena kemampuan siswa kelas VB dalam mengoperasikan program komputer sudah baik. Tujuan penelitian dan pengembangan ini adalah menghasilkan media CD interaktif subtema Cara Hidup Manusia, Hewan dan Tumbuhan yang valid (praktis, menarik, efisien) dan efektif. Produk media ini juga dilengkapi dengan buku petunjuk (guru dan siswa) dan soal evaluasi. Pengembangan media pembelajaran CD interaktif ini mengacu pada model pengembangan dari Borg dan Gall antara lain; 1) analisis kebutuhan; (2) perencanaan; (3) pengembangan draf produk; (4) uji coba ahli; (5) merevisi produk; (6) uji coba lapa¬ngan skala kecil yaitu 10 siswa; (7) Penyempurnaan produk hasil uji skala kecil; (8) Uji pelaksanaan lapangan dengan skala besar yaitu 20 siswa kelas VB ; (9) Penyempurnaan produk akhir; (10) Diseminasi. Dalam penelitian dan pengembangan ini menggunakan instrumen pengumpulan data melalui angket dan tes. Hasil pengembangan ini berupa produk media yang menyajikan materi dalam bentuk audio, animasi, gambar, dan video yang dikemas dalam CD (Compact Disc) dengan program microsoft powerpoint. CD Interaktif ini memuat 3 pembelajaran pada sub tema cara Hidup Manusia, Hewan dan Tumbuhan yaitu pada pembelajaran 1 tentang bagian-bagian tumbuhan dan fungsinya, hasil kerajinan, dan jaring-jaring balok. Pembelajaran 2 tentang cara manusia bernapas, alat pernapasan manusia dan hewan, gangguan pernapasan manusia dan jenis hewan peliharaan. Pembelajaran 3 tentang cara manusia, hewan dan tumbuhan dalam memenuhi makanannya. CD Interaktif ini dilengkapi dengan petunjuk penggunaan berbentuk buku saku dan dikemas dalam cover CD yang berukuran panjang 18,5 cm dan lebar 13 cm. Berdasarkan analisis data hasil validasi keseluruhan diperoleh persentase kevalidan 88,05 % sehingga media dikartegorikan valid. Untuk uji keefektifan pada uji terbatas dan uji skala yang lebih besar, media dapat dikartegorikan efektif. Namun, masih ada beberapa komponen yang harus diperbaiki yang meliputi, isi materi, tampilan media dan isi buku petunjuk. Saran lebih lanjut media ini dapat disebarkan dan dikembangkan dengan skala yang lebih luas. Sehingga dapat memperkaya media pembelajaran berbasis teknologi.

Strategi penyampaian jasa untuk meningkatkan jumlah nasabah pada PT. Asuransi Jiwasraya (Persero) Cabang Malang / Achmad Thobroni Rizal

 

Pengembangan Cd interaktif pada subtema hebatnya cita-citaku untuk kelas IV smester 2 sekol;ah dasar / Maulidia Fientya Ikrima

 

ABSTRAK Ikrima, Maulidia Fientya. 2015. Pengembangan Media CD Interaktif pada Subtema Hebatnya Cita-citakuuntuk Kelas IV Semester 2 Sekolah Dasar. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Drs. Suhartono, S. Pd.,M. Pd, (2) Dra. Tumardi, S. Pd., M. Pd. Kata Kunci: media CD interaktif, subtema hebatnya cita-citaku, kelas IV SD. Pembelajaran yang masih konvensional atau tidak menggunakan perantara/ media sebagai alat untuk membantu siswa memahami pengetahuan baru, banyaknya siswa yang tidak fokus atau tidak bersemangat saat belajar merupakan akibat dari tidak tercapainya kriteria pembelajaran tematik yakni pembelajaran harusnya sesuai dengan kebutuhan anak disertai bantuan media berbasis komputer. Pada kelas IV semester 2 terdapat Subtema Hebatnya Cita-citaku. Subtema ini sangat sesuai dikembangkan dalam media pembelajaran CD interaktif, karena selain subtema yang umum dan kontekstual, subtema ini juga sulit diterangkan kepada siswa apabila hanya menggunakan metode ceramah saja. Model yang digunakan merupakan modifikasi dari Mbulu dan Suhartono. Tahapannya antara lain (1) tahap merancang dan (2) tahap menilai dan revisi.Pada tahap merancang terdapat 7 kegiatan antara lain analisis kebutuhan, mengkaji kompetensi, analisis pembelajaran, analisis isi, seleksi isi, penataan urutan isi, struktur isi. Sedangkan pada tahap menilai dan revisi terdapat dua kegiatan yaitu penilaian formatif dan revisi. Hasil pengembangan berupa media CD interaktif subtema hebatnya cita-citaku yang dapat digunakan untuk 6 kali pembelajaran dengan materi kehebatan cita-cita, bangun ruang kubus dan ciri-cirinya, jaring-jaring kubus, kerjasama, dan senam, buku petunjuk penggunaan untuk guru dan siswa, serta 6 RPP. Penilaian formatif oleh ahli media dan ahli materi masing-masing dilakukan oleh 1 orang dosen KSDP, penilaian formatif oleh pengguna dilakukan oleh 1 orang guru kelas IV dan 1 orang guru mata pelajaran komputer, serta 10 siswa kelas IV SD Plus Qurrota Ayun tahun ajaran 2014/ 2015 yang dipilih secara acak. Instrumen pengumpulan datanya yaitu angket dengan format rating scale. Data yang diperoleh berupa data numerik dan verbal. Teknik analisis data yang digunakan yaitu teknik analasis rata-rata dan persentase.Hasil penilaian formatifoleh ahli media yaitu 87%, oleh ahli materi yaitu 91,67%, oleh pengguna guru yaitu 95,36%, dan oleh pengguna siswa yaitu 96,5%. Produk media CD interaktif Subtema Hebatnya Cita-citaku terbatas pada materi mengenai kehebatan dokter, arsitek, polisi, perajin, guru. Untuk itu disarankan kepada pengembang selanjutnya untuk mengembangkan media CD interaktif dengan subtema yang sama namun melengkapi dengan kehebatan cita-cita yang lain dan tema dan subtema yang berbeda.

Penerapan CTL dalam meningkatkan pembelajaran biologi dalam pokok bahasan sistem koordinasi pada siswa kelas II SMA Laboratorium Universitas Negeri Malang oleh Idah

 

Berbagaui payat elahb anyakd ilakukanu ntuk meningkatkanh asilb elajar siswad i sekol-ahs,a lahs atu upayuyangdilakukaand alahm enerapkabne rbagai pendekatadna n metoded alam pembelaiaranP' endekatand an metodey ang iit.ruptun olehg urud alamp rosesp em6elajaramn emiliki perananp enting dalam r.n.ntukun keberhasilansi iwa. Penelitianin i bertujuanu ntukm engetahui p"ningkutunp embelajaranB iologi melalui pembelajarans ecarak ontekstual (crl/ ViirTr*A Teaching'anld.e arniig)yang dalamp elaksanaannytear diri dari empat tafrupV, uitu't ahape lsplorasi/pendahuluatnlh, ut eksplanasi/inttia' hap elspansi/pemantapadna n tahape valuasi/penilaian' SuUyetp enelitiana dalahs iswak elasI I.6 SMA Laboratoriumu niversitas Negeri Maiang yang berjumlah 45 siswa, terdiri dari 21 orang siswa pltf dan24 ot"il rir*" pitiu. i"n"iitiun melaluip embelajarakno ntekstua(lC TLI Contextual iriiniig o"a Learning)i ni menerapkapne ndekatanku alitatif dengan jenis ftn"fitii'n tindakant etas err). rafrapln+alrpan dalamp enelitian ini,sesuai Lngun tahapan-tahapadna lamP TK, yaitu:( l) perencanaatnin dakan'( 2) p.iiir*"* tindakan,( 3) observasid, an( 4)refleksi. Penelitianin i dilaksanakan 'ctalam duas iklus.P ada riklur p"ttu*a, pembelajaraBn iologi dilaksanakan denganm enerapkamn etodep embelajaradni skusid anp resentasSi. edangkan pada Stii. f.Ao".inerapkan metodep embelajarapnr alrfkum dant anya jawab' HasilpenelitianmenunjukkanbahwapembeldjaranBiologipadasiswa kelasI L6 SMA Laboratoriumi; niversitasN egeriM alangm engalampi eningkatan. Hal ini ditunjukkano leh peningkatanm otivasid anp restasbi elajars isrvaP- restasi Ueta.lasri swas etelahm elaksanikank egiatanp embelajaraBn iologi-padas iklusI telai menunjukkana danyap eningkatanP. adan ilai pre-tesyt angd iberikano leh gurus eUelump elaksanaanp embelajaranp adas iklus I memiliki rata-ratak elas7 4, iedangkanp adan ilai post-tesyt angdiberikano _lehg urup adaa khir pelaksanaan ;;b;irj;; pada siklus I mencapai rata-rata -S0 Ini menunjukkan bahwa ada peningtataop iestaslb elajars iswasetelahp elaksanaapne mbelajaraBn iologi pada rifr"i. Keteiampilanp rosess iswap adas iklusI ini meliputi keterampilans iswa dalamm elakukank egiatand iskusid anp resentasDi. atay angd iperoleh menunjukkank emampuans iswad alamm elakukank egiatand iskusid ar presentasi .ut upboin Hal ini diiunjukkand engann ilai yangb erhasild icapai- olehs iswa, yaitu: dalam melakukan fegtatan diskusi mencapai skor tertinggi 82,5% dan mencapasik ort ertingg8i 1,87od alarnr nelakukakne giatanp resentas-t' Padas iklusl I: nilai pre-tesst iswam emiliki rata-rata4 2,48,s edangkan rata-ratanilapi ost-tesst iswa7 8,85.B erdasarkadna tad i atasm enunjukkanb ahwa padas iklusI I ielah mengalampi eningkatanp restasbi elajars iswa.K eterampilan I prosess iswas elamap elaksanaasni klusI I cukupb aik. Hal ini dapatd iketahuid ari nilai yangb erhasild iperolehs iswad alamm elakukank egiatanp raktikum.P ada kegiatanp raktikum,s iswab erhasilm encapasi kort ertinggi9 5,8o/oD.a ri hasil penelitiante rsebudt apatd itarik kesimpulanb ahwap enerapanp embelajaran kontekstua(l CTLI Contextual Teachinga nd Learning) dapatm eningkatkan pembelajaraBni ologi siswak elasI I.6 SMA LaboratoriumU niversitasN egeri Malangp adas ubpokokb ahasanS istemI nderad an SistemH ormonp adaM anusia. Berdasarkanh asil penelitian di atas,m aka sarany ang dapatd iajukan yaitu: (1) pembelajaraBn iologi denganp enerapanp embelajarakno ntekstua(lC TU ContextualT 'eachinga nd Learning) dapatd ijadikan alternatifbagi guru untuk meningkatkapne mbelajaraBn iologi, (2) dilakukanp enelitianl ebih lanjutt entang pelaksanaanp embelajarank ontekstual( CTL/ ContextualT eachinga nd Learning) padam ateriy angb erbedak, elasy angb erbedad anj enjangp endidikany ang berbeda(,3 ) sekolahh arusd apatm enyediakanfa silitasb elajary angm enunjang palaksanaapne mbelajarakno ntekstua(lC TLI ContextualT 'eachinagn d Learning). ll

Pengembangan media CD interaktif pada subtema aku bangga dengan daerah tempat tinggalku untuk kelas IV di SDN Cemorokandang 2 Malang / Nurul Laily Yunitasari

 

ABSTRAK Yunitasari, Nurul Laily. 2015. Pengembangan Media CD Interaktif Pada Subtema Aku Bangga dengan Daerah Tempat Tinggalku Untuk Kelas IV di SDN Cemorokandang 2 Malang. Skripsi. Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Dr. I Made Suardana, S.Pd,M.Pd, (2) Dra. Hj. Murtiningsih, M.Pd. Kata Kunci: media CD interaktif, subtema aku bangga dengan daerah tempat tinggalku,kelas IV SD Penggunaan buku siswa dibutuhkan media pembelajaran untuk melengkapi materi dan adanya laboraturium komputer yang belum dimanfaatkan secara maksimal. Berdasarkan hal tersebut,dikembangkan suatu media CD interaktif subtema aku bangga dengan daerah tempat tinggalku untuk kelas IV semester 2.Tujuan dari penelitian ini adalah mengahasilkan media CD interaktif subtema aku bangga dengan daerah tempat tinggalku yang valid menurut ahli media, ahli materi, uji coba pengguna (guru), dan uji coba (siswa) sehingga media CD interaktif ini dapat digunakan dan diimplementasikan. Media CD interaktif pada subtema aku bangga dengan daerah tempat tinggalku ini mengunakan model tuorial. Materi disajikan secara rinci dan urut sehingga siswa lebih memahami konsep materi. Disertai dengan latihan soal yang bertujuan untuk mengukur pemahaman siswa tentang materi yang sudah dipelajari. Model ini menggunakan modifikasi dari model penelitian pengembangan Borg dan Gall. Tahap pengembangan hanya dilakukan hingga tahap uji coba terbatas. Validasi dilakukan oleh 1 orang dosen media KSDP, 1 orang dosen tematik KSDP, 1 orang guru kelas IV, serta uji coba terbatas pada 20 siswa kelas IV SDN Cemorokandang 2 Malang. Instrumen pengumpulan data berupa angket tertutup dengan bentuk rating scale. Data yang diperoleh berupa data numerik dan verbal. Teknik analisis data yang digunakan yaitu teknik analasis rata-rata dan persentase. Hasil pengembangan berupa media CD interaktif subtema aku bangga dengan daerah tempat tinggalku digunakan untuk pembelajaran 1, 2, dan 3 dengan materi yang berisi keadaan geografis pantai, perkotaan, dan pegunungan di Kota Malang. Hasil validasi yang diperoleh 91% oleh ahli media, 96,6% oleh ahli materi, dan 90% oleh guru. Uji coba terbatas terhadap 20 siswa kelas IV mendapat hasil 94,16%. Hal inimenyatakan bahwa CD interaktif ini dikembangkan termasuk dalam kriteria sangat valid digunakan dan diimplementasikan. Media CD interaktif subtema aku bangga dengan daerah tempat tinggalku dapat menunjang dan melengkapi materi pada buku siswa. Oleh karena itu, disarankan kepada guru dan siswa untuk menggunakannya dalam pembelajaran sehingga diharapkan dapatmencetak siswa yang tidak hanya cerdas secara teori namun juga cerdas secara praktek menggunakan teknologi dalam pembelajaran.

Pengembangan multimedia interaktif model latihan bertahan (defense) sepakbola pada ekstrakurikuler sepakbola di SMP Negeri 15 Malang / Eka Febri Prasetio

 

ABSTRAK Prasetio, Eka Febri. 2016. Pengembangan Multimedia Interaktif Model Latihan Bertahan (Defense) Sepakbola Pada Ekstrakurikuler Sepakbola Di SMP Negeri 15 Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Dr. Wasis D. Dwiyogo, M.Pd, (II) I Nengah Sudjana, S.Pd Kata Kunci: Pengembangan, Multimedia Interaktif, Model Latihan Bertahan Sepakbola. Dalam bermain sepakbola diperlukan pemahaman tentang strategi bermain. Strategi dalam sepakbola menjadi penting karena jalannya permainan ditentukan oleh strategi tim yang didalamnya mengandung unsur yang kompleks mulai dari penempatan posisi, kerjasama tim, dan koordinasi. Berdasarkan data analisis kebutuhan pada kegiatan ekstrakurikuler sepakbola di SMP Negeri 15 Malang, dari hasil pemberian angket kepada peserta ekstrakurikuler sepakbola menunjukkan bahwa 88,46 % peserta jarang diberikan latihan bertahan sepakbola, 92,31% peserta membutuhkan model latihan bertahan (defense) sepakbola, 96,15 % peserta tertarik dengan pengembangan multimedia interaktif model latihan bertahan (defense)sepakbola. Tujuan dari penelitian ini adalah untuk mengembangkan/menghasilkan suatu produk multimedia interaktif digunakan untuk mengembangkan keterampilan bermain sepakbola khususnya tentang model latihan bertahan (defense) pada ekstrakurikuler sepakbola di SMP Negeri 15 Malang. Prosedur penelitian yang digunakan adalah merujuk padabukuLee & Owen, yaitu (1) analisis, (2) desain, (3) pengembangan, (4) implementasi, (5) evaluasi. Teknik analisis data yangdigunakan adalah analisis kualitatif dan analisis kuantitatif berupa persentase.Produk yang dihasilkan berupa multimedia interaktif yang digunakan sebagai pembelajaran di ekstrakurikuler sepakbola. Multimedia interaktif ini dibuat menggunakan software Adobe Flash CS3. Dalam multimedia interaktif ini berisikan materi tentang sejarah sepakbola, teknik dasar sepakbola, peraturan sepakbola, pengertian bertahan sepakbola, taktik bertahan sepakbola, prinsip-prinsip bertahan sepakbola, dan model latihan bertahan sepakbola. Berdasarkan hasil analisis data, diperoleh dari hasil uji coba kelompok kecil dan kelompok besar.Ujicoba kelompok kecil diperoleh persentase 86,16% dan persentase tersebut termasuk dalam kriteria layak kemudian hasil analisis data dari ujicoba kelompok besar diperoleh persentase 81,66% dan persentase tersebut termasuk dalam kriteria layak. Dapat disimpulkan bahwa pengembangan multimedia interaktif ini layak digunakan dalam pembelajaran ekstrakurikuler sepakbola. Pengembangan multimedia interaktif model latihan bertahan (defense) sepakbola pada ekstrakurikuler sepakbola di SMP Negeri 15 Malang yang dikemas dalam bentuk DVD yang nantinya dapat berjalan di semua komputer dengan sajian gambar sekaligus penjelasan yang terperinci, sehingga membuat pengguna lebih tertarik dalam mempelajarinya dan multimedia interaktif ini mudah untuk dilakukan atau dipelajari, sehingga akan cepat menguasai berbagai model latihan sepakbola.

Pengembangan modul biologi berorientasi siklus belajar pada materi sistem reproduksi manusia untuk siswa kelas XI MIA di SMA Negeri 1 Tumpang / Mustika Army Suci

 

ABSTRAK Suci, M. A. 2016. Pengembangan Modul Biologi Berorientasi Siklus Belajar pada Materi Sistem Reproduksi Manusia untuk Siswa Kelas XI MIA di SMA Negeri 1 Tumpang. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Drs.Triastono Imam Prasetyo, M.Pd, (II) Drs. I Wayan Sumberartha, M.Sc. Kata Kunci: Pengembangan Modul Biologi, Siklus Belajar, Sistem Reproduksi Manusia Proses pembelajaran Biologi, khususnya materi Sistem Reproduksi Manusia kelas XI MIA di SMA Negeri 1 Tumpang belum berjalan baik. Hal ini disebabkan kurang memadainya media pembelajaran yang tersedia, buku pegangan siswa terbatas, dan metode pembelajaran yang digunakan guru kurang variatif, sehingga siswa merasa bosan dan mengalami kesulitan dalam memahami materi. Oleh karena itu, untuk menangani masalah tersebut diberikan bahan ajar yang komunikatif berupa modul belajar kepada siswa. Modul belajar merupakan suatu bahan ajar yang disusun secara sistematis, operasional, dan terarah agar dapat digunakan siswa secara mandiri. Modul belajar yang dikembangkan ini berorientasi siklus belajar yang terdiri dari 3 tahapan (3e), yaitu eksplorasi, eksplanasi, dan elaborasi. Pengembangan modul biologi ini bertujuan menghasilkan modul pembelajaran Biologi berorientasi siklus belajar pada materi Sistem Reproduksi Manusia untuk siswa kelas XI MIA di SMA Negeri 1 Tumpang dan untuk mengetahui tingkat kelayakannya. Penelitian ini menggunakan model penelitian pengembangan Borg & Gall (1983) yang terdiri dari 10 langkah pengembangan. Namun, pada penelitian ini hanya menggunakan 7 langkah, yaitu (1) melakukan studi pendahuluan, (2) melakukan perencanaan, (3) mengembangkan produk awal, (4) memvalidasi produk, (5) merevisi produk utama, (6) melakukan uji coba lapangan utama, dan (7) merevisi produk operasional. Pada penelitian ini ada 3 jenis uji coba, yaitu validasi, uji kepraktisan, dan uji keefektifan modul belajar. Data yang diperoleh pada penelitian ini adalah data kuantitatif dan data kualitatif. Data kuantitatif diperoleh dari hasil pengisian angket validasi oleh validator ahli, angket respon siswa oleh siswa, dan skor hasil tes kognitif siswa. Sedangkan data kualitatif diperoleh dari saran dan komentar dari validator ahli. Subyek coba pada penelitian ini adalah validator ahli (terdiri dari ahli media, ahli materi, dan praktisi lapangan) dan siswa kelas XI MIA1 SMA Negeri 1 Tumpang. Hasil validasi oleh validator ahli media adalah sebesar 86,98 % untuk modul guru dan 85,71 % untuk modul siswa, oleh ahli materi adalah sebesar 96,85 % untuk modul guru dan 97,63 % untuk modul siswa, serta oleh praktisi lapangan adalah sebesar 85,79 % untuk modul guru dan 86,34 % untuk modul siswa. Hasil yang diperoleh tersebut menunjukkan bahwa modul belajar valid dan layak untuk digunakan. Hasil uji kepraktisan yang diperoleh adalah sebesar 87,11 %, yang menunjukkan bahwa modul belajar sangat praktis untuk digunakan. Sedangkan hasil uji keefektifan yang diperoleh adalah sebesar 93,75 %. Oleh karena hasil tersebut melebihi tingkat ketuntasan klasikal sebesar 85%, maka modul belajar dikatakan efektif untuk digunakan.

Penerapan schule-Spielen untuk menghafal kosakata pada tema schulsachen siswa kelas X SMA Negeri 1 Lawang / Ana Nur Adiyati

 

ABSTRAK Adiyati, Ana Nur. 2016. Penerapan Schule-Spielen untuk Menghafal Kosakata pada Tema Schulsachen Siswa Kelas X SMA Negeri 1 Lawang. Skripsi. Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: Dr. Primardiana H.W., M.Pd. Kata Kunci: Schule-Spielen, bermain, pembelajaran, kosakata. Kosakata memiliki peran penting dalam pembelajaran bahasa. Berdasarkan pengamatan, pemahaman kosakata di SMA Negeri 1 Lawang masih rendah, karena metode yang digunakan dalam mengajar kurang menarik. Schule-Spielen adalah permainan yang diterapkan pada siswa kelas X Lintas Minat bahasa Jerman SMA Negeri 1 Lawang untuk membantu siswa dalam menghafal dan memahami kosakata dengan baik dan untuk menjadikan pembelajaran kosakata yang menarik. Penelitian dilaksanakan dengan tujuan mendiskripsikan penerapan Schule-Spielen serta kendala yang dialami dalam penerapannya. Dalam penelitian ini digunakan rancangan penelitian kualitatif. Data penelitian diperoleh dari data hasil observasi dan data hasil wawancara terhadap siswa kelas X Lintas Minat bahasa Jerman SMA Negeri 1 Lawang yang berjumlah 20 orang. Schule-Spielen dilakukan oleh siswa dengan cara siswa menyebutkan kosakata dari benda yang dimilikinya serta menyebutkan nama benda yang dimiliki oleh siswa yang lain. Berdasarkan hasil analisis data tersebut, penerapan Schule-Spielen dapat membantu siswa dalam menghafal dan memahami kosakata bahasa Jerman sesuai dengan tema Schulsachen. Schule-Spielen juga dapat membantu siswa dalam menggunakan Akkusativ terutama mengenai Unbestimmter Artikel. Siswa terlibat aktif, merasa nyaman dan senang dalam pembelajaran, walaupun siswa sedikit mengalami kendala dalam mengingat kosakata yang telah diucapkan siswa sebelumnya apabila kurang berkonsentrasi. Selain itu, penerapan Schule-Spielen membuat suasana kelas sedikit ramai serta dalam pelaksanaannya membutuhkan tempat yang cukup luas.

Analisis penyebab kesulitan belajar pada mata pelajaran IPS (ekonomi) siswa kelas VIII (studi kasus di SMP Negeri 1 Papar Kab. Kediri tahun ajaran 2015/2016) / Dewi Maharani

 

ABSTRAK Maharani, Dewi. 2016. Analisis Penyebab Kesulitan Belajar Pada Mata Pelajaran IPS (Ekonomi) Siswa Kelas VIII (Studi Kasus di SMP Negeri 1 Papar Kab. Kediri Tahun Ajaran 2015/2016). Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Sri Umi Mintarti W., S.E, M.P. Ak (II) Drs. Prih Hardinto, M.Si Kata Kunci: kesulitan belajar, faktor internal, faktor eksternal dan upaya guru. Bangsa Indonesia berupaya mempersiapakan generasi penerus bangsa yang cerdas dan kompeten dengan menyelenggarakan pendidikan. Salah satunya melalui pendidikan formal di sekolah. Pada kenyataannya penyelenggaraan proses belajar tidak selalu lancar. Karena bagi setiap siswa yang belajar pasti menemui hambatan-hambatan yang berbeda antara satu dengan lainnya. Kesulitan belajar tersebut dapat dipengaruhi oleh faktor internal dan faktor ekternal. Berdasarkan temuan penelitian ini diketahui bahwa faktor internal berpengaruh paling besar yang menyebabkan kesulitan belajar ilmu ekonomi bagi siswa kelas VIII di SMP Negeri 1 Papar. Permasalahan yang dikaji dalam penelitian ini adalah (1) untuk mengetahui dan memaparkan faktor internal yang menyebabkan kesulitan belajar pada mata pelajaran IPS (Ekonomi) siswa kelas VIII di SMP Negeri 1 Papar, (2) untuk mengetahui dan memaparkan faktor eksternal yang menyebabkan kesulitan belajar pada mata pelajaran IPS (Ekonomi) siswa kelas VIII di SMP Negeri 1 Papar, (3) untuk mengetahui dan memaparkan upaya guru dalam mengatasi kesulitan belajar yang dialami oleh siswa kelas VIII di SMP Negeri 1 Papar. Penelitian ini menggunakan pendekatan deskriptif kualitatif dengan jenis penelitian yang digunakan adalah studi kasus. Sumber data yaitu sumber data primer dan sekunder dengan narasumber terdiri dari siswa kelas VIII, guru mata pelajaran IPS dan guru BK. Proses pengumpulan data menggunakan observasi, wawancara, dan dokumentasi. Lokasi penelitian dilakukan di SMP Negeri 1 Papar Kab. Kediri. Hasil penelitian menunjukkan faktor internal yang meliputi faktor psikologis yaitu ketidaksesuaian bakat siswa dengan ilmu ekonomi, kurangnya minat dan rendahnya motivasi siswa, kebiasaan belajar yang tidak baik dan tidak teratur serta kurangnya kesiapan siswa dalam belajar. Faktor eksternal meliputi cara penyajian pelajaran oleh guru yang kurang bervariasi, bahan pelajaran berupa materi hitungan serta kurva-kurva yang sulit dipahami oleh siswa serta faktor suasana rumah yang kurang kondusif menyebabkan siswa mengalami kesulitan belajar. Upaya guru untuk membantu siswa mengatasi kesulitan belajar adalah dengan mengamati gejala-gejala yang muncul, kemudian mengadakan pendekatan kepada siswa dan memberikan kesempatan berkonsultasi untuk menemukan solusi yang tepat.

Analisis sektor ekonomi unggulan perekonomian Kabupaten Malang (tahun 2011-2014) / Ufi Swaraswati Fadillah

 

ABSTRAK Fadillah, Ufi Swaraswati. 2016.Analisis Sektor Ekonomi Unggulan Perekonomian Kabupaten Malang Tahun 2011 – 2014.Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Dr. Nasikh, S.E, M.P., M.Pd. (2) Dr. Imam Mukhlis, SE, M.Si. Kata kunci: Sektor Unggulan, Location Quetient, Shift Share, Tipology Klassen Pembangunan merupakan proses perubahan yang direncanakan dan merupakan suatu kegiatan yang berkesinambungan, berkelanjutan dan bertahap ke tingkat yang lebih maju dan lebih baik. Masalah – masalah seperti rendahnya tingkat kesejahteraan msayarakat, kemiskinan, pengangguran, ketimpangan sosial dan ketimpangan pendapatan merupakan permasalahan yang dapat menghambat berjalannya pembangunan nasional di suatu negara khususnya di negara berkembang. Penelitian ini bertujuan untuk mengetahui sektor unggulan perekonomian Kabupaten Malang. Penelitian ini menggunakan data sekunder berupa runtun waktu (time series) dari Produk Domestik Regional Bruto (PDRB) Kabupaten Malang dan Provinsi Jawa Timur 2011 – 2014. Metode pengumpulan data yaitu metode dokumentasi, selanjutnya dilakukan analisis dengan menggunakan alat analisis Location Question (LQ), Shift Share (SS), Tipology Klassen. Hasil perhitungan Location Quetient (LQ) menunjukkan yang termasuk dalam sektor unggulan (LQ>1) yaitu : Sektor Pertanian, Kehutanan, dan Perikanan,, Sektor Industri Pengolahan, Sektor Kontruksi, Sektor Perdagangan Besar dan Eceran: Reparasi Mobil dan Sepeda Motor, dan sektor jasa lainnya. Analisis Shift Share (SS) menggunakan komponen pertumbuhan differential (D) menunjukkan 6 sektor dengan rata – rata D positif, yaitu sektor pengadaan listrik dan gas, sektor pengadaan air, pengelolaan sampah, limbah dan daur ulang, sektor kontruksi, sektor transportasi dan pergudangan, serta sektor jasa perusahaan dan sektor administrasi pemerintahan, pertahanan & jaminan sosial wajib. Sedangkan komponen proportional (P) menujukkan bahwa ada 11 sektor yang memiliki rata – rata positif yaitu industri pengolahan,kontruksi, perdagangan besar dan eceran: reparasi mobil dan sepeda motor, penyediaan akomodasi dan makan minum, informasi dan komunikasi, jasa keuangan dan asuransi, real estate, jasa perusahaan, jasa pendidikan, jasa kesehatan dan kegiatan Sosial, dan jasa lainnya. Dan yang terakhir hasil analisis Tipology Klassen Sektor yang termasuk maju dan tumbuh pesat diantaranya Sektor Pertanian, Kehutanan, dan Perikanan, Sektor Kontruksi,Sektor Jasa Lainnya.

Difenilmetanation dan 2,2,4,4-tetrametil-3-tioksosiklobutanon: kajian reaktivitas dan keadaan transisinya dalam reaksi sikloadisi-1,3 dengan 3-diazo-2,4-pentanadion menggunakan metode density functional theory / Annisa Alfadini

 

ABSTRAK Alfadini, Annisa. 2015. Difenilmetanation dan 2,2,4,4-tetrametil-3-tiooksosiklobutanon: Kajian Reaktivitas dan Keadaan Transisinya dalam Reaksi Sikloadisi 1,3 dengan 3-diazo-2,4-pentanadion Menggunakan Metode Density Functional Theory. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Yahmin, S.Pd, M.Si., (II) Dr. Siti Marfu’ah, M. S. Kata Kunci : 3-diazo-2,4-pentanadion, DFT, Energi Aktivasi, Keadaan Transisi, Reaksi Sikloadisi 1,3 Sintesis 1,3-oksatiol banyak dilakukan karena perannya dalam bidang farmasi yang sukup besar. 1,3-Oksatiol dapat disintesis dari reaksi sikloadisi 1,3 pada 3-diazo-2,4-pentanadion dengan difenilmetanation menghasikan produk dengan rendemen 81%, sedangkan dengan 2,2,4,4-tetrametil-3-tiooksosiklobutanon mempunyai rendemen sebesar 88%. Analisis mengenai perbedaan persentase produk yang telah disebutkan dapat dipelajari secara teoritis dengan menggunakan metode komputasi. Tujuan penelitian ini adalah (1) mengetahui struktur 3D keadaan transisi reaksi sikloadisi 1,3 pada 3-diazo-2,4-pentanadion, (2) mengetahui besar energi aktivasi reaksi sikloadisi 1,3 pada 3-diazo-2,4-pentandion dengan difenilmetanation dan 2,2,4,4-tetrametil-3-tiooksosiklobutanonon, (3) mengetahui reaktivitas difenilmetanation dan 2,2,4,4-tetrametil-3-tiooksosiklobutanon pada reaksi tersebut. Kajian dilakukan dengan menggunakan perangkat lunak Gaussian 09 dan Gauss view 5.0. Metode yang digunakan adalah DFT dengan fungsi hibrid B3LYP himpunan basis 6-31G(d). Pengumpulan data menggunakan seperangkat server komputer dengan menggambarkan struktur seyawa yang terlibat. Semua struktur tersebut kemudian dioptimasi dan dihitung frekuensi vibrasinya pada keadaan dasar. Selanjutnya mencari struktur keadaan transisi dengan metode QST3. Data yang didapatkan tersebut kemudian dianalisis proses pembentukannya serta pemutusan ikatannya, dan penentuan energi aktivasi reaksi sikloadisi 1,3 pada 3-diazo-2,4-pentanadion. Gambar 3D dari dua struktur keadaan transisi dalam masing-masing mekanisme reaksi sikloadisi 1,3 pada 3-diazo-2,4-pentanadion dengan dua pereaksi berbeda menunjukkan bahwa proses reaksi diawali dengan pembentukan struktur cincin, kemudian terjadi pelepasan N2 . Adanya dua keadaan transisi dan satu zat antara menyimpulkan bahwa proses reaksi terdiri dari dua tahap. Energi aktivasi reaksi 1 adalah: Tahap 1: 16,085 kkal/mol; Tahap 2: 18,184 kkal/mol. Energi aktivasi reaksi 2 adalah: Tahap 1: 16,118 kkal/mol; Tahap 2: 16,719 kkal/mol. Tahap 2 dari masing-masing reaksi merupakan penentu laju reaksi. Reaksi 2 lebih cepat berlangsung dibandingkan dengan reaksi 1. Reaktivitas difenilmetanation lebih kecil daripada 2,2,4,4-tetrametil-3-tiooksosiklobutanon.

Variasi sudut potong gerak makan dan spindle speed terhadap tingkat kekasaran pembubutan kuningan (Brass) / Mochammad Rivan Maulana

 

ABSTRAK Maulana, M. Rivan. 2016. Variasi Sudut Potong Gerak Makan dan Spindle Speed Terhadap Tingkat Kekasaran Pada Pembubutan Kuningan (Brass). Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Imam Sudjono, Drs., M.Pd, (II) Yuni Sunarto, Drs., M.Pd. Kata Kunci: sudut potong, kecepatan potong,spindle speed, kekasaran permukaan Penelitian ini bertujuan untuk mengetahui: (1) tingkat kekasaran permukaan benda kerja hasil pembubutan dengan variasi sudut potong, (2) tingkat kekasaran permukaan benda kerja hasil pembubutan dengan variasi gerak makan, dan (3) tingkat kekasaran permukaan benda kerja hasil pembubutan dengan spindle speed. Di dalam penelitian ini menggunakan metode eksperimen untuk mengetahui variasi sudut potong, gerak makan dan spindle speed terhadap tingkat kekasaran pada pembubutan kuningan (brass). Teknik analisis data yang digunakan dalam penelitian ini menggunakan pendekatan deskriptif, yaitu penelitian yang dilakukan untuk memperoleh data-data yang valid hasil pengujian yang berupa angka dan kemudian mendeskripsikan data tersebut dalam bentuk kalimat yang mudah dibaca, dipahami dan diinterpresentasikan. Dari hasil penelitian yang diperoleh bahwasanya variasi parameter pemesinan yang cocok digunakan untuk menghasilkan tingkat kekasaran N6 adalah variasi z1 x2 y1 (feed rate 0.05 mm/rev, sudut potong 800, spindle speed 1250 rpm) dengan nilai Ra 0.52 µm. Dari hasil penelitian yang diperoleh bahwasanya variasi parameter pemesinan yang cocok digunakan untuk menghasilkan tingkat kekasaran N7 adalah variasi z3 x2 y1 (feed rate 0.15 mm/rev, sudut potong 800, spindle speed 1250 rpm) dengan nilai Ra 1.70 µm. Dari hasil penelitian yang diperoleh bahwasanya parameter pemesinan yang cocok digunakan untuk menghasilkan tingkat kekasaran N8 adalah variasi z3 x3 y3 (gerak makan 0.15 mm/rev, sudut potong 750, spindle speed 630 rpm) dengan nilai Ra 2.65 µm. Untuk laboratorium jika melakukan proses pemesinan khususnya pembubutan kuningan, hasil penelitian ini dapat digunakan sebagai acuan untuk mendapatkan hasil kualitas permukaan benda kerja yang lebih baik.

Flouting maxims in a collection of children literaterature / Widya Hanum Sari Pertiwi

 

Thesis. Graduate Program in English Language Education, State University of Malang. Advisors: (I) Prof. Bambang Yudi Cahyono, M.Pd, M.A., Ph.D. (II) Dr. Yazid Basthomi, M.A. Keywords: children literature, tales, flouting maxims. In the area of English teaching and learning most attention is given to the teaching and learning of four language skills; on the other hand, culture learning is more or less ignored. In fact, to be bilingual means to be bicultural. Culture learning can be gained from research studies which investigate intersection between pragmatics and literature (as part of a culture). Pragmatics as one of linguistic disciplines has potential application to all fields with a stake in “how utterances are understood” or literature. The present study tries to find out the flouting of Gricean maxims and the functions of the flouting in the tales which are included in collection of children literature entitled My Giant Treasury of Stories and Rhymes. The objective of the study is generally to identify the violation of maxims of quantity, quality, relevance, and manner in the data sources and also to analyze the use of the flouting in the tales which are included in the book. This study was qualitatively approached. The qualitative approach was used to examine the utterances that become the data. The sources of data in this study were 75 tales included in the book and the data were all the utterances which are flouted Gricean maxims. Qualitative design using categorizing strategies, specifically coding strategy, was applied. Thus, the researcher as the instrument in this investigation was selecting the tales, reading them, and gathering every item which reflects the violation of Gricean maxims based on some conditions of flouting maxims. Qualitative design using coding strategy was applied because after selecting the data, the writer then implemented coding strategy so that she could analyze the data. On the basis of the data analysis, it was found that the some utterances in the tales, both narration and conversation, flouting the four maxims of conversation, namely maxim of quality, maxim of quantity, maxim of relevance, and maxim of manner. The flouting of maxim of quality was classified in to two conditions, fallacious statement and information with lack of evidence. Meanwhile, information or statement which was not as required and which was much more than required were the two conditions of flouting maxim of quantity. Maxim of relevance is flouted whenever there was irrelevant information/statement. Last, flouting of maxim of manner occurred when there was obscure statement or ambiguous information. The researcher has also found that the flouting of maxims has one basic function that is to encourage the readers’ imagination toward the tales. This one basic function is developed by six others functions: (1) generating specific situation, (2) developing the plot, (3) enlivening the characters’ utterance, (4) implicating message, (5) indirectly characterizing characters, and (6) creating ambiguous setting. In relation with the research findings of this study, it is expected that the research findings can be applied, followed up by the English language teachers and the next researchers so that the conversational implicature and cooperative principle can be further developed. In addition, it is suggested that the intersectional teaching method which involves linguistics and literature should be paid more attention in order to achieve the success of the teaching-learning process.

Analisa HDL (High Density Lipoprotein), serat pangan (dietary Fiber), dan uji organoleptik kue satu berbahan dasar bekatul (rice bran) / Sulisa Rosita Mabruroh

 

ABSTRAK Mabruroh, Sulisa Rosita. 2016. Analisa HDL (High Density Lipoprotein), Serat Pangan (Dietary Fiber), Dan Uji Organoleptik Kue Satu Berbahan Dasar Bekatul (Rice Bran). Skripsi. Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang, Pembimbing: (1) Dr. Dra. Mazarina Devi, M. Si. (2) Lismi Animatul Chisbiyah, S.Pd., M.Pd. Kata Kunci: Kue Satu, Bekatul (Rice Bran), HDL (High Density Lipoprotein), Serat Pangan (Dietary Fiber). Penelitian ini bertujuan untuk mengetahui pengaruh penggunaan tepung bekatul sebagai bahan dasar pembuatan kue satu bekatul dengan uji organoleptik, kandungan HDL (High Density Lipoprotein), serat pangan (Dietary Fiber), dan uji warna pada kue satu bekatul. Rancangan penelitian yang digunakan adalah Rancangan Acak Lengkap dengan tiga perlakuan dan dua kali pengulangan dengan formula antara tepung bekatul dan tepung kacang hijau 65%:35%, 70%:30%, dan 75%:25%. Data yang diperoleh dianalisis menggunakan One Way ANOVA (Analysis of Variance), yang dilanjutkan dengan uji Duncan’s Multiple Range Test. Perlakuan terbaik ditentukan menggunakan metode indeks efektivitas. Hasil penelitian menunjukkan bahwa terdapat pengaruh pemberian tepung bekatul sebagai bahan dasar pembuatan kue satu pada uji organoleptik, kandungan HDL (High Density Lipoprotein), serat pangan (Dietary Fiber), dan uji warna. Formula terbaik kue satu bekatul terdapat pada formula 2 (B2) dengan perbandingan 70%:30%. Formula terbaik ini memiliki spesifikasi kandungan HDL High Density Lipoprotein) 15,94%, serat pangan (Dietary Fiber) 8,00%, uji warna 76,43%, uji hedonik warna 4,07, uji hedonik rasa 3,97, uji hedonik aroma 3,84, dan uji hedonik tekstur sebesar 3,86.

Studi tentang sarana, prasarana dan tingkat kesegaran jasmani siswa SLTP Negerise Kcamatan KotaKabupaten Sumenep oleh Akhmad Rasyidi

 

Saranap endidikanJ asmandi anK esehatand alamh al ini berartis egalas esuatu yangd apata ipatcasi ebagaai lat demit ercapainyatu juanp endidikanJ asmandi an tes"trutao.P risaranab eiarti segalas esuatuy angd apatm enurjangt ercapainyatu juan pendidikanJ asmandi ank esehatanK. esegaranJ asmanyi aitu keadaans eseoranyga ng mempunyakie sanggupadna nk emampuanu nnrkm elalarkanp ekerjaannydae ngan efisient anpam engutu.l kelelahany angb erarti.S aranap rasarana kanm empengaruhi tercapainyake berhasilans uatup endidikanA. pabilas aruunp rasaranam emadaui nhrk menunjangp rosesb elajarm engajarm, akak urikulumd apatd iterapkans ecarao ptimal. Sebaliknyaip abila saranap rasaranati dak memadaui ntukm enunjangp rosesb elajar mengajarm, akak urikulurntidakd apatd iterapkurs ecarao ptimal.U ntuk tingkat keselaranja smani,a pabilas iswam empunyatii ngkatk esegarajna smanis angabt aik sekaf,,m akus iswat ersebutti dak mudahl elahd alamm ekalsrkans emuaa ktivitass eharihari. debaliknyaa pabilas iswam empunyatii ngkatk esegarajna smaniy angj elek, maka siswat ersebuiakanm udahl elahd aiamm ekakukana ktivitass ehari'hari.P enelitianin i bertujuanu ntukm enggambarkasna ranap, rasaranad, ant ingkatk esegaranjasmansiis wa SLTPN egeriS e-KecamataKno ta KabupatenS umenep ropitasi dalamp enelitianin i adalahs eluruhS LTPNegeriS e'KecamatanKota KabupatenS umenepia itu sebanyak6 sekolah.A dapunP fi1p-el:Try $Prasarana dalamp enelitianin iaaaUn sehrnrhp opulasiy angadayairuS LTP.NegerSi e-Kecamatan Kota KabupatenS umeneps,e banyak6 sekolah.T eknik pengambiland atad alem penelitianin i d.ng*."nggunakan tetnik observassi ecarala ngsungte rhadapo byek penelitiand anm eggunatana ngket.S edangkaunn tukm emperolehd atat ingkat kese-Hgaarsaijinap semnealnitiida inla kukant esh arv'ard. dapatd isimpulkanb ahwad i SLTPN egeris e-KecamataKn ota KabupatenS umenepu ntukp rasaranat,id ak memilikil intasanla ri' mafraslo mpatt inggi, lapanganto lak peluru,lapanganle mparl embing,l apanganle mparc {g1p danl apangan sepak-bolaS. edangkaunn tut Uat lompatj auh dalamk ondisib aik (1007o)a, ulao lahraga (g3,33%d alamk ondisib aik dan1 6,66% kurang)l,a pangabno lavoli-(757doa lam kondisib aik dan2 5% sedang)d, anl apanganb ola basket( 80%d alamk ondisis edang dan2 0% kurang).U ntuk saranas ebagianb esarb anyaky angm emilikik hususnya tongka(t 38,466/odalakmo ndisib aik sekali,1 5,38% baik, 15,38% sedangd, N3A,76% kurang) meteran(1 00 o/o)t,i angd anm istar( 60 % d,lam kondisi sedangd an4 0 Yo fu*E), peluru( 100% baik),lembing(4 0 % sedangd an6 0 7o,kur.an-cCa)lr, am( 23',08 x Ua{-:i,+O t"dang,d an3 8y'6o /ok urang)m, atras(1 00% sedang)b,o las epak( 36'84% I baik,2 1,05% os edng, dan4 2,11% kurang)b, olav oli (50 % baik,2 9,17V os edangd, an 20,83% kurang)n, et( 62,5% baik,2 5%s edangd an1 2,5%k urang)b, olab aske(t 45'83 % baik,1 6,67y os edangd, an3 7,5% kwang).S edangkaunn tukt ingkatk esegaran jasmansi iswap utrat erbanyatke rdapapt adak atagorsi angabt aiks ekal(i 61,16%)d an tingkatk esegaranjasmatnei rendahb eradap adak atagoris edang(1 ,657o)d an tingkat keiegaranjasmansii swap u6i terbanyakte rdapatp adak atagoris angabt aik sekali (41,460/doa) nu ntukt ingkatk esegaranjasmatenri endahb eradap adak atagorbi aik sekalic, ukup,d ans edang(7 ,32o/o). Berdasarkahna sil penelitianm akad apatd isarankanb ahwau ntuk SLTPN egeriS e- KecamataKn ota KabupatenS umenepya ngt idak memilikis aranad an prasarana pendidikanjasmanami,a kag uruo lakaga harusm eningkatkaknr eativitasd alam menyampaikmana tap elajarana garp rosesb elajarm engajadr apat ercapasi ecara maksimalS. edangkabna gi siswap utram aupunp ubi SLTPN egeriS e-KecamataKno ta KabupatenS umenepya ngk urangm emiliki tingkatk esegarajna smani,d isarurkanu rtuk meningkatkaank tivitasf isik khususnyad alamb idango lahraga

Penerapan model pembelajaran berbasis alam untuk meningkatkan kemampuan motorik halus anak Kelompok B di TKK Mardi Wiyata Malang / Maria Angela Winarsih Prihartini

 

ABSTRAK Prihartini, Maria Angela Winarsih. 2015. Penerapan Model Pembelajaran Berbasis Alam Untuk Meningkatkan Kemampuan Motorik Halus Anak Kelompok B di TKK Mardi Wiyata Malang. Skripsi. Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Program Studi Pendidikan Guru Pendidikan Anak Usia Dini, Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Drs. Usep Kustiawan, M.Sn, (II) Pramono, S.Pd, M.Or. Kata Kunci: Model Pembelajaran Berbasis Alam, Motorik Halus Anak Kelompok B Latar belakang yang mendasari penelitian ini dilakukan adalah karena rendahnya kemampuan motorik halus anak di TKK Mardi Wiyata Malang yang meliputi kegiatan membuat variasi coretan, meniru bentuk dan menggambar bebas masih menggunakan buku paket. Hal ini disebabkan karena kegiatan untuk mengenalkan alam sekitar tempat belajar belum pernah dilakukan. Maka peneliti merancang suatu model pembelajaran berbasis alam untuk meningkatkan kemampuan motorik halus anak. Penelitian ini dilaksanakan dengan tujuan: (1) mendeskripsikan penerapan model pembelajaran berbasis alam untuk meningkatkan kemampuan motorik halus anak Kelompok B TKK Mardi Wiyata Malang; (2)mendeskripsikan peningkatan kemampuan motorik halus anak Kelompok B TKK Mardi Wiyata Malang dengan menerapkan model pembelajaran berbasis alam. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) dan dilaksanakan dalam 2 siklus. Tiap siklus meliputi perencanaan, pelaksanaan, observasi dan refleksi. Subyek penelitian ini yaitu 22 anak kelompok B di TKK Mardi Wiyata Malang. Instrumen penelitian yang menjadi pedoman yaitu hasil observasi dan refleksi yang dilakukan oleh guru peneliti. Analisis data penelitian yang dipakai adalah deskriptif kuantitatif dan kualitatif. Hasil penerapan model pembelajaran berbasis alam dengan menggunakan pasir untuk menunjukkan kelancaran dalam menggores sesuai dengan apa yang diamati anak setelah melihat benda-benda di sekitar sekolah dapat meningkatkan kemampuan motorik halus anak. Hal ini terbukti dari hasil observasi pada persentase ketuntasan kelas pada siklus I sebesar 50% dan siklus II ketuntasan kelas meningkat sebesar 91%. Sehingga terdapat peningkatan persentase ketuntasan kelas dari siklus I hingga siklus II sebesar 41%. Berdasarkan penelitian ini, maka dapat disimpulkan bahwa model pembelajaran berbasis alam menggunakan media pasir dengan cara menunjukkan kelancaran dalam menggores dapat meningkatkan kemampuan motorik halus anak. Saran peneliti supaya pendidik dapat menerapkan kegiatan pembelajaran berbasis alam yang lebih bervariasi dan menarik untuk meningkatkan kemampuan motorik halus anak.

Peningkatan pemahaman konsep bilangan melalui permainan detektif cilik pada anak Kelompok A TK Al-Fadholi Malang / Lia Wahyuningsih

 

ABSTRAK Wahyuningsih, Lia, 2015. PeningkatanPemahaman Konsep Bilangan Melalui Permainan Detektif Cilik pada Anak Kelompok A TK Al-Fadholi Malang. Skripsi. Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Drs. I Wayan Sutama, M.Pd. (2) Drs. Ir. Endro Wahyuno, M.Si Kata Kunci: Pemahaman Konsep Bilangan, Permainan Detektif Cilik Berdasarkan latar belakang mengenai kemampuan kognitif yang dimiliki anak kelompok A TK Al-Fadholi Malang yang masih rendah, maka dilakukanlah penelitian ini. Penyebabnya yaitu pembelajaran yang kurang menarik bagi anak serta pembelajaran yang belum mampu membangun keaktifan dan minat anak untuk belajar serta media yang digunakan berupa lembar kerja dan papan tulis . Penelitian ini bertujuan untuk (1) mendeskripsikan penerapan permainan Detektif Cilik untuk meningkatkan kemampuan membuat urutan bilangan 1-5 dengan benda dan menghubungkan/memasangkan bilangan dengan benda sampai 5 anak kelompok A TK Al-Fadholi Malang, (2) mendiskripsikan peningkatan kemampuan membuat urutan bilangan 1-5 dengan benda dan menghubungkan/memasangkan bilangan dengan benda sampai 5 kelompok A TK Al-Fadholi Malang setelah penerapan permainan Detektif Cilik. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) dan dilaksanakan dalam 2 siklus. Subyek penelitian ini adalah 19 anak kelompok A di TK Al-Fadholi Malang. Instrumen penelitian yang menjadi pedoman yaitu hasil observasi dan refleksi yang dilakukan oleh guru kelas dan peneliti. Analisis data penelitian yang dipakai adalah deskriptif kuantitatif dan kualitatif. Kemampuan membuat urutan bilangan 1-5 dengan benda dan menghubungkan/memasangkan bilangan dengan benda sampai 5 pada anak kelompok A di TK Al-Fadholi Malang telah menunjukkan peningkatan. Hal ini dibuktikan dengan kondisi pembelajaran yang lebih menyenangkan dan dapat membangun minat belajar anak setelah diterapkan permainan Detektif Cilik. Persentase ketuntasan kelas juga mengalami peningkatan pada pratindakan ketuntasan kelas sebesar 15,8%, siklus I telah meningkat menjadi 36,8% sehingga dilaksanakan siklus II dikarenakan belum mencapai standar ketuntasan kelas yaitu ≥75%. Pada siklus II ketuntasan kelas meningkat menjadi 78,9%, artinya kemampuan kognitif anak kelompok A TK Al-Fadholi Malang dinyatakan tuntas. Peneliti berharap pendidik anak usia dini dapat menerapkan dan mengembangkan permainan Detektif Cilik dalam usaha meningkatkan kemampuan kognitif dan mengembangkan permainan lain dalam setiap kegiatan pembelajaran agar kegiatan pembelajaran lebih menyenangkan bagi anak.

Pengaruh pelaksanaan Kajian Praktik Lapangan (KPL) dan lingkungan keluarga terhadap minat menjadi guru pada mahasiswa program studi S1 Pendidikan Akuntansi Fakultas Ekonomi Universitas Negeri Malang angkatan 2012 / Deidra Desan Syukru

 

ABSTRAK Syukri, Deidra Desan. 2016. Pengaruh Pelaksanaan Kajian Praktik Lapangan (KPL) Dan Lingkungan Keluarga Terhadap Minat Menjadi Guru Pada Mahasiswa Program Studi S1 Pendidikan Akuntansi Fakultas Ekonomi Universitas Negeri Malang Angkatan 2012. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Bety Nur Achadiyah, S.Pd, M.Sc, (2) Diana Tien Irafahmi, S.Pd, M. Ed Kata Kunci: KPL, lingkungan keluarga, minat menjadi guru. Minat menjadi guru merupakan ketertarikan seseorang terhadap profesi guru yang ditunjukkan dengan adanya pemusatan pikiran, perasaan senang dan perhatian yang lebih terhadap profesi guru Minat dipengaruhi oleh dua faktor, yaitu faktor dari dalam dan dari luar. Faktor intrinsik mahasiswa yang mempengaruhi minat salah satunya adalah faktor penguasaan ilmu pengetahuan berupa Kajian Praktik Lapangan (KPL). Faktor eksternal dari luar diri mahasiswa diantaranya adalah adanya pengaruh dari lingkungan Banyak mahasiswa yang tidak berminat untuk menjadi guru. Penelitian ini bertujuan untuk menjelaskan pengaruh pelaksanaan KPL dan lingkungan keluarga terhadap minat menjadi guru. Rancangan penelitian ini adalah penelitian eksplanasi yang menggunakan variabel KPL (X1), Lingkungan Keluarga (X2) dan Minat Menjadi Guru (Y). Teknik pemilihan sampel menggunakan teknik proportional random sampling. Sampel penelitian ini berjumlah 112 responden yang berasal dari mahasiswa Program Studi S1 Pendidikam Akuntansi Fakultas Ekonomi Universitas Negeri Malang angkatan 2012. Teknik analisis data yang digunakan dalam penelitian ini adalah regresi linier berganda. Hasil penelitian menunjukkan bahwa secara parsial KPL dan lingkungan keluarga berpengaruh secara langsung terhadap minat menjadi guru dan memberikan kontribusi sebesar 51,8%. Minat menjadi guru pada mahasiswa akuntansi akan meningkat jika dipengaruhi oleh KPL dan lingkungan keluarga. Berdasarkan hasil penelitian tersebut, penelitian ini memiliki keterbatasan berupa (a) uraian penilaian KPL dalam P4L masih kurang jelas (b) indikator yang digunakan kurang kuat (c) teknik pengambilan data menggunakan penyebaran angket. Berdasarkan keterbatasan penelitian, disarankan bagi peneliti selanjutnya (a) penjelasan tentang uraian penilaian KPL oleh P4L (b) menggunakan populasi dan sampel penelitian yang lebih luas serta menambah variabel independen, (c) teknik pengumpulan data dapat ditambah, seperti menggunakan teknik observasi dan wawancara sehingga data yang terkumpul dapat lebih lengkap dan mendalam.

Pola konsumsi produk fashion pada mahasiswa Fakultas Ekonomi angkatan 2012 / Lailatun Fauziyah

 

ABSTRAK Fauziyah, Lailatun. 2016. Pola Konsumsi Produk Fashion pada Mahasiswa Ekonomi Angkatan 2012. Skripsi, Program Studi S1 Pendidikan Ekonomi Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Sri Umi Mintarti, S.E., M.P., Ak, (II) Drs. Mardono, M.Si Kata Kunci: pola konsumsi, Mahasiswa, produk fashion Kegiatan konsumsi pada dasarnya merupakan kegiatan untuk menghabiskan nilai guna suatu barang dan jasa untuk memdapatkan kepuasan bagi orang yang mengkonsumsinya. Akan tetapi kegiatan konsumsi sekarang ini telah berubah menjadi suatu gaya hidup. Perkembangan zaman telah berdampak pada budaya hedonisme dalam berkonsumsi. Hal ini juga terjadi pada perkembangan produk fashion. Mahasiswa tertarik mengkonsumsifashion karena untuk mengikuti trend anak muda. Fenomena tersebut dapat kita jumpai pada Mahasiswa Fakultas Ekonomi Universitas Negeri Malang Angkatan 2012.Sangat jelas telihat bahwa adanya perubahan yang signifikan terhadap konsumsi mahasiswa terhadap produk-produk fashion. Hal ini terlihat pada fashion yang digunakan mahasiswa Fakultas Ekonomi angkatan 2012 sejak menjadi mahasiswa baru pada tahun 2012 hingga tahun 2016 ini. Contohnya adalah pada pemakaian sepatu, baju, celana, rok dan sebagainya. Penelitian ini menggunakan rancangan penelitian kualitatif fenomenologi untuk mengetahui pola konsumsi mahasiswa FE UM. Data penelitian berupa hasil wawancara dan dokumentasi. Instrumen yang digunakan dalam penelitian ini adalah lembar wawancara serta perekam suara. Analisis data dalam penelitian ini dilakukan dengan membuat catatan lapangan dari hasil wawancara kemudian diberi kode dan dilakukan reduksi data dengan jalan merangkum, memilih hal-hal yang pokok atau memfokuskan pada hal yang penting serta membuang hal yang tidak dibutuhkan. Data dokumentasi diklasifikasikan, diurutkan dan diberi nama. Kemudian seluruh data tersebut disajikan dalam laporan penelitian. Pola konsumsi mahasiswa FE cenderung baik. Pola pembelian tersebut tergolong konsumsi yang rasional dan kurang rasional.Pola konsumsi yang rasional ditunjukkan dengan mahasiswa FE membeli produk fashion dengan mempertimbangkan kebutuhan dan keadaanya.Konsumsi mahasiswa FE yang rasional dikarenakan mereka mempunyai literasi atau pengetahuan mengenai ilmu ekonomi yang telah dipelajarinya.Sedangkan pola konsumsi pada mahasiswa yang kurang rasional ditunjukkan mahasiswa FE dengan membeli produk fashion melainkan karena faktor emosional dan tidak sesuai dengan kebutuhan fashion yang seharusnya. Konsumsi mahasiswa ini tidak hanya dilakukan karena motif kebutuhan saja, pembeliannya cenderung didasarkan pada motif emosional serta untuk aktualisasi diri. Informasi tersebut dapat digunakan sebagai acuan tentang informasi perilaku konsumsi khususnya produk fashion pada mahasiswa FEsehingga dapat digunakan untuk menyelenggarakan workshop konsumsi produk fashion yang proporsional sesuai trend di kalangan mahasiswa. penelitian ini juga diharapkan mampu dijadikan referensi bagi penelitian lain, dapat memperdalam dan menambah wawasan keilmuan serta meningkatkan pengetahuan dengan wawasan yang lebih luas.

Penerapan permainan sains sederhana untuk meningkatkan kemampuan kognitif anak usia 4-5 tahun TK Muslimat NU 21 Malang / Siti Zulaikhah

 

ABSTRAK Zulaikhah, Siti. 2015. Penerapan Permainan Sains Sederhana untuk Meningkatkan Kemampuan Kognitif Anak Usia 4-5 Tahun TK Muslimat NU 21 Malang. Skripsi, Jurusan KSDP, Prodi S1PG PAUD,Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (1) Drs. H Ahmad Samawi, M Hum, (II) Drs Tomas Iriyanto M.Pd Kata Kunci : Sains sederhana, kognitif, TK. Hasil pengamatan di TK Muslimat NU 21 menunjukkan bahwa hasil belajar anak dalam aspek pengembangan kognitif masih belum sesuai dengan harapan guru. Hal ini dapat diketahui pada pengamatan yang di lakukan peneliti di sekolah tersebut. Dari 15 anak 40% (6 anak) mampu mengenal konsep sains sederhana sedangkan 60% (9anak) lainnya masih belum mampu dalam mengenal konsep sains sederhana seperti: mengurutkan benda dengan bilangan angka 1-10, mengenal dan membedakan biji-bijian. Tujuan dari penelitian ini adalah untuk: (1) Mendeskripsikan penerapan permainan sains sederhana untuk meningkatkan kemampuan kognitif anak usia 4-5 tahun di TK Muslimat NU 21melalui kegiatan mengenal dan membedakan biji-bijian. (2) Mendeskripsikan peningkatan kemampuan kognitif anak usia 4-5 tahun di TK Muslimat NU 21setelah diterapkan permainan sains sederhana di TK Muslimat NU 21 Malang. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) model Kemmis & MC Taggart dengan empat komponen, yaitu (1) perencanaan, (2) pelaksaaan tindakan, (3) pengamatan, (4) refleksi. Peneliti bekerja sama dengan guru kelas dari awal penyusunan kegiatan harian (RKH) sampai pelaksanaan pembelajaran permainan sains sederhana untuk meningkatkan kemampuan kognitif anak Penelitian ini menggunakan instrument lembar observasi penilaian dan dokumen Hasil penelitian menunjukkan bahwa penerapan permainan sains sederhana melalui kegiatan mengenal dan membedakan biji-bijian, mengurutkan bilangan dengan benda pada anak usia 4-5 tahun di TK Muslimat NU 21 Malang dapat meningkatkan kemampuan kognitif anak. dengan rata-rata hasil tes mulai dari pra tindakan 58%, pada siklus I kemampuan kognitif anak meningkat menjadi 82%, pada siklus II meningkat lagi menjadi pada 94% dan dinyatakan berhasi tuntas. Disimpulkan bahwa penerapan permainan sederhana dapat digunakan untuk meningkatkan kemampuan kognitif anak udia 4-5 tahun kelompok A TK Muslimat NU 21 Malang. Kegiatan penerapan permainan sains sederhana meliputi :1) permainan melempar kantong biji, 2) mengenal dan membedakan biji-bijian, 3) menyebutkan bilangan dengan benda 1-10, 4) mengurutkan biji dari yang terkecil sampai yang terbesar. Dengan demikian disarankan bagi Pendidik Anak Usia Dini, hendaknya melaksanakan kegiatan pembelajaran yang melibatkan anak secara langsung. Karena hal ini akan memberikan makna yang mendalam dan mampu meningkatkan kemampuan kognitif anak. Penerapan permainan sains ini dapat mengembangkan seluruh potensi yang dimiliki oleh anak melalui kegiatan bermain. Bagi peneliti selanjutnya dapat melakukan penelitian lanjutan tentang permainan sains ini untuk perkembangan aspek yang lain.

Kemampuan absorpsiserbuk gergaji, arang non aktivasi, dan arang aktifdari kayu sengon (albazia falcataria) pada penurunan kadar ion timbal (Pb2+) dalam air

 

ABSTRAK Eswindro, Titis. 2012. Pengembangan Modul Pembelajaran Kimia Fuels for Light Vehicle System dengan Pendekatan Kontekstual untuk Siswa RSMKBI Kompetensi Keahlian Teknik Kendaraan Ringan. Tesis. Program Studi Pendidikan Kimia, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Drs. Effendy, M.Pd, Ph.D., (II) Drs. I Wayan Dasna, M.Si., M.Ed., Ph.D. Kata kunci: modul kimia, teknik kendaraan ringan, pendekatan kontekstual, RSMKBI Mata pelajaran kimia merupakan mata pelajaran adaptif di Rintisan Sekolah Menengah Kejuruan Bertaraf Internasional (RSMKBI) yang diperlukan sebagai dasar dan penguat pada mata pelajaran produktif. Pada kenyataannya pembelajaran kimia di RSMKBI lebih menekankan aspek teoritis dan kurang dikaitkan dengan pelajaran produktif. Hal ini menyebabkan siswa cenderung kurang termotivasi untuk belajar kimia dan beranggapan bahwa pelajaran kimia kurang penting. Pembelajaran kimia akan menjadi lebih bermakna, menarik, dan menyenangkan bagi siswa RSMKBI jika dikaitkan secara langsung dengan mata pelajaran produktif. Siswa Teknik Kendaraan Ringan (TKR) sebagai calon teknisi otomotif perlu mempelajari topik minyak bumi pada pelajaran kimia yang dikaitkan dengan sistem bahan bakar bensin dan diesel serta emisi gas buang yang dibahas pada pelajaran produktif. Keterbatasan alokasi waktu pembelajaran di kelas dan adanya program Praktek Kerja Industri (Prakerin) membuat pembelajaran kimia selama ini kurang dihubungkan dengan materi produktif. Salah satu solusi untuk mengatasi permasalahan tersebut adalah dengan menyediakan sumber belajar berupa modul yang menggunakan pendekatan kontekstual. Modul tersebut dapat digunakan oleh siswa pada pembelajaran di kelas dan belajar mandiri saat Prakerin. Tujuan penelitian ini adalah: (1) untuk mengembangkan modul pembelajaran kimia Fuels for Light Vehicle System untuk siswa Teknik Kendaraan Ringan (TKR); dan (2) untuk mengetahui kelayakan dan efektifitas modul pengembangan pada pembelajaran kimia. Pengembangan modul mengadopsi model pengembangan 4D dari Thiagarajan, dkk. Model ini meliputi empat tahap pengembangan yaitu pendefinisian, perancangan, pengembangan, dan penyebaran. Tahap penyebaran tidak dilakukan karena modul pengembangan digunakan terbatas di lingkup SMKN 1 Blitar. Modul pengembangan dinilai menggunakan instrumen penilaian modul yang dikembangkan berdasarkan standar penilaian bahan ajar yang dirumuskan oleh Badan Standar Nasional Pendidikan (BSNP). Penilaian modul meliputi empat aspek yaitu kelayakan isi, bahasa, sajian, dan kegrafisan. Modul pengembangan dinilai oleh dua dosen pendidikan kimia FMIPA UM, dua guru kimia, dan dua guru teknik otomotif SMKN 1 Blitar. Kelayakan modul diujicobakan terhadap enam siswa pada uji perorangan dan 30 siswa pada uji lapangan terbatas. Uji coba lapangan terbatas menggunakan posttest only non equivalent control group design dilakukan pada siswa kelas XI TKR 4 SMKN 1 Blitar untuk mengetahui efektifitas modul pada pembelajaran kimia. Data yang dikumpulkan terdiri dari data kualitatif dan data kuantitatif. Data kualitatif terdiri dari komentar dan saran untuk perbaikan modul dari dosen pendidikan kimia, guru kimia, dan guru teknik otomotif serta siswa. Data kuantitatif terdiri dari hasil penilaian kuesioner dan skor tes. Postes dilakukan dengan menggunakan soal pilihan ganda yang terdiri dari 25 soal, dengan validitas isi 92,3% dan koefisien reliabilitas, diukur dengan menggunakan rumus Kuder-Richardson 21 (K-R 21), sebesar 0,86. Data skor tes dianalisis menggunakan independent sample t test. Modul pengembangan terdiri dari dua kegiatan belajar. Masing-masing kegiatan belajar meliputi tujuan pembelajaran, pendahuluan, rumusan masalah, konsep awal yang disusun oleh siswa, pertanyaan untuk mengeksplorasi pengetahuan siswa, deskripsi materi, latihan soal, rangkuman, dan uji pemahaman. Uji kompetensi, kunci jawaban, umpan balik, glosarium, dan daftar pustaka diberikan di akhir bagian modul. Hasil penilaian ahli menunjukkan kelayakan isi 91,2%, kelayakan bahasa 90,3%, kelayakan penyajian 89,6%, dan kelayakan grafis 91,7%. Hasil penilaian kelayakan isi dan penyajian modul oleh siswa pada uji perorangan adalah sebesar 86,7% dan uji lapangan terbatas adalah sebesar 87,4%. Hal ini menunjukkan bahwa modul pengembangan layak untuk digunakan pada pembelajaran kimia. Hasil uji coba modul pengembangan menunjukkan bahwa 90,0% siswa mencapai skor di atas Kriteria Ketuntasan Minimal (KKM). Uji t yang dilakukan terhadap skor tes siswa menunjukkan bahwa skor tes siswa yang belajar menggunakan modul pengembangan lebih tinggi daripada skor tes siswa yang belajar menggunakan modul Hidrokarbon dan Minyak Bumi yang diterbitkan oleh Depdiknas. Hal ini menunjukkan bahwa modul pengembangan efektif untuk digunakan pada pembelajaran kimia. Penilaian lebih lanjut tentang kelayakan dan efektifitas modul sebaiknya dilakukan dengan penyebaran modul lebih luas.

Pengaruh pemanasan ulang dan variasi penurunan suhu pemadatan campuan HRS-WC ditinjau dari patameter Marshall / Novika Dei Nurstyawati

 

ABSTRAK Devi Nurtyaswati, Novika. 2016. Pengaruh Pemanasan Ulang dan Variasi PenurunanSuhu Pemadatan Campuran HRS-WC Ditinjau dari Parameter Marshall. Skripsi, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Pranoto, S.T., M.T, (II) Ir. Titi Rahayuningsih, M.Si. Kata Kunci: Pemanasan ulang, penurunan suhu pemadatan, HRS-WC, Marshall. Pengangkutan campuran dengan kendaraan yang tidak tertutup, perjalanan menuju lokasi pembangunan yang jauh, terjadinya perubahan cuaca dan suhu udara, serta durasi waktu dalam proses antrian untuk menuangkan ke dalam finisherdapat menyebabkan suhu dari campuran tersebut turun. Suhu pemadatan yang tidak sesuai standar menyebabkan timbulnya kerusakan permukaan aspal. Untuk itu peneliti mencoba melakukan pemanasan ulang dan variasi suhu dibawah suhu standar pemadatan sehingga diketahui bagaimana pengaruhnya terhadap parameter Marshall pada campuran Hot Rolled Sheet–Wearing Course(HRS-WC) Tujuan penelitian ini yaitu: 1) Mengetahui berapa nilai Kadar Aspal Optimum (KAO) untuk campuran HRS-WC, 2) Mengetahui pengaruh penurunan suhu pemadatan terhadap parameter Marshall, 3) Mengetahui pengaruh pemanasan ulang pada suhu pemadatan terhadap parameter Marshall. Bahan berupa aspal dan agregat akan diperiksa menurut spesifikasi SNI. Dalam penelitian ini dibuat 55 benda uji. Kadar aspal untuk mencari KAO adalah 6,5%, 7%, 7,5%, 8% dan 8,5%. Untuk benda uji selanjutnya dibuat dengan suhu pemadatan 145oC,125oC,105oC,85oC, dan 65oC dengan dua jenis perlakuan yaitu campuran dengan variasi penurunan suhu pemadatan dan yang kedua dipanaskan ulang setelah didiamkan hingga suhu 25oC. Kesimpulanberdasarkanhasilpenelitianyaitu: 1) DiperolehnilaiKAO sebesar 8%,2) Variasipenurunansuhupemadatan di bawahsuhustandarpemadatan 145oC menyebabkannilaistabilitasdan MQ mengalamipenurunan. Sedangkannilaiflow, VIM dan VMA mengalamipeningkatan, 3) Pemanasanulangmenyebabkannilaistabilitasdan MQ mengalamipenurunan.Sedangkannilaiflow, VIM dan VMA mengalamipeningkatanseiringdenganturunnyasuhupemadatan, 4).Campurantanpapemanasanulangmemilikinilaistabilitasdanflow yang lebihbesardibandingkancampurandenganpemanasanulang. Sedangkancampurantanpapemanasanulangmemilikinilai MQ, VIMdan VMA yang lebihrendahdibandingkancampurandenganpemanasanulangdan 5) Menurutanalisisstatistikperilakupemanasanulangdantanpapemanasanulangsuhupemadatantidakberpengaruhsecarasignifikanterhadapnilaistabilitas, MQ, VIM dan VMA. Sedangkanperlakuantersebutberpengaruhsecarasignifikanterhadapnilaiflow.

Peningkatan kemampuan motorik kasar melalui permainan egrang pada Kelompok B di TK Al-Hidayah 02 Kaweron Kabupaten Blitar / Ely Dwi Ratna Sari

 

ABSTRAK Dwi, Ely. 2015.PeningkatanKemampuan Motorik KasarMelalui PermainanEgrang Bathok pada Kelompok B di TK Al-Hidayah 02 Kaweron KabupatenBlitar.Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Program Studi Pendidikan Guru Pendidikan Anak UsiaDini, FakultasIlmuPendidikan, Universitas Negeri Malang.Pembimbing: (1) Dra. Lilik Bintartik, M.Pd (2) Dra. Sutansi, M.Pd Kata Kunci:kemampuanmotorik, permainan “Egrang Bathok” Berdasarkanobservasi yang dilakukan di TK AL-HIDAYAH 02 KaweronKabupatenBlitarkhususnya di Kelompok B, tampakperkembanganaspekmotorikanak belum optimal.Kesulitananakantaralainpadakemampuankeseimbangan, ketepatandankelincahan.Penyebabnya adalah pembelajaran yang dilakukan monoton, media pembelajaran yang digunakan kurang menarik, dan guru kurang mengoptimalkan kegiatan. Penelitian ini bertujuan untuk mendiskripsikan penerapan permainan Egrang Bathok dalam meningkatkan kemampuan motorik kasar anak pada kelompok B dan untuk mendiskripsikan peningkatan kemampuan motorik kasar anak pada kelompok B ketika menggunakan permainan Egrang Bathok. Penelitian dilakukan dengan pendekatan kualitatif, jenis penelitian tindakan kelas (PTK). Subjek penelitian adalah anak Kelompok B di TK AL-HIDAYAH 02 Kaweron Kabupaten Blitar yang berjumlah 15 anak. Teknik pengumpulan data menggunakan observasi, dokumentasi, dan catatan lapangan. Penelitian ini dilakukan sebanyak dua siklus, masing-masing melalui tahap perencanaan, pelaksanaan, observasi dan refleksi. Data dianalisis dengan langkah reduksi data, penyajian dan penarikan kesimpulan. Hasil penelitian menunjukkan bahwa penerapan permainan “Egrang Bathok” sudah baik. Guru dapat mengembangkan permainan Egrang Bathok yang dapat menstimulasi perkembangan motorik kasar dengan menarik, aktif, dan menyenangkan. Hal ini dapat dibuktikan dengan adanya peningkatan perkembangan motorik kasar yang ditunjukkan dengan nilai rata-rata pada pra tindakan meningkat dari siklus I 66,85 dan siklus II meningkat menjadi85,5. Dari 15 anak semua mengalami ketuntasan belajar sesuai dengan harapan di siklus II. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa dengan penerapan permainan “Egrang Bathok” dapat meningkatkan kemampuan motorik kasar anak pada Kelompok B di TK AL-HIDAYAH 02 Kaweron Kabupaten Blitar. Saran yang dikemukakan diharapkan guru dan sekolah memberikan kesempatan kepada anak untuk belajar di luar kelas dan menggunakan ataumencobapermainantradisionalEgrang Bathok dalammeningkatkankemampuanmotorikkasarpadaanaksertamemanfaatkan media yang menarik, praktis, tidak berbahayasesuai dengan kebutuhan anak sehingga perkembangan anak dapat berjalan secara optimal. Aspek motorik yang belum berkembang optimal adalah keseimbangan.

Hubungan antara daya ledak otot lengan dengan kemampuan tolak peluru gaya menyamping pada siswa putra kelas XI Teknik Otomasi Industri SMK PGRI Singosari Malang / Awud

 

ABSTRAK Awud. 2016. HubunganAntaraDayaLedakOtotLenganDenganKemampuanTolakPeluru Gaya MenyampingPadaSiswa Putra Kelas XI TeknikOtomasiIndustri SMK PGRI Singosari Malang. Skripsi. JurusanPendidikanJasmanidanKesehatan, FIK UniversitasNegeri Malang. Pembimbing: (1) Dr. SitiNurrochmah, M. Kes (2) Drs. TatokSugiarto ,S.Pd, M.Pd Kata Kunci:Hubungan, dayaledakototlengan, tolakpeluru, gayamenyamping. Salah satubagiandarinomorlemparadalahtolakpeluru, Untukmemperolehhasiltolakpeluru yang baikdiantaranyaditentukanolehteknikdankondisifisik yang bagus. Hasiltolakpeluruditentukanolehbeberapaunsurkondisifisikyaituunsurdayaledakototlengan, kecepatanmelempar, dankekuatan. Dari beberapaunsurkondisifisiktersebut, dayaledakototlenganmerupakansalahsatufaktor yang pentingdalamkemampuantolakpeluru, dikarenakandayaledakototlengandipergunakanuntukmenolakpelurupadasaatmelakukantolakan, yang menentukanjauhnyatolakan. Tujuanpenelitianiniadalahuntukmengetahui (1) hubungan yang signifikanantaradayaledakototlengandengankemampuantolakpelurugayamenyamping (2) untukmengetahuibesarnyasumbanganvariabeldayaledakototlengandengankemampuantolakpelurugayamenyampingsiswaputrakelas XI TeknikOtomasiIndustri SMK PGRI Singosari Malang. Rancanganpenelitian yang dipakaiadalahrancangansurveiberbentukkorelasional. Dari populasisebanyak 40 siswadiambilsampel 90% yaitu 36 siswadenganteknikpurposive sistematics proportional randome sampling. Instrumenpenelitianmenggunakaninstrumentesberupatesdayaledakototlengandantestolakpelurugayamenyamping. Pengumpulan data menggunakanteknikpengukuranbentuktesfisikyaitutestolakpelurutanpaawalanuntukdayaledakototlengandantestolakpelurugayamenyamping. Data yang terkumpuldianalisisdenganmenggunakanstatistikainferensialberupauji r, dandilanjutkandenganujilanjutberupauji t. Hasilanalisismenunjukkannilairhitungsebesar 0, 667, dandibandingkandenganrtabel(α 0,05)sebesar 0,329. Nilairhitung>rtabelberartiadahubunganantaravariabelbebasdanterikat. Hasilanalisisuji t diperolehhasilthitung 5,22danttabel(α 0,05)sebesar 1.69 sehinggaadahubungan yang signifikanantaravariabeldayaledakototlengandengankemampuantolakpelurugayamenyamping. Besarnyasumbanganefektifitassebesar 44,5%. Hasilpenelitiandisimpulkanbahwaadahubungan yang signifikanantaradayaledakototlengandengankemampuantolakpelurugayamenyamping(α 0,05). Saran bagi guru di SMK PGRI Singosari Malang untuklebihmenekankanlatihandayaledakototlenganuntukmemperolehhasiltolakan yang maksimal.

Sistem cerdas pemilah buah jeruk berdasarkan warna dan ukuran berbasis mikrokontroler / Lazuardi Widya Susilo

 

ABSTRAK Susilo, LazuardiWidya. 2016. Sistem Cerdas Penyortir Jeruk Berdasarkan Warna dan Ukuran Berbasis Mikrokontroler.TugasAkhir, JurusanTeknikElektro. Program Studi D3 TeknikElektro, FakultasTeknik. UniversitasNegeri Malang. Pembimbing: Drs. SlametWibawanto, M.T. Kata Kunci : : Arduino, Mikrokontroler, PemilahBuah Jeruk,SistemCerdas, Sensor Warna,Sensor Ukuran, TCS3200. Jerukkeprokmerupakansalahsatuvarietas yang banyakdiminatioleh konsumen.Hasil panen yang begitu banyak membuat para petani buah jeruk keprok terkadang tidak mengedepankan kualitas buah jeruk yang akan dijual pada pasar. Hal ini dikarenakan petani buah jeruk keprok jarang melakukan sortasi dan penggolongan kualitas terhadap hasil panennya. Sortasi buah sangat diperlukan untuk menggolongkan warna dan ukuran buah tersebut. Sortasi jeruk berdasarkan warna dan ukuran bertujuan untuk memenuhi permintaan pasar, dimana pasar ekspor dan swalayan meminta keseragaman warna dan ukuran daripada pasar tradisional. Perancanganprototypesistem cerdas penyortir jeruk berdasarkan warna dan ukuran berbasis mikrokontrolerini adalah sebuah alat mekanik berupa konveyor. Konveyor adalah sebuah alat untuk memindahkan suatu barang dari tempat a ke tempat b. Konveyor memiliki komponen utama yakni : (1) Hopper sebagai tempat buah jeruk di tampung; (2) grabber sebagai pengantar buah jeruk menuju konveyor; (3) belt sebagai alas pengantar buah jeruk; (4) motor power window sebagai penggerak utama konveyor. Prototipe ini dikendalikan oleh suatu alat pengontrol yang berfungsi untuk menjalankan sistem yakni digunakan pengontrol mikrokontroler arduino uno. Berdasarkanpengujian, sistempemilahbuah jeruk berbasis mikrokontroler dapatdisampaikanbahwa: (1) Pengujiansensor warna dapat membedakan buah jeruk berwarna kuning dan berwarna hijau sesuai rencana dan dapatdinyatakanbaik; (2) Pengujian sensor ukuran dapat membedakan ukuran besar dan kecil buah jeruk ; (3) Pengujian palang pintu pada kondisi tertentu dapat berjalan dengan baik; (4) Pengujian keseluruhan sistem dapat berjalan dengan baik yakni 8 dari 10 buah jeruk dapat tersortir sesuai dengan rencana.

Hubungan kekuatan otot tungkai dan kelincahan dengan kemampuan dribble bolabasket pada siswa kelas VIII A MTs negeri Jabung Kecamatan Talun Kabupaten Blitar / Yanuar Bagus Wiji Kurniawan

 

ABSTRAK Bagus, Yanuar. 2016. Hubungan Kekuatan Otot Tungkai dan Kelincahan dengan Kemampuan Dribble Bolabasket pada Siswa Kelas VIII A MTs Negeri Jabung Kecamatan Talun Kabupaten Blitar. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Drs. Oni Bagus Januarto, M.Kes, (II) Drs. Tatok Sugiarto, S.Pd., M.Pd. Kata Kunci: kekuatan otot tungkai, kelincahan, dribble bolabasket Hipotesis awal dalam penelitian ini adalah ada hubungan antara kekuatan otot tungkai dan kelincahan dengan kemampuan dribble bolabasket siswa kelas VIII A MTs Negerei Jabung Kecamatan Talun Kabupaten Blitar. Penelitian ini bertujuan untuk mengetahui hubungan antara kekuatan otot tungkai dan kelincahan dengan kemampuan dribble bolabasket pada siswa kelas VIII A MTs Negeri Jabung Kecamatan Talun Kabupaten Blitar. Metode yang digunakan dalam penelitian ini adalah korelasional dengan teknik pengumpulan data menggunakan tes dan pengukuran. Populasi yang digunakan dalam penelitian ini adalah siswa MTs Negeri Jabung Kecamatan Talun Kabupaten Blitar. Sampel yang diambil dengan teknik purposive random sampling adalah 34 siswa. Instrumen yang digunakan adalah kelincahan menggunakan tes shuttle run, kekuatan otot tungkai menggunakan leg and back dynamometer, dan kemampuan dribble menggunakan tes dribble bolabasket. Dengan pertimbangan tujuan penelitian dan jenis data yang diperoleh beberapa data rasio, maka data yang diperoleh dianalisis dengan menggunakan statistika inferencial berupa uji r. Hasil analisis data diperoleh besarnya hubungan antara kekuatan otot tungkai dengan kemampuan dribble bolabasket dengan 34 siswa sebesar 0,4033. Karena rhitung > rtabel (α 0,05) berarti ada korelasi antara kekuatan otot tungkai dengan kemampuan dribble bolabasket pada siswa kelas VIII A MTs Negeri jabung Kecamatan Talun Kabupaten Blitar dengan sumbangan efektifitas sebesar 16,26 %. Kemudian besarnya hubungan antara kelincahan dengan kemampuan dribble bolabasket dari hasil perhitungan sebesar 0,6221. Karena rhitung > rtabel (α 0,05) berarti ada korelasi antara kelincahan dengan kemampuan dribble bolabasket pada siswa kelas VIII A MTs Negeri jabung Kecamatan Talun Kabupaten Blitar dengan sumbangan efektifitas sebesar 38,7 %. Koefisien korelasi selanjutnya adalah kekuatan otot tungkai dan kelincahan dengan kemampuan dribble bolabasket sebesar 0,6569. Karena rhitung > rtabel (α 0,05) berarti ada korelasi antara kekuatan otot tungkai dan kelincahan dengan kemampuan dribble bolabasket pada siswa kelas VIII A MTs Negeri jabung Kecamatan Talun Kabupaten Blitar dengan sumbangan efektifitas sebesar 43,16 %. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa ada hubungan yang signifikan antara kekuatan otot tungkai dan kelincahan dengan kemampuan dribble bolabasket. Penelitian ini masih banyak menyimpan kekurangan, diharapkan pada penelitian yang selanjutnya lebih mengembangkan variabel yang diukur, sampel penelitian, prosedur penelitian dan instrumen yang digunakan.

Manajemen hubungan masyarakat di Madrasah (Studi kasus di Madrasah Ibtidaiyah Negeri Malang 2) / Abdul Rais

 

Kata kunci: madrasah, manajemen hubungan masyarakat. Peran serta masyarakat dalam pendidikan meliputi peran serta perseorangan, kelompok, keluarga, organisasi profesi, pengusaha dan organisasi kemasyarakatan dalam penyelenggaraan dan pengendalian mutu pendidikan (UU RI Nomor 20 Tahun 2003 tentang Sistem Pendidikan Nasional (Sisdiknas) Pasal 54 Ayat 1). Dengan demikian sekolah sebagai penyelenggara pendidikan dan tempat transformasi nilai-nilai dan budaya positif, tanpa kerjasama dan bantuan dari pihak luar akan sulit. Sehingga sekolah harus bisa menjalin hubungan yang baik dengan orangtua dan masyarakat, agar mereka mendukung dan bersedia bekerjasama untuk mencapai tujuan pendidikan bersama-sama. Madrasah merupakan sekolah umum tetapi berciri khas Islam. Semua proses pembelajaran secara formal sama dengan sekolah-sekolah umum, hanya di madrasah itu semuanya harus Islami, berpakaian Islami, berkata-kata Islami, peraturan-peraturan harus Islami, pergaulan sehari-hari Islami, pelaksanaan ibadah harus Islami, teori-teori pengetahuan yang diajarkan harus pula Islami. Dalam Undang-Undang Nomor 20 Tahun 2003 tentang Sistem Pendidikan Nasional (Sisdiknas) Pasal 17 Ayat 2, yakni Pendidikan dasar terdiri atas Sekolah Dasar (SD) atau Madrasah Ibtidaiyah (MI) atau bentuk lain yang sederajat serta Sekolah Menengah Pertama (SMP) dan Madrasah Tsanawiyah (MTs) atau bentuk lain yang sederajat. Penelitian ini memiliki fokus yaitu: (1) bagaimanakah kegiatan perencanaan hubungan masyarakat di MIN Malang 2?; (2) bagaimanakah pelaksanaan hubungan masyarakat di MIN Malang 2?; (3) bagaimanakah kegiatan pengawasan hubungan masyarakat di MIN Malang 2?. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus karena dengan studi kasus berusaha mengungkap secara deskriptif semua fenomena, kejadian, masalah di suatu lokasi yang mengutamakan kealamiahan atau natural. Teknik yang digunakan dalam penelitian ini meliputi: (1) wawancara mendalam; (2) observasi; dan (3) dokumentasi. Adapun teknik untuk mengecek keabsahan data meliputi: (1) perpanjangan kehadiran di lapangan; (2) triangulasi; dan (3) observasi yang mendalam. Kesimpulan penelitian yang dihasilkan yaitu: (1) kegiatan perencanaan hubungan masyarakat di MIN Malang 2 oleh wakil kepala madrasah bagian humas meliputi evaluasi program humas tahun sebelumnya untuk merumuskan program humas tahun berikutnya, kemudian setelah program tersebut dirumuskan maka akan dibahas pada rapat pimpinan yang dihadiri oleh kepala dan para waka apakah ada tambahan atau tidak dari rapat tersebut untuk program humas, wakil kepala madrasah bagian humas juga mengadakan kerjasama dengan wakil kepala madrasah bagian kesiswaan untuk proses pembuatan brosur penerimaan siswa ii baru, serta bekerjasama dengan komite dan anggota humas dalam perumusan program humas berikutnya dari saran orangtua juga termasuk. Rencana program yang telah disusun diserahkan kepada komite untuk disetujui, pada publikasi humas juga melalui beberapa media seperti kalender, brosur, baliho, spanduk dan blog MIN Malang 2; (2) kegiatan pelaksanaan hubungan masyarakat di MIN Malang 2 meliputi publikasi lembaga, pembuatan kalender, spanduk, brosur, Great Dream Motivation Training (GDMT), bakti sosial, kemah bakti, melibatkan orangtua dalam acara-acara maupun kegiatan yang terkait dengan humas. Pada pelaksanaan program-program humas juga dibantu oleh komite karena mereka merupakan jembatan pihak madrasah dengan pihak luar dan juga memberikan saran mengenai pelaksanaan program humas; (3) kegiatan pengawasan hubungan masyarakat di MIN Malang 2 meliputi Pengawasan dilakukan dengan melihat apakah tujuan sudah tercapai sesuai dengan apa yang direncanakan sebelumnya melalui laporan pelaksanaan program yang diberikan wakil kepala madrasah bagian humas, sehingga akan menjadi acuan untuk perumusan program-program humas selanjutnya. Saran yang bisa disampaikan dari hasil penelitian ini adalah: (1) kepala madrasah diharapkan terus memberikan pengawasan, arahan, bimbingan kepada wakil kepala madrasah bagian humas dalam perencanaan, pelaksanaan program-program humas dan menerapkan manajemen humas yang baik dan menyeluruh karena humas berperan penting untuk kemajuan MIN Malang 2 dalam promosi dan kerjasama dengan pihak luar; (2) wakil kepala madrasah bagian humas dalam perencanaan dan perumusan program supaya lebih banyak dan bervariasi dan program yang berciri khas Islami agar MIN Malang 2 lebih dikenal masyarakat luar; (3) diharapkan Komite MIN Malang 2 berperan dan membantu dalam kegiatan-kegiatan dan selalu memberikan masukan serta saran yang membangun untuk pelaksanaan program-program humas di MIN Malang 2; (4) akademisi Jurusan Administrasi Pendidikan diharapkan lebih meningkatkan kemampuan mengenai humas dan bisa memberikan teori serta praktek yang nyata kepada mahasiswa tentang manajemen hubungan masyarakat; (5) peneliti lain dapat dijadikan bahan referensi dan informasi awal untuk mengembangkan dan melaksanakan penelitian sejenis mengenai manajemen hubungan masyarakat

Pengembangan modul fisika berbasis inkuiri disertai scaffolding pada materi dinamika rotasi dan keseimbangan benda tegar / Inda Mey Lufita

 

ABSTRAK Lufita, Inda Mey. 2016. Pengembangan Modul Fisika berbasis Inkuiri disertai Scaffolding pada Materi Dinamika Rotasi dan Keseimbangan Benda Tegar. Program Studi Pendidikan Fisika, Jurusan Fisika Universitas Negeri Malang. Pembimbing: (I) Drs. Purbo Suwasono, M.Si., (II) Dr. H. Edi Supriana, M.Si. Kata kunci: Pengembangan, Modul Fisika, Inkuiri, Scaffolding, Dinamika Rotasi dan Keseimbangan Benda Tegar. Keikutsertaan Indonesia dalam Masyarakat Ekonomi ASEAN (MEA) membawa dampak sosial, ekonomi, pendidikan, dan politik. Pendidikan memegang peranan penting untuk mencetak sumberdaya manusia yang kritis, profesional, dan terampil. Penerapan Kurikulum 2013 yang menekankan pada pendekatan saintifik merupakan langkah awal dalam meningkatkan kualitas pendidikan di Indonesia. Karakteristik bahan ajar yang dapat menunjang tuntutan Kurikulum 2013 adalah bahan ajar yang menekankan proses bukan hasil, melalui perumusan prosedur dalam pemecahan masalah. Pendekatan saintifik mengedepankan cara memperoleh pengetahuan melalui inkuiri. Untuk memfasilitasi pembelajaran inkuiri, guru dapat menggunakan scaffolding. Scaffolding dalam bahan ajar berbentuk soal evaluasi yang harus dikerjakan oleh peserta didik dengan menguraikan masalah ke dalam langkah-langkah pemecahan masalah. Berdasarkan studi pendahuluan di SMAN 1 Malang, materi dinamika rotasi dan keseimbangan benda tegar merupakan salah satu materi fisika yang dianggap sulit oleh peserta didik, sehingga pembuatan modul diharapkan dapat membantu peserta didik memahami konsep. Penelitian dan pengembangan modul fisika ini dilakukan dengan tujuan mengembangkan produk berupa modul fisika berbasis inkuiri disertai scaffolding pada materi dinamika rotasi dan keseimbangan benda tegar serta mengetahui kelayakannya. Penelitian dan pengembangan modul fisika ini mengadaptasi model penelitian dan pengembangan Borg dan Gall dan dilakukan sampai tahap kelima (revisi hasil uji coba). Modul fisika ini divalidasi oleh seorang Dosen Fisika Universitas Negeri Malang dan seorang Guru Fisika SMA. Uji keterbacaan dilakukan oleh 29 orang peserta didik kelas X SMAN 1 Malang. Instrumen pengambilan data yang digunakan dalam penelitian dan pengembangan ini adalah angket. Penilaian terhadap produk penelitian dan pengembangan adalah validasi dan uji coba terbatas untuk mengetahui kualitas produk oleh pengguna. Data hasil penilaian berupa data kuantitatif dan kualitatif. Data kuantitatif diperoleh berdasarkan penilaian pada angket validator dan subyek uji coba terbatas dengan skala Likert. Data kualitatif diperoleh dari komentar dan saran validator. Teknis analisis data yang digunakan adalah analisis data nilai rerata. Hasil validasi isi modul fisika berbasis inkuiri disertai scaffolding untuk peserta didik dan untuk guru dinyatakan layak/valid. Hasil uji kelayakan modul peserta didik dinilai layak dengan rata-rata kelayakan isi, kebahasaan dan penyajian secara berturut-turut sebesar 3,61; 3,83; dan 3,62. Modul guru dinilai layak dengan kelayakan isi sebesar 3,95, kelayakan kebahasaan sebesar 3,67, dan kelayakan penyajian sebesar 3,70. Hasil keterbacaan siswa kelas X SMAN 1 Malang adalah layak dengan nilai rata-rata 3,67. Hasil penelitian menunjukkan bahwa produk termasuk dalam kriteria layak, namun memerlukan sedikit revisi. Modul fisika ini perlu dikembangkan sampai tahap kesepuluh (diseminasi dan implementasi).

Pengembangan permainan misteri dadu dalam pembelajaran kognitif mengenal konsep bilangan 1-10 pada anak Kelompok A di TK Bhima Putra Malang / Intan Kusuma Bekti

 

ABSTRAK Bekti, Intan Kusuma. 2015. Pengembangan Permainan Misteri Dadu dalam Pembelajaran Kognitif Mengenal Konsep Bilangan 1-10 pada Kelompok A di TK Bhima Putra Malang. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Prodi Pendidikan Guru Pendidikan Anak Usia Dini Fakultas Ilmu Pendidikan, Universitas Negeri Malang, Pembimbing (1) Drs. Tomas Iriyanto, S.Pd, M.Pd (2) Dra. Wiwik Dwi Hastuti, S.Pd, M.Pd Kata Kunci: Permainan Misteri dadu, konsep bilangan 1-10, aspek kognitif Media permainan misteri dadu merupakan media pembelajaran permainan mengembangkan kemampuan kognitif anak di Taman Kanak-kanak. Berdasarkan observasi yang telah dilakukan, kegiatan pembelajaran kognitif di TK Bhima Putra Malang berlangsung monoton, cenderung mengerjakan lembar kerja dan kurang adanya bermain. Sehingga peneliti menganjurkan permainan misteri dadu sebagai literature pada pembelajaran kognitif dengan menggunakan berbagai media. Tujuan penelitian dan pengembangan adalah untuk menghasilkan permainan Misteri Dadu untuk pembelajaran kognitif mengenal konsep bilangan 1-10. Model pengembangan yang digunakan dalam penelitian ini adalah diadaptasi oleh model pengembangan Borg and Gall. Prosedur permainan Misteri Dadu dalam pembelajaran kognitif adalah: (1) Melakukan penelitian dan pengumpulan data, (2) Melakukan perencanaan pengembangan permainan, (3) Mengembangkan bentuk produk awal permainan dan dievaluasi oleh ahli, (4) Melakukan uji coba kelompok kecil dengan 6 subjek, (5) Merevisi permainan dengan hasil uji coba kelompok kecil, (6) Melakukan uji coba kelompok besar terhadap 30 subjek,(7) Melakukan revisi produk. Instrument yang digunakan adalah berupa kuisioner berisi tentang rancangan produk dan produk yang telah dibuat. Teknik analisi data yang digunakan adalah analisis kualitatif dan kuantitatif berupa persentase. Berdasarkan hasil analisis data uji coba kelompok besar , diperoleh persentase yaitu (1) 100% anak senang untuk melakukan permainan misteri dadu (2) 97,8% anak dapat melakukan setiap aktivitas sesuai aturan (3) 100% anak aman melakukan permainan misteri dadu, maka produk ini tidak memerlukan revisi lagi, sehingga menjadi produk akhir yang dapat digunakan sebagai salah satu alternative pembelajaran yang menarik bagi anak. Diharapkan hasil pengembangan ini dapat diuji cobakan kepada kelompok besar dan dapat disosialisasikan kepada sekolah-sekolah dan lembaga pendidikan yang terkait sehingga dapat digunakan sebagaimana mestinya. Kesimpulan hasil observasi selama penelitian dan pengembangan permainan Misteri Dadu untuk pembelajaran kognitif mengenal konsep bilangan 1-10 adalah: dapat mengembangkan aspek agama, bahasa, sosial emosional, fisik motorik dan seni. Saran untuk peneliti selanjutnya dapat mengembangkan permainan tersebut sebagai salah satu pembelajaran kognitif, sehingga permainan ini dapat menstimulus kecerdasan anak.

Prospek industri kerajinan batik tulis Jombang / Agus Susanto

 

ABSTRAK Susanto, Agus. 2016. Prospek Industri Kerajinan Batik Tulis Jombang.Skripsi, Jurusan Ekonomi Pembangunan Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing (I) Dr. Mit Witjaksono, MS.Ed., (II) Dr. Farida Rahmawati, S.E., M.E. Kata Kunci : Prospek, Industri Kerajinan Batik Kabupaten Jombang yang tidak termasuk dalam daerah penghasil batik ternyata juga mempunyai industri kerajinan batik tulis. Keberadaan industriberpusat di desa Jatipelem, Kecamatan Diwek, Kabupaten Jombang. Industri ini merupakan industri rumahan yang bersifat padat karya serta mampu melahirkan wirausahawan-wirausahawan baru.Penelitian ini berusaha untuk mengkaji prospek industri kerajinan batik tulis Jombang berdasarkan tiga aspek Community Economic Development (CED), yaitu Growth, Development, dan Community Economic Develompent dan satu aspek kompetisi. Penelitian ini menggunakan pendekatan kualitatif dengan jenis Fenomenologi. Fenomenologi yang dimaksud adalah industri kerajinan batik tulis Jombang masih terbilang baru. Teknik analisis data yang digunakan adalah reduksi data, penyajian data dan verifikasi data. Berdasarkan hasil penelitian, diperoleh adanya prospek industri kerajinan batik tulis Jombang yang baik dimana dapat dilihat melalui empat aspek, yaitu: (1) Growth,industri ini setiap tahunya mengalami pertumbuhan baik dari segi pendapatan dan jumlah pengrajin yang ada; (2) Development, pengembangan produk meliputi desain/motif batik dan output yang dihasilkan; (3) Community Economic Development,proses dalam menjaga keberlangsungan industri, pengrajin melakukan beberapa upaya antara lain: membentuk paguyuban batik, menjaga kualitas batik, memanfaatkan internet untuk memperluas jangkauan pemasaran, mengikuti program kemitraan, meningkatkan kualitas sumber daya manusia, dan mendirikan bangunan khusus untuk memasarkan produk batik; (4)kompetisi, produk batik khas Jombang belum kompetitif jika dibandingkan dengan batik dari luar daerah terutama Jawa Tengah. Pengrajin diharapkan lebih inovatif dalam melakukan promosi produk agar produk batik lebih kompetitif dan lebih dikenal masyarakat luas, beradaptasi dalam penggunaan teknologi modern guna meningkatkan produksi, dan mengembangkan desain/motif batik khas Jombang.

Pengembangan media papan baca tombol geser untuk anak Kelompok B Taman Kanak-Kanak / Luluk Rohmatul Laili

 

ABSTRAK Rohmatul Laili, Luluk. 2015. Pengembangan Media Papan Baca Tombol Geser untuk Anak Kelompok B Taman Kanak-Kanak. Skripsi. Jurusan Kependidikan Sekolah Dasar Dan Prasekolah. Fakultas Ilmu Pendidikan.Universitas Negeri Malang. Pembimbing (1) Drs. I Wayan Sutama,M.Pd., (II) Drs. Ir. Endro Wahyuno, M.Si. Kata kunci : Media Papan Baca Tombol Geser, Kemampuan Membaca Awal Kemampuan membaca awal pada anak erat kaitanya dengan kemampuan bahasa yang dimiliki oleh anak. Kemampuan membaca, hendaknya dikembangkan dalam kegiatan pembelajaran yang menarik, sehingga dapat membangkitkan motivasi dan keingintahuan anak. Kegiatan yang hanya berupa lembar kerja, akan membosankan bagi anak. Penelitian ini memiliki tujuan untuk menghasilkan media pembelajaran yang dapat mengembangkan kemampuan membaca awal sehingga kegiatan pembelajaran lebih efektif, menarik dan menyenangkan bagi anak. Media yang dihasilkan untuk anak kelompok B Taman Kanak-kanak. Metode yang digunakan dalam penelitian ini adalah metode penelitian dan pengembangan. Data penelitian berupa data kualitatif dan data kuantitatif. Pengumpulan data dilakukan dengan menggunakan teknik wawancara, observasi dan dokumentasi. Uji coba dilakukan di TK Muslimat NU 11. Hasil analisis data diperoleh tingkat kelayakan media berupa persentase rata-rata hasil evaluasi 3 orang ahli sebagai validator media yaitu sebesar 91,7 %. Dapat disimpulkan bahwa penelitian dan pengembangan produk ini dapat digunakan sebagai media pembelajaran anak usia dini. Saran yang dapat diberikan antara lain ,media ini dapat digunakan sebagai alternatif dalam pembelajaran di Taman Kanak-kanak, khususnya pengembangan bahasa. Hasil pengembangan ini dapat diterapkan kembali dengan menambahkan variasi pada kartu gambar, sehingga aspek perkembangan lebih luas.

Pembelajaran kooperatif model STAD (student teams achievement division) dalam meningkatkan prestasi belajar fisika dasar II mahasiswa Program Studi Pendidikan Fisika FMIPA Universitas negeri Malang oleh Sarimang Aisah Jamco

 

FisikaD asarm erupakansa lahs atum atakuriahd asary angw ajib ditempuh olehm ahasiswtaa hrurp ertamad i FMIpA khususnypaa dajuiusanfi sitca.t uiuannya agup aram ahasiswtaa hunp ertamam enguasakio nsepkonsedpa sarfi sika secara mantapu ntukb ekalm empelajarmi atakuliahfi sika yangl ebih lanjut.N amunk enyataannypare stasbi elajarF isikaD asarI I mahasiswtaa hunp ertamam asihr endah, olehk arenait u untukm eningkatkapnr estasbi elajarF isikaD asarF digunakanb erbagaai lternatimf etodep embelajarayna ngm elibatkamn ahasiswsae ciraa ktif selama proseps embelajarans.a lahs atum etodep mbelajarantersebuat dalahpembelajaran kooperatifm odels rAD. Penggunaamno deli ni diharapkand apatm eningkattan prestasbi elajarm ahasiswjau rusanf isika.P enelitianin i bertujuanu ntukm engetahui qembeg jarank ooperatimf odels rAD dalamm eningkatkarprestabsei lajarF isika DasaIrI mahasiswpar ograrns tudip endidikanfi sika FMIpA universitasil egeri Malang. Penelitiainn i menggunakapne ndekataknu alitatifd engajne nisp enelitian tindakakne las( C/assroom A ctionR esearchT).a hap-tahappe nelitianin i meliputi(: I ) lahapperencana(a2n), t ahapp elaksanaa(n3,) tahapo bservas(i4, ) tahapr efleksi. Penelitiainn i dilaksanakadna lamd uas iklusy, aknis iklusI denganm at-eLrii strik Statisd ans iklusI I denganm aterLi istrikD inamis. Hasilp enelitianin i menu4iukkabna hwap restasbi elajarF isikaD asarI i mahasiswpar ogam studip endidikanfi sika mengalampi eningkatanp.e ningkatan prestasbie lajarm ahasiswdait unjukkano leh,( l) nilairata-ratikeladsa rik eadaan awals ebesa4r9 ,89m enjadi6 1,43s etelahm endapattin dakanw dasiklusI , dan menjad6i 4,63s etelahm endapatitn dakanp adas iklusI I (2) pelsentaskee lulusan berdasarkaknri teriap adaP edomanP endidikanU niversitasi. IegerMi alangd ari siklus I sebesa6r0 %om enjad7i 1,5%p adas iklusI I, (3) rata-ratask orp adam asing-masing kelompomk angalampie ningkatadna ris iklusi ke siklusI I, (4jPrestasbi elajaar niara kemamprraanr vald engans iklusI mengalampi eningkatayna ngs igrrifikann, amun antaras iklusI dengans iklusI I tidak adap eningkatayna ngs ignifikan Dari hasilp enelitiante rsebudt apatd isimpulkanb ahwap enerapapne mbelajqan kooperatimf odels rAD dapatm eningkatkapnr estasbi eiajarF isikaD asarI I mahasiswSa.e caruam umd apadt isarankaang ar( l) liepadad osenfi sika,d iharapkan ynl$ meryifh_pembel{3r.akno operatifm odetS TADs ebagaai lternatifp ilihanp embelajaradni kelas(, 2) dilalnrkapne nelitianle bihl anjut,m iJarnyuan tukje njang' pendidikaSn MUd anS LTP.

Hubungan adversity quotient dengan kemampuan manajerial pelaku wirausaha muda kafe di Kota Malang / Sabila Okta Syarafina

 

ABSTRAK Syarafina, Sabila Okta. 2016. Hubungan Adversity Quotient dengan kemampuan manajerial pada pelaku wirausaha muda Kafe di Kota Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi Universitas Negeri Malang. Pembimbing: (I) Diyah Sulistiyorini, S.Psi., M.Psi., (II) Gamma Rahmita U.H., S.Psi., M.Psi Kata kunci: adversity quotient, kemampuan manajerial, pelaku wirausaha muda kafe di Kota Malang Banyaknya Kafe yang bermunculan di Kota Malang membuat persaingan bisnis kuliner menjadi semakin ketat, persaingan tersebut merupakan salah satu tantangan yang harus dihadapi pelaku wirausaha muda. Untuk menghadapi tantangan mengharuskan pelaku wirausaha memiliki adversity quotient. Ketika pelaku wirausaha muda memiliki adversity quotient yang tinggi maka pelaku wirausaha muda akan mengerahkan seluruh usahanya untuk bisa menghadapi permasalahan yang ada, Salah satu usaha yang mungkin dilakukan untuk menghadapi tantangan yaitu membangun usahanya dengan berbagai strategi, hal tersebut membutuhkan kemampuan manajerial. Penelitian ini bertujuan untuk (1) mengetahui gambaran Adversity Quotient pada pelaku wirausaha muda kafe di Kota Malang, (2) mengetahui gambaran kemampuan manajerial pada pelaku wirausaha muda kafe di Kota Malang, dan (3) untuk mengetahui hubungan Adversity Quotient dengan kemampuan manajerial pada pelaku wirausaha muda kafe di Kota Malang. Penelitian ini merupakan penelitian kuantitatif dengan metode deskriptif dan korelasional, serta menggunakan teknik purposive sampling. Dengan jumlah sample 36 pemilik kafe. Instrumen yang digunakan angket adversity quotient dan penilaian kinerja kemampuan manajerial. Dengan reliabilitas masing – masing 0,798 dan 0,903. Teknik pengkategorian pada penilitian ini berdasarkan skor T. Uji hipotesis menggunakan analisis product moment. Hasil penelitian ini menunjukkan bahwa pelaku wirausaha muda kafe di Kota Malang (1) sebagian besar pelaku wirausaha muda kafe di Kota Malang memiliki nilai adversity quotient yang tinggi, (2) sebagian besar subjek memiliki kemampuan manajerial yang tinggi, (3) terdapat hubungan positif antara adversity quotient dengan kemampuan manajerial pada pelaku wirausaha muda kafe di Kota Malang dengan nilai rxy = 0,353 dan nilai p = 0,035 < 0,05 Saran yang dapat diberikan berdasarkan penelitian ini, yaitu (1) bagi pelaku wirausaha muda agar meningkatkan kemampuan dalam menghadapi tantangan, (2) bagi peneliti selanjutnya dapat menggunakan penelitian ini sebagai referensi untuk mengembangkan penelitian adversity quotient dengan menambahkan atau menggunakan subjek yang berbeda, serta dapat membuat pelatihan yang mampu meningkatkan adversity quotient.

Pengaruh penggunaan media presentasi prezi terhadap motivasi dan hasil belajar akuntansi siswa / Amanda Lia Arselia

 

ABSTRAK Arselia, Amanda Lia. 2016. Pengaruh Penggunaan Media Presentasi Prezi terhadap Motivasi dan Hasil Belajar Akuntansi Siswa. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Sulastri, S.Pd,. M.SA. (II) Bety Nur Achadiyah, S.Pd., M.Sc. Kata Kunci: Media Presentasi Prezi, Motivasi Belajar, Hasil Belajar. Salah satu manfaat penggunaan media dalam proses pembelajaran yaitu untuk membantu siswa dalam mencapai tujuan pembelajaran. Guru sebagai komponen terpenting dalam kegiatan pembelajaran dituntut untuk dapat bertindak proaktif yakni dengan menyajikan media pembelajaran yang inovatif, kreatif, dan menarik, sehingga dapat meningkatkan pemahaman siswa dan mewujudkan situasi belajar yang efektif. Salah satu media pembelajaran yang dapat digunakan guru dalam pengajaran yaitu media presentasi Prezi. Penelitian ini bertujuan untuk menjelaskan pengaruh penggunaan media presentasi Prezi terhadap motivasi dan hasil belajar Akuntansi siswa di kelas X APK SMK Cendika Bangsa Kepanjen. Jenis penelitian ini adalah Eksperimen Kuasi dengan desain Postest-Only Group Design untuk menguji variabel motivasi belajar dan Pretest-posttest Control Group Design untuk menguji variabel hasil belajar siswa. Subjek penelitian adalah siswa kelas X APK bilingual sebagai kelas kontrol dan kelas X APK regular sebagai kelas eksperimen. Instrumen yang digunakan berupa instrumen tes berupa soal pilihan ganda dan non-tes berupa angket. Analisis data pada penelitian ini menggunakan uji Independent Sample T. Berdasarkan hasil uji Independent Sample T terhadap data angket motivasi menunjukkan signifikansi 0,000 < 0,05, sehingga Ho di tolak dan H1 diterima, yang artinya bahwa terdapat pengaruh dalam penggunaan media presentasi Prezi terhadap motivasi belajar akuntansi siswa kelas X APK SMK Cendika Bangsa Kepanjen. Kemudian hasil analisis terhadap hasil belajar menunjukkan signifikansi 0,006 < 0,05, sehingga Ho di tolak dan H2 diterima, artinya penggunaan media presentasi Prezi berpengaruh terhadap hasil belajar akuntansi di kelas X APK SMK Cendika Bangsa Kepanjen. Kesimpulan dari penelitian ini yaitu penggunaan media presentasi Prezi berpengaruh terhadap motivasi dan hasil belajar akuntansi siswa kelas X APK SMK Cendika Bangsa Kepanjen.  

Pengaruh gaya belajar dan lingkungan keluarga terhadap prestasi belajar akuntansi siswa SMK Negeri 1 Pasuruan / Duwi Rahayu Maisaroh

 

ABSTRAK Maisaroh, Duwi Rahayu. 2016. Pengaruh Gaya Belajar dan Lingkungan Keluarga terhadap Prestasi Belajar Akuntansi Siswa SMK Negeri 1 Pasuruan. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing (1) Bety Nur Achadiyah, S.Pd, M.Sc (2) Diana Tien Irafahmi, S.Pd., M.Ed. Kata Kunci: Gaya Belajar Visual, Gaya Belajar Auditorial, Gaya Belajar Kinestetik, Lingkungan Keluarga, Prestasi Belajar Prestasi belajar merupakan tolak ukur keberhasilan suatu proses pembelajaran. Sedangkan prestasi belajar sangat ditentukan oleh berbagai faktor yang terjadi selama proses belajar mengajar tersebut. Prestasi belajar siswa dipengaruhi oleh banyak faktor yaitu faktor internal dan faktor eksternal. Salah satu contoh faktor internal adalah gaya belajar (visual, auditorial, dankinestetik). Sedangkan faktor eksternal yaitu lingkungan keluarga.Teori yang mendukung penelitian ini adalah teori kognitif sosial yang dikemukakan oleh Albert Bandura. Penelitian ini bertujuan untuk mengetahui pengaruh gaya belajar visual, gaya belajar auditorial, gaya belajar kinestetik dan lingkungan keluarga terhadap prestasi belajar akuntansi siswa SMK Negeri 1 Pasuruan. Penelitian ini tergolong dalam penelitian explanatory research dengan menggunakan pendekatan kuantitatif. Populasi penelitian ini adalah seluruh siswa kelas X Akuntansi dan kelas XI akuntansi SMK Negeri 1 Pasuruan sejumlah 210 siswa dan dengan teknik proportional random sampling digunakan sampel sebanyak 138 siswa. Metode pengumpulan data menggunakan angket untuk mengukur gaya belajar visual, gaya belajar auditorial, gaya belajar kinestetik dan lingkungan keluarga, sedangkan dokumentasi untuk mengambil data prestasi belajar akuntansi. Analisis data yang digunakan adalah analisis regresi linier berganda dengan pengujian hipotesis menggunakan uji t dan koefisien determinasi dengan bantuan program IBM SPSS Statistics 23. Hasil penelitian menunjukkan bahwa: (1) Terdapat pengaruh positif signifikan gaya belajar visual terhadap prestasi belajar. (2) Terdapat pengaruh positif signifikan gaya belajar auditorial terhadap prestasi belajar. (3) Terdapat pengaruh positif signifikan gaya belajar kinestetik terhadap prestasi belajar siswa. (4) Terdapat pengaruh positif signifikan lingkungan keluarga terhadap prestasi belajar. Dengan demikian dapat disimpulkan bahwa semakin baik gaya belajar visual, gaya belajar auditorial, gaya belajar kinestetik dan lingkungan keluarga maka akan semakin tinggi prestasi belajar yang diperoleh, begitu pula sebaliknya. Berdasarkan hasil penelitian disarankan bagi sekolah agar dapat memberikan masukan positif untuk pengembangan pembelajaran. Bagi guru agar dapat menyeseuaikan gaya mengajar dan kebutuhan siswa serta dorongan agar siswa dapat belajar dengan sungguh-sungguh sehingga memperoleh prestasi belajar yang maksimal. Bagisiswa agar lebih mengenal dan memahami gaya belajar nya sehingga prestasi belajar yang diperoleh menjadi maksimal. Serta untuk peneliti lain untuk lebih memperluas variabel penelitian dan menambah jumlah populasi.

Implementasi pendidikan karakter melalui pendekatan saintifik di kelas IV semester genap sekolah dasar negeri gugus V Kecamatan Blimbing Kota Malang / Ayip Herdima

 

ABSTRAK Herdima, Ayip. 2015. Implementasi Pendidikan Karakter melalui Pendekatan Saintifik di Kelas IV Semester Genap Sekolah Dasar Negeri Gugus V Kecamatan Blimbing Kota Malang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Sukamti, M.Pd, (II) Drs. Dimyati, S.Pd, M.Pd. Kata Kunci: implementasi, pendidikan karakter, pendekatan saintifik Dewasa ini semakin sering kita menjumpai secara langsung ataupun melalui pemberitaan media cetak/elektronik mengenai kenakalan yang melibatkan pelajar. Untuk itu diperlukan penanganan sejak dini dalam mengatasi permasalahan ini, salah satunya yaitu dengan menerapkan pendidikan karakter di sekolah. Pemerintah terkait dengan hal ini, membuat kebijakan dengan menerbitkan Kurikulum 2013 yang menekankan pada pendidikan karakter. Selanjutnya dalam praktik proses pembelajaran, pendekatan pembelajaran yang digunakan yaitu menggunakan pendekatan saintifik. Penelitian ini bertujuan untuk mendeskripsikan: (1) Pelaksanaan pendekatan saintifik di kelas IV, (2) Pelaksanaan pendidikan karakter pada saat langkah kegiatan mengamati di kelas IV, (3) Pelaksanaan pendidikan karakter pada saat langkah kegiatan menanya di kelas IV, (4) Pelaksanaan pendidikan karakter pada saat langkah kegiatan mengumpulkan informasi di kelas IV, (5) Pelaksanaan pendidikan karakter pada saat langkah kegiatan mengasosiasi di kelas IV, (6) Pelaksanaan pendidikan karakter pada saat langkah kegiatan mengkomunikasikan di kelas IV, (7) Kendala yang dihadapi guru ketika melakukan pendidikan karakter melalui pendekatan saintifik di kelas IV, dan (8) Solusi guru untuk mengatasi kendala pada saat melakukan pendidikan karakter melalui pendekatan saintifik. Penelitian ini merupakan penelitian deskriptif kualitatif. Pengumpulan data dilakukan melalui observasi, dokumentasi, serta wawancara. Dalam pengecekan keabsahan data, menggunakan metode triangulasi data. Berdasarkan hasil penelitian yang telah dilaksanakan, dapat disimpulkan bahwa seluruh guru kelas IV yang tergabung dalam gugus V Kecamatan Blimbing telah menggunakan pendekatan saintifik dalam proses pembelajarannya dan sudah dapat menanamkan nilai-nilai karakter melalui setiap langkah kegiatan pembelajarannya. Saran yang dapat diberikan berdasarkan hasil penelitian yaitu hendaknya guru lebih memanfaatkan fungsi RPP sebagai sarana guru agar lebih siap dalam melakukan kegiatan pembelajaran, membentuk kompetensi dan karakter siswa dengan perencanaan yang matang. Selanjutnya bagi kepala sekolah hendaknya dalam menyukseskan pendidikan karakter dapat menggunakan cara sosialisasi. Sosialisasi bertujuan untuk mengenalkan tentang visi dan misi sekolah, serta pendidikan karakter yang akan diimplementasikan.

Hambatan-hambatan pelaksanaan kegiatan praktikum kimia kelas III tahun pelajaran 2001/2002 yang dialami guru kimia SMU Negeri se Kabupaten Malang oleh Joko Dwi Pitono

 

Salahs atui vu-iudd ari pclaksanaapne nrlckataknc trampilanp roscsd alam pembela.iaraknir niaa clalahk egiatanp raktikurnd i laboratoriumk,a renad alam kegiatante rscbust isrvate rliball angsungc lalarnk egiatanp ernbcla,jaradnir nana siswab ertindaks ebagasi uhyekp clrksanak r'giatanI.) cngand crni'kianke gratan praktikunrm cmpunyaki edutiukani, angs angapt cnringd alarnr natap el a.jarakni rrra Nanrunk enyalaand i lapanganb any'akd ijurnpaib ah*,ap claksanlanp raitikurn krmiad i SMU t idakb isab er jatano p. i rnalI.l anrbataant auk esul i tavna nsd ialarni guruk irnias cbagapi elaksanakc giatanp raktikumd apatd isebabkaonl eh"berbagai fbktora nlaral airr:( I ) kurangnyas aranad arrp rzl.silraunnat u! kcgratanp raktrkurrr, (2) ti

Analisis faktor-faktor yang mempengaruhi ekspor Indonesia-Jepang dengan pendekatan model Vector Auto Regression (VAR) periode 2008:Q3-2015:Q4 / Aulia Eka Febriani

 

Peningkatan kemampuan membaca cerita melalui pemanfaatan buku cerita bergambar big book pada siswa kelas I SDN Karangrejo 02 Kabupaten Malang / Andrias

 

ABSTRAK Andrias. 2016. Peningkatan Kemampuan Membaca Cerita Melalui Pemanfaatan Buku Cerita Bergambar Big Book Pada Siswa Kelas I SDN Karangrejo 02 Kabupaten Malang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Pra Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs.,Sjafruddin A. Rahman, S. Pd, M. Pd (II) Dra. Sri Estu Winahyu, M. Pd Kata kunci: cerita bergambar,big book, membaca teknis SD Berdasarkan hasil obervasi pada pembelajaran Bahasa Indonesia di kelas 1 SDN Karangrejo 02, ditemukan masih ada sebagian besar siswa belum dapat membaca dengan lancar dan ada siswa yang masih mengeja sehingga terhambat kemampuannya untuk membaca kalimat dengan lancar. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan penerapan buku cerita bergambar big bookuntuk meningkatkan kemampuan membaca cerita siswa kelas I SDN Karangrejo 02 dan mendeskripsikan peningkatan kemampuan membaca cerita siswa kelas I SDN Karangrejo 02 setelah belajar melalui pemanfaatan buku cerita bergambar big book. Penelitian ini menggunakan pendekatan deskriptif kualitatif dengan jenis Penelitian Tindakan Kelas. Penelitian ini dilakukan dalam 2 siklus dengan materi membaca cerita pada siswa kelas 1 SDN Karangrejo 02 yang berjumlah 30 siswa. Data diperoleh dengan mengumpulkan lembar pengamatan terhadap aktivitas guru dalam pembelajaran, hasil tes kemampuan membaca siswa dan hasil tes pemahaman siswa dalam membaca cerita. Teknik yang digunakan untuk mengumpulkan data yaitu observasi dan tes. Kegiatan analisis data dimulai dari tahap reduksi data, paparan data, dan penyimpulan hasil analisis data. Hasil pada penelitian ini ditemukan bahwa: (1) siswa dapat membaca lancar dengan benar melalui buku cerita bergambar big book, (2) siswa lebih percaya dirimembaca teks cerita pendek dengan lafal dan intonasi yang tepat, (3) aktivitas siswa saat mengikuti pembelajaran membaca semakin aktif dan antusias. Hasil penelitian menunjukkan bahwa pemanfaatan buku cerita bergambar big bookdalam pembelajaran berjalan dengan baik sehingga terjadi peningkatan nilai rata- rata hasil tes kemampuan membaca cerita juga mengalami peningkatan 13,42% dengan ketuntasan klasikal sebesar 27% . Berdasarkan uraian di atas, dapat dsimpulkan bahwa penggunaan buku cerita bergambar big bookdapat meningkatkan keterampilan membaca cerita siswa kelas 1 SDN Karangrejo 02. Peneliti juga memberikan saran agar penggunaan ini dapat dipertimbangkan untuk diterapkan pada pembelajaran membaca Bahasa Indonesia sebagai salah satu alternatif dalam menggunakan media yang sesuai.

Peramalan jumlah wisatawan mancanegara ke Indonesia dengan menggunakan metode Autoregressive Integrated Moving Average with Exogenous Variabel (ARIMAX) efek variasi kalender libur akhir tahun / Fitria Rahmawati

 

ABSTRAK Rahmawati, Fitria, 2016. PeramalanJumlahWisatawanMancanegarake Indonesia denganMenggunakanMetodeAutoregressive Integrated Moving Average with Exogenous Variable (ARIMAX) EfekVariasiKalenderLiburAkhirTahun.Skripsi, JurusanMatematika, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: TrianingsihEni Lestari, S.Si, M.Si. Kata kunci : ARIMAX, variasikalender, wisatawanmancanegara Sektorpariwisata di Indonesia merupakansalahsatuandalanuntukmenyerapdevisa Negara.Salah satunyadariwisatawanmancanegara yang berkunjungke Indonesia.Dimanabiasanyameningkatpadaliburakhirtahun.Besarnyapotensiinimembuatpara investor asingberlomba-lombamenanamkan modal untukmembangun hotel yang dapatberakibatover supply.Untukmenanganihaltersebutdiperlukanprediksijumlahwisatawan yang akuratdenganmelakukanperamalanyaitudengananalisisderetwaktu. Ketika data deretwaktumemilikivariabellebihdarisatuyang disebutjugasebagaidata multivariatmisalkandenganadanyapenambahanvariabeldummyefekvariasikalenderliburakhirtahunmakasalahsatumetodeperamalan yang bisadigunakanadalahdenganAutoregressive Integrated Moving Average with Exogenous Variable (ARIMAX) EfekVariasiKalender.MetodeARIMAX adalahmodifikasidari model ARIMA Seasonal denganpenambahanvariabeleksogenyaituvariabeldummydanperiodewaktu. Denganmelihatpermasalahantersebut, penelitianinibertujuanmengetahui model deretwaktuterbaikuntukmeramalkanjumlahwisatawanmancanegaradenganmetode ARIMAX sertamengetahuihasilperamalanjumlahwisatawanmancanegaradenganmetode ARIMAX. Berdasarkanhasilanalisisterhadapjumlahwisatawanmancanegara, diperolehbahwa model terbaikperamalansebagaiberikut Y_t=475158,2+98619,9D_1t+3650,5t+a_t 〖(1- 0,22055B)〗^(-1) 〖(1-0,48107B^12)〗^(-1) Dari model diatasdiketahuibahwaperamalanuntuk data padabulanselanjunyadipengaruhiolehefekvariasikalenderliburakhirtahundanperiodewaktupadasaatbulantersebut.Hasilperamalanjumlahwisatawan yang datangke Indonesia denganmetode ARIMAX padabulanJanuari 2016 danbulanFebruari 2016 sebesar 814052,96 dan 858423,27 orang.

Partisipasi masyarakat dalam pelaksanaan program sekolah di SDN segugus 5 Kecamatan Blimbing Kota Malang / Agustina Putri Setia Mardika

 

ABSTRAK Mardika, Agustina Putri Setia, 2015. Partisipasi Masyarakat dalam Pelaksanaan Program Sekolah di SDN Segugus 5 Kecamatan Blimbing Kota Malang. Skripsi. Jurusan Kependidikan Sekolah Dasar dan Prasekolah. Fakultas Ilmu Pendidikan. Universitas Negeri Malang. Pembimbing (1) Muchtar, S.Pd, M.SI (2) Drs. M. Imron Rosyadi, H.SY, S.Pd, M.Pd Kata Kunci: Partisipasi Masyarakat, Program Sekolah, dan Komite Sekolah Dasar. Partisipasi masyarakat merupakan bentuk keikutsertaan dan keterlibatan secara fisik maupun mental secara aktif yang mendorong untuk menyokong pada pencapaian tujuan pada tujuan serta ikut bertanggung jawab dalam proses perencanaan dan pembangunan. Bentuk partisipasi tersebut berupa partisipasi fisik dan non fisik. Partisipasi masyarakat dalam pendidikan berperan dalam peningkatan mutu pelayanan pendidikan dalam program pendidikan. Keikutsertaan masyarakat ini dapat diwujudkan dalam bentuk Komite Sekolah atau Dewan Pendidikan. Komite Sekolah berperan sebagai pemberi pertimbangan, pendukung, baik yang berwujud finansial, pemikiran maupun tenaga dalam penyelenggaraan pendidikan di satuan pendidikan, pengontrol, serta mediator antara sekolah dengan masyarakat di satuan pendidikan. Tujuan yang ingin dicapai dalam penelitian ini untukmendiskripsikan partisipasi masyarakat dalam pelaksanaan program sekolah di SDN Segugus 5 Kecamatan Blimbing, Kota Malang, yang meliputi: (1) bentuk partisipasi masyarakat di SDN Segugus 5 Kecamatan Blimbing Kota Malangdalam pelaksanaan program sekolah; (2) faktor pendukung partisipasi masyarakat di SDN Segugus 5 Kecamatan Blimbing Kota Malang dalam pelaksanaan program sekolah; (3) kendala yang dialami sekolah untuk mengoptimalkan partisipasi masyarakat di SDN Segugus 5 Kecamatan Blimbing Kota Malang dalam pelaksanaan program sekolah; dan (4) cara sekolah mengatasi kendala untuk mengoptimalkan partisipasi masyarakat di SDN Segugus 5 Kecamatan Blimbing Kota Malang dalam pelaksanaan program sekolah. Penelitian ini dirancang menggunakan pendekatan kualitatif. Penelitian kualitatif dilakukan dengan langsung mengamati fenomena yang terjadi di lapangan. Subyek penelitian ini terdiri dari Kepala Sekolah, Guru Kelas, Ketua Komite Sekolah, serta data-data sekolah yang menunjang. Hasil penelitian ini menunjukkan bahwa dalam penyelenggaraan pendidikan, sekolah membutuhkan bantuan yakni campur tangan dari sistem sosial masyarakat yang tergabung dalam organisasi komite sekolah untuk mencapai mutu pelayanan pendidikan yang baik. Sekolah perlu menjaga hubungan yang harmonis dengan masyarakat sehingga masyarakat dapat menjalankan peran dan tanggung jawabnya dengan maksimal dalam rangka peningkatan mutu pendidikan.

Pengaruh variasi konsentrasi cairan karbon cleaner dalam bahan bakar terhadap daya dan emisi gas buang pada Honda Vario 110 PGM-FI / Ahmad Arbi Trihatmojo

 

ABSTRAK Trihatmojo, Ahmad Arbi. 2016. Pengaruh Variasi Konsentrasi Cairan Carbon Cleaner dalam Bahan Bakar terhadap Daya dan Emisi Gas Buang pada Honda Vario 110 PGM-FI. Skripsi, Jurusan Teknik Mesin, Fakultas Teknik Universitas Negeri Malang. Pembimbing: (1) Dr. Hj. Widiyanti, M.Pd. (2) Drs. Partono, M.Pd. Kata Kunci: Bahan Bakar, Carbon Cleaner, Daya Mesin, Emisi Gas Buang. Pada saat ini sektor transportasi tumbuh dan berkembang seiring dengan peningkatan ekonomi nasional maupun global. Berdasarkan data Badan Pusat Statistik (BPS) pada tahun 2013, menunjukkan bahwa perkembangan jumlah kendaraan bermotor di Indonesia mengalami peningkatan 9,86 % dari tahun sebelumnya. Pesatnya pertumbuhan kendaraan bermotor berakibat meningkatnya penggunaan bahan bakar minyak (BBM) di sektor transportasi, sehingga emisi gas buang yang mengandung polutan akan naik dan meningkatkan kadar pencemaran udara. Peneltian ini bertujuan untuk mengetahui signifikansi pengaruh variasi konsentrasi cairan carbon cleaner dalam bahan bakar terhadap daya dan emisi gas buang pada Honda Vario 110 PGM-FI. Penelitian ini menggunakan metode penelitian kuantitatif yaitu True Experimental Design jenis Post Test Only Control Design dengan menggunakanvariasi konsentrasi cairan carbon cleaner 0 ml, 10 ml, 15 ml, 20 ml, dan 25 ml berbanding satu liter bahan bakar untuk diuji pengaruhnya terhadap daya dan emisi gas buang pada Honda Vario 110 PGM-FI. Bahan bakar yang digunakan adalah pertamax 92 standar Pertamina. Cairan carbon cleaner yang digunakan mengandung Poly Ether Amine (PEA). Parameter putaran mesin yang digunakan yaitu 2000 rpm sampai 5000 rpm dengan kenaikan 500 rpm. Analisis data hasil penelitian dengan uji statistik One Way Anovadan Post Hoc. Hasil pengujian daya mesin dan emisi gas buang menunjukkan bahwa variasi konsentrasi cairan carbon cleaner dalam bahan bakar mempengaruhi daya mesin dan emisi gas buang yang dihasilkan. Daya mesin yang dihasilkan mengalami peningkatan seiring dengan bertambahnya variasi kadar carbon cleaner yang terdapat didalam bahan bakar. Penggunaan variasi konsentrasi cairan carbon cleaner 25 ml menghasilkan daya mesin tertinggi, serta emisi gas buang CO dan HC yang dihasilkan lebih rendah dibandingkan dengan bahan bakar pertamax murni, namun untuk daya mesin, dan emisi gas buang yang dihasilkan dari variasi konsentrasi cairan carbon cleaner 15 ml, 20 ml, dan 25 ml tidak berbeda jauh, hal tersebut dikarenakan perbedaaan jumlah konsentrasi carbon cleaner yang tidak terlalu banyak dan mendekati angka aturan pakai yang terdapat dalam kemasan produk, sehingga peningkatan kualitas daya bakar yang ditimbulkan sama.

Mengoptimalkan pemahaman

 

Hasilp enelitiayna ngd iperoleha dalah(:l ) prestashia silb elajars iswa kelompoke kiperimenle biht inggid aripadak elompokk ontroly angd itunjukkano leh rerataik or tes-kelompoekk sperimeyna ngl ebiht inggrd aripadak elompokk ontrol, yaknis ebesa1r7 ,06d an 13,69D. ari reratas kort esk eduak elompokte nebut lemudiand ilakukana nalisism enggunakaunji t untpkm engetahuaid at idaknya perbedaayna ngs igrifikant erhadapp restashi asilb elajars iswaa ntaratelg"pok itsperitnena ank ontrol.M elaluip erhitungadni perolehtm ,"'gs ebesa6r, 859y ang teUitUr esadr aripada1 65"1(2,39H)a. t ini menunjukkabna 6wap enggunaabna hana jar terpadua apamt engoptimalkapne matrama!9n8 "p selG 4vani! i:Y1J2l tingkat ;rrh;;" tonsei selG alvanisiswak elasI II IPA SMUN egeri6r ytaqnqte rgolong ii"ggr ff"f ini dituijukkano lehr ata-ratap ersentaspee mahamakne duak elompok sebes6a6r %.

Perencanaan pembangunan ekonomi sektoral sebagai upaya peningkatan pertumbuhan ekonomi di Kabupaten Malang / Fikri Hernanda Sudaryo

 

ABSTRAK Sudaryo, Fikri H. 2016. Perencanaan Pembangunan EkonomiSektoralSebagaiUpayaPeningkatanPertumbuhanEkonomi di Kabupaten Malang. Skripsi, ProgamStudi S1 Ekonomi Pembangunan, Jurusan EkonomiPembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Farida Rahmawati, S.E, M.E. (II) Dr. Imam Mukhlis. S.E, M.Si Kata Kunci: Sektor Unggulan, Perencanaan Pembangunan, Pertumbuhan Ekonomi. Kondisi ekonomi di Kabupaten Malang dalam kurun waktu 2010 hingga 2014 terus mengalami peningkatanPendapatanDomestik Regional Bruto (PDRB).Namun lajupertumbuhanperekonomianKabupaten Malang menujukkanpenurunan di tahun 2013. Penelitian ini dilakukan untuk mengetahui apakah pembangunanekonomitelahdidasarkankepadastrategiperencanaanpembangunan yang tepat. Kebijakan pembangunan pada setiap sektor ekonomi haruslah tepat dan dioptimalkan pada sektor yang memberikan manfaat pada sektor lainnya. Penelitian ini bertujuan untuk (1) mengetahuisektorekonomi yang unggulan di Kabupaten Malang (2) mengetahuibagaimanaperencanaanpembangunandenganpendekatansektoralmelalui di Kabupaten Malang. Model analisis yang digunakan dalam penelitian ini adalah Analisis Location Quotient, Analisis Shift Share, serta Analisis TipologiKlassen. Hasil dari penelitian ini berdasarkananalisis LQ memperlihatkan bahwa Kabupaten Malang memiliki sektor basis, yaitu : sektor Pertanian, Kehutanan, dan Perikanan, Industri Pengolahan; sektorKonstruksi; sektorPerdagangan Besar dan Eceran, Reparasi Mobil dan Sepeda Motor; serta sektor Jasa Lainnya. Sementaraitu, analisisShift Share (SS) menggunakankomponenDifferential Shift (D) menunjukkanadasepuluhsektor yang menunjukkannilai rata-rata D positif. KomponenPropotional Shift (P) menunjukkansepuluhsektor yang memilikinilai rata-rata positif. Hasilanalisisdarigabungankeduaalatanalisis LQ danShift Share menunjukkanadatigasektorunggulanyaitusektorsektor Pertanian, Kehutanan, dan Perikanan;sektorKonstruksi; serta sektor Jasa Lainnya. Dalammenyusunperencanaanpembangunan, pemerintahdaerahhendaknyamemprioritaskanpengembangansektor yang menjadi basis sertaberdayasaing. Serta program kebijakan yang dibuathendaknyamemperhatikan pula sektor yang masih non basis sehinggadapatmemilikikontribusi yang besardandapatmeningkatkanpertumbuhanekonomi di Kabupaten Malang.

Pengaruh persepsi nasabah tentang tingkat suku bunga. pemberian hadiah dan fasilitas bank terhadap loyalitas menabung nasabah pada PT bank Rakyat Indonesia (Persero) Tbk Unit Bentoel Malang Sutoyo / Wahyu Putra Rachmadi

 

ABSTRAK Putra, Wahyu. 2015. Pengaruh Persepsi Nasabah tentang Tingkat Suku Bunga, Pemberian Hadiah dan Fasilitas Bank terhadap Loyalitas Menabung Nasabah pada PT Bank Rakyat Indonesia (Persero) Tbk Unit Bentoel. Skripsi. Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang (UM). Pembimbing : (I) Dr. Agung Haryono, S.E., M.P., Ak (II) Drs. Prih Hardinto, M.Si Kata Kunci: Suku Bunga, Hadiah, Fasilitas, Loyalitas Menabung Pada era global seperti sekarang lembaga keuangan memliki peran yang penting untuk pembangunan ekonomi. Salah satu lembaga keuangan yang sangat penting dalam era pembangunan ekonomi adalah perbankan. Perbankan memiliki tanggung jawab yang besar untuk menghimpun dana dari masyarakat yang kelebihan dana dan menyalurkannya kepada masyarakat yang kekurangan dana. Dalam melaksanakan kegiatannya tersebut bank harus dapat bersaing dengan lembaga keuangan lainnya baik pemerintah atau swasta. Untuk menghadapi tantangan tersebut bank harus melakukan strategi yang baik untuk dapat mengoptimalkan produk-produknya. Dilatarbelakangi dari penjelasan diatas, penulis tertarik untuk mencoba melakukan penelitian terhadap loyalitas menabung nasabah Bank Rakyat Indonesia khususnya nasabah Bank Rakyat Indonesia Unit Bentoel, dimana sumber data yang digunakan dalam penelitian ini adalah data primer dengan metode kuesioner yang bertujuan untuk mengkaji pengaruh dari persepsi nasabah tentang suku bunga, hadiah dan fasilitas. Jenis penelitian ini adalah kuantitatif dengan sampel 98 nasabah dari 5000 nasabah. Hasil dari penelitian ini menunjukkan bahwa secara bersama-sama variabel suku bunga, hadiah dan fasilitas bepengaruh terhadap loyalitas menabung nasabah sedangkan secara parsial suku bunga berpengaruh terhadap loyalitas menabung nasabah, juga hadiah dan fasilitas berpengaruh terhadap loyalitas menabung nasabah. Untuk dapat meningkatkan penghimpunan dana nasabah maka pemberian hadiah dan fasilitas harus dilakukan secara optimal dan lebih baik lagi.

Studi pelaksanaan dan analisis biaya untuk pekerjaan plat pada proyek pembangunan laboraturium kimia Politeknik Negeri Malang / Benny Kurniawan

 

Kata kunci: studi, pelaksanaan, analisis, biaya, dan pelat Perkembangan industri konstruksi di Indonesia sudah mengalami kemajuan. Dalam bidang konstruksi, kita mengenal banyak konstruksi yaitu konstruksi beton, konstruksi baja dan konstruksi kayu. Pekerjaan konstruksi di Indonesia umumnya menggunakan konstruksi beton bertulang, dan kebanyakan material yang digunakan dalam pekerjaan pembangunan rumah, gedung dan tempat hunian lainnya adalah konstruksi beton bertulang. Pelat merupakan salah satu elemen struktur bangunan yang berfungsi menambah kekuatan pada arah horizontal dan untuk menahan beban yang ada diatasnya. Kegagalan pelaksanaannya akan berakibat langsung pada runtuhnya stuktrur lain yang berhubungan dengannya. Maka dari itu dalam mendirikan bangunan memerlukan pelaksanaanyang cermat Studi lapangan ini bertujuan untuk: (1)Mengetahui pelaksanaan pelatProyek Pembangunan Laboratorium Kimia Politeknik Negeri Malang, dan (2) untuk mengetahui perbedaan analisa biaya untuk pekerjaan pelat pada Proyek Pembangunan Laboratorium Kimia Politeknik Negeri Malang, bila menggunakan standart perhitungan analisa biaya pada BOW (Burgerlijke Openbare Werken) dan Standart Nasional Indonesia (SNI 03-2835-2002). Studi lapangan pelaksanaan balok dan pelat dilaksanakan pada Proyek Pembangunan Laboratorium Kimia Politeknik Negeri Malang. Teknik yang digunakan dalam pengumpulan data pada studi lapangan ini adalah: (1) observasi lapangan, (2)wawancara/interview, dan (3) dokumentasi. Setelah semua data terkumpul, kemudian dianalisa dan selanjutnya dideskripsikan. Hasil studi ini menunjukkan bahwa terdapat beberapa ketidaksesuaian pelaksanaan pelat beton bertulang dari segi pelaksanaan. Pada pelaksanaan pekerjaan penulangan plat lantai, pembengkokan tulangannya tidak sesui dengan RKS di lapangan. Untuk analisa biaya terdapat selisih antara yang ada pada Rencana Anggaran Biaya proyek dengan Analisa Biaya Pelaksanaan. Hasilnya biaya pelaksanaan lebih besar dari pada biaya perencanaan. Berdasarkan studi ini disarankan dalam pelaksanaan pelat dilaksanakan dengan memperhatikan ketentuan dalam kajian teori yang ada, sehingga tidak terjadi kesalahan atau penyimpangan dalam pelaksanaan proyek. Pada akhirnya dapat mencapai kualitas beton yang baik. Begitu juga dengan penggunaan biayanya, sehingga pelaksanaan proyek dapat mencapai kualitas beton yang baik dengan biaya yang efisien.

Implementasi penilaian autentik kurikulum 2013 mata pelajaran ekonomi SMAN 1 Mojosari Mojokerto / Elok Gita Yuliastuti

 

ABSTRAK Yuliastuti, Elok Gita. 2016. Implementasi Penilaian Autentik Kurikulum 2013 pada Mata Pelajaran Ekonomi SMAN 1 Mojosari, Mojokerto. Skripsi. Jurusan Ekonomi Pembangunan. Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing (1) Dr. Hj. Lisa Rokhmani, M.Si (2) Drs.H. Achmad Ali Wafa, M.Pd Kata Kunci: Penilaian, Penilaian Autentik, Kurikulum 2013, Mata Pelajaran Ekonomi Dalam penerapan kurikulum 2013, penilaian autentik amatlah penting dalam mengetahui keberhasilan proses dan hasil belajar. penilaian autentik adalah bentuk penilaian yang menghendaki peserta didik menampilkan sikap, menggunakan pengetahuan dan keterampilan yang diperoleh dari pembelajaran dalam melakukan tugas pada situasi yang sesungguhnya. Penilaian autentik mengukur tingkat kemampuan siswa yang diukur melalui penilaian pengetahuan, penilaian sikap dan penilaian keterampilan. Penilaian dilakukan agar mengetahui seberapa otentikkah kemampuan siswa yang terdeteksi baik sikap, pemgetahuan maupun keterampilan.SMAN 1 Mojosari dipilih sebagai tempat penelitian, karena SMAN 1 Mojosari telah menerapkan penilaian autentik kurikulum 2013. Mata pelajaran ekonomi di SMAN 1 Mojosari telah menerapkan penilaian autentik berdasarkan kurikulum 2013, sehingga perlu dilihat apakah implementasi penilaian autentik yang dilaksanakan di SMAN 1 Mojosari telah maksimal dan sesuai dengan pedoman penilaian kurikulum 2013. Untuk itu, perlu diketahui bagaimana perencanaan penilaian autentik pada mata pelajaran ekonomi, pelaksanaan penilaian autentik pada mata pelajaran ekonomi serta faktor- faktor kendala penilaian autentik kurikulum 2013 pada mata pelajaran ekonomi di SMAN 1 Mojosari, Mojokerto. Jenis penelitian ini adalah penelitian deskriptif kualitatif. Data penelitian berupa data primer dengan menggunakan teknik wawancara, dokumentasi serta observasi. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri. Berdasarkan hasil penelitian, perencanaan penilaian autentik kurikulum 2013 di SMAN 1 Mojosari dianggap sesuai dengan ciri-ciri penilaian autentik. Sedangkan, pelaksanaan penilaian autentik sesuai dengan tuntutan Kompetensi Inti yang terdiri atas penilaian kompetensi sikap, penilaian kompetensi pengetahuan serta penilaian kompetensi keterampilan. Sedangkan penelitian ini menemukan beberapa kendala baik dari eksternal maupun internal. Namun, tidak semua kendala tersebut diatasi oleh guru. Perlu perbaikan sistem yang dapat menyempurnakan penilaian autentik berdasarkan kurikulum 2013.

Penerapan model pembelajaran Numbered Head Together (NHT) untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran perencanaan pemasaran (studi pada siswa kelas X Jurusan Pemasaran SMK PGRI 2 Malang) / M. Rizki Perdana Putra

 

ABSTRAK Putra, M. Rizki Perdana. 2015. Penerapan Model Pembelajaran Numbered Head Together (NHT) Untuk Meningkatkan Aktivitas Dan Hasil Belajar Siswa Pada Mata Pelajaran Perencanaan Pemasaran. (Studi Pada Siswa Kelas X Jurusan Pemasaran SMK PGRI 2 Malang). Skripsi, Jurusan Manajemen, Program Studi S-1pendidikan Tata Niaga, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. Djoko Dwi Kusumajanto, M.Si, (II) Drs. Mohammad Hari, M.Si Kata Kunci: Numbered Head Together (NHT), Aktivitas, Hasil Belajar. Model pembelajaran Numbered Head Together (NHT) adalah struktur yang melibatkan lebih banyak siswa dalam menelaah materi yang tercakup dalam suatu pelajaran dengan pembentukan kelompok-kelompok kecil. Penerapan model pembelajaran Numbered Head Together (NHT) ini dilaksanakan dalam dua siklus dengan empat kali pertemuan.Jenis penelitian ini adalah penelitian kualitatif. Tujuan dari penelitian ini adalah (1) untuk mengetahui penerapan model pembelajaran Numbered Head Together (NHT), (2) untuk mengetahui aktivitas belajar dan (3) untuk mengetahui tingkat hasil belajar siswa pada model pembelajaran Numbered Head Together (NHT) pada Mata Pelajaran Perencanaan Pemasaran siswa kelas X SMK PGRI 2 Malang (4) untuk mengetahui kendala-kendala dari penerapan model pembelajaran Numbered Head Together (NHT). Metode penelitian yang digunakan dalam penelitian ini adalah dengan pendekatan kualitatif dan jenis penelitian tindakan kelas (PTK) Dari hasil penelitian menunjukkan bahwa (1) penerapan model pembelajaran NHT Numbered Head Together (NHT) sudah berjalan dengan baik, siswa antusias dalam kegiatan diskusi dan siswa dapat mengungkapkan pendapat dengan baik walaupun pendapat siswa terkadang kurang sesuai dengan materi yang dibahas, (2) hasil nilai aktivitas belajar siswa mengalami peningkatan dari siklus I 74,38% meningkat di siklus II menjadi 87,19%. (3) hasil belajar siswa mengalami peningkatan dari siklus I rata-rata kelas sebelum tindakan 62,57% dengan ketuntasan klasikal 30,30% sesudah di beri tindakan rata-rata kelas menjadi 79,24 dengan ketuntasan klasikal 78,78% pada siklus II mengalami peningkatan sebelum di beri tindakan rata-rata sebesar 62,72% dengan ketuntasan klasikal 36,36% setelah diberi tindakan menjadi, rata-rata 83,78 dengan ketuntasan klasikal 87,87%. (4) pada siklus I siswa masih kesulitan dalam menerima model Numbered Head Together (NHT), kurang terampilnya guru dalam mengelolah kelas. Berdasarkan penelitian yang telah dilakukan, saran yang diberikan oleh peneliti adalah 1) guru harus mulai membiasakan menerapkan model pembelajaran kooperatif agar siswa dapat menyesuaikan dengan model pembelajaran. 2) dalam pengelolaan pembelajaran di kelas guru harus selalu memberi arahan dan motivasi kepada siswa agar siswa lebih tertarik dalam mengikuti proses pembelajaran. 3) guru harus lebih terampil dalam mengelola dan mengkondisikan kelas agar siswa dapat mengikuti rangkaian proses pembelajaran dikelas dengan baik. 4) penguasaan materi harus lebih diperhatikan agar tidak terjadi mis komunikasi dengan siswa saat proses pembelajaran. .

Hubungan antara need of counteraction dengan kesehatan mental pada warga binaan pemsyarakatan menjelang bebas di Lembaga Pemasyarakatan Wanita Kelasa II A Malang / Indah Rahmita

 

ABSTRAK Rahmita, Indah. 2016. Hubungan Antara Need of CounteractionDengan Kesehatan Mental Pada Warga Binaan Pemasyarakatan Menjelang Bebas Di Lembaga Pemasyarakatan Wanita Klas II A Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (I) Dra. Sri Weni Utami, M.Si, (II) Pravissi Shanti, S.Psi., M. Psi. Kata Kunci :kesehatan mental, need of counteraction, warga binaan pemasyarakatan menjelang bebas Kesehatan mental adalah kondisi individu yang memiliki pengetahuan dan perbuatan untuk mencapai dan memelihara kesejahteraan psikologis, mencegah gangguan mental, serta ketidakmampuan menyesuaikan diri. Need of counteraction merupakan kebutuhan individu untuk memperbaiki kegagalan dengan berusaha kembali, menghilangkan penghinaan, mengatasi ketidakmampuan, menekan rasa takut, mengembalikan nama baik, dan mempertahankan harga diri. Tujuan penelitian ini adalah (1)mengetahui kesehatan mental yang dimiliki warga binaan pemasyarakatan menjelang bebas di Lembaga Pemasyarakatan Wanita Klas II A Malang(2) mengetahui need of counteraction yang dimiliki warga binaan pemasyarakatan menjelang bebas di Lembaga Pemasyarakatan Wanita Klas II A Malang (3) mengetahui hubungan antara need of counteractiondengan kesehatan mental pada warga binaan pemasyarakatan menjelang bebas di Lembaga Pemasyarakatan Wanita Klas II A Malang. Penelitian ini merupakan penelitian kuantitatif dengan metode korelasional, dengan jumlah subjek penelitian 57 warga binaan pemasyarakatan menjelang bebas. Instrumen penelitian adalahskala kesehatan mentaldan skala need of counteraction.Skala kesehatan mental diperoleh 61 aitem valid dengan reliabilitas sebesar 0,944.Skala need of counteraction diperoleh 39 aitem valid dengan reliabilitas sebesar 0,882. Analisis deskriptif dengan pengkategorian berdasar skor T, sedangkan data penelitian menggunakan teknik korelasi Pearson Product Moment. Hasil penelitian ini menunjukkan warga binaan pemasyarakatan menjelang bebas (1) sebanyak 58% memiliki kesehatan mentalyang rendah(2)sebanyak 54% memilikineed of counteractionyang rendah(3) terdapat hubungan positif antara need of counteractiondengan kesehatan mental dengan nilai korelasi 0,702 dan nilai signifikansi sebesar 0,000.Hal ini menunjukkan semakin rendah need of counteraction maka semakin rendah pula kesehatan mental pada warga binaan pemasyarakatan menjelang bebas. Saran yang dapat diberikan dari penelitian ini adalah (1) bagi warga binaan pemasyarakatan menjelang bebas: aktif mengikuti kegiatan keterampilan di dalam lapas serta melakukan interaksi yang sehat dengan warga binaan pemasyarakatan yang lain dan petugas lapas (2) bagi Lembaga Pemasyarakatan Wanita Klas II A Malang: melakukan konselling bagi warga binaan pemasyarakatan menjelang bebas serta mengikutkan untuk membantu pekerjaan di kantor lapas (3) bagi peneliti selanjutnya: mengkaji lebih dalam mengenai faktor-faktor lain, seperti faktor sosial budaya yang dapat meningkatkan kesehatan mental pada warga binaan pemasyarakatan menjelang bebas.

Pengaruh latihan kekuatan lengan dengan menggunakan alat bantu hand paddle terhadap kecepatan renang 50 meter gaya dada pada atlet Junior Tiger, AC tahun 2016

 

ABSTRAK Sofa, Lailatus. 2016. Pengaruh Latihan Kekuatan Lengan Dengan Menggunakan Alat Bantu Hand Paddle Terhadap Kecepatan Renang 50 meter Gaya Dada Pada Atlet Tiger, Ac Tahun 2016. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Drs. Tatok Sugiarto, S.Pd, M.Pd, (II) Usman Wahyudi, S.Pd, M.Pd. Kata kunci: Kekuatan Lengan, Hand Paddle, Latihan Konvensional, Kecepatan Renang 50 meter, Gaya Dada. Pada umumnya pelatihan di Perkumpulan Tiger, AC ini masih konvensional atau masih tradisional tetapi ada juga yang sudah menggunakan alat bantu termasuk hand paddle, namun pada umumnya alat bantu hand paddle ini masih dikenakan pada gaya-gaya tertentu termasuk lebih banyak pada renang gaya bebas sedangkan renang gaya dada nyaris tidak diberikan, sehingga dengan memanfaatkan teknologi hand paddle itu maka akan menambah daya kekuatan lengan yang pada akhirnya akan menambah kecepatan pada renang gaya dada. Dengan penelitian ini hand paddle digunakan untuk latihan renang gaya dada yang tujuan akhirnya menambah kecepatan pada renang 50 meter gaya dada. Tujuan penelitian ini adalah untuk mengetahui pengaruh latihan kekuatan lengan menggunakan alat bantu hand paddle terhadap kecepatan renang 50 meter gaya dada pada atlet junior Tiger, Ac. Rancangan penelitian menggunakan bentuk matching pretest-posttest control group design, pengambilan sampel penelitian ini dilakukan dengan membagi kelompok menjadi 2 kelompok, masing-masing kelompok terdiri dari 15 atlet, menggunakan “teknik ordinal pairing matching”. Teknik pengumpulan data berbentuk tes yang dilakukan di awal pelaksanakaan perlakuan yaitu tes awal/pretest renang 50 meter gaya dada. Setelah tes awal kemudian diberi perlakuan selama 6 minggu dengan 3 kali pertemuan setiap minggu, selasa dan kamis, akhir perlakuan dilaksanakan tes akhir/posttest renang 50 meter gaya dada. Sebelum dilakukan pengujian hipotesis dengan analisis varians satu jalur (Anova) terlebih dahulu dilakukan data uji persyaratan analisis berupa: uji normalitas dan uji homogenitas. Dari hasil penelitian pengujian hipotesis skor kecepatan renang 50 meter gaya dada masing-masing kelompok latihan, diperoleh harga F_hitung 9,11 > F_tabel taraf signifikansi α = 0,05 = 4,67. Dengan demikian dapat disimpulkan bahwa terdapat pengaruh yang signifikan antara kelompok latihan hand paddle dengan latihan konvensional terhadap kecepatan renang 50 meter gaya dada. Kesimpulan pada hasil penelitian ini yaitu ada perbedaan pengaruh antara penggunaan alat bantu hand paddle dengan latihan konvensional terhadap kecepatan berenang 50 meter gaya dada. Diharapkan dalam usaha meningkatkan hasil renang gaya dada terutama untuk kecepatan dianjurkan untuk menggunakan program latihan kekuatan lengan yang salah satunya dengan menggunakan alat bantu hand paddle.

Penerapan model pembelajaran kooperatif tipe Student Teams Achievement Divisio (STAD) untuk meninbgkatkan hasil belajar siswa kelas X APK 4 di SMKN 2 Kediri (studi pada standar kompetensi mengelola peretemuanrapat) / Irfa Ridha Khoirun Nisak

 

ABSTRAK Nisak, Irfa R.K. 2016. Penerapan Model Pembelajaran Kooperatif Tipe Student Teams Achievment Division (STAD) untuk Meningkatkan Hasil Belajar Siswa Kelas X APK 4 di SMKN 2 Kediri (Studi pada Standar Kompetensi Mengelola Pertemuan/Rapat). Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dra. Hj. Wasiti S.Sos., M.Si., (II) Dr. Wahju Wibowo, A.Md., S.E., M.Si. Kata Kunci: Student Teams Achievment Division (STAD), hasil belajar. Kurangnya antusias siswa dalam mengikuti pembelajaran Standar Kompetensi Mengelola Pertemuan/Rapat, mengakibatkan siswa kelas X APK 4 di SMKN 2 Kediri rendah pengetahuannya tentang Standar Kompetensi tersebut, sehingga hasil belajar yang diperoleh sangat rendah. Hal ini dikarenakan metode yang dipakai oleh guru Standar Kompetensi Mengelola Pertemuan/Rapat menggunakan konvensional. Oleh karena itu diterapkannya Model Pembelajaran Kooperatif tipe Student Teams Achievment Division (STAD) guna memperbaiki proses pembelajaran kelas X APK 4 yang dapat meningkatkan hasil belajar siswa. Subjek pada penelitian ini adalah siswa kelas X APK 4 berjumlah 35 siswa. Penelitian dilaksanakan selama 2 siklus. Setiap siklus terdiri dari 4 tahap kegiatan, yaitu perencanaan, pelaksanaan, pengamatan dan refleksi. Teknik pengumpulan data menggunakan teknik observasi, catatan lapangan, tes, wawancara dan dokumentasi. Analisis data menggunakan analisis interaktif, yakni reduksi, penyajian data dan penarikan kesimpulan. Hasil penelitian menunjukkan bahwa Penerapan Model Pembelajaran kooperatif tipe Student Teams Achievment Division (STAD) dapat meningkatkan hasil belajar siswa. Persentase ketuntasan hasil belajar siswa yang diperoleh pada ranah kognitif setelah mengikuti post test siklus 1 adalah 85,71% dan meningkat pada siklus 2 sebesar 94,28%, sedangkan pada ranah afektif siklus 1 diperoleh 80,00% dan meningkat pada siklus 2 menjadi 94,28% dan hasil psikomotorik siswa diperoleh 85,71% pada siklus 1, mengalami peningkatan pada siklus 2 menjadi 94,28%. Penerapan model juga berjalan baik, yaitu kegiatan guru dan siswa meningkat pada setiap siklusnya. Ketepatan guru dalam menerapkan model pembelajaran STAD memperoleh persentase 94,60% di siklus 1 dan meningkat menjadi 99,10% di siklus 2, sedangkan aktivitas siswa pada siklus 1 yaitu sebesar diperoleh 91,60% meningkat di siklus 2 menjadi 94,50%. Kesimpulan pada penelitian ini adalah penerapan model pembelajaran kooperatif tipe Student Teams Achievment Division (STAD) berjalan dengan baik dan dapat meningkatkan hasil belajar siswa kelas X APK 4 SMKN 2 Kediri pada Kompetensi Dasar Menyelenggarakan Pertemuan/Rapat. Saran yang dapat diberikan pada penelitian ini adalah diharapkan guru dapat menerapkan model pembelajaran ini sebaik mungkin agar siswa menjadi lebih aktif dalam proses pembelajaran sehingga mendapat hasil belajar yang memuaskan, bagi siswa hendaknya belajar dengan mandiri melalui kerja sama kelompok untuk memahami materi dan mengerjakan tugas dari guru dan bagi peneliti selanjutnya dapat mengembangkan model pembelajaran kooperatif ini pada SK yang lain.

Perbedaan pengaruh gaya mengajar reciprocal dengan gaya mengajar self check terhadap motivasi peserta didik pada pembelajaran pendidikan jasmani di kelas XI MAN Kota Batu / Alwin Hardiantomy

 

ABSTRAK Hardiantomy, Alwin. 2016. Perbedaan Pengaruh Gaya Mengajar Reciprocal dengan Gaya Mengajar Self Check terhadap Motivasi Peserta Didik pada Pembelajaran Pendidikan Jasmani di Kelas XI MAN Kota Batu. Skripsi. Jurusan Pendidikan Jasmani dan Kesehatan FIK Universitas Negeri Malang. Pembimbing (I) Dr. Asim, M.Pd Pembimbing, (II) Fahrial Amiq, S.Or M.Pd Kata Kunci: gaya mengajar reciprocal, gaya mengajar self check, motivasi, pembelajaran. Pembelajaran yang memiliki motivasi tinggi ditunjang dengan pengajar yang mampu memfasilitasi motivasi tersebut akan membawa pada keberhasilan pencapaian target belajar. Pembelajaran pendidikan jasmani adalah memberi kesempatan kepada peserta didik untuk terlibat dalam memberi peran lebih dalam pembelajaran secara optimal, dengan mengurangi perilaku yang menyimpang oleh guru dan peserta didik. Kegiatan pembelajaran bervariasi yang tidak akan membuat peserta didik jenuh dalam menerima pembelajaran dari guru dan akan membuat peserta didik menjadi termotivasi dalam kegiatan pembelajaran yang menyenangkan. Tujuan penelitian ini untuk mengetahui dan mengkaji perbedaan pengaruh gaya mengajar reciprocal dan gaya mengajar self check terhadap motivasi peserta didik pada pembelajaran pendidikan jasmani di kelas XI MAN Kota Batu. Metode penelitian ini yang digunakan dalam penelitian ini adalah metode eksperimen semu dengan variabel bebas yang dimanipulasikan adalah gaya mengajar reciprocal dan gaya mengajar self check, sedangkan untuk variabel terikatnya adalah motivasi peserta didik. Model penelitian ini didesain dengan rancangan pretest dan posttest dengan uji persyaratan analisis uji normalitas yang dikenal dengan uji one sample kolmogrov-smirnov dengan uji homogenitas menggunakan uji levene’s signifikansi α = 0.05, dilanjutkan dengan uji hipotesis menggunakan uji analisis satu jalur (one way anova). Dari hasil data yang diperoleh gaya mengajar reciprocal berdasarkan hasil signifikasi (α) > dari 0,05 (0,990 > 0,05), sedangkan hasil data yang diperoleh gaya mengajar self check mempunyai hasil signifikasi (α) > dari 0,05 (0,418 > 0,05). Jadi dapat disimpulkan tidak ada perbedaan terhadap motivasi awal dan akhir pada kelompok pembelajaran reciprocal dan self check. Hasil uji hipotesis menggunakan one way anova menunjukkan bahwa motivasi akhir pada kelompok pembelajaran reciprocal dan self check mempunyai Sig 0.354. Berdasarkan hasil signifikasi (α) > dari 0,05 (0,354 > 0,05). Jadi dapat disimpulkan tidak ada perbedaan terhadap motivasi akhir pada kelompok pembelajaran reciprocal dan self check terhadap pembelajaran pendidikan jasmani. Dengan melihat hasil dari data yang diperoleh gaya mengajar reciprocal dan self check tidak ada perbedaan pengaruh terhadap motivasi peserta didik, maka dapat disarankan guru untuk lebih memaksimalkan perannya dalam meningkatkan motivasi peserta didik terhadap pembelajaran pendidikan jasmani.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |