Pengembangan Lembar Kerja Siswa (LKS) dalam pembelajaran IPA model learning cycle 5E untuk SMP kelas VII / Lailatul Afiyah

 

ABSTRAK Afiyah, Lailatul. 2016.Pengembangan Lembar Kerja Siswa (LKS) dalam Pembelajaran IPA Model Learning Cycle 5E untuk SMP Kelas VII. Skripsi, Program Studi Pendidikan Ilmu Pengetahuan Alam, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (I) Sugiyanto, S.Pd, M.Si (II) Erni Yulianti, S.Pd, M.Pd. Kata Kunci: Pengembangan, Lembar Kerja Siswa (LKS), Learning Cycle 5E. Pelaksanaan pembelajaran akan lebih efektif apabila ditunjang dengan adanya bahan ajar yang sesuai. Berdasarkan hasil observasi diketahui bahwa bahan ajar yang banyak digunakan di sekolah berupa Lembar Kerja Siswa (LKS), tetapi LKS tersebut belum sesuai dengan apa yang dibutuhkan siswa. Salah satu permasalahan yang terjadi adalah guru melakukanpembelajaran dengan menggunakan model Learning Cycle 5E tetapi LKS yang digunakan tidak sesuai dengan model pembelajaran tersebut. Dengan demikian LKS kurang bisa memandu siswa dalam melakukan pembelajaran. Oleh karena itu perlu dilakukan penelitian pengembangan bahan ajar berupa LKS yang mampu memberi solusi untuk permasalahan tersebut. Tujuan dari penelitian pengembangan ini adalah untuk menghasilkan LKS dalam pembelajaran IPA model Learning Cycle 5Euntuk SMP kelas VII layak. Penelitian pengembangan ini menggunakan model Thiagarajan yang terdiri dari empat tahapan yang dikenal dengan model 4-D (four D Model). Keempat tahap tersebut adalah tahap pendefinisian (define), tahap perancangan (design), tahap pengembangan (develop) dan tahap penyebaran (disseminate). Penelitian pengembangan ini hanya melaksanakan tahapan 1-3 saja. Produk hasil pengembangan diuji coba melalui proses validasi dan uji keterbacaan terbatas. Validasi dilakukan oleh 1 dosen IPA, sedangkan uji keterbacaan terbatas dilakukan oleh 1 guru IPA SMP dan 10 siswa SMP kelas VII. Instrumen pengumpulan data berupa angket dengan skala Likert serta lembar komentar dan saran. Jenis data yang diperoleh adalah data kualitatif dan kuantitatif. Teknik analisa data yang digunakan adalah dengan menghitung nilai rata-rata. Berdasarkan hasil validasi kelayakan umum diperoleh nilai sebesar 3,95 dengan kriteria sangat layak, hasil validasi kelayakan khusus diperoleh nilai sebesar 4,00 dengan kriteria sangat layak, hasil uji keterbacaan terbatas oleh guru diperoleh nilai sebesar 3,90 dengan kriteria sangat layak, dan uji keterbacaan terbatas oleh siswa diperoleh nilai sebesar 3,92 dengan kriteria sangat layak. Dengan demikian, LKS yang dikembangkan sudah layak untuk digunakan dalam pembelajaran.

Pembinaan mental santri penyandang penyakit sosial di Pesantren Tanfirul Chowayah Kecamatan Kanigaran Kota Probolinggo / Tri Hayyu Muhaimin

 

Pemurnian dan penetapan struktur senyawa "1,3-Dihidroksi-2-(4-Piridil)-4,5-Dimetilmidazolina (DPyDlm)"hasil sintesis / oleh Hindrawati

 

PH optimum pada biosorpsi ion logam Cr(VI) oleh ragi roti dan pengaruh perlakuan awal NaOH terhadap kapasitas biosorpsinya / oleh Baskoro

 

Kajian struktural semiotik terhadap novel Arab modern Qalb Ridwan, Nur Anisah

 

Isolasi, karakterisasi, dan identifikasi jenis karagenan fraksi larut dalam KCl 2,5% pada alga merah Eucheuma Cottoni dari perairan Talango Sumenep Madura / oleh Afriliza Linda Hidayati

 

Kajian tingkat pengetahuan dan sikap siswa Madrasah Aliyah Al Ma'arif Singosari tentang teori evolusi / oleh Siti Samsiyah

 

Pengaruh diversifikasi produk terhadap omzet penjualan pada Baker's Delight Matahari Supermarket Madiun / oleh Erna Tri Oktanti

 

Peranan koperasi sekolah sebagai sarana pendidikan dalam upaya upaya melatih kemampuan entrepreneurship siswa di SMP Negeri 5 Malang / Horas Daniel Victor Siagian

 

Kata Kunci : Koperasi Sekolah, Kemampuan Enterpreneurship Siswa SMPN 5 Malang sebagai sekolah yang bertujuan untuk meningkatkan ketrampilan dan melakukan peningkatan pembelajaran melalui pengadaan sarana pendidikan. Ilmu pengetahuan sosial sebagai bagian dari pembelajaran sekolah dapat ditingkatkan melalui koperasi sekolah. Di lingkungan sekolah, koperasi memegang peranan penting dalam upaya terwujudnya kemandirian bagi warga sekolah umumnya dan siswa khususnya. Keberadaan koperasi sekolah dibutuhkan untuk melatih, mendidik, dan mempertajam kemampuan kewirausahaan siswa. Tapi permasalahannya masih banyak pendidikan formal yang memandang koperasi sekolah hanya merupakan bagian pelengkap dari keberadaan sebuah lembaga pendidikan. Pengelolaannya pun kadang masih belum profesional dan terlihat seadanya. Penelitian ini berupa penelitian deskriptif kualitatif untuk mengetahui peranan koperasi sekolah sebagai sarana pendidikan dalam upaya melatih kemampuan entrepreneurship siswa. Sumber data dalam penelitian ini adalah: (1) Kepala Sekolah SMP Negeri 5 Malang, (2) Guru Mata Pelajaran IPS, (3) Guru Pembina Koperasi, dan (4) Siswa SMP Negeri 5 Malang Tahun 2010. Prosedur pengumpulan data meliputi: (1) metode dokumentasi; (2) wawancara/interview; (3) metode kuesioner. Data yang diperoleh dari ketiga teknik tersebut dianalisis guna menyusun temuan lapangan. Analisis data yang digunakan dalam penelitian ini adalah: (1) Data Reduction (Reduksi Data); (2) Data Display (Penyajian Data); (3) Conclusion Drawing/Verifikasi. Keabsahan data diuji dengan (1) perpanjangan keikut sertaan; (2) ketekunan/keajegan pengamatan; (3) teknik triangulasi. Berdasarkan paparan data dan temuan penelitian diketahui bahwa: (1) Perkembangan koperasi sekolah di SMPN 5 Malang cukup baik, baik dari segi sumber daya manusia maupun pengelolaan sarana dan prasarana. Pengelolaan dan perencanaannya terangkum dalam program nyata dalam bidang organisasi usaha yang tertulis dalam rencana kerja pengurus tahun 2010. (2) Banyak manfaat yang diperoleh siswa dengan berpartisipasi dalam kegiatan organisasi koperasi maupun kegiatan usaha koperasi sekolah. Manfaat itu dapat berupa ketrampilan-ketrampilan dalam wirausaha maupun manfaat dalam proses pengembangan kepribadian siswa seperti: mencatat, membukukan, melayani pelanggan, menerima barang, mengelola barang serta berbagai aktifitas transaksi lainnya. (3) Koperasi sekolah memiliki peranan yang penting dalam pengoptimalan potensi-potensi yang dimiliki oleh siswa, antara lain: wadah pengembangan potensi wirausaha siswa, sebagai laboratorium praktek siswa dalam pengimplementasi teori pembelajaran yang disampaikan dalam proses kegiatan belajar mengajar, sebagai tempat untuk pengembangan kepribadian siswa. Dari paparan data dan temuan penelitian dapat diberikan saran bahwa: (1) Koperasi sebagai tempat pendidikan praktek lapangan berkoperasi dan berwirausaha bagi siswa hendaknya lebih ditingkatkan fungsi dan peranannya sebagaimana koperasi. (2) Bagi perkembangan usaha koperasi sekolah, hendaknya lebih ditingkatkan lagi sarana dan pra sarana koperasi serta variasi usahanya. (3) Hendaknya program-program yang dapat menumbuhkan jiwa entrepreneurship siswa, seperti mengikut sertakan penataran yang diselenggarakan Dekopinda serta pelatihan kewirausahaan sebaiknya segera dilaksanakan agar sesuai dengan visi yang diusung yaitu mendorong terciptanya dunia kewirausahaan bagi siswa. (4) Bagi siswa diharapkan koperasi tidak asing lagi, karena dalam kehidupan sehari-hari melalui praktek pengalaman dalam memahami, menghayati dan mengamalkan nilai-nilai koperasi terwujud nyata bagi siswa. Siswa juga mendapatkan pendidikan yang berbobot dari sekolah, meningkatkan mutu kader pembangunan, dan memudahkan mereka untuk memasuki dunia kerja.

Hubungan antara kerajinan mengerjakan pekerjaan rumah mata pelajaran matematika dengan prestasi belajar mata pelajaran matematika siswa kelas V SDN Mulyorejo I Kecamatan Sukun Kota Malang / oleh Sutami

 

Pelaksanaan pembelajaran konsep pecahan dengan menggunakan bahan manipulatif bidang studi matematika kelas III SDN Ciptomulyo III No. 132 Kecamatan Sukun Kota Malang tahun pelajaran 2003 - 2004 semester II / oleh Anyar Intiyasasih

 

Teacher talk produced by the PKG English language teachers of senior secondary schools / by Clarry Sada

 

Pendapatan siswa tentang penggunaan operasi hitung dalam mata pelajaran matematika kelas III SD Negeri Bunulrejo VII Kecamatan Blimbing Kota Malang / oleh Menik Endrawati

 

Pengajaranm atematikad i kelas III SekolahD asar,t erutamad iarahkana gar siswam emiliki pengetahuand an keterampiland alam berhitungm elalui kegratan praktisy ang dilakukan sendiri oleh siswa. Programp engajaranm engenaip okok bahasan penggunaan operasi hitung merupakan bahan kajian inti mata pelajaran matematika pada siswa kelas III Sekolah Dasar dengan materi mencakup: penjumlahanp, enguranganp, embagian,p erkalian, dan hitung campuran.H al itulah yangm elatarbelakandgil aksanakannypae nelitianin i. Fokus masalahp enelitian ini diarahkanp ada: 1) Bagaimanakahp emahaman siswat entangp enggunaano perasih itung dalamm atematika?2; ) Bagaimanakahs ikap siswa dalam aktivitas belajar penggunaan operasi hitung dalam matematika?; 3) Bagaimanakakhe terampilans iswad alamp rosesb elajarp enggunarlonp erasih itung dalam matematika?; dan 4) Bagaimanakah upaya siswa menyelesaikan kesulitan prosesb elajarp enggunaano perasih itung dalamm atematika? Penelitianin i menggunakarna ncangapne nelitiand eskriptif.S ubyekp enelitian adalahp aras iswak elasI II SekolahD asarN egeriB unulrejoV II KecamatanB limbing Kota Malang. Jumlah subyek penelitian adalah sebanyak 39 orang siswa. Pengumpulan data menggunakan instrumen angket (kuesioner). Analisa data menggunakanp endekatanp ersentase(% ). Hasil penelitians ebagabi erikut: (l) Pemahamansi swat entangp enggunaan operasi hitung dalam matematika bahwa dari 39 orang siswa terdapat 20 orang siswa sangatm emahamip enggunaano perasih itung mengenaip enjumlahanp, engurangan, pembagian, perkalian dan hitung campuftn. Berikutnya 16 orang siswa relatif cukup memahami penggunaan operasi hitung. Sedangkan 2 orang siswa agak sulit memahamip enggunaano perasih itung terutamam engenaip embagiarLp erkaliand an hitung campuran. Bahkan terdapat I orang siswa sangat sulit dalam penggunaan operasi hitung terutama mengenai hitung campuran. (2) Sikap siswa dalam aktivitas belajar penggunaano perasih itung dalam matematikate rungkapb ahwa 17 orang siswa sangat sering menaruh perhatian dan minat serta muncul rasa keingintahuan untuk belajarp enggunaano perasih itung. Selaini tu sangats eringm elakukana ktivitas belajar sendiri maupun dengan kelompok antar siswa, begitujuga dalam pelaksanaan tugas-tugasy ang diberikano leh guru sangats ering dikerjakannyaB. erikutnya 14 orangs iswar elatifsering melakukanh al tersebutS. edangkatne rdapa6t orangs iswa kadang-kadang saja melakukannya. Bahkan 2 orang siswa tidak pemah menaruh l l l perhatiadna n minat sertat idak muncul rasak eingintahuanu ntuk belajarb erhitung. Begitu juga tidak pemah melakukan aktivitas belajar sendiri maupun dalam kelompok antar siswa. (3) Mengenai keterampilan siswa dalam proses belajar p€nggunaaonp erasih itung dalamm atematikat,e rnyata6 orangs iswas angats ering menggunakaanla t bantub elajar,m enggunakapnr insip dasarb erhitung,m elakukan kegiatanb erhitungs ecarac epat dan tepat/benarm, engerjakans oal-soalb erhitung tanpam elihatc ontoh.B erikutnyay angm enyatakanre latif seringm elakukank egiatan tersebutte rdapatI I orangs iswa.B erikutnya1 1 orangs iswah anyak adang-kadang sajam elakukannyaB.a hkanI I orangs iswal ainnyat idak pernahm elakukannya(4. ) Upayas iswa menyelesaikank esulitan belajar penggunaano perasi hitung dalam matematikdaa patd iungkapkanb ahwa1 4 orangs iswas angast eringm elakukanu paya menyelesaikakne sulitanb elajarb erhitung,d iantaranyas epertib ertanyap ada guru, belajar kelompok antar siswa, membaca buku paket matematika kelas III, memperhatikapne njelasand ari guru denganb aik dan upayal atihan menge{akan soal-soabl erhitungd i rumah.B erikutnya 14 orang siswa relatif seringm elakukan upayate rsebutS. edangkan9 orangs iswak adang-kadansga jam elakukanu payai tu. Bahkan2 orangs iswat idak pemahm elakukannya. . Adapuns arand ari penelitianin i terutamab agi guruy aitu:( l) perlua dak ajian terhadape rmasalahasnis wad alamp embelajarapne nggunaaonp erashi itung,d an( 2) tindakl anjutt erhadaph asilk ajiant ersebut. lv

Metode pembelajaran ilmu pengetahuan sosial kelas V MI Ma'arif Sukun Kecamatan Sukun Kota Malang / oleh Sri Yuliani

 

Penerapan metode pembelajaran kooperatif model Group Investigation (GI) untuk meningkatkan motivasi belajar fisika siswa SMP Negeri 1 Bangkalan oleh Isna Ida Mardiyana

 

Berdasarkanir asii pengamatand i iapangan,m enunjukkanb ahwam otivasi belajarf isika siswam asihr en

Studi tentang kesulitan belajar siswa kelas dua program studi sekretaris SMK Bisnis dan Manajemen (SMEA) Yadika Bangil dalam menempuh matapelajaran korespondensi bahasa Indonesia tahun ajaran 1996/1997
oleh Mokhamad Alifudin

 

Pengembangan perangkat ajar sistem persamaan linier dua variabel dengan media botol minuman untuk siswa kel;as VIII SMP yang berciri realistic mathematic education / Seviana Maryam

 

ABSTRAK Maryam, Seviana. 2015. PengembanganPerangkat Ajar SistemPersamaan Linier DuaVariabeldengan Media BotolMinumanuntukSiswaKelas VIII SMP Yang Berciri Realistic Mathematic Education. JurusanMatematika FMIPA UniversitasNegeri Malang.Pembimbing: Prof. Drs. GatotMuhsetyo M.Sc. Kata kunci: perangkat ajar, RME, sistempersamaan linier duavariabel, media botolminuman Tujuanpengembanganiniadalahuntukmenghasilkanperangkat ajar persamaan linier duavariabeldengan media botolminumanuntuksiswakelas VIII SMPyang bercirirealistic mathematic education. Model pengembangan yang digunakanadalah model 4-D (four D model)dariThiagarajan yang terdiriatasempattahap, yaitutahappendefinisian (define), tahapperancangan (design), tahappengembangan (develop), dantahappenyebaran (disseminate). Tetapidalampenelitianinitidakdilakukantahappenyebaran (disseminate). Perangkat ajar yang dikembangkanterdiriatas RPP, soaltesdanBukuSiswa.Dalampembelajaranjugadigunakan media botolminumanuntukmemudahkansiswadalammempelajarimateripersamaan linier duavariabel.Uji yang dilakukanpenelitiadalahujikevalidan yang dilakukanolehsatu orang dosendandua orang guru matematika, danujikelayakanperangkat ajar dilakukanoleh 10 siswasebagaisubjekujicoba. Berdasarkananalisis data yang dilakukandiperolehhasilyaitu: (1) persentasekevalidan RPP danBukusiswaberturut-turutadalah 85,71% dan 82,22%, (2) persentasesiswa yang mendapatnilaidiatas SKM adalah 90% yang ditunjukandengan 9 dari 10 subjekujicobamemperolehnilaiakhirlebihdariatausamadengan 75. Dengandemikianperangkat ajar persamaan linier duavariabeldengan media botolminuman yang berciri RME yang dihasilkanmemenuhikriteria valid danlayakuntukdigunakan.Berdasarkanpengembanganinidisarankanuntukmenyesuaikanmateridengansituasikontekstualnyadanmengembangkanperangkat ajar yang berciri RME untukmateri lain.

Pembelajaran melalui pendekatan open-ended problem untuk membantu mengatasi kesulitan siswa dalam menyelesaikan soal cerita bentuk pembagian pada kelas III SDN Sumbersari III Malang / oleh Samsiar Rivai

 

Kepemimpinan kepala madrasah dalam melaksanakan inovasi pendidikan : studi kasus pada MTsN Model Amuntai / oleh Suriagiri

 

Penggunaan metode bermain peran pada pembelajaran sejarah untuk meningkatkan sikap cinta tanah air siswa di kelas V SDN Lesanpuro VI Kota Malang / oleh Elly Nurul Ilmi

 

Hubungan antara iklim organisasi dengan produktivitas kerja pegawai di lingkungan Kandepdikbud Kodya Malang / oleh Mutia Faida

 

Penerapan pembelajaran pohon matematika untuk meningkatkan kreativitas dan hasil belajar matematika pada siswa kelas V SD Negeri Purwantoro 6 Malang / Ruslin

 

ABSTRAK Ruslin. 2015. Penerapan Pembelajaran Pohon Matematika untuk Meningkatkan Kreativitas dan Hasil Belajar Matematika pada Siswa Kelas V SD Negeri Purwantoro 6 Malang. Tesis. Program Studi Pendidikan Dasar, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. H. Subanji, S.Pd., M.Si., (II) Dr. Edy Bambang Irawan, M.Pd. Kata Kunci: Pembelajaran Pohon Matematika, Kreativitas, Hasil Belajar. Berdasarkan pengamatan pembelajaran kelas V SD Negeri Purwantoro 6 Malang yang dilaksanakan tanggal 22 dan 23 September 2014, siswa hanya mengerjakan soal tanpa diberi peluang untuk memberikan alternatif jawaban lain. Dalam pembelajaran tersebut seharusnya siswa diberi kesempatan untuk memberikan alternatif jawaban lain dan mengajukan pertanyaannya sendiri. Hal tersebut menyebabkan hasil belajar matematika siswa sulit mencapai KKM. Permasalahan ini diatasi dengan memberikan kesempatan siswa untuk menyelesaikan masalah open ended dan membangun masalah (problem posing) melalui penerapan pembelajaran Pohon Matematika. Tujuan penelitian ini adalah untuk mendeskripsikan penerapan pembelajaran Pohon Matematika yang dapat meningkatkan kreativitas dan hasil belajar matematika pada siswa kelas V SD Negeri Purwantoro 6 Malang. Penelitian ini merupakan penelitian tindakan kelas (PTK) dengan desain yang mengacu pada model Kemmis & McTaggart yang meliputi: perencanaan, tindakan, pengamatan, dan refleksi. Proses PTK dilaksanakan dalam dua siklus. Siklus I dilakukan dalam empat pertemuan dan Siklus II dalam tiga pertemuan. Penelitian ini dilaksanakan di SD Negeri Purwantoro 6 Malang dengan subjek penelitian 40 siswa kelas V tahun pelajaran 2014/2015. Pengumpulan data diperoleh dari, observasi, video pembelajaran, tes kreativitas, tes hasil belajar, dan wawancara. Hasil penelitian menunjukkan bahwa peningkatan kreativitas dan hasil belajar terjadi karena penerapan pembelajaran Pohon Matematika dengan tahapan: (1) menyajikan materi; (2) memberikan masalah dan menyelesaikan bersama; (3) memberikan media pohon matematika; (4) menentukan penyelesaian masalah open ended dan membangun masalah (problem posing) dalam pohon matematika; (5) mengoreksi dan menilai masalah atau jawaban yang disusun; dan (6) mendiskusikan masalah yang sulit. Peningkatan kreativitas dan hasil belajar diukur melalui hasil tes kreativitas dan tes hasil belajar pada akhir siklus. Kreativitas siswa meningkat sebesar 19,85%. Pada siklus I persentase kreativitas klasikal siswa sebesar 59,89% (kriteria cukup kreatif), sedangkan pada siklus II mencapai 79,06% (kriteria kreatif). Hasil belajar siswa meningkat sebesar 24,50%. Pada siklus I nilai rata-rata kelas 75,67 dengan persentase ketuntasan klasikal sebesar 65,5%, sedangkan pada siklus II nilai rata-rata kelas sebesar 88,77 dengan ketuntasan klasikal sebesar 90%.

Penggunaan kata tugas Bahasa Indonesia dalam karangan siswa kelas V SDN Rampal Celaket I Malang tahun pelajaran 2003 - 2004 / oleh Supriyadi

 

Perangkat pembelajaran matematika dalam pokok bahasan peluang di SMU dengan menggunakan metode pembelajaran kooperatif oleh Lely Setyaningsih

 

salahs atum etodpee mbelajaryaann gs eringd igunakasna atin ia dalamh etode pembelajakraon vensionNaalm. udna lamke nyataannbyeab,e rapaah lmi enyatakbaanh wa metodpee mbelajarkaonn vensiondainl ilakiu ranegf ektikfa rendaa lamm etodien ip roses pembelajarbaenr pusapta dag uruH ali nim enyebabkpaenn galambaenl aiasri swam enjadi terbatasi,s wac enderunpga sifd, ani nterakysai ngte r,;apdai das aatp rosepse mbelajaran biasanyhaa nysaa tua taud uaa rahs ajas ehingginat erakmsiu ltai rahja ransge kaliterjadi Salahs atut emuamn etodpee mbelajaryaann gs udahd ikenasla atin ia dalamh etode pembelajarkaono peratMif.e todpee mbelajarkaono peradtiifd asarkaanta sk eriasamaan tar siswdaa lamsu atuk elompoukn tumk encaptauij uabne lajabre rsamDa.a rhi asipl enelitian Slavind,k k( dalamS upriyad1i9, 95), diketahbuai hwam etodpee mbelajarkaono peratif mampmu emotivassisi wau ntubk elajadre mtie rcapaintyuaju abne lajabre rsamdaib andingkan dengamn etodpee mbelajakraonm petidtiafn i ndividuDala, lamm etodpee mbelajaran kooperatteifr jadini terakmsiu ltai rahy aituin terakssiis wad engagnu rud ani nterakssiis wa dengasnis wala innysae hinggaak ante rbentusiks waya ngm ampbue rtanggungjaswenadbi ri dicapainkyeab erhasiilnadni viddua) ns iswam ampbue kerjasadmean gaonr anlga in dicapainkyeab erhasiklaenlo mpo) dka lamb elajarnya. Sampasai aitn it elahb anyadki temukmano del-mopdeeml belajayrang te lah dikembangkdaanla mm etodpee mbelajarkaono peratMif.o de-l m odeilt ua ntarlaa in: model STADd idasarkpaand ak erjak elompokek mudiasne tiaspi swad ibertei si ndividpue, nilaian setiaspi swab ergantupnagd ah asikl erjak elompokke,a ktifasnis wad alamke lompodka,n h asil tesi ndividunymao, deTl GTd idasarkapna dakerikae lompokke mudiadnil aksanakan pertandingaannta kr elompopke, nilaiasne tiaspi swab ergantupnagd ak eaktifanndyaala m kerjak elompodka lamp ertandingmano,d eTl AId idasarkapna dak erjak elompokke mudian setiapsi swam engerjaksaona yl angb erbedake, mudiasnis was alingm enukadra nm emeriksa hasiljawabtaenm annypae,n ilaiasne tiaspi swab ergantupnagd ak eaktifanndyaala m kelompodka nh asipl engerjaanndyaads oayl angb erbedtaa di. Perangkpaetm belajaaradna lashe mual adt anb ahayna ngd igunakdaanl ampr oses pembelajarDana lamsk ripsini id ituliskapne rangkpaet mbelajarmaant ematidkal amp okok bahasapne luan(g p ermutaksoi,m binaksei,j adiasna linlge pasd,a nk ejadiasna linbge ba)s diS MUd engamn enggunakmaent odpee mbelajakraono peraltnifid. imaksudkuanntu k membangtuur us ebagaic uanm engajpaor kobk ahasapne luandga ns ebagaci uan pembuatpaenr angkpaet mbelajarmaent odkeo operadtiaf lamp okokb ahasamn atematika yangla innysae rtam embanstius was ebagabia habne lajasre hinggtuaj uan{ujusaons iadla ri metodpee mbelajarkaono peradtiaf patte rcapaAi dapupne rangkpaet mbelajaryaann gd itulis dalamsk npsini ib esertmao deple mbelajadreanng amn etodkeo operaatdifa lapho kok bahasapne rmutadsei ngamn enggunakmano deSl TADp, okokb ahasakno mbinadsei ngan menggunamkaond eTlG Td, anp okobka hasakne jadiasna linlge passe rtak ejadiasna ling bebadse ngamne nggunamkaond eTlA l.

Pola pembelajaran guru meningkatkan kemampuan siswa kelas IV dalam menyelesaikan soal cerita hitung campuran pelajaran matematika SD Negeri Jimbaran I Kecamatan Puspo Kabupaten Pasuruan / Sri Ubadeyah

 

Studi tentang persiapan dan penampilan guru pendidikan jasmani di SDN se-kecamatan Kraksaan Kabupaten Probolinggo / Sandhy Arie Herfanto

 

Penampilan merupakan suatu proses dan hasil kerja, baik secara individu maupun organisasi. Seorang guru didalam memberikan materi pelajaran secara tidak langsung akan mempengaruhi baik tidaknya proses pembelajaran, oleh karena itu agar menimbulkan citra yang baik dimata peserta didik seorang guru harus memperhatikan penampilannya. Pendidikan jasmani merupakan bagian dari pendidikan secara umum sebagai mana pendidikan di sekolah, maka pendidikan jasmani juga memiliki tujuan yang mudah dicapai. Berdasarkan uraian di atas, maka peneliti mengadakan penelitian Studi Tentang Persiapan dan Penampilan Guru Pendidikan Jasmani di SDN se-Kecamatan Kraksaan Kabupaten Probolinggo. Hal ini dilatarbelakangi oleh hasil observasi awal yang menujukkan bahwa penampilan guru dalam proses pembelajaran pendidikan jasmani kurang optimal. Penelitian ini bertujuan untuk mengetahui dan mendeskripsikan tentang persiapan dan penampilan guru Pendidikan Jasmani di SDN se-Kecamatan Kraksaan Kabupaten Probolinggo dalam proses pembelajaran, yang meliputi: (1) kegiatan persiapan mengajar, (2) kegiatan saat awal pelajaran, (3) kegiatan saat proses mengajar, (4) kegiatan saat akhir pelajaran. Penelitian ini termasuk jenis penelitian deskriptif kuantitatif. Pengumpulan Data dengan menggunakan panduan observasi, seorang observer sebagai pengumpul data di lapangan. Subjek penelitian adalah guru Pendidikan Jasmani di SDN se-Kecamatan Kraksaan Kabupaten Probolinggo, dari jumlah subjek penelitian 27 guru. Analisis data penelitian yang digunakan adalah statistik deskriptif kuantitatif dengan persentase. Hasil penelitian tentang persiapan dan penampilan guru pendidikan jasmani di SDN se-Kecamatan Kraksaan Kabupaten Probolinggo mencapai 57,16%. Hal ini dihasilkan dari: (1) kegiatan persiapan mengajar 61,12%, (2) kegiatan saat awal pelajaran 68,87%, (3) kegiatan saat proses mengajar 53,68%, (4) kegiatan saat akhir pelajaran 45%. Berdasarkan hasil penelitian di atas, dapat simpulkan bahwa penampilan guru pendidikan jasmani di SDN se-Kecamatan Kraksaan Kabupaten Probolinggo cukup baik keterlaksanaannya. Hal ini berdasarkan hasil dari: (1) kegiatan persiapan mengajar dalam kategori cukup, (2) kegiatan saat awal pelajaran dalam kategori cukup, (3) kegiatan saat proses mengajar dalam kategori kurang baik, (4) kegiatan saat akhir pelajaran dalam kategori kurang baik. Dari hasil penelitian di atas maka dapat disimpulkan beberapa saran sebagai berikut: (1) Pada saat proses belajar mengajar berlangsung termasuk dalam kategori kurang baik. Dengan demikian guru pendidikan jasmani diantaranya perlu menyesuaikan demonstrasi dengan materi agar siswa bisa lebih mengerti dalam proses belajar mengajar, menggunakan metode yang sesuai dengan materi agar proses belajar mengajar dapat berjalan dengan sempurna, lebih memperhatikan keselamatan serta mengawasinya dalam proses belajar mengajar siswa agar tidak terjadi hal-hal yang tidak diingnkan, dan memberikan penguatan breupa sentuhan dan gerakan guna siswa lebih semangat dalam proses belajar mengajar. (2) Pada saat proses belajar mengajar berlangsung termasuk dalam kategori kurang baik. Dengan demikian guru pendidikan jasmani diantaranya perlu membariskan siswa pada akhir pelajaran, mengoreksi secara individu agar guru mengetahui siswa yang dinilai kurang sempurna dalam proses belajar mengajar, dan mempresensi siswa pada akhir pelajaran.

Hubungan struktur kognitif siswa SMU kelas I dengan kemampuan siswa menyelesaikan soal kimia / oleh Endang Siwi Retnaningsih

 

Padanan makna antologi cerpen Laila Azzifaf dengan terjemahannya dalam Bahasa Indonesia oleh Khalifurrahman Fath / oleh Puspitarini Muyassaroh

 

Pembuatan alat pengukur intensitas suara pengajar di sekolah berbasis komputer / oleh Herwin Yunanto

 

Gelombangs uarad i udaray angm engelilingim anusiate rjadik arena adanypae rubahatne kanany angs angakt ecil danc epat.B esamyag elombang suaray angb isad idengarb iasanyad ikenald enganin tensitass uaraU. ntuk manusia intensitatse rsebubt eradap adai nterval2 0 Hz sampa2i 0 KHz(Rettinger1 968:l). Kenyamanadna n ketenanganli ngkungans angatd ibutuhkand idalamd unia pendidikank"a renas La sanay angt enangd apatm empengaruhbie rhasilnyap roses belajarmengajaSr.e laink etenangalnin gkungani,n tesitasa taul evel suara pengajaar taug uru menjadi faktor utamad alam prosesb elajarm engajar. Bagaimansau arap engajard apatt erjangkaub agi merekay angb eradajauh darinyad, an yang adad idekatnyat idak merasat erganggud engank erasnyas uara pengajarP? ermasalahan-permasalahtearns ebutm enjadi sangatm embingungkan jika pemahamante ntangb atasans uaray ang baik kurangd ipahamio leh pengalar. Untukm engukuri ntensitass uarap erlu dilakukanp embuatana lat ukur intensitas suaraB. erdasarkanh al diatas,m aka dilakukan penelitiant entangp engukuran intensitassu arap engajard i sekolahb erbasiskakno mputer. Penelitianin i bertujuanu ntukm engetahutie knik kaiibrasis uaram enjadi satuanp engukurs ruuad igital, karakteristika lat ukur dan batasans uaras tandar bagip engajadr alamp rosesb elajarm engajadr i kelas.P enelitianin i drlakukand i laboratoriume lektronikad an instrumentasjiu rusan fisika UM selamak urang lebihe namb ulan.R ancangapne nelitiany angd igunakand imulai dari pembuatan rangkaiand B meter penangkaps uaram enjadit eganganp, enguatanp engubah analogm enjadid igital, pembuatanso ftwareb agi ADC 0809d anP PI 8255s erta mencarhi ubungana ntarain tensitass uara( dB) dengand atad igital (biner). Selanjutnyaa,n alisd atap enelitianin i menggunakamn etodeg rafik baik dalam pengujianp €nguata udiom ic condensors, tabilitas ADC 0809,s tabilitas sistem, repeatibilitass istem,r esponet ime ,sistemr,e coveryt ime sistemd an pengukuran intensitasu arap engajar. Hasil analisisd atam enunjukkanb ahwa:( 1) Perubahaanm plitudo masukans ebandingd enganp erubahante gangank eluaranV out:0,7568 Ln (A) + A)6. (2) StabilttasA DC 0809m empunyatia raf kestabilany angc ukupb aik. Maka alati ni layakd igunakanH. asil uji cobad iperolehin tensitass uarap engajapr ada rentang5 1,829d B sampai8 4,829d B. Sementarait u, padar entang4 7,829d B sampai5 1,829d B merupakanin tensitass uarap engajary ang hampir samad engan suarab ackgroundk elas( intensitass uarap engajayr angl emah).I ntensitass uara backgroundtedetapka dar entang4 2,829d B sampa4i 7,829d B dand eraup ada 42.829d B.

Inventarisasi marga chlorophyceae di danau kawah gunung Kelud propinsi Jawa Timur / oleh Agus Amak Fadholi

 

DanauK awahG unungK elut merupakand anaub erairp anasd engans uhu normalb erkisara ntara3 l-34" c yang terletak di wilayah perbatasanK abupaten MalangB, litar danK ediri, PropinsiJ awaT imur. Padas aatp eningkatana L:tifitas Gunungb erapi,s uhua ir naik hingga6 3uC . Kondisid anauK awahG unungK elut terdiri dari tebing, batuan serta tanahnya selalu lembab alau basah dan air Kawah yangb erwamah ijauj ernih. Kondisi demikiani ni memungkinkanC hlorophyceae dapath idup.H asil penelitianA ristyanti( 1996)d i sumbera ir panasd i daerahw isata alamC angarM alangm enunjukkanb ahwag anggangh ijau mampuh idupd alams uhu yangr elatiftinggi. Sejauhi ni belump ernahd ilakukan penelitiante ntang inventarisasmi argaC hlorophyceayea ngt erdapadt i danauK awahG unungK elut, sehinggas ampars aati ni belum diketahuim argaC hlorophyceaea pas aja yang hidup di danau Kawah Gunung Kelut. Berdasarkanh al tersebutm aka perlu adanyap enelitiany angb ertujuanu ntuk mengetahumi argaC hlorophyceaey ang terdapatd i danauK awah GunungK elut PropinsJi awaT imur danm argaa pay angp aling seringd itemukanH. asilp enelitian ini diharapkand apatm emberikans umbanganb agi dunia ilmu pengetahuan khususnypae ngajaranya ngb erkaitand engang anggang. Penelitianin i menggunakamn etodes urvaid ilakukanm ulai bulanM ei-Juni 2001. Sampedl alamp enelitianin i adalahm argaC hlorophyceayea ngt erdapadt alam 10m l air danauK awahG unungKelut.S ampeiln i meliputib agranp ermukaan, tengahd and asaru ntukm asing-masinsgt asiunH. asil penelitiand i analisiss ecara deskriptif dan identifikasi dilakukan sampai tingkat marga yang mengacu pada kunci identifikasmi enuruSt mith( 1950). Dari hasilp enelitiand itemukan8 margaC hlorophyceayea itu:P rotococcus, . Golenkinia, ScenedesmssM, icrospora, Ulotrk, Chlorococcum,L jhndrocystis dan Pandorins.M argay angs eringd itemukana dalahG olenkiniad anChlorococcum. Dalam penelitiani ni diternukanjugag anggangd ari kelas lain, sehinggap erlu dilakukanp enelitianle bih lanjut untukm engetahuki eseluruhamn argag anggang yangl erdapatd i danauK awahG unungK elut

Pembelajaran matematika berkonstruksi origami untuk meningkatkan kecerdasan spasial siswa di SMP Negeri 5 Singosari Satuy AStap Malang / Dian Wardhani

 

ABSTRAK Wardhani, Dian. 2016. Pembelajaran Matematika Berkonstruksi Origami Untuk Meningkatkan Kecerdasan Spasial Siswa di SMP Negeri 5 Singosari Satu Atap Malang. Program Studi Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M.Pd, (II) Prof. Dr. Cholis Sa’dijah, M.Pd., MA Kata Kunci:pembelajaran matematika, origami, kecerdasan spasial Permasalahan yang dialami siswa kelas VIII di SMP Negeri 5 Singosari Satu Atap dengan peneliti sebagai guru matematika adalah siswa kurang mampu memahami gambar atau bentuk pada bangun ruang. Siswa kurang mampu memahami bagian-bagian yang terdapat pada bangun ruang (rusuk, sisi, diagonal, dll) dan tidak memahami darimana didapatkannya rumus luas permukaan dan volume. Siswa cenderung untuk menghafalkan rumus yang telah ada. Siswa tidak berusaha mengembangkan kemampuan dan penginderaan spasialnya yang sangat berguna dalam memahami relasi dan sifat-sifat dalam geometri untuk memecahkan masalah matematika dan masalah dalam kehidupan sehari-hari. Tujuandaripenelitianiniadalahmendeskripsikanpenerapan pembelajaran matematikaberkonstruksi origamiyang dapatmeningkatkan kecerdasanspasial siswa kelas VIII SMPNegeri 5 SingosariSatuAtap. Metode penelitian yang digunakanyaituClassroom Action Research (PenelitianTindakanKelas), karenapenelitianinibertujuanuntukmemperbaikipembelajaran di kelas yang dilakukan guru.Jenispenelitiantindakaninimengacupada model PenelitianTindakanKelas (PTK) yang dikembangkanoleh Lewin (2007). Secaragarisbesar, penelitianberupasiklus yang terdiridariempattahap, yaituperencanaan (planning), pelaksanaan (action), observasi (observations) danrefleksi (reflection).Siklusakandiulangsampaikriteriakeberhasilantercapai. Penelitianinidilaksanakan di SMPNegeri 05 SingosariSatuAtap yang beralamatkan di Dusun Sumbul, DesaKlampok, Kec. Singosari-Kab.Malang yang terdiri dari 20 orang siswa.Data penelitian yang terkumpul dianalisis dengan model alir Milles, dkk (2014) yang meliputikegiatan (1) mereduksi data, (2) menyajikan data, dan (3) menarikkesimpulandanverifikasi. Hasil penelitian menyimpulkan, bahwanilaiaktivitassiswapadasiklus II lebihbaikdarisiklus I. Nilaipadasiklus I adalah (3,15), (3,32), dan (3,32). Sedangkannilaipadasiklus II adalah (3,15),(3,36), dan (3,42). Dari data tersebutdisimpulkanbahwaaktivitassiswadalammengikutipembelajaranmatematika berkonstruksi origamiberadapadakategori BAIK sehinggamemenuhikriteriakeberhasilan.Berdasarkan hasil analisa datahasilunjukkerjasiswapada LKS, diketahuibahwaskor rata-rata LKS padasiklus II adalah 81,6 (memenuhikriteriakeberhasilan). Skortersebutmenunjukkanpeningkatandariskor rata-rata LKS padasiklus I yaitusebesar 74,6. Berdasarkan hasil analisa data nilai tes akhir siswa, diketahui bahwa persentaseketuntasansiswapadasiklus II sebesar80%. Persentasetersebutmenunjukkanpeningkatandaripersentaseketuntasansiklus I yang hanyamencapai35%.Berdasarkanuraian data diatas, maka pembelajaran yang dilakukan pada penelitian ini dikatakan berhasil karena telah mencapai kriteria yang ditetapkan.

Pengaruh pemahaman anggota tentang laporan keuangan terhadap partisipasi anggota pada KPRI Al-Ukhuwwah Blitar / oleh Ifa Nur Rusydiana

 

The implementation of basic principles of cooperative leasrning in English class at grade XI MAn Tambakberas Jombang / Yossy Sunda Permatasari

 

ABSTRAK Permatasari, YossySunda. 2016. ImplementasiPrinsipDasarPembelajaranSecaraKooperatifdalamKelasBahasaInggrisKelas XI MAN TambakberasJombang. Skripsi. JurusanSastraInggris, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Dr. Sri Rachmajanti, Dip. TESL, M. Pd (II) Dra. Sri Andreani, M. Ed. Kata kunci: pembelajarankooperatif, prinsipdasar, implementasi, Kurikulum 2013, sekolahberbasispondokpesantren Islam. BerdasarkanPermendikbudNomor 103 Tahun 2014, Kurikulum 2013 menuntut guru untukmenciptakanaktifitaspembelajaran yang berfokuspadasiswadanmeningkatkankeaktifanmerekadalam proses pembelajaran. Penelitianinibertujuanuntukmendeskripsikanimplementasiprinsipdasarpembelajaransecarakooperatifdisebuahsekolahberbasispondokpesantren Islam yang meliputiimplementasiinterdependensipositif, akuntabilitas individual, pastisipasisetaradaninteraksisimultan. Penelitianinimenggunakandesainstudikasusdeskriptif yang menyajikan data kualitatif (Yin, 2009). Penelitisebagai instrument utama, mengumpulkan data denganmenggunakanlembarwawancara, lembaranalisa RPP, lembarobservasi, dankuisioner yang ditujukanuntuk guru BahasaInggris, RPP, prosespembelajaran, dansiswakelas XI. Berdasarkanhasilpenelitian,interdependensipositifdiimplementasikandenganmenciptakanaktifitasdimanasiswabergantungsatusama lain danmemilikiinformasi yang dibutuhkanteman yang lain. Akuntabilitas individual diimplementasikandenganmemberikansiswatanggungjawabdantugasmasing-masingdalamtugaskelompok.Lalu, pastisipasisetaradiimplemetasikandenganmemberisiswakesempatandantugas yang setaradengantingkatkesulitan yang sama. Kemudian, interaksisimultandiimplementasikandenganmenciptakanaktifitasdimanasiswamemilikikesempatanmeresponpertanyaan guru danmengungkapkan ide danopinisecaraterusmenerus. Di akhirpertemuan, nilaiseluruhsiswaluluskriteriakelulusan minimal untukpenilaiankemampuanmembacadanberbicara. Selebihnya, 85.19% nilaisiswaluluskriteriakelulusan minimal untukulangantekseksposisisedangkan 14.81% lainnyaharusmengambilujianremidi. Prinsipdasardaripembelajarankooperatiftelahdiimplementasikandenganbaikdanmemberikanpengaruhpositifpadakeaktifandanpencapaiansiswa. Untukitu, guru BahasaInggris MAN Tambakberasuntukmembentuk forum diskusiuntukmendiskusikandanberbagiperkembanganpendidikandalampengajaranBahasaInggris. Terakhir, peneliti yang akandatangdapatmeningkatkanpenelitianinidengancaramelakukanpenelitianserupatentangprinsipdasarpembelajaransecarakooperatifnamundalamfokus yang lebihspesifik.  

Ta'liimu qowaa'idul-lugh al 'Arabiyyah : dirasah fii Ma'hadi "Firdaus" lit-thullaab wat-ththolabat Malang / oleh Hijriyyah

 

Identifikasi mikroalga dari Pantai Teluk Raas Kabupaten Malang serta identifikasi komposisi asam lemaknya / Alifah Novitasari

 

ABSTRAK Novitasari, Alifah. 2016. Identifikasi Mikroalga dari Pantai Teluk Raas, Kabupaten Malang serta Identifikasi Komposisi Asam Lemaknya. Skripsi, Jurusan Kimia, FMIPA, Universitas Negeri Malang. Pembimbing: (I) Eli Hendrik Sanjaya, S.Si., M.Si., (II) Drs. Parlan, M.Si. Kata kunci : mikroalga, ekstraksi, transesterifikasi, asam lemak. Mikroalga adalah alga yang berukuran mikroskopis yang memiliki ukuran 3-30m. Mikroalga memiliki kandungan lipid yang tinggi sehingga dapat dimanfaatkan sebagaibahan baku biodiesel. Tujuan penelitian ini adalah untuk mengetahui: (1)jenis mikroalga yang terdapat di Pantai Teluk Raas; (2) rendemen lipid yang dihasilkan mikroalga dari Pantai Teluk Raas; dan (3) analisis komposisi asam lemak dari lipid yang dihasilkan mikroalga dari Pantai Teluk Raas. Penelitian ini bersifat eksploratif dan terdiri dari beberapa tahapan yakni (1)identifikasi mikroalga yang terdapat di Pantai TelukRaas,(2)kultivasi mikroalga dengan media walne,(3)pemanenan mikroalga,(4)penentuan rendemen lipid mikroalga dengan metode ekstraksi sokhlet, dan(5)analisiskomposisi asam lemak lipid mikroalga dengan GC-MS. Hasil penelitian menunjukkanmikroalga dari pantai Teluk Raas diduga berjenis Euglena sp (dominan) dan terdapat sedikit Gloeocapsa.Persen kadar lipidmikroalga kering sebanyak 7,5 %. Komposisi asam lemak yang terdapat dalam lipid mikroalga adalah asam dodekanoat (1,6%), asam tetradekanoat (1,3%), asam heksadekanoat (16,6%), asam 9,12-oktadekadienoat (25,2%), 9-Oktadekenoat (29,8 %), dan asam oktadekanoat (6,7%).

Studi tentang hambatan dan dukungan yang dialami oleh para guru kimia sekolah percontohan dalam pelaksanaan pembelajaran kimia berdasarkan kurikulum berbasis kompetensi di Kota Surabaya / oleh Ita Rahmawati

 

Pemetaan animo peserta didik SLTP yang melanjutkan ke SLTA di Kecamatan Ngancar Kabupaten Kediri / Risa Novita Sari

 

ABSTRAK Sari, Risa Novita. 2016. Pemetaan Animo Peserta Didik SLTP yang Melanjutkan ke SLTA di Kecamatan Ngancar Kabupaten Kediri. Skripsi. Jurusan Administrasi Pendidikan. Fakultas Ilmu Pendidikan. Universitas Negeri Malang. Pembimbing: (I) Dr. Bambang Setyadin, M.Pd, (II) Sunarni, S.Pd, M.Pd. Kata Kunci: pemetaan, animo peserta didik Jenjang pendidikan adalah suatu tahap dalam pendidikan berkelanjutan yang ditempatkan berdasarkan tingkat perkembangan para peserta didik serta keluasan dan kedalaman bahan pengajaran. Dalam dunia pendidikan formal terdapat jenjang pendidikan, yaitu pendidikan dasar meliputi Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) hingga Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs), dan pendidikan menengah, meliputi Sekolah Menengah Atas (SMA)/Sekolah Menengah Kejuruan (SMK)/Madrasah Aliyah (MA). Untuk melanjutkan ke jenjang selanjutnya dibutuhkan perencanaan pendidikan. Dalam hal ini perencanaan pendidikan memegang andil untuk menentukan kemajuan pendidikan. Penolakan Wajar 12 tahun seharusnya tidak menjadi penghalang untuk meningkatkan kualitas pendidikan di Indonesia. Hal ini dikarenakan semakin tingginya permintaan lulusan tingkat SLTA, terutama dalam mencari pekerjaan. Sebab sekarang banyak lowongan pekerjaan yang memberi persyaratan minimal lulusan SMA/sederajat. Jadi jika ingin cepat mendapatkan pekerjaan harus menempuh pendidikan selama 12 tahun untuk memenuhi persyaratan yang telah diajukan. penyebaran peserta didik yang melanjutkan di daerah tersebut harus ke luar wilayah Kecamatan Ngancar karena kecamatan tersebut belum memiliki SLTA. Hal ini dilakukan dengan harapan akan segera dibangun SLTA di daerah Kecamatan Ngancar. Penelitian ini bertujuan untuk: (1) Menggambarkan peta (map) penyebaran peserta didik SMP dan MTs dalam memilih SLTA, (2) Menemukan tingkat animo peserta didik SLTP yang melanjutkan ke SLTA, (3) Mengidentifikasi alasan peserta didik dalam memilih SLTA, (4) Mengidentifikasi motivasi peserta didik dalam memilih SLTA. Penelitian ini menggunakan metode penelitian deskriptif dengan metode pendekatan kuantitatif. Populasi dalam penelitian ini yaitu peserta didik Kelas IX SMP dan MTs di Kecamatan Ngancar Kabupaten Kediri sejumlah 460 peserta didik. Dari jumlah populasi tersebut dijadikan sampel penelitian sejumlah 214 peserta didik dari 2 sekolah SMP Negeri dan 1 Sekolah MTs Swasta. Pengumpulan data dalam penelitian ini menggunakan angket tertutup untuk memudahkan responden dalam menjawab serta memudahkan peneliti dalam melakukan analisis. Berdasarkan hasil penelitian diperoleh kesimpulan sebagai berikut: (1) Pemilihan sekolah lanjutan atas yang paling diinginkan peserta didik tidak mengacu pada hakekatnya lokasi sekolah yang akan dipilih dengan rumahnya, tetapi lebih memilih kualitas dari sekolah, (2) Peserta didik lulusan SMP dan MTs lebih cenderung memilih melanjutkan sekolah lanjutan atas berstatus negeri, sedangkan yang memilih sekolah lanjutan atas berstatus swasta hanya sedikit. Di antara jenis sekolah lanjutan atas (SMA/SMK/MA), calon siswa lebih banyak memilih melanjutkan ke SMK, (3) Animo peserta didik SMP dan MTs yang memilih SMA berdasarkan keadaan dari siswa, dalam hal ini prestasi peserta didik sebagian besar memilih setuju baik dengan nilai UAN maupun kemampuan akademik dan nonakademik yang dimiliki peserta didik, kemudian animo peserta didik SMP dan MTs yang memilih SMK berdasarkan keadaan dari siswa, dalam hal ini prestasi peserta didik lebih banyak memilih setuju baik dengan nilai UAN maupun kemampuan akademik dan nonakademik yang dimiliki peserta didik, sedangkan animo peserta didik SMP dan MTs yang memilih MA berdasarkan keadaan dari siswa, dalam hal ini prestasi peserta didik lebih dominan memilih setuju baik dengan nilai UAN maupun kemampuan akademik dan nonakademik yang dimiliki peserta didik, (4) Motivasi peserta didik SMP dan MTs untuk melanjutkan sekolah di SMA berdasarkan faktor dari dalam (internal) peserta didik baik untuk meraih cita-cita, sesuai aspirasi dengan mempertimbangkan bakat dan minat yang dimiliki serta keinginan sendiri dalam pemilihan sekolah lebih dominan memilih sangat setuju. Berdasarkan kesimpulan di atas, saran-saran yang dapat diberikan peneliti, yaitu: (1) Kepala Dinas Pendidikan Kabupaten Kediri, sebaiknya lebih memperhatikan daerah yang belum memiliki SLTA dan segera membantu proses pembangunan sekolah serta melengkapi dengan tenaga pendidik dan kependidikan. Hal ini perlu dilakukan untuk meningkatkan animo peserta didik dalam melanjutkan sekolah, (2) Kepala UPTD Kecamatan Ngancar, hendaknya mengajukan proposal pendirian SLTA di Kecamatan Ngancar, supaya segera dibangun SLTA, (3) Ketua Badan Pemerintah Daerah (Bappeda), hendaknya segera membuat perencanaan dan merealisasikan pembangunan gedung SLTA di daerah Kecamatan Ngancar untuk meningkatkan animo peserta didik dalam melanjutkan sekolah, (4) Kepala Dinas Perhubungan Kabupaten Kediri, seyogyanya melakukan pengembangan pengadaan transportasi umum untuk wilayah Ngancar dan sekitarnya, khususnya di sediakan untuk jalur menuju SLTA, (5) Kepala SLTA seyogyanya lebih meningkatkan fasilitas sekolah yang di berikan kepada peserta didik dan menyediakan ekstrakurikuler yang beragam. Hal ini perlu dilakukan untuk meningkatkan jumlah peserta didik yang mendaftar ke SLTA, (6) Wakil Kepala Hubungan Sekolah dan Masyarakat (Humas) SLTA, hendaknya lebih mengenalkan sekolah kepada calon peserta didik yang akan melanjutkan tidak hanya melalui brosur tetapi juga datang langsung ke sekolah. Hal ini perlu dilakukan untuk mendapatkan siswa yang lebih banyak, (7) Guru SMP dan MTs, seharusnya mampu menanamkan pentingnya pendidikan yang tinggi atau memberikan motivasi, selain itu memberikan wawasan tentang sekolah lanjutan agar tidak sampai salah pilih sekolah. Hal ini perlu dilakukan untuk meningkatkan animo peserta didik melanjutkan sekolah, (8) Orangtua peserta didik, seharusnya membantu peserta didik mencari sekolah yang sesuai dengan bakat dan minat siswa serta kemampuan keluarga. Hal ini perlu dilakukan untuk menyalurkan bakat dan minat peserta didik dan supaya orangtua tidak merasa kesulitan membiayai sekolah, (9) Peneliti lain, hendaknya dapat melakukan kajian tentang faktor-faktor yang mempengaruhi minat peserta didik dalam melanjutkan jenjang pendidikannya. Hal ini perlu dilakukan untuk mengetahui seberapa tinggi minat peserta didik melanjutkan pendidikan ke jenjang yang lebih tinggi.

Hubungan pemilikan pengetahuan tentang tubektomi, informasi tentang tubektomi, tingkat pendapatan keluarga, jumlah anak lahir hidup dalam keluarga dan usia ibu dengan motivasi melakukan tubektomi di kecamatan Pare Kabupaten Kediri / oleh Sri Hartanti

 

Analisis implementasi hasil pelatihan kurikulum berbasis kompetensi (KBK) guru-guru kimia SMA yang diselenggarakan oleh MGMP ilmu kimia Kabupaten Jombang / oleh Siti Afdar Faiqotul Himmah

 

Pengembangan bahan ajar materi sifat koligatif larutan dengan model learning cycle 5E untuk siswa kelas XII SMA/MA / Shinta Gusta

 

ABSTRAK Gusta, Shinta. 2016. Pengembangan Bahan Ajar Materi Sifat Koligatif Larutan dengan Model Learning Cycle 5E untuk Siswa Kelas XII SMA/MA. Skripsi. Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Endang Budiasih, M.S., (II) Dra. Dedek Sukarianingsih, M.Pd., M.Si. Kata Kunci: sifat koligatif larutan, Learning Cycle 5E Karakteristik buku teks untuk mata pelajaran kimia yang ada di pasaran saat ini sebagian besar menyajikan materi secara deskriptif, dengan penyajian materi bersifat langsung, diikuti dengan rumus-rumus, serta diberikan beberapa contoh permasalahan atau contoh soal yang disertai dengan penyelesaian langsung menggunakan rumus-rumus yang tersedia. Soal-soal untuk uji kompetensi siswa banyak yang serupa dengan contoh soal yang telah diberikan, sehingga ada kecenderungan siswa hanya akan menghafal saja. Hal ini dapat mengakibatkan kurangnya pemahaman siswa serta kurang bermaknanya pemahaman yang telah dimiliki siswa, sehingga siswa tidak mampu menerapkan konsep pada kondisi atau permasalahan yang lebih luas. Dengan demikian, diperlukan bahan ajar dengan model pembelajaran yang lebih konstruktivis dan berpusat pada siswa (student centered), salah satunya adalah Learning Cycle 5E, yang melibatkan siswa secara aktif dalam proses pembelajaran untuk membangun pengetahuannya, dengan harapan pemahaman siswa dapat lebih bermakna. Materi yang akan dikembangkan adalah sifat koligatif larutan. Materi ini memiliki banyak aplikasi dalam kehidupan sehari-hari, sehingga sesuai dengan model pembelajaran Learning Cycle. Tujuan penelitian pengembangan ini adalah menghasilkan bahan ajar kimia untuk siswa kelas XII dengan model Learning Cycle 5E pada materi sifat koligatif larutan dan menguji tingkat kelayakan bahan ajar. Pengembangan bahan ajar materi sifat koligatif larutan mengadopsi model pengembangan 4-D dari Thiagarajan, dkk (1974). Tahap-tahap pengembangan adalah (1) define, (2) design, (3) develop dan (4) disseminate. Tahap disseminate tidak dilakukan karena keterbatasan waktu dalam penelitian. Kelayakan produk ditentukan berdasarkan kelayakan isi, bahasa, dan penyajian. Penilaian kelayakan bahan ajar dilakukan oleh satu orang dosen kimia dan dua orang guru kimia. Data penelitian berupa data kualitatif dan data kuantitatif. Data kualitatif berupa catatan validasi, saran, dan komentar para validator. Data kuantitatif berupa perhitungan persentase yang diperoleh dari penskoran hasil validasi. Alat pengumpul data yaitu angket validasi untuk dosen kimia dan guru kimia, serta angket uji keterbacaan oleh siswa SMA. Teknik yang digunakan untuk analisis bahan ajar yang telah dikembangkan adalah teknik perhitungan persentase. Berdasarkan hasil penilaian validator didapatkan hasil kelayakan bahan ajar yang diperoleh dari perhitungan persentase rata-rata yaitu dari segi isi sebesar 91,9%, segi bahasa sebesar 94,7%, dan segi penyajian sebesar 92,2%, sehingga diperoleh rata-rata sebesar 92,9%. Berdasarkan kriteria yang telah ditetapkan maka bahan ajar ini sangat layak digunakan untuk membantu pembelajaran maupun sebagai sumber belajar materi pokok sifat koligatif larutan berbasis Learning Cycle 5E bagi siswa kelas XII SMA/MA.

A Descriptive study on rhetoric in students' expository essays / by Sulistyaningsih

 

Implementasi manajemen kurikulum berputar pada SMP Islam Bani Hasyim di Singosari Malang / Terry Restu Andriyani

 

ABSTRAK Andriyani, Terry R. 2015. Manajemen Kurikulum Berputar Pada SMP Islam Bani Hasyim di Singosari Malang, Tesis. Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing : (I) Dr. H. Kusmintarjo, M.Pd (II) Dr. Ahmad Yusuf Sobri, M.Pd Kata Kunci: manajemen kurikulum berputar, pendidik, peserta didik Visi misi sekolah terimplementasi dalam kurikulum yang dirancang, disusun, dan dikembangkan oleh sekolah secara mandiri. Sekolah yang mengimplementasikan visi misi dengan menyusun kurikulum secara mandiri adalah SMP Islam Bani Hasyim Singosari Malang. Kurikulum Berputar dilaksanakan sejak didirikannya sekolah yaitu pada tahun 2010. Adapun kajian mata pelajaran pada Kurikulm Berputar dibagi menjadi 4 aspek yaitu integrated science, Islam dan peradaban, kemampuan dasar dan pengembangan diri. Kurikulum Berputar memiliki kekhasan, untuk itu perlu dilakukan kajian penelitian. Tujuan penelitian sebagai berikut: (1) Mendeskripsikan Manajemen Kurikulum Berputar yang meliputi proses perencanaan, pelaksanaan, pengorganisasian dan pengevaluasian kurikulum di SMP Islam Bani Hasyim. (2) Mendeskripsikan dampak Manajemen Kurikulum Berputar terhadap kompetensi tenaga pendidik di SMP Islam Bani Hasyim. (3) Mendeskripsikan dampak Manajemen Kurikulum Berputar SMP Islam Bani Hasyim terhadap perkembangan peserta didik meliputi input, proses, output dan outcome. Penelitian ini dilakukan dengan menggunakan pendekatan kualitatif, dan jenis penelitian studi kasus. Teknik pengumpulan datanya menggunakan teknik wawancara, observasi, dan dokumentasi. Berdasarkan data yang terkumpul, dilakukan reduksi data, penyajian data, dan penarikan kesimpulan. Pengecekan keabsahan datanya menggunakan ketekunan pengamatan, triangulasi, dan kecukupan referensi. Temuan penelitian adalah sebagai berikut: (1) Kurikulum Berputar merupakan seperangkat mata pelajaran yang menyatu dan saling terkait dalam materi dan aktivitas pembelajaran dengan tema sebagai pengkait yang berlandaskan nilai-nilai pada qur’an dan hadist. Adapun Manajemen Kurikulum Berputar meliputi: (a) tahap perencanaan, yaitu kurikulum disusun oleh lembaga pendidikan Bani Hasyim, kepala sekolah, dan guru yang dikemas dalam bentuk tema sebagai pusat utama kurikulum yang merujuk visi misi yayasan. Mata pelajaran yang terdapat dalam Kurikulum Berputar yaitu Islam dan peradaban, matematika, integreted science, bahasa Indonesia, dan Jawa, Bahasa Inggris, seni budaya, olah raga dan kepanduan. Kegiatan pembiasaan meliputi baca tulis qur’an, tholabul Ilm, pro lingkungan, sholat. Kegiatan pengembangan diri yaitu ekstrakurikuler, osis, pramuka. (b) tahap pengorganisasian, dan pelaksanaan, meliputi jadwal kegiatan belajar yaitu senin sampai sabtu, dengan rincian Senin–Kamis pembelajaran yang didampingi guru untuk masing-masing kelas sesuai kode guru pendamping, Jum’at setiap siswa mencari guru pendamping mandiri dengan menyesuaikan keinginan belajar masing-masing siswa, hari Sabtu adalah kegiatan unjuk diri, yaitu pentas seni, presentasi, bedah buku, pameran, dengan setiap pekan bergantian. Pelaksanaan aktivitas pembelajaran guru tidak menyusun perangkat pembelajaran (prota, proses, silabus, RPP), tetapi guru mempersiapkan materi dengan membuat LKS, dan media yang digunakan memanfaatkan sumber belajar yang relevan dengan tema yang terintegrasi dengan materi. (c) tahap evaluasi, pada Kurikulum Berputar dilakukan evaluasi setiap semester, yaitu dengan mengadakan kegiatan workshop kurikulum, yaitu masing-masing guru memberikan evaluasi yang berkaitan materi ajar, dan keberhasilan peserta didik dari segi akademik, dan non akademik. (2) Dampak Kurikulum Berputar pada pendidik, yaitu meliputi 4 aspek kompetensi, yaitu (a) pedagogik, pendidik lebih bebas mengembangkan materi, media, sumber belajar, metode secara kreatif, (b) kepribadian, pendidik lebih bertanggungjawab secara mandiri, tetapi memiliki kelemahan yaitu kedisiplinan. (c) sosial, pendidik bersikap objektif, dan saling menghargai terhadap siswa dan pendidik lainnya. (d) profesional, pendidik mengembangkan bahan ajar secara mandiri, tetapi membutuhkan waktu untuk menguasai materi pelajaran yang diampu, karena bersifat integrasi dan komprehensif. (3) Dampak Kurikulum Berputarpada peserta didik, yaitu (a) siswa merasa nyaman, dan santai dalam belajar, serta sesuai dengan perkembangan dari segi afektif, kognitif maupun psikomotorik. (b) Siswa merasa dihargai, karena dapat mengembangkan potensi dirinya melalui berbagai aktivitas kegiatan secara mandiri, (c) Siswa mengalami kesulitan dalam meteri ujian nasional, dikarenakan materi Kurikulum Berputar berbeda dengan materi pada umumnya. Berdasarkan hasil penelitian, maka disarankan kepada : (1) Yayasan Bani Hasyim; (a) Membuat kebijakan program petunjuk pelaksanaan Manajeman Kurikulum Berputar di SMP Islam Bani Hasyim; (b) Sebaiknya mengikutsertakan secara aktif semua komponen sekolah, stakeholder dan orang tua dalam proses Manajemen Kurikulum Berputar. (2) Bagi Kepala sekolah; (a) sebaiknya melaksanakan proses supervisi dan evaluasi terhadap Manajemen Kurikulum Berputar; (b) Sebagai Manager sekolah perlu memotivasi dan menfasilitasi tenaga pendidik untuk mengembangkan diri melalui kegiatan ilmiah dan kependidikan; (c) Kepala sekolah sebagai administrator sekolah membuat kebijakan tentang aturan melaksanakan administrasi kelas untuk kegiatan proses perencanaan, pelaksanaan dan pengorganisasian serta pengevaluasian Kurikulum Berputar. (3) Bagi tenaga pendidik; (a) Membuat administrasi pembelajaran dan melaksanakan manajemen kelas; (b) tenaga pendidik sebaiknya mengembangkan diri dengan membuat bahan ajar yang lebih maksimal (selain LKS) sebagai tindak lanjut dari Manajemen Kurikulum Berputar; (c) Tenaga Pendidik SMP Islam Bani Hasyim, hendaknya: meningkatkan kualitas kinerja melalui formasi kerjasama (teamwork) dan lebih disiplin; (4) bagi peneliti selanjutnya hasil penelitian ini dapat digunakan sebagai referensi dalam memperluas cakupan penelitian Manajemen Kurikulum pada jenjang Sekolah Menengah Pertama.

Penerapan model inquiry untuk meningkatkan hasil belajar IPA pada pembelajaran gaya di kelas IV SDN Pejangkungan I Kecamatan Rembang / Rusman

 

Kata Kunci: Inquary, Gaya, IPA Sebagian besar guru masih mendominasi pembelajaran di dalam kelas dengan menerapkan pendekatan pembelajaran yang konvensional, dimana kegiatan masih terpusat pada guru. Hal ini menyebabkan kurang kebermaknaan siswa dalam pembelajarannnya, yang menyebabkan siswa mudah lupa dan pembelajaran terkesan hanya sebagai proses “ transfer of knowledge” yang tidak memberi kesempatan siswa untuk mengembangkan keterampilannya dalam memecahkan suatu permasalahan. Pembelajaran inkuiri memungkinkan siswa untuk belajar melalui keterlibatan aktif untuk menemukan sendiri konsep-konsep atau prinsip-prinsip pengetahuan yang dipelajari. Berdasarkan pengamatan peneliti pada siswa kelas IV SDN Pejangkungan I diketahui bahwa hanya sedikit siswa memiliki konsep-konsep materi IPA yang melekat, nilai rata-rata pada pembelajaran IPA semester I tahun ajaran 2007/2008 hanya mencapai 52,5. Penelitian ini bertujuan untuk mendeskripsikan pembelajaran IPA dengan model inkuiri siswa Kelas IV SDN Pejangkungan I, meningkatkan kemampuan menemukan konsep gaya, dan meningkatkan hasil belajar siswa. Rancangan digunakan sebagai pedoman dalam melakukan penelitian. Rancangan yang digunakan dalam penelitian ini adalah Penelitian Tindakan Kelas (PTK). Model siklus yang digunakan dalam penelitian ini adalah Model Kemmis dan Taggart, yang terdiri dari beberapa tahap, yaitu: Planning/Perencanaan, Acting and Observing/Tindakan dan Observasi, Reflecting/Refleksi, dan Rervise/Revisi. Penelitian dilakukan di kelas IV SDN Pejangkungan I Kecamatan Rembang, Kabupaten Pasuruan, pada mata pelajaran IPA. Kegiatan penelitian dilaksanakan pada tanggal 10 Januari 2009 sampai dengan 1Maret 2009, dilakukan dalam 2 siklus. Hasil penelitian ditemukan bahwa setelah pembelajaran dengan menggunakan model inquary diperoleh hasil belajar siswa pada pokok bahasan gaya di kelas IV dapat dikemukakan sebagai berikut; a). Siklus I rata-rata nilai post tes siswa adalah 78,1 dimana 16 siswa (83,3%) mendapat nilai di atas rata-rata dan mengalami ketuntasan belajar individu yaitu 75. Sedangkan siswa di bawah rata-rata sejumlah 3 siswa (16,7 %) dan belum mengalami ketuntasan belajar. b). Siklus II Dari 19 siswa yang mendapat nilai antara 75-100 sebanyak 19 siswa (100 % ) dan yang mendapat nilai di bawah 60 tidak ada atau 0 % dengan rata rata kelas sebesar 94.2 % . Hal ini menunjukkan bahwa pembelajaran dengan menggunakan model inquary sudah berhasil dan mencapai ketuntasan belajar. Berdasarkan hasil penelitian dan kesimpulan di atas, saran yang dapat berikan adalah hendaknya pembelajaran inkuiri dapat diterapkan pada mata pelajaran IPA serta mata pelajaran lainnya.

Daya predasi kumbang kubah (Coccenellidae, Coleoptera) terhadap tingkatan instar kutu daun Myzus perciae Sulz / oleh Sri Wahyuni

 

Pemanfaatan koperasi sekolah sebagai laboratorium pembelajaran pemasaran bagi siswa kelas X Pemasaran di SMK Negeri 1 Turen / Pardono

 

ABSTRAK Pardono.2016. PemanfaatanKoperasiSekolahsebagaiLaboratoriumPembelajaranPemasaranbagiSiswaKelas X Pemasaran di SMK N 1 Turen.Skripsi.JurusanManajemen Program Studi S1 Pendidikan Tata NiagaFakultasEkonomiUniversitasNegeri Malang.Pembimbing: (I) Prof. Dr. H. HeriPratikto., M.Si (II) Dr. WeningPatmiRahayu, S.Pd., M.M. Kata kunci: PemanfaatanKoperasiSekolah, LaboratoriumPembelajaranPemasaran. KoperasiSekolahmerupakansalahsatutempatpembelajaran di luarkelasbagisiswasekolahyang digunakansebagaiwadahuntukmengembangkanpribadisetiappesertadidik, khususnyabagisiswajurusanpemasaran.Penelitian di SMK N 1 Tureninidilaksanakandengantujuanmengetahuipengelolaankoperasisekolah di SMK N 1 Turen, mengetahuipemanfaatankoperasisekolahsebagailaboratoratoriumpembelajaranpemasaran,mengetahuiupayasekolahdalammengoptimalkanpemanfaatankoperasisekolahsebagailaboratoriumpembelajaranpemasaran. Penelitianinimenggunakanrancanganpenelitiandeskriptifkualitatif.Sumber data dalampenelitianiniadalahnarasumber (informan) yaitupembimbingkoperasisekolah SMK N 1 Turen, Guru Pemasaran, KaryawanKoperasi, Siswa yang menjadipenguruskoperasi.Teknikpengumpulan data dilakukandenganmenggunakanteknikobservasi, wawancara, dandokumentasi.Kegiatananalisis data dimulaidaritahapreduksi data, penyajian data, danmenarikkesimpulan. Berdasarkanhasilanalisis data tersebutdiperolehkesimpulanbahwa, pengelolaankoperasisekolahsudahberjalandenganbaik.Program-program sudahdijalankansecararutin.Koperasisekolahmemberimanfaatkepadasiswapemasaranuntukbelajarmelakukanjualbeli, saranaberwirausahasecarariil, saranabelajarmengelolausaha, melakukanadministrasi. Saranadanprasarana di koperasisekolah SMK N 1 Turenbelummemenuhistandarlaboratoriumdisebabkanruangankoperasiyang kurangluas. KendaladalammengoptimalkanpemanfaatankoperasisekolahsebagailaboratoriumpembelajaranpemasaranyaitudisebabkankurangadanyakoordinasiantaraKepalasekolah, Pembimbingkoperasi,sehingga Guru kurangmemberikanmotivasikepadasiswauntukmelakukanpraktik di koperasisekolahpadawaktu jam pelajaran. Upaya yang dilakukanuntukmengoptimalkanpemanfaatankoperasisekolahsebagailaboratoriumpembelajaranpemasaranyaituKepalaSekolah, PembimbingKoperasidan para GurumelakukanKoordinasiuntukmemberdayakansiswa, Guru memberimotivasikepadasiswauntukmelakukanpraktik di koperasi. kepalasekolahmelakukanpengadaan/perbaikan/pembangunangedung di koperasisekolah. Berdasarkanpaparan data temuanpenelitian, penelitimenyarankankoperasisekolahhendaknyamenambahkan unit usaha lain sepertifoto copy, dan juga simpanpinjam.KepalaSekolah, PembimbingKoperasi, dan para Guru melakukankoordinasiuntukmemberdayakansiswamelakukanpraktik di koperaasisekolah.KepalaSekolahhendaknyamemberikanataumemperluasruangankoperasi.Guru hendaknyamemberikanmotivasikepadasiswauntukmelakukanpraktik di koperasisekolah.

Rancang bangun sistem pelacak sumber panas dengan menggunakan sensor LM35 pada bidang 2 dimensi berbasis komputer / oleh Afinatuz Zuhriyah

 

Pengembangan modul pembelajaran pelayanan penjualan untuk siswa kelas XII Pemasaran (studi pada siswa Program Keahlian Pemasaran SMKN 1 Pasuruan) / Desy Anisah Fatmawati

 

ABSTRAK Fatmawati, Desy Anisah. 2016. Pengembangan Modul Pembelajaran Pelayanan Penjualan Untuk Siswa Kelas XII Pemasaran (Studi Pada Siswa Program Keahlian Pemasaran SMKN 1 Pasuruan). Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (1) Prof. Dr. H. Heri Pratikto, M.Si., (2)Dr. Aniek Indrawati, S.Si., M.M. Kata Kunci: pengembangan modul, pelayanan penjualan. Modul adalah salah satu bentuk bahan ajar berbasis cetakan yang dirancang untuk belajar secara mandiri oleh siswa. Modul dipilih dengan beberapa pertimbangan. Pertama, karena modul merupakan bahan ajar yang digunakan siswa untuk belajar secara mandiri. Kedua, modul dibuat berdasarkan kurikulum yang ada dan disesuaikan dengan karakteristik siswa sehingga penggunaan modul menjadi lebih baik dibandingkan bahan ajar lain yang belum tentu sesuai dengan kurikulum. Ketiga, pemilihan bahan ajar harus disesuaikan situasi dan kondisi dari siswa. Modul memungkinkan siswa untuk mempelajari tiap materi dengan durasi waktu yang lebih lama sehingga siswa dapat menemukan pemahamannya sendiri meski tanpa pengawasan guru dikelas. Tujuan pengembangan modul pembelajaran Pelayanan Penjualan adalah menghasilkan modul pembelajaran Pelayanan Penjualan sesuai dengan kurikulum 2013 kompetensi dasar Melakukan Konfirmasi Keputusan Pelanggan dan Melakukan Pelayanan Purna Jual kelas XII Program Keahlian Pemasaran SMK Negeri 1 Pasuruan yang valid dan efektif. Tahap penelitian dan pengembangan yang digunakan pada penelitian ini yaitu menggunakan penelitian Research and Development berdasarkan model dari Borg dan Gall dalam Sugiyono (2013:409) menggunakan tujuh tahap yaitu potensi masalah, pengumpulan data, desain produk, validasi desain, revisi desain, uji coba pengguna, revisi produk. Modul di validasi oleh 2 ahli penulisan modul, 2 ahli materi modul 30 siswa sebagai uji coba pengguna (user). Pengukuran penilaian validasi ahli dan respon siswa menggunakan skala Likert. Berdasarkan hasil validasi menunjukkan, validasi dari ahli penulisan modul sebesar 84% (Valid), rata-rata validasi ahli materi modul sebesar 90% (Sangat Valid), dan rata-rata penilaian oleh pengguna modul sebesar 88% (Sangat Valid). Sehingga dapat disimpulkan bahwa pengembangan modul Pelayanan Penjualan yang telah dikembangkan dinyatakan sangat valid atau sangat layak sebagai bahan ajar di SMKN 1 Pasuruan. Beberapa saran yang terkait dengan pengembangan modul pembelajaran Pelayanan Penjualan adalah Saran pemanfaatan dan Diseminasi.Saran pemanfaatan adalah pemanfaatan modul Pelayanan Penjualan yang tervalidasi sebaiknya digunakan oleh sekolah yang telah melaksanakan kurikulum 2013 sebagai acuan dalam melaksanakan kegiatan pembelajaran. Selain itu, diharapkan pengguna memiliki referensi tambahan sebagai sumber belajar untuk melengkapi pengembangan modul Pelayanan Penjualan yang tervalidasi.Sedangkan diseminasi adalah pemanfaatan modul pembelajaran bisa lebih dioptimalkan, jika modul pembelajaran ini dapat digunakan oleh siswa kelas XII Pemasaran. Misalnya guru atau sekolah dapat menyebarluaskan pemakaian modul yang telah tervalidasi pada guru MGMP SMK Program Keahlian Pemasaran sehingga sekolah lain dapat memanfaatkan modul sebagai salah satu sumber belajar.

Studi tentang upaya mengembangkan kemampuan bersosialisasi anak di kelompok bermain Yaa Bunayya Hidayatullah Surabaya
Budiyati

 

Pengembangan media pembelajaran Computer Assisted Instruction (CAI) berbasis Problem Based Learning (PBL) materi sistem ekskresi untukj meninngkatkan kemampuan berpikir kritis sikap spiritual dan sikap sosial peserta didik kelas XI SMA Panjura Malang / Firza Dwi Hasana

 

ABSTRAK Hasanah, Firza Dwi. 2015. Pengembangan Media Pembelajaran Computer Assisted Instruction (CAI) berbasis Problem Based learning (PBL) Materi Sistem Ekskresi untuk Meningkatkan Kemampuan Berpikir Kritis, Sikap Spiritual, dan Sikap Sosial Peserta Didik Kelas XI SMA PANJURA Malang. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Hj. Mimien Henie Irawati, M.S, (II) Dr. H. Abdul Gofur, M.Si. Kata Kunci: media pembelajaran CAI berbasis PBL, sistem ekskresi, berfikir kritis, sikap spiritual, sikap sosial, SMA PANJURA Malang. Media pembelajaran dibutuhkan dalam pembelajaran agar pesan yang ada dalam materi pelajaran dapat tersampaikan dengan baik dan proses pembelajaran dapat berjalan dengan baik. Media pembelajaran di SMA Panjura Malang masih menggunakan power point. Power point kurang bisa representatif terutama untuk materi yang rumit seperti sistem ekskresi. Selain itu, kemampuan berfikir kritis masih kurang berdasarkan hasil observasi di SMA PANJURA Malang. Padahal kemampuan berfikir kritis penting untuk pemahaman materi secara komprehensif. Kemampuan berfikir kritis dapat ditingkatkan melalui Problem Based Learning (PBL). Penanaman sikap sosial dan spiritual juga masih kurang di SMA PANJURA Malang. Sehingga diperlukan media pembelajaran interaktif atau Computer Assisted Instruction (CAI) berbasis PBL materi sistem ekskresi untuk meningkatkan kemampuan berfikir kritis, sikap sosial dan sikap spiritual. Tujuan dari penelitian ini adalah untuk mengembangkan media pembelajaran Computer Assisted Instruction (CAI) berbasis PBL materi sistem ekskresi dengan harapan dapat meningkatkan kemampuan berfikir kritis, sikap spiritual dan sikap sosial, mengetahui keefektifan, kepraktisan dan kelayakan media yang dikembangkan. Media pembelajaran CAI ini dikembangkan berdasarkan model Thiagarajan 4-D namun tanpa tahap Disseminate karena tidak dilakukan uji coba dalam skala luas. Data pada penelitian ini terdiri dari data kuantitatif dan data kualitatif. Data kuantitatif diperoleh dari pengisian angket validasi oleh validator ahli materi, validator ahli media, validator ahli praktisi lapangan untuk menentukan kevalidan media, sedangkan validator peserta didik untuk menentukan kepraktisan dan keefektifan, dimana semua data nantinya akan dikonversi dalam bentuk persen (%). Data kualitatif berupa saran dan komentar dari pada validator. Berdasarkan hasil analisis diperoleh hasil persentase kevalidan sebesar 91,39%, 94,79%, 89,76% dari validator ahli materi, validator ahli media, validator ahli praktisi lapangan dengan kriteria sangat valid. Tingkat keefektifan diperoleh gain-score sebesar 0,7 yang berarti efektifitas sedang. Tingkat kepraktisan diperoleh hasil sebesar 90,28% dengan kriteria sangat valid. Berdasarkan hasil validasi yang diperoleh maka dapat disimpulkan bahwa media CAI berbasis PBL materi sistem ekskresi sangat layak untuk digunakan.

Pemanfaatan gelombang radio FM sebagai pentransmisi data hasil pengukuran ketinggian air / oleh Muhamad Mas'ud

 

Pengaruh beban pajak tangguhan, aktiva pajak tangguhan dan kompensasi terhadap manajemen laba (studi pada perusahaan manufaktur sektor industri dasar dan kimia yang terdaftar di BEI tahun 2010-2014) / Yuzvi Esia Ramadani

 

ABSTRAK Ramadani, Yuzvi Esia. 2016. Pengaruh Beban Pajak Tangguhan, Aktiva Pajak Tangguhan dan Kompensasi Manajemen Terhadap Manajemen Laba (Studi Pada Perusahaan Manufaktur Sektor Industri Dasar dan Kimia yang Terdaftar di Bursa Efek Indonesia Tahun 2010-2014). Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing : (I) Hj. Yuli Widi Astuti, S.E., M.Si., Ak., (II) Nujmatul Laily, S.Pd.,M.SA. Kata Kunci: Beban Pajak Tangguhan, Aktiva Pajak Tangguhan, Kompensasi Manajemen, Manajemen Laba Tujuan penelitian ini adalah untuk menguji pengaruh beban pajak tangguhan, aktiva pajak tangguhan dan kompensasi manajemen terhadap manajemen laba. Penelitian ini menggunakan pendekatan kuantitatif karena menekankan pada pengujian teori-teori melalui pengukuran variabel-variabel penelitian dengan angka dan melakukan analisis data dengan prosedur statistik. Populasi yang digunakan adalah perusahaan manufaktur sektor industri dasar dan kimia yang terdaftar di Bursa Efek Indonesia tahun 2010-2014 sebanyak 71 perusahaan. Sampel dalam penelitian ini sebanyak 26 perusahaan, teknik pengambilan sampel mengunakan metode purposive sampling dan teknik analisis data menggunakan statistik deskriptif dan logistic regression. Hasil penelitian menunjukan bahwa beban pajak tangguhan dan aktiva pajak tangguhan tidak berpengaruh signifikan terhadap manajemen laba, sedangkan kompensasi manajemen berpengaruh signifikan terhadap manajemen laba. Keterbatasan penelitian ini menggunakan data sekunder yang berasal dari annual report dan sustainability report. Obyek penelitian hanya pada satu sektor perusahaan manufaktur yaitu sektor industri dasar dan kimia. Saran yang diajukan dalam penelitian ini yaitu bagi investor selalu menggunakan standar akuntansi dalam memberikan penilaian atas pencapaian kinerja keuangan perusahaan dan untuk penelitian selanjutnya diharapkan menggunakan variabel lain yang mempengaruhi terjadinya praktik manajemen laba sehingga hasil penelitian ini dapat berkembang.

Pengaruh ion NO3 , SO4 dan volume adsorbat terhadap adsorbsi ion Dc2+ dalam air oleh serbuk gergaji kayu lamtoro gung (Leucaena leucocephala) dan arangnya serta arang komersial / oleh R.A. Syukuri Nikmah

 

Isolasi karagenan fraksi larut dalam KCL 2,5% dari alga merah Eucheuma spinosum dan uji aktivitasnya sebagai adsorben ion Cr(III) / oleh Dina Marini

 

Pengaruh struktur modal, pertumbuhan perusahaan dan pengungkapan corporate social responsibility terhadap nilai perusahaan pada perusahaan pertambangan yang terdaftar di BEI periode 2012-2014 / Lukhi Ati Nuroh

 

ABSTRAK Nuroh, Lukhi Ati, 2016. Pengaruh Struktur Modal, Pertumbuhan Perusahaan dan Pengungkapan Corporate Social Responsibility Terhadap Nilai Perusahaan pada Perusahaan Pertambangan yang Terdaftar di BEI Periode 2012-2014. Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Dr. Hj. Puji Handayati, S.E., M.M., Ak, CA, CMA. (2) Sawitri Dwi Prastiti, S.E., M. Si., Ak. Kata Kunci: Nilai Perusahaan, struktur modal, pertumbuhan perusahaan dan Corporate Social Responsibility Peningkatan nilai perusahaan sangat penting karena memcerminkan kinerja perusahaan yang dapat dilihat dari kinerja keuangan atau kinerja sosialnya. Penelitian ini bertujuan untuk memperoleh bukti empiris tentang pengaruh struktur modal, pertumbuhan perusahaan dan pengungkapan Corporate Social Responsibility terhadap nilai perusahaan pada perusahaan pertambangan yang ada di Indonesia, dimana nilai perusahaan diukur dengan Per Book Value (PBV). Populasi dari penelitian ini adalah semua perusahaan pertambangan yang terdaftar di Bursa Efek Indonesia (BEI) dari tahun 2012 sampai tahun 2014. Pengambilan sampel dalam penelitian ini menggunakan metode purposive samping. Total sampel penelitian adalah 13 perusahaan dengan tiga tahun pengamantan. Jadi total sampel yang diteliti adalah 39 perusahaan. Analisis data yang dilakukan dengan uji asumsi klasik dan pengujian hipotesis dengan metode regresi linier berganda. Hasil penelitian ini menunjukkan bahwa (1) struktur modal berpengaruh negatif dan signifikan terhadap nilai perusahaan (2) variabel pertumbuhan perusahaan tidak berpengaruh terhadap nilai perusahaan dan (3) Pengungkapan Corporate Social Responsibility berpengaruh positif terhadap nilai perusahaan. Keterbatasan penelitian ini adalah variabel struktur modal, pertumbuhan perusahaan dan pengungkapan CSR hanya berpengaruh 15,1% terhadap nilai perusahaan sehingga disarankan untuk penelitian selanjutnya dapat menggunakan atau menambah variabel lain yang tidak digunakan dalam penelitian ini. Terdapat unsur subjektifitas dalam menentukan indeks pengungkapan sehingga dapat menimbulkan persepsi yang berbeda pada setiap peneliti sehingga disarankan untuk penelitian selanjutnya menggunakan pedoman pengungkapan CSR terbaru.

Homomorfisma dan Isomorfisma Grup / oleh Eka Wahyu Hidayati

 

Pengaruh susu kambing peranakan etawa terhadap kulaitas spermatozoa mencit (Mus musculus) galur Balb/C / Halimatus Sa'diyah

 

ABSTRAK Sa’diyah, Halimatus. 2015. Pengaruh Susu Kambing Peranakan Etawa terhadap Kualitas Spermatozoa Mencit (Mus musculus) Galur BALB/ C. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dra. Amy Tenzer, M. S, (II) Dra. Hj. Nursasi Handayani, M. Si Kata Kunci : Susu kambing peranakan etawa, Kualitas spermatozoa, Konsentrasi, Morfologi normal, dan Motilitas. Susu kambing PE merupakan susu yang dihasilkan oleh kambing persilangan kambing Etawa dari India dengan kambing Kacang (lokal). Susu kambing PE memiliki kandungan vitamin A, kalsium, protein, lemak, vitamin D dan asam lemak esensial yang lebih tinggi dibandikan dengan susu sapi. Susu kambing bisa menjadi alternatif bagi konsumen yang alergi terhadap susu sapi. Penelitian ini bertujuan untuk mengetahui pengaruh susu kambing PE terhadap kualitas sperrmatozoa yang meliputi konsentrasi, morfologi normal, dan motilitas mencit. Penelitian dilakukan di Kandang Pemeliharaan Hewan dan di Laboratorium Struktur Perkembangan dan Taksonomi Hewan Fakultas MIPA Universitas Negeri Malang, pada bulan Januari 2015-Februari 2015. Hewan coba yang digunakan adalah mencit jantan galur Balb/ C umur 8-10 minggu dengan berat 22 ± 2 gram. Mencit dibagi secara acak ke dalam empat kelompok perlakuan yaitu (0; 0,25; 0,5 dan 0,75) ml/ 20 g BB dengan enam kali ulangan. Susu kambing PE diberikan per oral secara gavage setiap hari selama 36 hari. Hari ke-37 mencit dibedah. Epididimis diambil kemudian dicacah dalam 1 ml NaCl 0,9% sehingga terbentuk suspensi yang digunakan untuk mengukur kualitas spermatozoa secara mikroskopis. Data konsentrasi, morfologi normal dan motilitas spermatozoa dianalisis dengan Anava dengan taraf signifikansi 5%, jika hasilnya signifikan dilanjutkan uji lanjut Duncan. Data menunjukkan bahwa secara nominal konsentrasi, morfologi normal, dan motilitas spermatozoa cenderung meningkat seiring dengan penambahan dosis susu kambing PE. Hasil analisis statistik menunjukkan bahwa sampai dengan dosis 0,75 ml/ 20 g BB susu kambing PE tidak berpengaruh signifikan terhadap konsentrasi, dan motilitas spermatozoa tetapi berpengaruh signifikan terhadap peningkatan morfologi normal spermatozoa.

Adaptasi sosial masyarakat Madura Pendalungan di Pedukuhan Baran Kawasan Gunung Buring Malang / Lutmiati

 

Hubungan kepribadian dan kemandirian bertugas dengan kesuksesan karir keguruan guru bidang Keahlian TIK SMK Negeri di Kota Malang / Rizal Nur Hadi

 

Rendemen dan karakter minyak kulit biji jambu mete (CNSL) yang diperoleh dari metode maserasi, soxhlet, dan refluks dengan n-Heksana sebagai pelarut / Yuniarti

 

Manajemen kesiswaan di rintisan sekolah bertaraf internasional (RSBI) (Studi kasus di SMP Negeri 1 Pamekasan) / Novita Setiyawati

 

Kata kunci: manajemen kesiswaan, rintisan sekolah bertaraf internasional Pendidikan merupakan kontribusi yang sangat besar terhadap kemajuan suatu bangsa. Melalui pendidikan, akan ditentukan secara langsung bagaimana kualitas sumber daya manusia yang akan dihasilkan oleh bangsa tersebut. Kenyataan inilah yang mendorong pemerintah untuk melaksanakan program Sekolah Bertaraf Internasional (SBI). Program ini merupakan salah satu upaya untuk meningkatkan mutu pendidikan Indonesia agar setara dengan negara-negara lain, sehingga mutu lulusannya memiliki daya saing yang tinggi di kancah internasional. Tahap penyelenggaraan SBI dimulai pada fase rintisan terlebih dahulu, selanjutnya menuju fase kemandirian. Rintisan SBI adalah sekolah yang melaksanakan atau menyelenggarakan pendidikan bertaraf internasional, dimana baru sampai pada fase pengembangan kemampuan pada berbagai komponen sekolah untuk memenuhi Indikator Kinerja Kunci Minimal (IKKM) dan Indikator Kinerja Kunci Tambahan (IKKT) sesuai dengan kriteria yang ditetapkan. Manajemen sekolah merupakan salah satu komponen yang harus ditingkatkan oleh rintisan sekolah bertaraf internasional. Sedangkan salah satu substansi manajemen sekolah yang memerlukan pengembangan adalah manajemen kesiswaan. Pengembangan manajemen kesiswaan di RSBI sangat diperlukan untuk mengatur segala kebutuhan siswa yang nantinya diharapkan menjadi output dan outcomes yang berkualitas dan mampu bersaing dengan output dan outcomes dari negara lain. Pengembangan tersebut meliputi semua kegiatan yang berkaitan dengan siswa mulai dari siswa tersebut masuk sampai dengan lulus dari sekolah tersebut. Penelitian ini menggunakan metode atau pendekatan kualitatif yang berlokasi di SMP Negeri 1 Pamekasan. Fokus penelitian ini antara lain: (1) Sistem Seleksi Penerimaan Siswa Baru di RSBI SMP Negeri 1 Pamekasan, (2) Pembinaan Olimpiade Sains Nasional (OSN) bagi Siswa di RSBI SMP Negeri 1 Pamekasan, (3) Upaya Sekolah Mengembangkan Bakat dan Minat Siswa di RSBI SMP Negeri 1 Pamekasan, dan (4) Upaya Sekolah Meningkatkan Kedisiplinan Siswa di RSBI SMP Negeri 1 Pamekasan. Teknik pengumpulan data yang digunakan meliputi: (1) teknik observasi, (2) teknik wawancara mendalam, dan (3) teknik dokumentasi. Informan dalam penelitian ini terdiri dari: (1) wakil kepala sekolah, (2) penanggungjawab RSBI SMP Negeri 1 Pamekasan, (3) Penanggungjawab Kesiswaan urusan pengembangan diri dan prestasi sekaligus guru BK, (4) pembina OSIS, dan (5) beberapa siswa. Data yang diperoleh iv kemudian dianalisis dengan melakukan reduksi data, display data, dan verivikasi data atau kesimpulan. Untuk memperoleh keabsahan data, dilakukan perpanjangan keikutsertaan, ketekunan pengamatan, serta uji triangulasi sumber data dan metode. Hasil yang diperoleh dari penelitian ini untuk masing-masing fokus penelitian diinformasikan sebagai berikut: (1) sistem seleksi penerimaan siswa baru di RSBI SMP Negeri 1 Pamekasan menggunakan kebijakan dari Direktorat SMP, sedangkan kebijakan operasionalnya disesuaikan dengan kondisi sekolah. Peserta diseleksi kemampuan akademik dan non akademiknya. Semua guru dan staf TU turut dilibatkan sebagai panitia PSB. (2) pembinaan OSN bagi siswa di RSBI SMP Negeri 1 Pamekasan dilakukan dengan mengadakan kegiatan Sains Club dan Potensial Club, serta bekerjasama dengan lembaga-lembaga olimpiade. Sekolah memiliki wewenang untuk memilih siswa berbakat sains untuk mengikuti OSN tingkat kabupaten. Pembinaan terus dilakukan sampai siswa mengikuti OSN tingkat nasional. (3) upaya sekolah mengembangkan bakat dan minat siswa di RSBI SMP Negeri 1 Pamekasan yaitu dengan menyediakan kegiatan ekstrakurikuler untuk mengembangkan bakat dan minat non akademik (keagamaan, seni dan olahraga), serta membentuk OSIS untuk mengembangkan bakat dan minat kepemimpinan dan berorganisasi. (4) upaya sekolah meningkatkan kedisiplinan siswa di RSBI SMP Negeri 1 Pamekasan yaitu dengan sosialisasi tata tertib siswa melalui Buku Pribadi Siswa dan menempelnya di setiap kelas. Sekolah menggunakan sistem scoring untuk setiap pelanggaran yang dilakukan siswa. Semua personil sekolah, khususnya guru BK dan kepala sekolah, serta warga sekitar turut terlibat dalam peningkatan kedisiplinan. Saran dalam penelitian ini ditujukan kepada: (1) kepala RSBI SMP Negeri 1 Pamekasan, agar kepala sekolah hendaknya mulai menerapkan pendaftaran secara online untuk penerimaan siswa baru di RSBI SMP Negeri 1 Pamekasan. Sehingga bisa terakses oleh para peserta PSB tanpa harus datang langsung ke sekolah. Selain itu, hendaknya kepala sekolah dapat mengembangkan kegiatankegiatan manajemen kesiswaan lainnya, sehingga bisa meningkatkan kualitas pelayanan bagi para siswanya. (2) guru dan karyawan SMP Negeri 1 Pamekasan, agar selalu turut terlibat dalam upaya peningkatan kedisiplinan siswa. Salah satunya dengan memiliki tingkat disiplin yang tinggi agar menjadi contoh bagi para siswanya. (3) orang tua/wali siswa, agar selalu memilih sekolah yang berkualitas untuk pendidikan putra-putrinya. Selain itu, peran orang tua/wali siswa sangat dibutuhkan untuk selalu mendukung dan memantau perilaku anak agar terhindar dari hal-hal yang negatif. (4) kepala sekolah lain, agar mengambil contoh positif dalam penerapan manajemen kesiswaan yang telah dilakukan di RSBI SMP Negeri 1 Pamekasan, sehingga nantinya bisa diterapkan di sekolahnya. (5) pengelola jurusan administrasi pendidikan, agar menambah referensi mengenai program SBI dan manajemen kesiswaan, dan (6) peneliti lain, agar dapat melakukan penelitian sejenis yang berkaitan dengan manajemen kesiswaan di RSBI dengan fokus penelitian pada ruang lingkup manajemen kesiswaan yang belum diteliti pada penelitian ini.

Pengaruh ion NO3- dan SO42- terhadap adsorpsi ion Cd2+ oleh sekam padi dan arangnya serta arang komersial sebagai adsorben ion Cd2+ dalam air / Sherly Hastari Haristanti

 

Peranan organisasi peserta Pemilihan Umum (PPP, Golkar, PDI) dalam pelaksanaan Pemilihan Umum 1992 terhadap sistem Pemerintahan di Kotamadya Malang / oleh Endah Setyowati

 

Pembelajaran matematika realistik untuk meningkatkan aktivitas dan hasil belajar materi luas bangun datar siswa kelas VI SD / Wiwin Sudarmawan

 

ABSTRAK Sudarmawan, Wiwin. 2015. Pembelajaran Matematika Realistik untuk Meningkatkan Aktivitas dan Hasil Belajar Materi Luas Bangun Datar Siswa SD Kelas VI. Tesis Program Studi Pendidikan Dasar, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M.Pd., (II) Dr. M. Ramli, M.A. Kata kunci: pembelajaran matematika realistik, aktivitas, hasil belajar Hasil belajar matematika materi luas bangun datar siswa kelas VI SD Negeri Jetak, Sentolo, Kulon Progo Tahun ajaran 2014/2015 masih rendah. Berdasarkan hasil observasi guru saat pembelajaran, masih menggunakan metode konvensional dan tidak melibatkan aktivitas siswa. Pembelajaran konvensional mentransfer pengetahuan dengan berlatih dan mencatat. Pembelajaran yang dilakukan belum berpusat pada siswa dan tidak mengaitkan dengan dunia nyata sebagai landasan berpikir anak SD. Pembelajaran merupakan salah satu aktivitas manusia, agar efektif diperlukan pembelajaran yang variatif. Pembelajaran Matematika Realistik dapat dijadikan alternatif untuk membelajarkan matematika agar masalah lebih nyata dan persoalan mudah diselesaikan. Penelitian ini bertujuan untuk meningkatkan aktivitas dan hasil belajar. Untuk mengetahui hasilnya, peneliti melakukan pengamatan aktivitas pembelajaran pada guru dan siswa, selain itu dilakukan tes pada akhir siklus. Pembelajaran Matematika Realistik pada penelitian ini menggunakan3 langkah Pertama, Kegiatan Awal yaitu pembukaan, Kedua Kegiatan Inti yang berisi langkah-langkah pembelajaran matematika realistik (1) memahami masalah kontekstual, (2) menyelesaikan masalah kontekstual, (3) membandingkan dan mendiskusikan jawaban, dan(4) menyimpulkan.Ketiga, Penutup dengan pesan anak rajin belajar agar nilainya meningkat. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK). Penelitian dilaksanakan sejak bulan Oktober 2014 sampai bulan Maret 2015 di SD Negeri Jetak, Sentolo, Kulon Progo. PTK ini dilaksanakan dua siklus menggunakan model Kemmis dan Mc Taggart yang meliputi: tahap perencanaan, pelaksanaan tindakan, observasi/evaluasi dan refleksi. Hasil penelitian menunjukkan Aktivitas Belajar siswa dari siklus I sebesar 75% menjadi 78,1% pada siklus II. Aktivitas pembelajaran yang dilakukan guru juga mengalami peningkatan dari siklus I sebesar 92% menjadi 94,2%. Hasil penelitian Hasil Belajar terjadi peningkatan dari siklus I nilai rata-rata 69,4 dengan ketuntasan belajar 53% menjadi 80,8 ketuntasan belajar 82,5% pada siklus II. Ketertarikan siswa dilihat dari hasil angket, siswa merasa senang . Hasil catatan lapangan pada aktivitas guru dan siswa menunjukkan pembelajaran ini melakukan sintak pembelajaran matematika realistik. Hasil wawancara menunjukkan bahwa siswa menyenangi pembelajaran ini. Kesimpulan penelitian ini adalah Pembelajaran Matematika Realistik dapat Meningkatkan Aktivitas dan Hasil Belajar Materi Luas Bangun Datar Siswa SD Kelas VI. Saran yang dapat penulis sampaikan kepada Kepala Sekolah dan guru agar mendesain pembelajaran matematika realistik lebih inovatif dan mudah memahamkan anak.

Analisis kesalahan konsep materi ikatan kovalen melalui gambaran mikroskopik pada siswa kelas III IPA-1 MAN Malang 1 tahun ajaran 2004/2005 / oleh Khotimatuz Zuhrufah

 

Seni pertunjukan lamut Kalimantan Selatan : analisis pertunjukan, fungsi, dan struktur / oleh Sabhan

 

A Pragmatic analysis of speech acts in the dialogues of senior secondary school english textbook / by Fauzuddin

 

Pengadaan, pemberdayaan dan mempertahankan karyawan pada industri distro dan clothing company di Kota Malang / I Gusti Ratu Ayu Purnamasari

 

ABSTRAK Purnamasari, I GustiRatuAyu. 2016. Pengadaan, PemberdayaandanMempertahankanKaryawanpadaIndustriDistrodan Clothing Company di Kota Malang. Skripsi, JurusanManajemenFakultasEkonomiUniversitasNegeri Malang. Pembimbing (1) Dr. Syihabudhin, S.E., M.Si. (2) LohanaJuariyah, S.E., M.Si. Kata Kunci :Rekrutmen, Seleksi, PemberdayaanKaryawan, Kompensasi Persaingan yang semakinmeningkatmenuntuttiapdistrodanclothing company di Kota Malanguntuktanggapmenghadapikondisisertamempertahankaneksistensimereka.Industridistrodanclothing companyharusbisamemperolehkaryawan yang sesuaidengankebutuhan. Tahapan yang paling awalyaitupengadaankaryawanmelaluirekrutmendanseleksi, selanjutnyaperludilakukanpermberdayaankaryawangunamemunculkan potensi yang ada dalam diri karyawan.Tugaslebihlanjutyaitumempertahankankaryawannyadenganmemberikankompensasisecarafinasialdan non finansial.Penelitianinibertujuanuntukmengetahuimetoderekrutmendanseleksikaryawan, bentukpemberdayaankaryawan, sertaupayamempertahankankaryawanpadaindustridistrodanclothing company di kota Malang. Pendekatanyang digunakanadalahpendekatankualitatifberjenisfenomenologi. Objekpenelitianberjumlah 4 distrodanclothing company. Teknikpengumpulan data menggunakanwawancara, observasidandokumentasi. Pengecekankeabsahantemuanmenggunakantriangulasi data, diskusidengantemansejawatdanujidependabilitas. Hasilpenelitianmenunjukkan,rekrutmendanseleksi diindustridistrodanclothing company di Kota Malang menggunakansumber internal daneksternaltergantungjabatan yang akandiisi; media sosiallebihbanyakdigunakandibandingkan media massakoransebagai media informasi; tidakadaperiodesasidantidakterdapatkendala yang besardalampelaksanaanrekrutmen; secaragarisbesartahapanseleksi yang dilakukansamayaitupengecekansuratlamarandanformulir, wawancara, tespraktekkerja, training dankontrakkerja; aspek yang dinilaidalamseleksiyaitusikapdankemampuanberkomunikasi, kemampuanbekerja, pengetahuandanpenampilanfisikpelamar. Pemberdayaankaryawawan yang dilakukanyaitupemberianwewenang, tanggungjawabdanpengambilankeputusandalammenyelesaikantugas; melibatkankaryawandalammerancangkonsepstore danmelaksanakanevent. Untukmempertahankankaryawan,industridistrodanclothing companymemberikankompensasifinansialdankompensasi non finansial. Saran yang diberikankepadapelakuusaha di industridistrodanclothing company di kota Malangadalahbagi yang belummenggunakan media sosialsebagai media informasidapatmempertimbangkanpenggunaan media sosial; menambahkantespraktekkerjadalamtahapanseleksiuntukmengetahuikemampuandasarpelamar; lebihmelibatkankaryawanuntukmendesainproduk,dapatlebihmewadahimasukandarikaryawanmengenaiproduk yang sedangtrendandigemaripasar; mengadakanliburansingkatsebagaikompensasiuntukkaryawandanmemberikanpenghargaanberupa “best employee” setiapbulan.

Efektivitas sistem modul mata pelajaran IPS pada SMP Terbuka di kecamatan Pogalan kabupaten Trenggalek / oleh Siti Kusrinimiati

 

Pengembangan bahan ajar menggunakan pendekatan saintifik untuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis pada materi asam basa dan titrasi / Nur Lailiyah Zafi

 

ABSTRAK Zafi, NurLailiyah. 2015. PengembanganBahan Ajar MenggunakanPendekatanSaintifikuntukMengeksplisitkanHakikatSains (NOS) danBerpikirKritispadaMateriAsamBasadanTitrasi. Skripsi,Jurusan Kimia, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: (I) Dra. SriRahayu, M.Ed., Ph.D.(II) Dr. Yahmin, S.Pd.,M.Si. Kata Kunci: bahan ajar, literasisains, pendekatansaintifik, hakikatsains (NOS), berpikirkritis Kesulitanpembelajarankimia di SMA khususnyapadamateriasamdanbasadisebabkanolehkurangnyapemahamansiswaterhadapketerkaitanantaratigaaspekrepesentasi.Selainitu, berdasarkanpenelitian yang dilakukanoleh PISA, rendahnyakemampuanberliterasisainssiswa Indonesiajugadapatmenyebabkanterjadinyakesulitanbelajartersebut.Kurangnyakemampuansiswadalamhalmengaitkantigaaspekrepresentasidalambelajarkimiadanrendahnyakemampuanliterasisainsdapatdisebabkanolehbahan ajar yang tersediatidakdapatmenunjangketerampilan-keterampilantersebut.Peningkatankemampuanberliterasisainssiswadapatdilakukandenganmengeksplisitkanhakikatsainsdanberpikirkritisdalampembelajaran.Pengembanganbahan ajar inibertujuanuntukmenghasilkanprototipebahan ajar menggunakanpendekatansaintifikuntukmegeksplisitkanhakikatsains (NOS) danberpikirkritispadamateriasambasa, danuntukmengetahuitingkatkelayakandariprototipebahan ajar melaluivalidasibahan ajar tersebut. Model pengembangan yang digunakanadalah model pengembangan 4D yang terdiridariempattahapyaitu, tahapmembatasi (define), merancang (design), mengembangkan (develop), danmenyebarkan (disseminate). Namun model 4D yang digunakandalampenelitianinihanyaterbatassampaitahapdevelop, dantidaksampaipadatahapdisseminate. Bahan ajar hasilpengembanganinidivalidasiolehdosenjurusankimiadan guru matapelajarankimiasebagai validator ahlidan validator praktisi.Validasidilakukanuntukmendapatkan data berupapenilaiandan saran-saran terhadapprototipebahan ajar hasilpengembangan. Hasilpengembanganiniberupaprototipebahan ajar yang terdiridaribukusiswadanbukupanduan guru.Bukusiswamemuatmateriasambasadantitrasidanbukupanduan guru berisipengantarpembelajaranmenggunakanpendekatansaintifik,petunjukpenggunaanbukusiswa, silabus, RPP, daninstrumenpenilaian. Dari hasilvalidasibahan ajar secarakeseluruhandiperolehnilai rata-rata 84,1% untukbukusiswadengankriteriasangatlayakdan 91,7% untukbukupanduan guru dengankriteriasangatlayak. Olehkarenaitudapatdisimpulkanbahwabahan ajar menggunakanpendekatansaintifikuntukmengeksplisitkanhakikatsains (NOS) danberpikirkritispadamateriasambasadantitrasisangatlayakuntukditerapkandalampembelajaran.

Pengaruh pembelajaran kontekstual model kooperatif dan tutorial sebaya dibandingkan dengan pembelajaran konvensional pokok bahasan listrik arus searah terhadap prestasi siswa kelas II SMU Laboratorium Universitas Negeri Malang / oleh Hamid Arif Shodiqi

 

Pembelajarakne lompokm erupakanb entukp embelajarayna nge fektif dalam praktekp embelajarand an banyakd ipakai oleh guru-guruI PA. Pembelajarante rsebut dalamp embentukannymae nerapkapno la-polat ertentus epertpi olat utorials ebaya danp olak ooperatif,s ehinggad ari pola-polat ersebutd iharapkante rciptap ola interaksdi iantaraa nggotak elompok yang nantinyam ampum engangkapt restasi belajamr ereka Penelitianin i bertujuanu ntukm engetahuei fektifitasm odelp embelajaran kelompokd enganp ola tutorial sebayad an pola kooperatifdibandingkand engan pembelajarakno nvensionatel rhadapp restasbi elajars iswa. Jenisp enelitianin i adalahp enelitiane ksperimend engan3 sampetle rpisah dalams atup opulasiR. ancangapne nelitiany angd ikembangkaand alahr andomized pre-testpost-testcontrolgroupdesigTne. knikpengambilasna mpled enganra ndom samplings ecarau ndian,k emudianu ntuk menentukank elompokm anay ang memperolephe rlakuantu torial sebayad ank ooperatifd ipilih dari nilai ujian Semester I. Untukm engujih ipotesisy angi sinyau ntuk mengetahuai danyap erbedaayna ng nyataa ntarat iga metodey ang digunakant eknik uji-t dan untuk mengetahuki elompok manay angp alinge fektif untukm eningkatkanp restassi iswad ilakukana naiisis Scheffete st. Dari hasila nalisism enggunakaann alisisv arians atujalany angd igunakan untukm embandingkabne berapak elompoko byek penelitians ecaras erentaku ntuk satuje nisv ariabepl restasdi idapatF ni*e: 25.71d anF 1u6: "17 .89p adat araf signifikans5i Vod engand b (2 versus6 6), karenaF i,it*e> Fraurm, akad ari data tersebuat dap erbedaany ang signitikan dalam hal prestasib elajarf isika antara kelompokt utorial sebayak, ooperatif dan konvensional.U ntuk mengetahuki elompok mana yang memiliki prestasi lebih baik, maka dilakukan Scheffe test pada taraf signifikans5i o/od engand b (2 versus4 4) dand idapatkanh asil.t 1-2: ti,it*e- 4.781> \^1''11.97s9e, hinggam etodet utorials ebayale bih efektif dari padak onvensional. Padatr -:: t61*,g-1 .985> tr,t"r1 .979,d engand emikianm etodek ooperatifle bihe fehif darip adak onvensionaUl. ntuk tr-u: tnit*e2 .840> tt"ta 1.979,m akam etodetu torial sebaylae bihe fektifdari padak ooperatif.

oleh kepala buku rusak

 

Kebijakan relokasi pedagang kaki lima dan pengaruhnya terhadap omzet penjualan: studi pedagang buku di jalan wilis Malang oleh Binti Koliyah

 

ABSTRAK Koliyeh' Bintl 2003.K ebi;iakanR elokasPi edagangK aki Lima dan lrengaruhnya terhadap() mzePt enjuakm(s tnrlip erkrgang-B uku tli,lL. tvilis MakngL Skripsi, JunrsanP endidikanE konomiK operasi,F akurtasE konomi"U niversitasN egeri MalangP. ernbirnbin(lg) prof. DR. i. G. Nirbito,l v{.p d (2) Drs.S ugengC adi UtomoM, . Ec. KrtaK unci:K ebrjakaRn elokasiP, edaganKga ki Lirna,O *rzetp enjuala' Keberadaasne ltor informaly anga dad i kota Malangs emakinla mas emakin hrkenrbansge iringd enganp erkembangapne rnbangunasn-h, inggajurnlaphK t yang adad ikotaM alangs emakinta mas emakinb anya\ iral rni karenilengaruh atau dorongadna rit emank, einginanu ntuli meniruk eberhasilaonr angL in"atatrk arena sttlihya-mencpaerik erjaand i sektorf ormal.p Kr yanga dat li ko-taM alangy ang nernanfaatkasenb agiand ari fasilitasu rnurnd irasas angart nengga'gguja lamya kaerubalna lul intasm erusakta tar uangk ota, sehinggJkotau arang yangt ujuannya utukmenciptakanTribincait a kota Malang( penaraftanp, ariwisal-oaiindustr) dapat scdftitt erganggrhra, l ini dikh nrskanp adap enciptaanko ta pariwisataS. ehinggan nhrk nencaparri ibfurak otaM alangb erdasarkapne raturanD aerahN o. I tahun2 00dt entang Per4aturadna nP ernbinaaPne daganKg aki Lirna di kota Malang,K eputusanW alikora MalanNg o. 212r ahm 2000t entangK elompokk erja penataania n plmbinaanp edagang !u

Analisis keterlaksanaan pembelajaran biologi berpendekatan ilmiah (scientific approach) berdasarkan kurikulum 2013 (studi kasus di SMA Negeri 4 Malang) / Agung Wibowo

 

Wibowo, Agung. 2014. Analisis Keterlaksanaan Pembelajaran Biologi Berpendekatan Ilmiah (Scientific Approach) Berdasarkan Kurikulum 2013 (Studi Kasus di SMA Negeri 4 Malang). Skripsi, Jurusan Biologi, Program Studi Pendidikan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Dr. Hadi Suwono, M.Si Kata Kunci: Studi kasus, Kurikulum 2013, keterlaksanan pembelajaran, pendekatan ilmiah     Kurikulum 2013 didesain berdasarkan pada budaya dan karakter bangsa, berbasis peradaban, dan berbasis pada kompetensi. Perubahan Kurikulum 2013 harus didukung oleh peran serta guru dalam kegiatan pembelajaran, sehingga guru memegang peran penting dalam perubahan kurikulum. Proses pembelajaran pada kurikulum 2013 untuk semua jenjang dilaksanakan dengan menggunakan pendekatan ilmiah/saintifik. Pendekatan ilmiah diyakini sebagai metode yang cocok untuk mengembangkan sikap, keterampilan, dan pengetahuan siswa. Masalah yang dibahas di dalam peneilitian meliputi (1) bagaimana pemahaman guru biologi mengenai Kurikulum 2013, (2) bagaimana keterlaksanaan pembelajaran biologi dengan pendekatan ilmiah berdasarkan Kurikulum 2013, dan (3) apa yang dapat dipelajari dari pelaksanaan Kurikulum 2013 di SMA Negeri 4 Malang.     Penelitian ini menggunakan pendekatan kualitatif, bersifat deskriptif, dan merupakan penelitian studi kasus (case study) yang dirancang khusus untuk mempelajari secara rinci dan mendalam mengenai sebuah kasus khusus yaitu mengenai tingkat pemahaman serta keterlaksanaan pendekatan ilmiah (scientific) dalam pembelajaran berdasarkan tuntutan Kurikulum 2013. Pengambilan data serta analisis data dilakukan pada bulan Maret-Juni 2014. Metode yang digunakan adalah wawancara, observasi, dan dokumentasi. Teknik analisis data dilakukan dengan cara reduksi data, penyajian data, dan penarikan kesimpulan. Hasil penelitian menunjukkan bahwa guru sudah memahami secara umum mengenai Kurikulum 2013 dilihat berdasarkan pernyataan guru dari hasil wawancara yang sesuai dengan Permendikbud No. 69 Th. 2013 tentang kerangka dasar dan struktur kurikulum SMA/MA walaupun kegiatan sosialisasi oleh pemerintah yang diberikan kepada guru biologi sangat kurang. Keterlaksanaan pembelajaran mata pelajaran biologi dengan pendekatan ilmiah (scientific approach) berdasarkan Kurikulum 2013 sudah dilakukan dengan baik mulai dari kegiatan perencanaan, pelaksaanan, dan evaluasi. Keterlaksaan pembelajaran telah menggunakan tahapan-tahapan ilmiah dipadu model pembelajaran kooperatif. Keterlaksanaan pembelajaran yang dilakukan semua mengacu pada Permendikbud No. 65 Th. 2013 tentang standar proses dan Permendikbud No. 81a tentang implementasi Kurikulum 2013. Pelajaran yang dapat diambil dari pelaksanaan Kurikulum 2013 di SMA Negeri 4 Malang adalah pemahaman guru yang diperoleh melalui kegiatan workshop serta eksplorasi sumber online dari Permendikbud mengenai Kurikulum 2013 memberikan pengaruh terhadap keberhasilan kegiatan pembelajaran di kelas yang telah menerapkan tahapan-tahapan pendekatan ilmiah

Perbedaan prestasi pembelajaran fisika siswa yang dibelajarkan dengan sistem modul dan prestasi pembelajaran fisika siswa yang dibelajarkan dengan sistem konvensional pokok bahasan getaran dan gelombang pada kelas II cawu I SLTP Khoiriyah Sumobito Jombang

 

Meskipunp embaharuapne ndidikante lahb anyakd ira;afano lgn ltotal namunm asihb anyakp "*u"rujo:rony angb ercoraktr adisionals. epertip embelajaran denganc eramahg "t":;;"J";-),".tc iengakrbatkans iswak uranga ktit Dalamh ai ini gurum erasas ebagaffri ;;;;n;'ho-*r iLrit sebagaimanbae rlangsundgi SLTP KhoiriyahS umobitoJ ombang'-Dengsains tem.rymbelJjaramno duld iharapkasni swa akand apabt elajard anu erkeirbansge cara_maksismeaslu adi engakne mampuadna n kesempatannydaa,p atrn.rrv"ruarr,i*d iri dengank eunikanc arab elajarnyase ndiri danm enjaminte r,adinyc; ';;U"fujut srswaaftif Tujuanp enelitianinai dalah mengetahPuei rbedaaenit tt" ftttt^$ PembelajaraFnis ikaS istemM oduld an PrestasiPembelajaranFisikaSistemKonvensionalPokokBahasanGetarandan GelombanSgi swaK etasIi bu*t I di SLTPK hoirivahS umobitoJo mbang' Jenisp eneliti"n* i oautute' ksperimen.st'"?";: ",11?:T::1ii'lipi adalah siswak elas2 SLTPK il;iy"h sr.obito Jombantga huna jaran2}}.ll200d2e ngan populasbie rjumlahrs isd*a' sedangkasna mpeidalampe nelitiabne rjumla9h2 siswaT. eknikp engamuiiatn"* p"f "iutuh a"ng* menempatkasnis was ecaraa cak bandomc luster).Teka1;;liti;y""g digunakaand alahte knikU ji t padato pik GetaranD anG elombang' Hasilp enelitianin enunjukkans: isway angd ibelajarkan-dengan.sismteomd ul lebihb ;ik da;paaas ls*ay an! dlbetaiartradng rtn metode^konvensioantaaul ceramahd,a rip erhitungariJi,t?putLtru,,t-tt 4,869) ttub:- 2'00d engatna raf rigr,il;;;i5tt. orerti ateoai tu i""tuntun, sebaiknyma odul.digunakpaand a sekolahin i. Dengan.u,u,"rnu..i modulk epadam aiing-masinagn akm, erekad apat il;;ilil*" #;."d;il;;rouru" v*e *l.d?t". modusl ebeluma teriterbahas. cu* ,.uuitnyam enyiaptamn ateryi ungt "uit' baikd anl ebihl uasd arim oduyl ang adas ebelumm oduld ibahas'

Pengaruh penggunaan media belajar VCD, tingkat motivasi belajar dan cara belajar siswa terhadap sikap berekonomi dalam pembelajaran ekonomi di SMU PGRI Kota Malang / oleh Lilik Kustiani

 

Perencanaan visual iklan layanan masyarakat media televisi untuk Yayasan Amal Islami di Malang / oleh Ika Handayani

 

Sejadk asawarstaah un1 950-ante levisti elahm enjadmi ediai klany ang mendunDiae.w asain i hampirt idaka dar umahy angt idakm empunyatei levist' natrt

Pengaruh penggunaan media terhadap minat dan hasil belajar Bahasa Arab di SD Muhammadiyah IX "Panglima Sudirman" Malang / oleh Sri Lestari

 

Upaya peningkatan prestasi belajar fisika siswa kelas II SLTPN 1 Malang melalui pendekatan kontekstual model siklus belajar / oleh Muhammad Aminudin

 

Ruang vektor kompleks / oleh Madekur

 

Pengaruh penggunaan kadar aspal pada limbah debu keramik sebagai bahan pengisi terhadap stabilitas lapis pondasi atas jalan raya / oleh Dyah Setyo Rini

 

Hubungan pelaksanaan teknik supervisi pendidikan dengan kompetensi profesional guru dalam proses belajar mengajar di sekolah dasar se Kecamatan Kramat Kabupaten Tegal
oleh Heri Susanto

 

Hubungan kebiasaan belajar, motivasi belajar dan prestasi belajar siswa SMU negeri se-kodya Malang / oleh Maf Ulah

 

Pengembangan suplemen bahan ajar geografi sumber daya berbasis kearifan lokal tentang pelestarian Taman Nasional Lore Lindu (TNLL) / Zumrotin Nisa'

 

ABSTRAK Nisa’, Zumrotin. 2015.PengembanganSuplemenBahan Ajar GeografiSumberDayaBerbasisKearifanLokalTentangPelestarian Taman Nasional Lore Lindu (TNLL).Tesis, JurusanPendidikanGeografi, PascasarjanaUniversitasNegeri Malang. Pembimbing: (1) Prof. Dr. Sumarmi, M.Pd. (2) Dr. I NyomanRuja, S.U. Kata Kunci:bahan ajar, pengembangan, kearifanlokal Bahanajardigunakanolehpendidikuntukmembantudalamproses pembelajaran. Bahan ajar perludikembangkandalampembelajarandanharusdisesuaikandengantuntutankurikulum, karakteristiksasaran, pemecahanmasalah,dansebagaiupayapeningkatkankualitaspembelajaran.Namunmasihadakendala yang dihadapidalam proses pembelajaransepertikurangtersediannyasumberbelajarpadamatakuliahgeografisumberdayakhususnyamateripengelolaansumberdayaalamberwawasanlingkungandanberkelanjutan.Hal inimenjadikanketerbatasanpengetahuanmahasiswadalammemecahkanmasalah yang dihadapibersumberdarilingkungansekitarnya.Olehkarenaitu, potensilokalsuatudaerahperludikemasdandikembangkanmenjadisuatubahan ajarberbasiskearifanlokaluntukmeningkatkanpemahamanmahasiswatentangpotensinyata yang ada di daerahnya. Pengembanganbahanajarberdasarkankaidahkeilmuangeografidenganmodifikasipenelitiandanpengembangan model Brag & Gall. Prosedurpenelitiandanpengembanganterdiridarisepuluhlangkahnamunhanyadilakukantujuhlangkah.Data hasilvalidasidanujicobaberupa saran, tanggapan, danpenilaiansebagaidasaruntukperevisiandanpenyempurnaanprodukbahan ajar yang dikembangkan.Hasilujicobamenunjukkanprodukbahan ajar yang dikembangkanmendapatresponpositifdari validator danmahasiswabaikaspekisi, desaintampilanmaupunkemanarikanbahasanya.Produkbahan ajar hasilpengembangantidakperludirevisidengantingkatpersentase 82% danlayakuntukdigunakan.Kelayakanproduk yang telahdivalidasiahliberadapadakualifikasisangatlayakdengan rata-rata persentase 84%.Hasilujicobapadakelompokkecilberadapadakualifikasilayakdantidakperludirevisidengantingkatpencapaian 72%. Adanyapengembanganbahan ajar berbasiskearifanlokalinidiharapkandosendanmahasiswalebihkreatifdanmemanfaatkanlingkungansekitarsebagaisumberbelajar.Sebagai saran deseminasisebaiknyadalamlangkahpenelitiandilakukansampaipadatahapevaluasisumatifuntukmengetahuiefektifitasdanefesiensibahan ajar.Untuksaran pengembanganselanjutnyasebaiknya: 1) bahanajardikembangkansecarautuhpadasemuakompetensidasardanlebihdarisatukajiankearifanlokalmasyarakat, 2) dilakukanpenelitianeksperimenuntukmemperolehhasil yang lebihberkualitasdanmengujipengaruhprodukpadahasilbelajarmahasiswa.

Studi tentang TV kampus Widya Mandala Comunnity Television (WMtv) di Universitas Katalik Widya Mandala Surabaya oleh Aris Bayu Kusbiyanto

 

Kunci : TV Kampus, Kreativitas. TV kampusa dalaha dalahT V yang berbasisd i perguruant inggi' dengan jangkauand an sasarans ebatasc ivitas akademika Saati ni keberadaanT V kampus diperlukanr mtuk menyampaikanin formasi,b aik infonnasi seputark ampusa tau peristiwa penting yanC terjadi di berbagai wilayah. TV kampus disamping juga ikut mendukungp rosesb elajarm ahasiswas ekaligusd iharapkanm enjadii kon banry ang akanm enjadi kebanggaank ampust ersebutu ntuk bersaingd engan kampus lain.. Kebangaan stake holder'nyaakan lreativitas civitas mereka langsungp adam inat drmiak ampuss ecarau mum menanggapi eksistenssi ebuahT V kampus. Kecenderunganla hirnya TV lokal baik di komunitasd aerahm aupun kampusb ukant anpam asalah.B eberapap ermasalahamn endasary ang dimulai denganfa ktor hinggam asalahp erijinan seakanm engiringi berdirinya sebuahT V kampus.P ermasalahin tern TV karnpuspunju ga tidak kalah rumit. Dinulai denganp engadaanp rogramh inggab agaimanam enjadi sebuahto ntonan yangt idak ditinggalkano leh penontonnyaa dalaht antangana wal yang harus dijawab oleh sebuah TV kampus. Beberapak anpus yang lain justru tidak memberic ontohy ang baik tentang formatT V kampusy ang benar.K enyataany ang adad i lapangan,m erekahanya bermodalkanp emancard an hanyab eranim encantumkanlo go disampingl ogo stasiun TV swasta yang mereka relay. Dengan regulasi W Kepenyiaran yang cukupk ondusifsekarangi ni, sebenarnyap eluangt umbuhnyaT V komunitasb aru semakin terbuka Penulisan skripsi ini bertujuan mencari format ideal tentang TV kampus yang benar dengan melakukan studi yang mendalam tentang keberadaan7idya Msndala ComunnityT elevision,dengans egalak eungguland an kelemahannya sertak ompleksitasp ermasalahanya ng dihadapid an bagaimanam ereka merrecahkanm asalah-masalathe rsebut,s ehinggam erekad ianggapd apat dijadikan contoh bagi civitas lain, karena mempunyai kreativitas yang berbeda Kejelian sebuahp rogramming televisi untuk merumuskank onsepa cara yang akan diuyangkan membultikan Mhwatelevision is planning. Dengan memiliki karalter acaray ang kuat di matav iewe rs-ny4 konsepE du-taiwnent dinilai cukup b€rhasil dijabarkan sebagai format TV kampus yang ideal bagi viewers-nyd

Persepsi orang tua terhadap program tempat penitipan anak (TPA) IKIP MALANG / oleh Lina Hariyani

 

Pengaruh lingkungan belajar terhadap hasil belajar siswa pada mata pelajaran Aplikasi Administrasi Kepegawaian kelas XII di SMK negeri 2 Blitar / Jainul Agus Arifin

 

ABSTRAK Arifin, J.A. 2015. Pengaruh Lingkungan Belajar Terhadap Hasil Belajar Siswa Pada Mata Pelajaran Aplikasi Administrasi Kepegawaian Kelas XII Di SMK Negeri 2 Blitar. Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. H. Gatot Isnani, M.Si., (II) Dr. Aniek Indrawati, S.Si., M.M. Kata kunci: lingkungan belajar, hasil belajar Lingkungan tidak dapat dipisahkan dalam kehidupan manusia karena lingkungan selalu mengitari manusia dari waktu ke waktu, sehingga antara manusia dengan lingkungan terdapat hubungan timbal balik dimana lingkungan mempengaruhi manusia dan manusia mempengaruhi lingkungan. Begitu pula dalam proses belajar mengajar, lingkungan merupakan sumber belajar yang berpengaruh dalam proses belajar dan perkembangan anak. Lingkungan belajar terdiri dari tiga lingkungan utama yaitu, lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat. Penelitian ini bertujuan untuk mengetahui: (1) Deskripsi lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat; (2) Deskripsi hasil belajar siswa; (3) Pengaruh lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat secara parsial terhadap hasil belajar siswa kelas XII di SMK Negeri 2 Blitar; (4) Pengaruh lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat secara simultan terhadap hasil belajar siswa kelas XII di SMK Negeri 2 Blitar; (5) Pengaruh dominan lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat terhadap hasil belajar siswa kelas XII di SMK Negeri 2 Blitar. Penelitian ini adalah penelitian kuantitatif dengan menggunakan analisis deskriptif dan analisis regresi linier berganda. Variabel bebas dari penelitian ini adalah lingkungan keluarga (X1), lingkungan sekolah (X2), dan lingkungan masyarakat (X3), dengan variabel terikatnya adalah hasil belajar siswa (Y). Populasi dalam penelitian ini adalah siswa kelas XII Program Keahlian Administrasi Perkantoran SMK Negeri 2 Blitar yang berjumlah 135 siswa dengan sampel 100 siswa. Pengambilan sampel ini menggunakan teknik proportional random sampling. Skala yang digunakan dalam penelitian ini adalah skala Likert. Sedangkan hasil belajar diklasifikasikan menjadi sangat rendah (< 40), rendah (40-59), cukup tinggi (60-74), tinggi (75-90), dan sangat tinggi (> 90). Sumber data berasal dari data primer yang berasal dari responden dan data sekunder yang didapat dari guru tentang nilai kognitif siswa pada rapor semester ganjil. Teknik pengumpulan data menggunakan metode kuesioner dan metode dokumentasi. Untuk uji kelayakan instrumen digunakan uji validitas dan reliabilitas. Penelitian ini menggunakan tiga model uji asumsi klasik, yaitu: (1) Uji normalitas dengan melihat grafik P-P Plot of Regression Standardized Residual; (2) Uji multikolinearitas yang dapat dilihat dari nilai tolerance dan VIF (Variance Inflation Factor) pada model regresi; (3) Uji heteroskedastisitas dengan melihat grafik scatterplot. Hasil uji asumsi klasik menunjukkan bahwa: (1) Model regresi memenuhi asumsi normalitas terlihat dari titik-titik menyebar di sekitar garis diagonal pada gambar grafik P-P Plot of Regression Standardized Residual. (2) Model regresi tidak terjadi heteroskedastisitas terlihat pada gambar grafik scatterplot tidak membentuk suatu pola tertentu dan menyebar acak di atas dan di bawah angka 0 pada sumbu Y. (3) Model regresi tidak terjadi gejala multikolinearitas. Jadi, model regresi layak untuk digunakan. Hasil analisis deskriptif menunjukkan bahwa: (1) Lingkungan keluarga pada siswa dapat diklasifikasikan cukup baik; (2) Lingkungan sekolah pada siswa dapat diklasifikasikan cukup baik; (3) Lingkungan masyarakat pada siswa dapat diklasifikasikan cukup baik; (4) Hasil belajar siswa termasuk dalam klasifikasi tinggi. Berdasarkan hasil uji hipotesis menunjukkan bahwa: (1) Tidak ada pengaruh yang signifikan antara lingkungan keluarga terhadap hasil belajar siswa pada mata pelajaran Aplikasi Administrasi Kepegawaian; (2) Ada pengaruh yang signifikan antara lingkungan sekolah terhadap hasil belajar siswa pada mata pelajaran Aplikasi Administrasi Kepegawaian; (3) Ada pengaruh yang signifikan antara lingkungan masyarakat terhadap hasil belajar siswa pada mata pelajaran Aplikasi Administrasi Kepegawaian; (4) Ada pengaruh yang signifikan antara lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat terhadap hasil belajar siswa pada mata pelajaran Aplikasi Administrasi Kepegawaian; (5) Variabel lingkungan masyarakat mempunyai pengaruh yang dominan yaitu sebesar 6,07%. Berdasarkan hasil penelitian ini, peneliti menyarankan: (1) Bagi SMK Negeri 2 Blitar melalui kepala sekolah harus mempertahankan serta meningkatkan kondisi lingkungan sekolah secara optimal; (2) Bagi orang tua hendaknya memberikan perhatian yang lebih untuk anak dalam belajar; (3) Bagi guru SMK Negeri 2 Blitar hendaknya lebih dekat dan berbaur dengan siswa; (4) Bagi masyarakat hendaknya mengajak siswa berperan aktif dalam kegiatan sosial yang bermanfaat untuk meningkatkan pengetahuan siswa; (5) Bagi peneliti yang tertarik untuk melanjutkan penelitian ini sebaiknya perlu dilakukan penelitian lebih lanjut tentang variabel lain yang dapat mempengaruhi hasil belajar siswa selain dari lingkungan belajar seperti bakat, minat, motivasi, dan cara belajar siswa.

Hubungan antara status sosial ekonomi orang tua dan pemahaman terhadap cita-cita pekerjaan pada siswa SMA Negeri se-Kota Sumenep / oleh Rr. Mahsunah

 

Pengaruh perbedaan tipe, tempat dan lama penyimpanan biji jagung terhadap total koloni kapang / oleh Lilik Suryani

 

Pengaruh cara belajar dan minat belajar terhadap prestasi belajar siswa pada mata pelajaran PengantarAdsmoinistrasi Perkantoran (studi pada kelas X Administrasi Perkantoran SMKN 1 Pasuruan) / Siti Maisaroh

 

ABSTRAK Maisaroh, Siti. 2015. Pengaruh Cara Belajar dan Minat Belajar Terhadap Prestasi Belajar Siswa Pada Mata Pelajaran Pengantar Administrasi Perkantoran (Studi pada Kelas X Administrasi Perkantoran SMKN 1 Pasuruan). Skripsi, Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Dra. Hj. Wasiti, S.Sos., M.Si., (II) Dr. Agus Hermawan, M.Si, Grad Dip MGT., M.Bus. Kata kunci: Cara Belajar, Minat Belajar, Prestasi Belajar Dalam proses belajar mengajar minat belajar sangat besar perananya terhadap prestasi belajar. Karena adanya minat belajar dapat menumbuhkan cara belajar siswa secara intensiv. Minat belajar sangat berperan dalam belajar, dengan minat belajar inilah siswa menjadi tekun dalam proses belajar mengajar, dan dengan minat belajar itu pula hasil belajar siswa dapat diwujudkan dengan baik. kurangnya minat akan berdampak pada rendahnya hasil belajar. Penelitian ini bertujuan untuk mengetahui: (1) Deskripsi cara belajar dan minat belajar. (2) Deskripsi prestasi belajar. (3) Pengaruh cara belajar dan minat belajar secara parsial terhadap prestasi belajar siswa pada mata pelajaran Pengantar Administrasi Perkantoran kelas X SMKN 1 Pasuruan. Penelitian ini adalah penelitian kuantitatif dengan menggunakan analisis deskriptif dan uji linearitas. Variabel bebas dari penelitian ini adalah cara belajar (X1) dan minat belajar (X2), dengan variabel terikatnya adalah prestasi belajar (Y). Populasi dalam penelitian ini adalah siswa kelas X Administrasi Perkantoran SMKN 1 Pasuruan yang berjumlah 71 siswa. Teknik pengambilan sampel menggunakan metode sampling jenuh. Skala yang digunakan dalam penelitian ini adalah skala Likert dengan lima opsi jawaban yaitu sangat setuju skor 5, setuju skor 4, kurang setuju skor 3, tidak setuju skor 2, dan sangat tidak setuju skor 1. Sedangkan prestasi belajar diklasifikasikan menjadi sangat rendah (< 3,07), rendah (3,07-3,13), cukup tinggi (3,14-3,20), tinggi (3,21-3,27) dan sangat tinggi (3,28-3,336). Jenis data penelitian ini adalah data ordinal yang diperlakukan sebagai data interval. Sumber data primer berasal dari responden dan data sekunder yang dideroleh dari guru tentang nilai raport siswa semester ganjil. Teknik pengumpulan data menggunakan metode kuesioner dan metode dokumentasi. Untuk uji kelayakan instrumen digunakan uji validitas dan reliabilitas dengan bantuan SPSS 20 for Windows. Penelitian ini menggunakan empat model uji asumsi klasik, yaitu: (1) Uji normalitas dengan melihat grafik P-P Plot of Regression Standardizeed Residual. (2) Uji multikolinearitas yang dapat dilihat dari nilai tolerance dan VIF (Variance Inflation Factor) pada regresi. (3) Uji heteroskedastisitas dengan melihat grafik scatterplot. (4) Uji hipotesis dengan melihat tabel coefficients. Hasil uji asumsi klasik menunjukkan bahwa: (1) Model regresi memenuhi asumsi normalitas terlihat dari titik-titik menyebar di sekitar garis diagonal pada gambar grafik P-P Plot of Regression Standardized Residual. (2) Model regresi tidak terjadi heteroskedastisitas terlihat pada gambar grafik scatterplot tidak membentuk suatu pola tertentu dan menyebar acak diatas dan dibawah angka 0 pada sumbu Y. (3) Model regresi tidak terjadi gejala multikolinearitas. Jadi model regresi layak untuk digunakan. (4) Hasil uji hipotesis menunjukkan bahwa: (1) Ada pengaruh positif dan signifikan antara cara belajar terhadap prestasi belajar siswa pada mata pelajaran Pengantar Administrasi Perkantoran. (2) Ada pengaruh positif dan signifikan antara minat belajar terhadap prestasi belajar pada mata pelajaran Pengantar Administrasi Perkantoran. Hasil analisis deskriptif menunjukkan bahwa: (1) cara belajar pada siswa dapat diklasifikasikan baik. (2) minat belajar siswa dapat diklasifikasikan baik. (3) Prestasi belajar siswa termasuk dalam klasifikasi tinggi. Berdasarkan hasil penelitian ini, peneliti menyarankan: (1) Bagi siswa diharapkan dapat lebih meningkatkan minatnya terhadap membaca buku karena hal tersebut dapat mendatangkan kesuksesan dalam studi (2) Bagi guru sebaiknya selalu melakukan upaya untuk membuat kegiatan belajar mengajar yang kreatif dan menyenangkan. (3) Bagi sekolah hendaknya bisa mempertahankan serta meningkatkan penunjang kegiatan belajar mengajar sehingga dapat mendukung siswa untuk meningkatkan minat membaca dengan baik. (4) Bagi peneliti yang tertarik untuk melanjutkan penelitian ini sebaiknya menyempurnakan dan menambahkan hal-hal yang masih kurang dari penelitian ini.

Database untuk mendukung managemen Jurusan Fisika FMIPA UM / oleh Sri Budhi Utami

 

Pengaruh populasi cacing tanah pheretima javanica terhadap pertumbuhan vegetatif tanaman tomat lycopersicum commune dalam menunjang pengajaran avertebrata dan fisiologi tumbuhan / oleh Elsje Theodora Maasawet

 

Pengaruh cara belajar dan fasilitas belajar terhadap hasil belajar pada mata pelajaran Kearsipan (syudi pada siswa kelas X Paket Keahlian Administrasi Perkantoran di SMKN 1 Sooko Kabupaten Mojokerto) / Rizki Sridarta Putri

 

ABSTRAK Putri, R.S. 2015. Pengaruh Cara Belajardan Fasilitas Belajar terhadap Hasil Belajar Pada Mata Pelajaran Kearsipan(Studi pada Siswa Kelas X Paket Keahlian Administrasi Perkantoran di SMKN 1 Sooko Kabupaten Mojokerto). Skripsi, Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Drs. H. Gatot Isnani, M.Si.(II) Dr. Ludi Wishnu Wardana, S.E., S.Pd., S.T., M.M. Kata kunci: cara belajar, fasilitas belajar, hasil belajar Pendidikan tidak terlepas dari kegiatan belajar mengajar. Belajar merupakan faktor penting dalam pendidikan, karena belajar merupakan kegiatan pokok dalam proses pembelajaran. Belajar merupakan suatu proses yang dilakukan oleh peserta didik untuk mencapai hasil belajar yang diinginkan. Cara belajar siswa adalah rangkaian kegiatan yang dilakukan dalam usaha belajarnya. Selain cara belajar siswa, sekolah juga harus memiliki fasilitas belajar yang memadai, hal ini bertujuan untuk menunjang jalannya proses pembelajaran.Cara belajar yang efektif dan fasilitas belajar yang memadai diperlukan untuk mendapatkan hasil belajar yang maksimal.Terdapat beberapa faktor yang mempengaruhi hasil belajar siswa, diantaranya adalah cara belajar dan fasilitas belajar. Penelitian ini bertujuan untuk mengetahui: (1) Deskripsi cara belajar,fasilitas belajar, dan hasil belajar. (2) Pengaruh cara belajar terhadap hasil belajar. (3) Pengaruh fasilitas belajar terhadap hasil belajar.(4) Pengaruh dominan dari cara belajar dan fasilitas belajar terhadap hasil belajar. Penelitian ini merupakan penelitian deskriptif korelasional yaitu penelitian dengan tujuan memperoleh gambaran tentang variabel yang diteliti dan menemukan ada tidaknya hubungan antara masing-masing variabel. Variabel bebas dalam penelitian ini adalah cara belajar (X1) dan fasilitas belajar (X2), sedangkan variabel terikatnya adalah hasil belajar. Populasi penelitian ini adalah siswa kelas X yang berjumlah 108 siswa dengan jumlah sampel 84 siswa. Pengambilan sampel menggunakan teknik proportional random sampling. Skala yang digunakan adalah skala Likert dengan lima skala ukur dimulai dari opsi selalu, sering, kadang-kadang, jarang, dan tidak pernah. Sedangkan hasil belajar diklasifikasikan adalah rendah sekali, rendah, cukup tinggi, tinggi, dan sangat tinggi. Jenis datanya adalah data ordinal yang diperlakukan sebagai data interval. Untuk sumber data berasal dari data primer dan sekunder yang dimana data primer berasal dari responden sedangkan data sekunder berasal dari nilai kognitif siswa pada rapor semester ganjil.Teknik pengumpulan data menggunakan metode kuesioner,dan metode dokumentasi. Dalam penelitian ini angket dibagikan pada tanggal 4Februari 2015, yaitu dengan cara semua siswa dikumpulkan dalam kelas masing-masing dan semua sampel mengisi angket. Metode dokumentasi digunakan untuk memperoleh data mengenai jumlah siswa dan nilai kognitif pada rapor semester ganjil.Untuk uji kelayakan instrumen digunakan uji validitas dan reliabilitas. Dalam penelitian ini menggunakan tiga uji asumsi klasik, yaitu: (1) Uji normalitas. (2) Uji heteroskedastisitas. (3) Uji multikolinearitas. Hasil uji asumsi klasik menunjukkan bahwa: (1) Hasil uji normalitas menunjukkan databerdistribusi normal dan terlihat dari titik-titik yang menyebar di sekitar garis diagonal pada grafik NormalP-P Plot of Regression Standardized Residual.(2)Hasil uji multikolinearitas menunjukkan tidak terjadi gejala multikolinearitas yang dapat dilihat dari tolerance dan VIF. (3) Hasil uji heteroskedastisitas menunjukkantitik-titik pada grafikScatterplot tidak membentuk suatu pola tertentu dan menyebar acaksehingga dalam penelitian ini tidak terjadi gangguan heteroskedastisitas. Jadi, persamaan regresi layak untuk digunakan. Hasil analisis deskriptif menunjukkan bahwa: (1) Cara belajar siswa dapat diklasifikasikan cukup baik. (2) Fasilitas belajar siswa dapat diklasifikasikan cukup baik. (3) Sebagian besar siswa memiliki hasil belajar yang tinggi. Berdasarkan hasil uji hipotesis menunjukkan bahwa: (1) Ada pengaruh positif yang signifikan antara cara belajar terhadap hasil belajar. (2) Tidak ada pengaruh positif yang signifikan antara fasilitas belajar terhadap hasil belajar. (3) Cara belajar merupakan variabel yang dominan mempengaruhi hasil belajar siswa. Penelitian ini menggunakan bantuan SPSS 19 for Windows. Berdasarkan hasil penelitian ini, peneliti menyarankan: (1) Bagi siswa, siswa seharusnya menambah jam belajar untuk materi yang belum dipahami, siswa juga seharusnya membaca materi terlebih dahulu sebelum diajarkan, dan hendaknya mau membaca kembali pelajaran yang telah diajarkan supaya hasil belajar yang didapatkan siswa dapat tercapai atau sesuai dengan yang diinginkan. (2) Bagi pihak sekolah untuk lebih melengkapi fasilitas belajar yang sudah ada seperti penambahan jumlah alat dan bahan seperti (kartu indeks dan kartu tunjuk silang) supaya dapat lebih menunjang proses pembelajaran. (3) Bagi guru hendaknya melakukan kegiatan praktek dan tidak hanya teori saat pembelajaran kearsipan untuk mengembangkan potensi yang dimiliki siswa demi peningkatan hasil belajar. (4) Saran berikutnya ditujukan kepada peneliti selanjutnya yang tertarik untuk melanjutkan penelitian ini, sebaiknya melakukan penelitian menggunakan faktor-faktor lainnya yang juga dapat mempengaruhi hasil belajar seperti motivasi, minat, dan lingkungan belajar yang telah banyak ditemukan oleh ilmuan.

Efisiensi gerak tolakan sudut 90 derajat dan sudut 110 derajat pada start jongkok / oleh Priyo Hari Sulistiadi

 

Aktualisasi dosen teknologi pendidikan dalam menjalankan bidang tugas nya olh Tita Puspitasari

 

Pembangunapne ndidikaus ecarau mumd itekankanp adap eningkatan kualitass umberd ayam anusiad an nengetahuannyaS.a lahs atuu sahau ntuk meningkatkaknu alitass umberd ayam anusiate rsebuvt angu tamaa dalahu saha melalui sistemp endidikan.F aktor utamay ang ikut menentukanp eningkatan kualitasp endidikand ank ualitass umberd ayam anusiaa dalahk ualitas kemampuanp rofesionals tirf akademika taud osend i tingkat perguruant inggr. ProgramS tudiT eknologiP endidikan(T EP)m erupakans alahs atuu nsur/unit pelaksanFa akultasIl mu Pendidikan(F IP)y angm emiliki tuiuanm enghasilkan tenaga kependidikan profesional bidang TEP ]'ang rnampu merancang, mengembangkapnr ogramo embelajarand an pelatihan,m ampum engembangkan menselolasu mbebr elajard iberbagapiu satp endidikadna nl atihan( UM.2001) Tujuand ilakukannyap enelitianil i adalahi ngin memperolehg ambaran tentanga ktualisasdi iri dosenT EP dalam'menjalankabnid angt ueasnya. khususnyam enl.angkutk eadaanp sikologrd osend alarnk onteksk elernbagaan yang dideskripsikan dalam tata hubungan pribadi dosen TEP dilihat dalam efektivitask e{a, kompetenski erja sertab agaimanaca rap engambilanke putusan dan kepedulian dosen TEP pada peningkatan kualitas akademik yang dimiliki dosend ilihat dari motivasid andisiplink erja dalama Llualisasmi enjalankan bidang tugasnya Penelitiani ni tergolongp enelitiand eskriptif denganr espondeny ang terlibatd i dalamnyaa dalahd osenT EP;F IP UniversitasN egeriM alang. lnstrument yang digunakan dalam penelitian ini adalah teknik angket terstruktur yangt erbagid alamd uab agiand ant erdiri atas7 6 pertanyaanS. ementartae knik analisa datayatg digunakan adalah feknik analisa rata-rata,. Berdasarkahna silp enelitiany angt elahd ilakukan,d idapatd atas ebagai berikut Total nilai rata-rata untuk semua p€rtanyaan adalah279,46 dengan nilai rata-rata3 ,74.S edangkqn,nil ai rata-ratate rkecila dalah1 ,73d ann ilai rata-rata terbesara dalah4 ,91. Nilai rata-ratauntukm asing-masingin dikator yangt ermasuk dalamt atah ubunganp ribadid osena dalah(: 1) Efektifitask erjam emiliki nilai rata-rata terkecil2,27, nilai rata-rata terbesar 4,91 dan nilai rata-rata indikator 3,77.( 2) Kompetenski eriam emiliki nilai rata-ratate rkecil 1,73;n ilai rata-rata terbesa4r ,82d ann ilai rata-ratain dikator3 ,51.( 3) Pengambilakne putusan memiliki nilai rata-ratate rkecil3 , 27, nllai rata-ratate rbesa4r .91d ann ilai rara-ram indikator 4,04. Nilai rata-ratau ntuk masing-masingin dikator yangt ermasuk dalamp eningkataknu alitasa kademika dalah(:1 ) Disiplink erjam emilikin ilai ruta-ratat erkecil 1,73;n ilai rata-ratat erbesar4 ,82 dan nilai rata-ratain dikator 3,68. (2) Motivasi kerja memiliki nilai rata-ratate rkecil2 ,00;n ilai rata-rata terbesa4r ,91d ann ilai rata-ratain dikator3 ,71 Dari hasil analisa di atas dapat ditafsirkan bahwa dari 3 (tiga) indikatory angt ermasukk e dalamt atah ubunganp ribadid oseny aitu efektifitas kerja,p engambilanke putusand ank ompetenski erj4 2 (dua)i ndikatory aitu efektifitask erjad anp engambilank epurusansu daht inggi tetapi I (satu)i ndikator lainnya yaitu kompetensi ke{a masih rendah dan dari 2 (dua) indikator yang tennasukd alarnp eningkatanku alitasa kaderniky aitu disiplink erjad anm otivasi kerja, kedua indikator baik disiplin ke{a maupun motivasi kerja masih rendah. Berdasarkakne simpulany angd idapatd ari hasilp enelitianm, akas aran yang dapat diberikan adalah Kompetensi yang dimiliki dosen TEp harus diberdayagunakaang arm emberikank ontribusiy angm aksimalb agij urusand an mahasiswpaa dak hususnyad anp endidikanp adau mumnyaM. otivasid and isiplin adalah dua hal yang sangat berkaitan. Untuk itu, faktor-faktor yang mempengarhi motivasi yang mengakibatkanm enurunnyad isiplin perlu diatasi sehinggad osen TEP dapat memberikan kontribusi terbaik bagi jurusan dan rnahasiswa.

Pengaruh kualitas layanan terhadap loyalitas konsumen : studi pada kosumen Confetti Ice Cream Malang / oleh Yulia Marthalina

 

Sejak dahulu makanan menempati urutan teratas dalam pemenuhan kebutuhan manusia, sehingga masalah pangan dikategorikan ke dalam kebutuhan primer atau kebutuhan pokok. Dengan alasan itu, manusia tidak dapat melepaskan kebutuhannya untuk makan karena hanya dengan makan manusia dapat terus melangsungkan hidupnya. Confetti Ice Cream sebagai salah satu perusahaan yang bergerak dalam industri makanan dan memiliki konsep memberikan kualitas layanan terbaik demi kepuasan konsumen dalam usahanya, merasa perlu untuk mempertahankan siklus perusahaan dalam hal ini (product life cycle) untuk mempertahankan eksistensi perusahaan. Penelitian ini dilakukan untuk mengetahui pengaruh secara langsung bukti nyata (tangible), keandalan (reliability), ketanggapan (responsiveness), jaminan (assurance) dan empati (empathy). Penelitian ini menggunakan pendekatan deskriptif korelasional, data yang diperoleh menggunakan angket tertutup. Sampelnya adalah 140 konsumen yang pernah dan telah melakukan pembelian di Confetti Ice Cream Malang. Variabel bebas dalam penelitian ini yaitu variabel dimensi kualitas pelayanan yang meliputi bukti nyata (tangible) (X1) , keandalan (reliability) (X2), ketanggapan (responsiveness) (X3), jaminan (assurance) (X4) dan empati (empathy) (X5). Sementara variabel terikatnya adalah loyalitas konsumen (Y). Analisis data dilakukan dengan bantuan SPSS 13, dengan taraf signifikansi 5%. Setelah melalui proses pengolahan data dan analisis regresi berganda diketahui hasil penelitian menyatakan bahwa: (1) bukti nyata mempunyai β = 0,189, (2) keandalan dengan nilai β = 0,106, (3) ketanggapan mempunyai β = 0,171, (4) jaminan dengan nilai β = 0,549 dan (5) empati dengan memiliki nilai β = 0,133, kelima dimensi kualitas layanan tersebut mempunyai hubungan yang signifikan dengan loyalitas konsumen. Selain itu juga diperoleh koefisien determinasi total sebesar 0,794. Hasil penelitian ini menyimpulkan bahwa: (1) ada pengaruh secara langsung yang signifikan antara bukti nyata (tangible), ketanggapan (responsiveness), jaminan (assurance) dan empati (empathy) terhadap loyalitas konsumen, (2) variabel jaminan (assurance) sebagai variabel yang paling dominan dalam memberikan pengaruh terhadap loyalitas konsumen. Saran yang bisa diberikan berkaitan dengan temuan yang diperoleh selama melaksanakan penelitian adalah: (1) Confetti Ice Cream Malang harus meningkatkan kualitas layanan yang diberikan kepada konsumen dengan meningkatkan keramahan karyawan, memaksimalkan pemberian perhatian kepada konsumen,dan tetap memahami kebutuhan dan keinginan konsumen. (2) Sebagai perusahaan yang memperhatikan kualitas produk, kepuasan dan loyalitas konsumen, juga dalam rangka mempertahankan siklus perusahaan dalam hal ini (product life cycle) Confetti Ice Cream Malang sudah saatnya untuk melakukan ekspansi usahanya, salah satunya adalah mewaralabakan produknya (franchise

Pengembangan student worksheet berbasis group investation pada materi penelitian geografi IPS SMA / Nur Cholifah

 

ABSTRAK Cholifah, Nur. 2016.Pengembangan Student Worksheet Berbasis Group InvestigationPada Materi Penelitian Geografi IPS SMA. Tesis, Program Studi Pendidikan Geografi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Sumarmi, M.Pd, (II) Dr. Ach. Amirudin, M.Pd. Kata Kunci: Pengembangan Student Worksheet, Model Group Investigation, Penelitian Geografi. Penelitian geografi sebagai salah satu materi yang membutuhkan studi lapangan tentu lebih mudah pelaksanaannya apabila ada bahan ajar pendukung sepertistudent worksheet. Pembuatan atau pengembangan student worksheet tidak bisa disamaratakan dengan semua materi yang ada di kelas X. Hal ini dikarenakan setiap materi mempuyai ketercapaian kompetensi yang berbeda. Pada kenyataannya student worksheet yang ada di lapangan disamaratakan dan masih mengacu pada tekstual dan evaluasi hasil belajar dengan pengisian soal-soal. Berdasarkan fakta di atas maka pengembangan student worksheet yang sesuai dengan kebutuhan materi sangat diperlukan.Penelitian pengembangan ini bertujuan menghasilkan bahan ajar berupa studentworksheet berbasis Group Investigation pada materi penelitian geografi semester gasal kelas X IPS. Jenis penelitian ini research development yang menggunakan metode pengembangan dari Borg & Gall (mengambil sembilan tahap).Subjek uji coba yaitu: kelompok kecil 18 siswa kelas Lintas Minat, kelompok besar 31 siswa kelas X IPS di SMAN 3 Malang. Instrumen yang digunakan adalah angket sebagai penilaian untuk validator ahli materi, desain pembelajaran, bahasa, guru mata pelajaran, dan siswa. Penghitungan skor kriterium yang diperoleh dari hasil angket menggunakan skala likert. Analisis data yang dilakukan melalui deskriptif kualitatif dan statistik deskriptif. Berdasarkan hasil penelitiandapat diketahui bahwa pengembangan student worksheet berbasis Group Investigation layak untuk digunakan dalam pembelajaran geografi pada materi yang berkaitan dengan penelitian lapangan. Hal ini karena student worksheet berbasis Group Investigation berfungsi sebagai panduan penelitian lapangan. Hasil kelayakan mengacu pada penilaian dari tiga validator masing-masing ahli yaitu: materi (79,35%), desain pembelajaran (73,28%), dan bahasa (721,42%). Hasil uji coba kelompok kecil (80,90%), kelompok besar (84,35%), dan penilaian (praktikum I (80,30%), praktikum II (83,23%), dan laporan penelitian (82,90%). Mengacu pada hasil tersebut dapat dikatakan bahwa student worksheet yang dikembangkan layak dan mampu dipahami oleh siswa, walaupun dalam pembuatan laporan penelitian masih perlu pembenahan. Saran pemanfaatan, pentingnya menejemen waktu dalam penerapan student worksheet. Saran desiminasi salah satunya bisa melalui seminar nasional atau MGMP. Bagi peneliti lanjutan yaitu pengembangan student worksheet dengan mengombinasikan menggunakan mediakarena dengan media akan memudahkan siswa mengetahui dan mempelajarai daerah lain yang tidak bisa secara langsung dijangkau oleh siswa, sehingga pembahasan akan lebih luas.

Persepsi mahasiswa terhadap tugas dosen penasehat akademik di Universitas negeri Malang oleh Anita Soegiarto

 

ABSTRAK SoegiartoA, nia. 2003.P enepsl Mahaslswalefiadop TugasP enoseha Aledemik di Univenitas Negert Malong. Skripsi, Jurusan Bimbingan Konseling dan Psikologi. Fakultas Ilmu Pendidikan UniversitasN egeriM alang.P embimbing(:l ) Dr. Dany M Handarini, M.,\ (2) Dra. Carolina L. R. N4 kes. Kata Kunci: persepsi,t ugasP enasehaAt kademik Pelaksanaanla yananb imbingano leh dosenP cnasehaAt kadernik telah diperkenalkan pada semua p€rguruan tinggi sebagpi bagian'dari suatu programy ang lebih luas ruang{ingkupnya,y aitu programp elaksanaans istem kedit. Dalam sistemi ni setiapm ahasiswad iberikan seorangp embimbinga tau PenasehaAt kademik, ya4g diharapkand apatm embantum ahasiswam enptasi masalah-masalaahk ademiks ertam asalahl ainnya. Di UniversitasN egeri Malangprogam kegiatank epenasehatainn i telah berjalan cukup lam4 masalah pokok dalam penelitian ini adalah bagimana persepsim ahasiswate rhadapp elaftsanaantu gasd osenP enasehat Akademikd i UniversitasN egeriM alang.S ecarak husus( l) bagaimana persepsmi ahasiswate rhadapd osenP enasehaAt kademik sebagasi umber informasi, (2) bagaimanap ersepsmi ahasiswate rhadapp elaksanaantu gas dosenP enasehaAt kademik sebgdi pendamping (3) bagaimanap ersepsmi ahasiswate rhadapp elaksanaantu gasd osenP enasehat Akademik sebagapi emandu,( 4) bagaimanap ersepsmi ahasiswate rhadap pelaksanaantu gasd osenP enasehaAt kademik sehgai motivator,( 5) bagaimanap ersepsmi atrasisnntre rhadapp claksanaantu gasd osenP enasehat Akademik sebagai model. Tujuan penelitian ini secara umum untuk mengetahui pcrsepsi mahasiswate rhadapt ugasD osenP enasehaAt kademik bagi mahasiswad an secarak husus( l) persepsim ahasiswate rhadapt ugasD osenP enasehat Akademik sebagai sumber informasi aka&mik mauputr non Akademik (2) persepsim ahasiswat erhadapt ugasD osenP enasehaAt kademik sebagai pedamping (3) penepsi mahasiswate rhadapt ugasD osenP enasehat Akademik sebagapi ernandu( a) persepsmi ahasiswate rhadapt ugasD osen PenasehaAt kademik sebagai motivator (5) persepsim ahasiswate rhadapt ugas DosenP enasehaAt kadcmik s€bagpmi odel. Rancanganp enelitiany ang digunakand alam penelitiani ni adalah deslniptif Populasid alamp enelitiani ni adalahm ahasiswaU M angtcatan2 000. Sampel perrclitian yaitu mahasisua FIP, FE, FP MIPA FS, dan FT. Instruman yang digunakan dalam penelitian adalah angket. Pengambilan sampel menggunakante knik Quota RandomS ampling Flasil penelitian,m enunjukkanb ahwap claksanaantu gasd osenP A terhadapm ahasiswad ideskripsikany ang meliputi beberapaa speks ebagai sumberi nformasi, pendampingp, emandq motivator, dan model.Menunrt penepsmi ahasiswab clumm cnunjukkanp adak cdudukany angb clum memadaia, rtinya masihjauh dari yang diharapkana taud ari ketentuany ang berlakud i Universitasn egeriM alangy angd ijelaskand alamp edoman akademikw, alaus ecarau mump ersepsmi ahasiswacu kupb aik terhadap pelaksanaatnu gasP A. Dari data tersebut maka dapat dikemukakan saran sebagai berikut: bagiP enasehaAtk ademik,h asilp enelitianin i diharapkand apatd igunakan sebagi evaluasip elaksanaank epenasehatany,a ng selanjutnyad apt menjadi pertimbangand alam meningkatkanla yanank epenasehatanB.a gi Lembaga hendaknyap erlu diciptakans uatus istemp engawasar/supervistei rhadap pelaksanaakne penasehataonl eh dosenP A, misalnyad enganc arap enyebaran daftari sian kepadam asing-masingP A yang dilaksanakans etiaa wal semester atua khir semester.Daftainri sefaligusd apatb erfungssi ebagaai latk ontrol kualitasd ank emajuanb imbingand ari dosenP A kepadam ahasiswaB. agi mahasiswaU M hendaknyale bih aktif dalamm embinah ubung'aank rabd engan dosenP enasehaAtk ademft. Bagip enuliss elanjutnyah endaknyadapat menjadikanh asilp enelitianin i sebagaai cuand alamp enelitians elanjutnya denganm enggunakans ampely ang lebih besar,d enganm etodey ang lebih tepat sepertio bsewasip artisipatifdan wawancarat,c ntangf aktor-faktor pendukung dan penghambapt elaksanaantu gask epenasehatamn engingatp enelitiany ang dilakukans ekarangin i masihm erupakanp enelitiana ual danh anyam emakai metodea ngket,y angm emiliki keterbatasan-keterbatasan.

Persepsi siswa SMU Swasta di Kota Malang tentang bimbingan belajar kimia dan pengaruh keikutsertaan siswa dalam bimbingan belajar terhadap prestasi belajar kimia di sekolah oleh Mukti Ali

 

The Teaching of functional skills and communicative expressions at SMU IKIP MALANG based on the 1994 English curriculum: a case study / by Ismalianing Eviyuliwati

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |