Penerapan pembelajaran kooperatif model stad dalam pembelajaran IPS untuk meningkatkan hasil belajar siswa kelas IV SDN Pogar III Kecamatan Bangil Pasuruan / Rusika

 

Kata Kunci Pembelajaran IPS, hasil belajar, model STAD, Sekolah Dasar Salah satu tujuan pembelajaran IPS SD adalah agar siswa mengenal konsep-konsep, yang berkaitan dengan kehidupan masyarakat dan lingkungan serta memiliki kemampuan berkomunikasi dan berfikir kritis. Guru sebagai pelaksana dan pengembang pembelajaran harus mampu memilih, menerapkan pendekatan dan metode untuk meningkatkan hasil belajar siswa. Berdasarkan hasil observasi yang dilakukan dalam mengajar di SD Pogar III Kecamatan Bangil,dengan materi pokok “perkembangan teknologi transportasi. Ternyata selama ini yang diterapkan adalah pembelajaran konvensional yang banyak menggunakan metode ceramah dan kurang melibatkan aktivitas siswa, sehingga terjadi kecenderungan para siswa dibiasakan sekedar mendenganr apa yang diajarkan oleh guru, dengan demikian nilai hasil belajar siswa masih tergolong rendah Penelitian ini bertujuan untuk mendiskripsikan penerapan model STAD yang dapat meningkatkan hasil belajar IPS siswa kelas IV SDN Pogar III Kecamatan Bangil dan dilakukan dengan subyek siswa SDN Pogar III sebanyak 23 siswa yang terdiri dari 14 siswa laki-laik dan 9 siswa perempuan. Rancangan penelitian yang digunakan adalah penelitian tindakan kelas atau PTK yang dikembangkan oleh Kemmis dan McTaggart yang terdiri dair 4 tahapan yaitu perencanaan pelaksanaan observasi dan refleksi. Peningkatan hasil belajar setelah mengikuti pembelajarn kooperatif model STAD dapat dikatakan baik karena rata-rata skor siswa pada tes akhir siklus I adalah 43,29 % dari jumlah siswa yang mencapai skor lebih dari 60 adalah dan 56,71% kurang mencapai skor dari 60 .Sehingga pada siklus II jumlah siswa yang mendapat nilai diatas skor lebih dari 60 yaitu 82,61% dan yang mendapat nilai dibawah skor 60 yaitu 17,39 Saran yang dapat diberikan oleh peneliti adalah guru kelas IV di SDN Pogar III dapat menerapkan model STAD dalam pembelajaran IPS SD khususnya dan,mata pelajaran lain umumnya, karena pembelajaran kooperatif model STAD sebagai salah satu alternatif untuk peningkatan hasil belajar siswa. i

Implementasi sistem manajemen mutu ISO 9001:2000 dalam meningkatkan mutu manajemen sekolah (studi multikasus di SMAK Santo Albertus dan SMP Negeri 1 Malang) / Myriam Juniati

 

Kata kunci: implementasi sistem manajemen mutu ISO 9001:2000, meningkatkan, mutu manajemen sekolah Implementasi Sistem Manajemen Mutu ISO 9001:2000 merupakan penataan manajemen sekolah untuk menciptakan suatu sistem organisasi dan budaya sekolah yang kondusif untuk membangun komitmen tumbuhnya mutu manajemen sekolah sebagai penjamin mutu. Untuk itu lembaga pendidikan perlu menyiapkan kerangka sistem mutu lembaganya ke arah yang diinginkan sesuai dengan sasaran atau tujuan akhir yang mampu mencapai kesesuaian dengan keinginan yang diharapkan dari pelanggan atau mitra kerja sekolah tersebut. Munculnya pendidikan asing di kota-kota besar Indonesia sangat pandai mengemas pendidikan persekolahnya dengan kualitas, kompetensi, keunggulan, kompetitif dan profesionalitas. Lembaga-lembaga pendidikan mengupayakan memiliki mutu bertaraf nasional bahkan internasional agar mampu bersaing dengan lembaga-lembaga pendidikan asing yang mulai berkembang pesat. Salah satu upaya yang secepatnya ditangani oleh para penyelenggara pendidikan persekolahan adalah perlu adanya transformasi dan inovasi sistem manajemen kelembagaan persekolahan dengan menerapkan sistem manajemen mutu ISO 9001:2000. Fokus penelitian ini adalah implementasi sistem manajemen mutu ISO 9001:2000 dalam meningkatkan mutu manajemen sekolah dengan rincian fokus: (1) proses implementasi sistem manajemen mutu ISO 9001:2000 dan (2) proses mempertahankan sistem manajemen mutu ISO 9001:2000. Lokasi penelitian ini di SMAK Santo Albertus Malang dan SMP Negeri 1 Malang yang merupakan sekolah memiliki sejarah panjang didirikan sebelum kemerdekaan Negara Kesatuan Republik Indonesia, memiliki karakteristik budaya sekolah yang berandil besar dalam membentuk pribadi peserta didik, aneka prestasi di bidang akademik dan non akademik diraih, dan bersertifikat ISO 9001:2000. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan multikasus, karena dua kasus penelitian dengan latar yang berbeda. Teknik pengumpulan datanya dilakukan dengan tiga cara, yakni: (1) wawancara mendalam, (2) observasi berperan serta pasif, (3) studi dokumentasi. Pemilihan informan penelitian ini menggunakan teknik snowball sampling. Data yang terkumpul dianalisis secara deskriptif dengan alur (a) reduksi data, (b) penyajian data, (c) penarikan kesimpulan, (d) analisis data kasus individu, (e) analisis data lintas kasus. Agar memperoleh keabsahan data dilakukan dengan empat kriteria: (1) kredibilitas, (2) transferbilitas, (3) dependabilitas, dan (4) konfirmabilitas. Dari hasil paparan data penelitian di lapangan ditemukan sebagai berikut: Kasus SMAK Santo Albertus Malang dan SMP Negeri 1 Malang merupakan sekolah mengimplementasikan sistem manajemen mutu ISO 9001:2000 dengan urutan fokus: Pertama, proses implementasi sistem manajemen mutu ISO 9001:2000, yaitu: (1) latar belakang implementasi sistem manajemen mutu mutu ISO 9001:2000; (2) persiapan implementasi sistem manajemen mutu ISO 9001:2000; (3) proses implementasi sistem manajemen mutu ISO 9001:2000; (4) tindak lanjut implementasi sistem manajemen mutu ISO 9001:2000. Kedua, proses mempertahankan sistem manajemen mutu ISO 9001:2000, yaitu: (1) manfaat implementasi sistem manajemen mutu ISO 9001:2000; (2) proses mempertahankan sistem manajem mutu ISO 9001:2000. Berdasarkan hasil penelitian diperoleh kesimpulan secara umum Implementasi sistem manajemen mutu ISO 9001:2000 di sekolah merupakan penataan manajemen sekolah untuk menciptakan suatu sistem organisasi dan budaya sekolah yang kondusif untuk membangun komitmen tumbuhnya mutu manajemen sekolah sebagai penjamin mutu. Sistem manajemen mutu ISO 9001:2000 bila dilaksanakan dengan konsisten akan memperoleh manfaat-manfaat bagi sekolah antara lain seperti : (1) menentukan secara jelas tanggung jawab dan wewenang dari personel kunci; (2) mendokumentasikan prosedur secara baik; (3) menerapkan sistem dokumentasi yang efektif; (4) meningkatkan kepercayaan dan kepuasan pelanggan; (5) meningkatkan citra dan daya saing organisasi; (6) memberikan kepada seluruh warga metode pelatihan yang sistematis melalui prosedur mutu dan instruksi kerja; (7) sebagai alat bagi pimpinan puncak menilai kinerja sumber daya manusia; (8) biaya yang efektif dan efisien; (9) sebagai sarana bekerja dengan benar dan terkendali di setiap waktu; (10) sistem manajemen dengan kinerja optimal karena adanya sistem PDCA (Plan, Do, Check, Act) yang mengendalikan mutu pelayanan secara sistematis. Manfaat implementasi sistem manajemen mutu ISO 9001:2000 akan terlihat dengan data dan informasi yang terekam dan selalu terpantau serta diinformasikan kepada seluruh warga terhadap perkembangan kinerja organisasi baik yang telah mencapai sasaran mutu maupun yang belum. Sehingga dengan mengimplementasikan sistem manajeman mutu ISO 9001:2000 mampu meningkatkan mutu manajemen sekolah. Berdasar pada kesimpulan tersebut, maka dapat dirumuskan saran-saran sebagai berikut: perlunya komitmen dari pimpinan puncak/ Top Management dalam implementasikan sistem manajemen mutu ISO 9001:2000 untuk meningkatkan mutu manajemen sekolah, sehingga mendatangkan kepuasan pelanggan bagi stakeholders dan melibatkan semua warga mengikuti sosialisasi manajemen mutu ISO secara terus-menerus, terlibat aktif dalam implementasi ISO sesuai klausul ISO yang tercantum dalam dokumen ISO.

Penerapan pembelajaran tenatik tema kesehatan untuk meningkatkan berbagai kemampuan siswa kelas II SDN Ampelsari I Kabupaten Pasuruan / Sunartin

 

Kata Kunci : Pembelajaran Tematik, Berbagai Kemampuan Siswa kelas II SD Pembelajaran tematik adalah pembelajaran terpadu yang menggunakan tema untuk mengaitkan beberapa mata pelajaran. Sehingga dapat memberikan pengalaman bermakna kepada siswa.Penelitian ini berlatar belakang adanya kualitas pembelajaran di kelas II SDN Ampelsari I Pasuruan yang relatif rendah. Kegiatan pembelajaran masih tergantung pada buku teks, belum memanfaatkan lingkungan terdekat atau lingkungan sekitar. Di samping itu juga, berbagai kemampuan dasar siswa dalam belajar masih rendah, keaktifan siswa dalam belajar kurang, dan pemahaman terhadap konsep kesehatan juga relatif rendah. Penelitian ini bertujuan untuk : 1) Mendeskripsikan penerapan pembelajaran tematik tema kesehatan yang dapat meningkatkan kemampuan dasar siswa kelas II SDN Ampelsari I Pasuruan. 2) Mendeskripsikan peningkatan kemampuan berbahasa siswa kelas II SDN Ampelsari I Pasuruan. 3) Mendeskripsikan peningkatan pemaha-man konsep kesehatan siswa kelas II SDN Ampelsari I Pasuruan. 4) Mendeskripsikan peningkatan kemampuan kognitif siswa kelas II SDN Ampelsari I Pasuruan. Untuk mencapai tujuan di atas, penelitian ini dilakukan dengan rancangan penelitian tindakan kelas (PTK). Model PTK yang dilakukan adalah penelitian tindakan kelas jenis kolaboratif, mulaidari tahap proses identifikasi masalah, perencanaan tindakan, pelaksanaan tindakan, observasi, dan refleksi. Hasil penelitian menunjukkan bahwa pelaksanaan siklus I nilai ketuntasan masih belum tercapai, nilai rata-rata siklus I 71,25 dari criteria ketuntasan kelas yaitu 75 %. Pada siklus II dari 24 siswa ( 100 % ) sudah mencapai kriteria ketuntasan dengan nilai rata-rata 78,7. Dari hasil penelitian tersebut, penerapan pembelajaran tematik tema kesehatan dapat meningkatkan berbagai kemampuan dasar siswa kelas II SDN Ampelsari I Pasuruan. Peningkatan berbagai kemampuan dasar tersebut, ditandai dengan : 1) Dalam pembelajaran membaca semua siswa dapat membaca dengan lancar. 2) Dalam pembelajaran menulis siswa dapat menulis dengan baik dan benar. Di samping itu, penerapan pembelajaran tematik di kelas II SDN Ampelsari I dapat meningkatkan pemahaman konsep tentang kesehatan. Berdasarkan hasil penelitian dapat disimpulkan bahwa penerapan pembelajaran tematik tema kesehatan dapat meningkatkan kemampuan dasar siswa kelas II SDN Ampelsari I Pasuruan. Disarankan bahwa dalam pembelajaran tema kesehatan guru kelas II SDN Ampelsari I hendaknya menggunakan model tematik. Hasil penelitian ini, sangat dimungkinkan dapat diterapkan di kelas II sekolah lain yang kondisinya sama dengan sekolah yang menjadi latar penelitian ini.

Pemecahan masalah geometri berdasarkan langkah-langkah Polya pada siswa kelas IX ditinjau dari kemampuan spasial / Abdullah Hasan

 

ABSTRAK Hasan, Abdullah. 2013. Pemecahan Masalah Geometri Berdasarkan Langkah-langkah Polya Pada Siswa Kelas IX Ditinjau Dari Kemampuan Spasial. Tesis. Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing (1) Prof. Drs. Purwanto, Ph.D., (2) Dr. Abd. Qohar, M.T. Kata kunci: Pemecahan Masalah, Geometri, Langkah-langkah Polya, Kemampuan spasial Prestasi pemecahan masalah siswa Indonesia rendah pada soal tes internasional konten ruang dan bentuk yang memiliki konstruksi kemampuan spasial. Kemampuan spasial sangat penting dalam memecahkan masalah geometri dan kurangnya kemampuan ini dapat menimbulkan miskonsepsi. Kesalahan siswa dalam memecahkan masalah dapat terjadi pada tahap tertentu dan berbeda setiap siswa. Banyak penelitian menunjukkan siswa dengan kemampuan spasial tinggi menampilkan hasil yang lebih baik dibandingkan siswa dengan kemampuan spasial rendah. Namun perlu diinvestigasi strategi dari pemecah masalah berdasarkan masing-masing tingkat kemampuan spasial. Tujuan penelitian ini adalah mendeskripsikan pemecahan masalah geometri berdasarkan langkah-langkah Polya pada siswa kelas IX ditinjau dari kemampuan spasial. Penelitian ini adalah penelitian kualitatif, dilaksanakan di kelas IX SMP Al-Ma’hadul Islami Beji Pasuruan yang terdiri dari 72 siswa dengan kemampuan spasial 69% rendah, 28% sedang dan hanya 3% tinggi. Subjek penelitian diambil 6 siswa dengan masing-masing 2 siswa kemampuan spasial rendah, sedang dan tinggi. Siswa diberi tes kemampuan spasial, tugas pemecahan masalah dan terakhir diwawancarai. Soal geometri yang diberikan terdiri dari tiga soal yang diadaptasi dari soal PISA konten ruang dan bentuk dan soal penelitian sebelumnya. Pemecahan masalah geometri yang diteliti berdasarkan langkah-langkah Polya yaitu memahami masalah, menyusun rencana penyelesaian, melaksanakan rencana penyelesaian, dan memeriksa kembali. Analisis data meliputi reduksi data, penyajian data dan kesimpulan. Kemudian validitas data diperoleh dengan metode triangulasi membandingkan hasil tes dan wawancara. Hasil penelitian menunjukkan siswa kemampuan spasial rendah tidak dapat memecahkan masalah karena tidak memahami masalah akibat sulit membayangkan, tidak dapat menyusun rencana yang tepat, tidak dapat memvisualisasi jaring-jaring tabung yang benar, tidak dapat menggambar, atau tidak memeriksa kembali jawabannya. Siswa kemampuan spasial sedang dapat memecahkan sebagian masalah dan tidak dapat memecahkan sebagian besar masalah karena tidak dapat memvisualisasi jaring-jaring tabung yang benar, tidak dapat menyusun rencana yang tepat, tidak melaksanakan rencana dengan baik atau tidak memeriksa kembali jawabannya dan mencari kemungkinan lain. Siswa kemampuan spasial tinggi dapat memecahkan masalah secara baik meskipun sebagian kurang teliti pada proses pelaksanaan rencana atau selesai sebagian karena kurang dapat memvisualisasi jaring-jaring tabung yang benar, tidak memeriksa kembali kemungkinan lain, melakukan kesalahan dalam pelaksanaan rencananya. Siswa kemampuan spasial tinggi lebih baik dari siswa kemampuan spasial sedang kecuali pada temuan soal kubus yang dicat dan jaring-jaring tabung. Siswa kemampuan spasial tinggi dan siswa kemampuan spasial sedang lebih baik dari siswa kemampuan spasial rendah. Adapun persamaan dari ketiga tingkatan berdasarkan soal yang dipecahkan yaitu di antara 3 soal maka soal nomor 1 tentang kubus yang dipotong dan dicat paling mudah dipecahkan oleh semua tingkat kemampuan spasial, dan soal nomor 3 tentang kemasan paling sulit dipecahkan oleh semua tingkat kemampuan spasial.

Presensi berbasis sidik jari dengan komunikasi wireless menggunakan Arduino / Virga Anwarektino Megah

 

ABSTRAK Megah,Virga Anwarektino 2015. Presensi Berbasis Sidik Jari dengan Komunikasi Wireless Menggunakan Arduino. Tugas Akhir. Progam Studi D3 Teknik Elektronika. Jurusan Teknik Elektro. Fakultas Teknik. Universitas Negeri Malang. Pembimbing : (I) Dr. Muladi, S.T., M.T., (II) Dyah Lestari, S.T., M.Eng. Kata Kunci : Presensi, Sidik Jari, Arduino, Modul WiFi, Web. Semakin majunya teknologi dan ilmu pengetahuan dapat dirasakan manfaatnya di segala bidang. Kebutuhan manusia akan kecepatan dan kemudahan telah mendorong manusia untuk selalu berinovasi, khususnya dalam bidang teknologi informasi dan elektronika. Perkembangan dalam memproses dan menyampaikan informasi untuk menunjang kebutuhan seperti mengembangkan suatu alat yang efektif dalam pencatatan kehadiran atau presensi. Pencatatan kehadiran yang menggunakan metode konvensional melalui media kertas, dengan cara memberikan tanda tangan dalam praktiknya kurang efektif, sebab pencatatan kehadiran melalui tanda tangan ini relatif mudah ditiru. Untuk mengatasi hal tersebut diperlukan suatu metode pencatatan kehadiran yang bersifat unik dan juga akurat salah satunya menggunakan sidik jari. Penggunaan sensor sidik jari sebagai media presensi bisa menjadi solusi yang lebih baik, maka dikembangkanlah alat presensi berbasis sidik jari dengan komunikasi wireless menggunakan Arduino yang lebih praktis. modul wifi ESP 8266 dapat membuat koneksi dengan wireless router serta mengirim data hasil pembacaan dari sensor sidik jari kedalam komputer server untuk ditampilkan dalam bentuk tabel. Sistem dapat mengidentifikasi pola sidik jari user yang sudah terdaftar dengan indikator suara buzzer dan nama user akan muncul pada penampil LCD 2x16. Alat presensi dapat terhubung ke ke komputer server melalui jaringan WLAN sehingga hasil rekapan dapat diakses pada jaringan lokal melalui web server. Tabel pencatatan kehadiran dibangun menggunakan bahasa pemrograman PHP yang berisi informasi kolom nomor, identitas, nama tanggal dan waktu. Agar alat lebih berkembang maka Alat pencatatan kehadiran ini perlu ditambahkan backup penyimpanan agar apabila jaringan wifi tidak terdeteksi, maka presensi masih dapat dilakukan.

Identifikasi pemahaman konseptual dan pemahaman siswa kelas XII IPA SMA Negeri 7 Malang pada materi sifat koligatif larutan tahun pelajaran 2009/2010 / Danny Tri Mawardi

 

Kata kunci: pemahaman konseptual, pemahaman algoritmik, sifat koligatif larutan. Ilmu kimia merupakan salah satu cabang dari ilmu pengetahuan alam (IPA) yang berhubungan dengan sifat-sifat zat, perubahan zat, hukum-hukum dan prinsip-prinsip yang menggambarkan perubahan zat,serta konsep-konsep dan teori-teori yang menjelaskan perubahan tersebut. Dalam ilmu kimia terdapat dua jenis pemahaman yang harus dikuasai oleh siswa, yaitu pemahaman konseptual dan pemahaman algoritmik. Pemahaman konseptual merupakan pemahaman tentang hal-hal yang berhubungan dengan konsep, yaitu arti, sifat, dan uraian suatu konsep. Pemahaman algoritmik merupakan pemahaman tentang prosedur atau serangkaian peraturan yang melibatkan perhitungan matematika untuk memecahkan suatu masalah. Salah satu materi kimia yang mencakup kedua pemahaman tersebut adalah sifat koligatif larutan. Adanya kedua aspek pemahaman baik konseptual maupun algoritmik dalam materi sifat koligatif larutan menunjukkan bahwa pemahaman siswa terhadap sifat koligatif larutan tidak dapat didasarkan pada salah satu diantara kedua aspek tersebut. Berdasarkan hal tersebut, tujuan penelitian adalah untuk: (1) mengetahui persentase siswa kelas XII IPA SMA Negeri 7 Malang tahun pelajaran 2009/ 2010 yang dapat menjawab pertanyaan konseptual maupun algoritmik pada materi sifat koligatif larutan; (2) mengetahui persentase siswa kelas XII IPA SMA Negeri 7 Malang tahun pelajaran 2009/ 2010 yang dapat menjawab pertanyaan konseptual, tetapi salah menjawab pertanyaan algoritmik pada materi sifat koligatif larutan; (3) mengetahui persentase siswa kelas XII IPA SMA Negeri 7 Malang tahun pelajaran 2009/ 2010 yang dapat menjawab pertanyaan algoritmik, tetapi salah menjawab pertanyaan konseptual pada materi sifat koligatif larutan; (4) mengetahui persentase siswa kelas XII IPA SMA Negeri 7 Malang tahun pelajaran 2009/ 2010 yang tidak dapat menjawab pertanyaan konseptual maupun algoritmik pada materi sifat koligatif larutan; (5) mengetahui adanya perbedaan antara tingkat pemahaman konseptual dengan pemahaman algoritmik siswa kelas XII IPA SMA Negeri 7 Malang tahun pelajaran 2009/ 2010 pada materi sifat koligatif larutan. Penelitian ini menggunakan rancangan penelitian deskriptif. Populasi penelitian adalah seluruh siswa kelas XII IPA SMA Negeri 7 Malang tahun pelajaran 2009/2010, yaitu kelas XII IPA 1, XII IPA 2 dan XII IPA 3 yang terdiri dari 111 siswa. Sampel penelitian adalah kelas XII IPA 1 dan XII IPA 3 yang dipilih dengan teknik sampling kelompok dengan cara undian kelas. Instrumen penelitian berupa tes objektif yang tersusun dari 13 soal pemahaman konseptual dan 13 soal pemahaman algoritmik yang dibuat berpasangan masing-masing

Persepsi guru tentang penilaian portofolio dan pelaksanaannya di SMA negeri Kota Malang (studi pada guru yang membina mata pelajaran ekonomi di SMA negeri Kota Malang) / Retno Erwin A.

 

Kata Kunci : Guru, Persepsi, Pelaksanaan, Penilaian Portofolio. Dunia pendidikan memiliki tantangan untuk meningkatkan standar kualitas sumber daya manusia yang nantinya mampu bersaing dalam era global yang menuntut keterampilan serta kreatifitas tinggi. Dalam Kurikulum Tingkat Satuan Pendidikan sistem penilaian dilandasi oleh prinsip validitas, reabilitas, menyeluruh, berkesinambungan, obyektif dan mendidik. Sehubungan hal tersebut, pendekatan penilaian yang digunakan adalah pendekatan penilaian berbasis kelas salah satunya adalah penilaian portofolio. Keberhasilan pelaksanaan penilaian portofolio sangat dipengaruhi oleh kemampuan guru dalam mempersepsikan, menerapkan dan mengaktualisasikan penilaian portofolio dalam pembelajaran. Kemampuan guru dalam mempersepsikan penilaian portofolio tersebut terutama berkaitan dengan pengetahuan dan pemahaman guru. Tujuan penelitian ini yaitu: 1) mendeskripsikan persepsi guru SMA Negeri di Kota Malang yang membina Mata Pelajaran Ekonomi tentang konsep penilaian portofolio; 2) mendeskripsikan persepsi guru SMA Negeri di Kota Malang yang membina Mata Pelajaran Ekonomi tentang implementasi penilaian portofolio dalam KTSP, 3) mendeskripsikan persepsi guru SMA Negeri di Kota Malang yang membina Mata Pelajaran Ekonomi tentang pelaksanaan kegiatan balajar mengajar dalam rangka implementasi penilaian portofolio; 4) mendeskripsikan bagaimana guru SMA Negeri di Kota Malang yang membina Mata Pelajaran Ekonomi melaksanakan penilaian portofolio; 5) mendeskripsikan hambatan yang terjadi pada pelaksanaan penilaian portofolio. Dalam mengumpulkan data, penulis menggunakan metode kuisioner/angket, wawancara dan dokumentasi. Populasi yang digunakan dalam penelitian ini adalah Guru Yang Membina Mata Pelajaran Ekonomi Di SMA Negeri Kota Malang yang berjumlah 33 orang. Penelitian ini adalah penelitian populasi karena pertimbangan jumlah populasi <100 responden. Hasil penelitian ini menjelaskan bahwa 33 responden sebagian besar atau sebesar 79% guru SMA Negeri yang membina Mata Pelajaran Ekonomi di Kota Malang memiliki persepsi yang baik. Presentase skor sebesar 74,48% juga menunjukkan bahwa Guru SMA Negeri yang membina Mata Pelajaran Ekonomi di Kota Malang memiliki persepsi yang baik. Pelaksanaan penilaian portofolio guru SMA Negeri yang membina Mata Pelajaran Ekonomi di Kota Malang cukup baik, ini diperlihatkan oleh data yang menunjukkan bahwa sebagian besar atau sebanyak 17 responden (51,52%) menyatakan bahwa kadang-kadang melaksanakan penilaian portofolio. Sebanyak 72% dari responden memiliki kemampuan melaksanakan penilaian portofolio dengan cukup baik, tetapi hanya sebagian kecil yaitu sebesar 35,46% yang dapat menunjukkan bukti dokumen pelaksanaan penilaian portofolio yang mereka lakukan. Dari hasil penelitian ini penulis dapat memberikan saran kepada kepada guru SMA Negeri yang membina Mata Pelajaran Ekonomi di Kota Malang hendaknya guru dapat lebih meningkatkan kompetensinya yang lebih baik lagi, kepada pihak sekolah mendukung pelaksanaan penilaian portofolio dengan menyediakan tempat penyimpanan folder portofolio dan sekolah lebih bijak dalam menentukan jumlah rombongan belajar, kepada peserta didik dapat lebih kooperatif dalam proses pembelajaran karena penilaian portofolio membutuhkan komunikasi yang multi arah, kepada orang tua siswa untuk turut berperan memantau perkembangan belajar peserta didik, kepada peneliti selanjutnya agar dapat mengungkap pelaksanan penilaian portofolio dengan lebih mendalam melalui teknik observasi yang dapat mengungkapkan kegiatan secara lebih rinci.

The Rhetoric of thesis abstracts writen written by Indonesian EFL graduate students / Erma Sujiyani

 

ABSTRAK Sujiyani, Erma. 2015. The Rhetoric of Thesis Abstracts Written by Indonesian EFL Graduate Students. Tesis. Program Pascasarjana Pendidikan Bahasa Inggris Universitas Negeri Malang. Pembimbing (I) Prof. Bambang Yudi Cahyono, M.Pd, M.A, Ph.D, (II) Prof. Drs. A. Effendi Kadarisman, M.A., Ph.D Kata Kunci: Analisis Genre, Kajian Retorika, Langkah-Strategi, Kata Kerja Perujuk Proses, Fitur-Fitur Non-Linguistik Penelitian ini mengkaji genre dan retorika dari abstrak tesis yang ditulis dalam bahasa Inggris oleh mahasiswa Pascasarjana Indonesia Program Studi Pendidikan Bahasa Inggris Universitas Palangka Raya. Dalam penelitian ini, peneliti mendeskripsikan ciri-ciri dan karakteristik retorika dari abstrak tesis mereka dengan fokus penelitian pada pola langkah retorika, strategi dalam mewujudkan langkah retorika, kata kerja yang digunakan untuk mendukung langkah retorika, dan fitur-fitur non-linguistik pendukung retorika dari abstrak tesis tersebut. Penelitian ini adalah penelitian deskriptif kualitatif dengan menggunakan teknik analisis genre. Data penelitian diperoleh dari tujuhbelas abstrak yang sengaja dipilih setelah memenuhi kriteria yang telah ditentukan sebelumnya. Untuk menganalisis langkah dan strategi retorika, digunakan model retorika abstrak yang dikembangkan oleh Samraj (2002). Model ini terdiri dari lima langkah retorika: Langkah 1–Memposisikan Penelitian, Langkah 2– Menyatakan Tujuan Penelitian, Langkah 3–Mendeskripsikan Metode Penelitian, Langkah 4–Melaporkan Hasil Penelitian, dan Langkah 5–Menyimpulkan Hasil Penelitian. Sedangkan kata kerja pendukung retorika dianalisis dengan merujuk pada model klasifikasi kata kerja yang diusulkan oleh Hyland (2002), dan fitur-fitur non-linguistik pada abstrak diteliti berdasarkan panduan yang terdapat pada buku “Panduan Penulisan Usulan Penelitian Dan Tesis, 2010” dan beberapa acuan yang disarankan oleh para ahli dalam penulisan abstrak seperti yang terangkum pada artikel Basthomi (2006b). Temuan dari penelitian ini menyatakan bahwa apabila dibandingkan dengan dua langkah retorika lainnya yaitu Langkah 1 dan Langkah 5; tiga langkah retorika yang paling sering digunakan oleh penulis abstrak adalah Langkah 2, Langkah 3, dan Langkah 4. Temuan selanjutnya merujuk kepada pola retorika yang paling sering digunakan oleh penulis abstrak yaitu pola PMRC. Namun dalam pengejawantahan strategi serta langkah retorika yang digunakan oleh penulis abstrak, pengaruh retorika dari bahasa Indonesia masih ditemukan. Hal ini bisa dilihat dari munculnya penggunaan strategi yang berulang untuk menyatakan tujuan penelitian, pola strategi non-linear yang digunakan untuk mendeskripsikan metode penelitian, adanya tumpang-tindih fungsi pada langkah retorika ke-4 dan ke-5, minimnya penggunaan langkah retorika ke-1 (untuk memposisikan penelitian), serta berulangnya pola penggabungan langkah retorika khususnya penggabungan langkah retorika ke-2 dengan langkah retorika ke-3. Selain itu, temuan penelitian ini juga menunjukkan dominasi penggunaan kata kerja yang mengacu pada Research (Real-World) Acts. Analisis fitur-fitur non-linguistik menunjukkan bahwa sebagian besar penulis abstrak cenderung mengikuti pedoman penulisan yang telah ditetapkan walaupun dalam pelaksanaannya masih ditemukan keragaman dalam jumlah kata dan paragraf yang digunakan untuk menyusun abstrak; demikian juga dengan penggunaan kata kunci dan posisinya dalam abstrak yang tidak seragam tata-letaknya. Berkenaan dengan hal tersebut di atas, diharapkan temuan dalam penelitian ini dapat memberikan kontribusi positif di bidang pendidikan. Temuan ini dapat digunakan untuk membantu pembelajar bahasa Inggris agar lebih mudah untuk memahami dan menguasai ciri-ciri dan karakteristik retorika bahasa Inggris. Untuk pengajar bahasa Inggris, temuan ini dapat diaplikasikan dengan materi bahan ajar mereka terutama yang berhubungan dengan pengajaran Academic Writing. Selanjutnya temuan ini bisa juga dimanfaatkan sebagai bahan ajar dalam mata kuliah “An Introduction to Discourse Analysis” serta dapat juga digunakan untuk melengkapi dan merevisi aturan yang telah termaktub dalam buku “Panduan Penulisan Usulan Penelitian Dan Tesis, 2010”. Peneliti selanjutnya disarankan untuk meneliti bagian lainnya dari tesis semisal bagian pembukaan ataupun bagian pembahasan dengan melibatkan penulis dari penutur asli bahasa Inggris yang berasal dari universitas di Indonesia maupun dari luar negeri yang mengkaji bidang ilmu yang sama maupun bidang ilmu lainnya.

The relationship between metacognitive knowledge and metacognitive experience and reading comprehensian ability / Rahayu Prasetyaningsih

 

ABSTRAK Prasetyaningsih, Rahayu. 2015. HubunganantaraPengetahuandanPengalamanMetakognitifdenganKemampuanMemebacaPemahaman.Tesis, PengajaranBhaasaInggris, PascasarjanaUNiversitasNegeri Malang. Pembimbing: (I) Dr. EkaningDewantiLaksmi, M.Pd., M.A., (II) Dr. Johannes A. Prayogo, M.Pd.,M.Ed. Kata Kunci: PengetahuanMetakognitif, PengalamanMetakognitif,KemampuanPemahamanMemebaca. Sebagaibagian darikemampuan bahasa, membacamenjadi salah satuhal penting yang harusdikuasai dalam rangkauntuk memenuhikebutuhanpendidikandiseluruhdunia. Tujuan dari penelitianiniadalahuntuk mengetahuihubungan antara PengetahuandanPengalamanMetakognitifdengankemampuan membaca pemahaman. DuapuluhenammahasiswadariUniversitasKanjuruhan di Malang berpartisipasisebagaisampeldalampenelitianini.Merekaadalahmahasiswa semester empat yang mengambilmatakuliah Reading 4.Diberikan Metacognitive Awareness Inventory (MAI) dan Reading tes.Pengambilan data dilakukanselamaduahari.Untuksetiapharinya, mahasiswadimintamengisikuesionerselama 10 menit.Kemudian, merekadimintauntukmemebacateksdanmenjawablimapertanyaanuntukmasing-masingnyaberdasarkantekstersebut. Untukmenemukanhubunganpadabeberapa variable, data yang diperolehdianalisismenggunakananalisiregresibergandadengan SPSS.22. Hasildaripenelitianiniterungkapbahwaadahubungan yang signifikanantarapengetahuandanpenglamanmetakognitifdengankemampuanmemebacapemahaman. Sepertihasildaripenelitiansebelumnyadanbeberapaliteratur, pengetahuanmetakognitifsecarasignifikanberhubungandengankemempuanpemahamanmemebaca (0.694) coefficient β danpengalamanmetakognitifsecarasignifikanberhubungandengankemepuanpemahamanmemebaca (0,399) coefficient β. Memepertimbangkanhubungan yang lebihtinggiantarakedua variable prediktorterhadapkemempuanmemebacapemahaman, pengetahuanmetakognitifmemeilikihubungansecarasignifikanlebihtinggiterhadapkamampuanpemahamanmemebaca (0.630) coefficient βdaripadapengalamanmetakognitif (0.342) coefficient β. Dapatdisimpulkan, pengetahuanmetakognitifdanpengalamanmetakognitifdapatdigunakansebagaiperdiktoruntukmelihatkemampuansiswadalampemahamanmemebacanya.Sebagaiimplikasidaripenelitianini, disarankanparadoesndapatmengajarkandanmelatihsiswauntukmengoptimalkanpenggunaanmetakognisipada reading untukmendapatkanhasilpemeblajaran yang lebihbaik.Sebagaitambahan, dosen reading dapatemembuatmacam-macamstartegi yang memasukkanaktifitasmetakognitifselama proses pengajarandanpembelajaranuntukmeningkatkankemampuanmerekadalamkemampuanmembaca. Untuktambahan, peneliti yang lebihlanjutperludilakukandenganmenggunakanmetakognisidihubungkandengan skill berbahasa yang lain. Melakukanpenelitianpadabidangmetakognisiterkhusus sub aspekdarisetiapmetacognisidibutuhkanuntukmendapatkan data yang lebihakuratdanmenggunakanhasildaripenelitianinisebagaireferensi.

Pengaruh kinerja keuangan terhadap kebijakan dividen pada perusahaan manufaktur yang go publik di Bursa Efek Indonesia tahun 2005-2007 / Lucien Meytasari

 

Kata Kunci: Current Ratio, Earning Per Share, Return On Investment, Debt to Total Assets, Total Assets Turn Over dan Dividen Payout Ratio. Kebijakan dividen merupakan keputusan apakah laba yang diperoleh perusahaan akan dibagikan kepada pemegang saham sebagai dividen atau akan ditahan dalam bentuk laba ditahan guna pembiayaan investasi di masa yang akan datang. Salah satu faktor penetapan kebijakan dividen yaitu faktor financial yang diukur dengan menggunakan unsur-unsur kinerja keuangan perusahaan. Kinerja keuangan perusahaan mampu memberikan gambaran baik kepada manajemen maupun para investor mengenai pertumbuhan dan perkembangan perusahaan serta kondisi keuangan pada periode tertentu. Kinerja keuangan dapat diukur dengan menggunakan analisis rasio keuangan yang merupakan hubungan perkiraan neraca dan laporan laba rugi terhadap satu laporan dengan laporan yang lain, yang memberikan gambaran tentang sejarah perusahaan serta penilaian terhadap keadaan suatu perusahaan. Laba perusahaan merupakan unsur dasar dari kebijakan dividen sehingga analisis rasio keuangan berpengaruh terhadap kebijakan dividen. Tujuan dari penelitian ini adalah: (1) Untuk mengetahui kondisi kinerja keuangan yang diukur dengan rasio keuangan berupa Current Ratio (CR), Earning Per Share (EPS), Return on Investment (ROI), Debt To Total Assets, Total Asset Turn Over dan Dividen Payout Ratio (DPR) pada perusahaan manufaktur yang go publik di BEI, (2) Untuk menguji pengaruh Current Ratio (CR), Earning Per Share (EPS),Return on Investment (ROI), Debt To Total Assets, Total Asset Turn Over secara parsial terhadap Dividen Payout Ratio (DPR) pada perusahaan manufaktur yang go publik di BEI pada tahun 2005-2007, (3) Untuk menguji pengaruh rasio keuangan yang berupa Current Ratio (CR), Earning Per Share (EPS), Return on Investment (ROI), Debt To Total Assets, Total Asset Turn Over secara simultan terhadap Dividen Payout Ratio (DPR) pada perusahaan manufaktur yang go publik di BEI pada tahun 2005-2007. Jenis penelitian ini adalah Explanatory Research yaitu penelitian yang menyoroti hubungan antara variabel penelitian. Analisis data yang digunakan adalah metode kuantitatif. Populasi dalam penelitian ini adalah perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia (BEI) selama tahun 2005-2007 yang berjumlah 151 perusahaan. Teknik pengambilan sampel dalam penelitian ini adalah purposive sampling, sehingga terpilih 24 perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia (BEI) pada tahun 2005-2007 sebagai sampel penelitian. Hasil dari penelitian ini adalah sebagai berikut (1) Kondisi kinerja keuangan pada perusahaan manufaktur yang go publik pada tahun 2005-2007 yang meliputi current ratio mengalami tren meningkat, earning per share ii mengalami tren menurun, return on investment mengalami tren meningkat, debt to total assets mengalami tren meningkat, dan total assets turn over mengalami tren meningkat, dan dividen payout ratio memiliki tren meningkat, (2) Hanya Variabel Earning per Share saja yang berpengaruh signifikan secara parsial terhadap Dividen Payout Ratio pada perusahaan manufaktur yang go publik pada tahun 2005-2007, (3) Rasio keuangan yang berupa Current Ratio, Earning Per Share (EPS), Return on Investment (ROI), Debt To Total Assets, dan Total Asset Turn Over mempunyai pengaruh secara simultan terhadap Dividen Payout Ratio (DPR) pada perusahaan manufaktur yang go publik di BEI pada tahun 2005-2007. Berdasarkan penelitian ini, dapat disarankan (1) Variabel dalam penelitian ini belum mampu menjelaskan variasi variabel yang mempengaruhi dividen payout ratio dikarenakan variabel dalam penelitian ini memiliki nilai Adjusted R-Square hanya sebesar 12,6% dan sisanya sebesar 87,4% dijelaskan oleh variabel di luar penelitian ini, (2) Perusahaan manufaktur hendaknya selalu meningkatkan kinerja perusahaannya, terutama tentang rasio pasar yaitu earning per share dikarenakan rasio ini berpengaruh terhadap kebijakan dividen, (3) Apabila para investor berkeinginan untuk berinvestasi pada perusahaan manufaktur, maka hendaknya para investor secara selektif memperhatikan kondisi kinerja keuangan perusahaan manufaktur setiap tahunnya, para investor dapat memperhatikan Earning per Share sebagai pertimbangan atas pengembalian investasinya (dividen), sehingga kegiatan investasi yang akan dilakukan benar-benar dapat memberikan jaminan atas keuntungan yang akan diterima, (4) Bagi peneliti selanjutnya diharapkan untuk memperkaya jumlah sampel pada perusahaan manufaktur, mengingat jumlah perusahaan manufaktur yang sangat banyak dengan menggunakan periode penelitian yang terbaru sehingga penelitian ini dapat lebih berkembang dan dapat memberikan manfaat yang lebih besar bagi pihak-pihak yang terkait.

Pengaruh model Project Based Learning (PjBL) terhadap hasil belajar geografi siswa SMAN 1 Rejotangan Tulungagung / Emi Hanurowati

 

ABSTRAK Hanurowati, Emi. 2015. Pengaruh Project Based Learning (PjBL) terhadap Hasil Belajar Geografi Siswa SMAN 1 Rejotangan Tulungagung. Tesis. Program Studi Pendidikan Geografi, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Sugeng Utaya, M.Si, (2) Drs. I Komang Astina, MS. Ph.D. Kata Kunci: Model Project Based Learning (PjBL), Hasil Belajar Project Based Learning (PjBL) merupakan salah satu model pembelajaran saintifik pada kurikulum 2013 yang bertujuan mengembangkan keterampilan siswa pada ranah konkrit dan abstrak. Model ini berpengaruh pada motivasi dan hasil belajar siswa. Hal ini karena siswa mengalami secara langsung, sehingga peduli terhadap lingkungan sekitar. Penelitian ini bertujuan untuk mengetahui pengaruh PjBL terhadap hasil belajar geografi siswa SMA pada materi pengelolaan sampah. Penelitian ini menggunakan eksperimental semu (quasi experimental design). Penelitian eksperimental semu digunakan untuk menjelaskan hubungan sebab akibat antara variabel bebas dan terikat dengan cara melibatkan kelas kontrol dan eksperimen. Kelas kontrol dengan pembelajaran ceramah bervariasi dengan tanya jawab dan penugasan pada kelas eksperimen dengan model Project Based Learning (PjBL). Instrumen dalam penelitian ini berupa soal esay untuk Pretest-Posttest. Analisis yang digunakan adalah analisis statistik deskriptif dan statistik parametrik. Hasil penelitian menunjukkan bahwa: hasil belajar kelas eksperimen memiliki rata-rata 76.04, lebih tinggi 7.64 poin dibandingkan dengan kelas kontrol 68.40. Uji beda Independent Sample t-Test memperoleh nilai signifikansi 0.000<0.05. Hal ini berarti model Project Based Learning (PjBL) berpengaruh signifikan terhadap hasil belajar geogafi siswa SMAN 1 Rejotangan. Berdasarkan kesimpulan yang diperoleh dalam penelitian ini, maka dapat disarankan bagi semua pihak yang berkepentingan. Model PjBL disarankan pada materi lingkungan lain dengan alokasi waktu yang cukup. Guru menjaga motivasi siswa tetap stabil dengan cara menunjukkan sikap antusias dan memberikan penghargaan terhadap proyek siswa.

Perlindungan hukum bagi pemegang hak cipta bidang musik di Indonesia dalam mengahadapi teknologi motion pictures expert group audio layer III (MP3) / Nadia Amalia

 

Kata Kunci : Perlindungan Hukum, Pemegang Hak Cipta, Bidang Musik, Teknologi Motion Pictures Expert Group AudioLayer III (MP3). Dibidang Hak cipta, pengaturan dan perlindungannya telah diatur dalam Undang- Undang Nomor 6 tahun 1982, tentang hak cipta sebagaimana telah diubah dan ditambah serta disempurnakan dengan Undang-Undang Nomor 7 Tahun 1987, dan terakhir diubah dengan Undang-Undang Nomor 12 Tahun 1997, tentang hak cipta, yang merupakan pengganti dari Auteurswet 1912 sebagimana termuat dalam Staastblad Tahun 1912 Nomor 600, tentang hak cipta. Undang-Undang tersebut selain menyempurnakan beberapa ketentuan yang dirasakan kurang memberi perlindungan bagi pencipta, juga mengadakan penambahan dan penyesuaian seperlunya dengan persetujuan Trade Related Aspects of Intellectual Property Rights (TRIPs) sebagai bagian dari General Agreement on Tariffs and Trade (GATT)/ Word Trade Organitation (WTO). Kemudian Undang-Undang Hak Cipta 1982 ini secara total diganti dengan Undang-Undang Nomor 19 Tahun 2002, tentang Hak Cipta yang telah mulai berlaku pada 29 Juli 2003. Aktifitas pertukaran file Motion Pictures Expert Group AudioLayer III (MP3) ini jelas merugikan hak ekonomi para pencipta musik, belum lagi aktifitas pertukaran konvensional yang nyata dapat kita lihat sehari-hari. Upaya dalam memperbaiki keadaan tersebut adalah dengan menyebarluaskan pemahaman yang sebenarnya mengenai arti, fungsi dan peranan perlindungan hukum bagi pemegang hak cipta bidang musik di Indonesia dalam kehidupan berbangsa dan bernegara. Kita semua tidak cukup hanya mengandalkan dengan cara mengundangkan suatu peraturan perundang-undangan dengan menempatkannya dalam Lembaga Negara, agar setiap orang dianggap mengetahui perundang-undangan tersebut. Perlu adanya usaha yang sungguhsungguh untuk menyebarluaskan materi perundang-undangan tersebut kepada masyarakat, termasuk kepada aparat penegak hukumnya, agar semua memahami dan menyadari secara benar perlindungan hukum bagi pemegang hak cipta di Indonesia. Metode Penelitian ini menggunakan metode kajian yuridis normatif, yaitu penelitian ini menjadikan sistem norma sebagai pusat kajiannya. Yang berfokus pada peraturan perundang-undangan terkait dengan perlindungan hukum bagi pemegang hak cipta bidang musik di indonesia dalam menghadapi teknologi Motion Pictures Expert Group AudioLayer III (MP3). Hasil dari penelitian ini, (1) Problematika Hak Cipta di Indonesia muncul karena budaya masyarakat tradisional di indonesia tidak mengenal hak cipta. Nilai-nilai budaya masyarakat Indonesia tidak mengenal pemilik individu terhadap suatu karya cipta dalam bidang ilmu pengetahuan, sastra, dan seni. Pada intinya tiru-meniru dalam kehidupan seni masyarakat tradisional tidak pernah dirisaukan dan dipermasalahkan. Sedangkan negaranegara maju mengusung filsafat individualisme dan kapitalisme, yang kemudian mewujud dalam gagasan melindungi hak-hak milik individual, khususnya perlindungan terhadap property, baik intellectual property maupun modal (capital). Inilah prolematika hak cipta di Indonesia yang kemudian menjadi pertemuan interaksi yang tentu saja polanya sangat ii ditentukan oleh latar belakang budaya masing-masing pihak yang berinteraksi; (2) Tindakan para pemilik file MP3 yang saling bertukar file Motion Pictures Expert Group AudioLayer III (MP3) termasuk dalam doktrin fair use di dalam perundang-undangan tentang hak cipta. Namun terhadap progam komputer khususnya Motion Pictures Expert Group Audio Layer III (MP3) pengecualian yang diperbolehkan hanya pembuatan salinan oleh pemegang lisensi penggunaan sebagai cadangan bila terjadi kerusakan saja. sedangkan bagi kepentingan pendidikan, penelitian atau non komersial lainnya Undang-Undang Hak Cipta Indonesia belum mengaturnya. Dalam beberapa pasal Undang-Undang Hak Cipta yang mengatur tentang penggunaan dan perlindungan progam komputer untuk kepentingan pendidikan atau non komersial dalam Undang-Undang Nomor 19 tahun 2002, tentang Hak Cipta belum diatur secara tegas, atau terjadi kekosongan hukum dibidang ini. Hal ini memungkinkan di laksanakan dalam suatu mekanisme penerapan fair use terhadap karya cipta progam komputer khususnya Motion Pictures Expert Group Audio Layer III (MP3); (3) Tindakan para pemilik file Motion Pictures Expert Group AudioLayer III (MP3) yang saling bertukar file MP3 termasuk dalam doktrin fair use di dalam perundang-undangan tentang hak cipta. Namun terhadap progam komputer khususnya Motion Pictures Expert Group Audio Layer III (MP3) pengecualian yang diperbolehkan hanya pembuatan salinan oleh pemegang lisensi penggunaan sebagai cadangan bila terjadi kerusakan saja. sedangkan bagi kepentingan pendidikan, penelitian atau non komersial lainnya Undang-Undang Hak Cipta Indonesia belum mengaturnya. Dalam beberapa pasal Undang-Undang Hak Cipta yang mengatur tentang penggunaan dan perlindungan progam komputer untuk kepentingan pendidikan atau non komersial dalam Undang-Undang Nomor 19 tahun 2002, tentang Hak Cipta belum diatur secara tegas, atau terjadi kekosongan hukum dibidang ini. Hal ini memungkinkan di laksanakan dalam suatu mekanisme penerapan fair use terhadap karya cipta progam komputer khususnya Motion Pictures Expert Group Audio Layer III (MP3). Saran yang dapat disampaikan berkaitan dengan hasil dari peneiltian adalah sebagai berikut : (1) Perlu diadakan sosialisasi tentang pentingnya hak cipta pada semua masyarakat sampai ke daerah-daerah, khususnya pada masyarakat selebritis, seniman dan budayawan agar menghayati norama-norma yang berlaku di masyarakat, supaya tidak menjadi korban oleh pelanggar hak cipta yang tidak bertanggung jawab, sehingga memberi pengetahuan lebih tentang pentingnya suatu ciptaan atau hasil karya; (2) Adanya perbaikan dalam Undang- Undang No.19 tahun 2002, tentang hak cipta yang masih banyak kelemahan di tiap ayatnya, agar lebih terfokus tentang ciptaan yang semakin hari semakin banyak dan berkembang; (3) Agar aparat hukum dapat berperan sesuai dengan ketentuan Undang-Undang No.19 tahun 2002, tentang hak cipta. Menjalankan sebagaimana mestinya sehingga kasus-kasus pelanggaran hak cipta di Indonesia dapat dengan mudah dan cepat terselesaikan.

Pengembangan multimedia interaktif pembelajaran IPS tema Pahlawanku kelas IV SDN Krebet 01 Bululawang Kab. Malang / Fitri Rohdiyah Guntarto Wati

 

ABSTRAK Wati, FitriRohdiyahGuntarto. 2015. Pengembangan Multimedia InteraktifPembelajaran IPS TemaPahlawankuKelas IV SDN Krebet 01 KecamatanBululawangKabupaten Malang.Tesis.JurusanPendidikanDasar, PascasarjanaUniversitasNegeri Malang. Pembimbing : (I) Prof. Dr.Hariyono,M.Pd., (II) Dr. Sunaryanto, M.Pd Kata kunci : Multimedia Interaktif, Pahlawanku, Pembelajaran IPS Berdasarkanhasilobservasidanwawancara di SDN Krebet 01 Bululawang, ditemukanbahwapembelajaran yang dilakukanmenggunakanmetodeceramah, penugasansertatanyajawab. Selainitu media yang digunakanadalahgambar diam. Hal inimenunjukkanbahwapemanfaatankemajuan (IPTEK) dalam proses belajarmengajarmasihkurang. Temapahlawankumerupakanmateri yang memerlukancontohuntukmempelajarinyadanmelibatkansiswasecaralangsungdalampenemuankonsep.Tujuanpenelitianpengembanganadalahmenghasilkanproduk multimedia interaktifpembelajaran IPS kelasempat, bukupetunjukpenggunaanuntuk guru dansiswasertauntukmengetahuitingkatkeefektifan, keefisienandankemenarikan multimedia interaktifpadapembelajaran IPS. Penelitianpengembanganmenggunakan model ASSURE inidiadopsidariSharon E Smaldino yang terdiridarianalisiskarakteristiksiswa, menentukantujuanpembelajaran, metode, media danbahan ajar, memanfaatkanbahan ajar, melibatkansiswadalamkegiatanbelajarmengajar, evaluasidanrevisi. Data yang dikumpulkanberupavalidasiahli, observasisertaangketsiswa.Ujicobadilakukandua kali pertemuanyaitupadatanggal 23 April 2015 dan 25 April 2015.Subjekpenelitianiniadalahsiswakelasempat SDN Krebet 01 Bululawang. Pengembangan multimedia interaktifdivalidasioleh 3 ahliyaituahli media, materidanbahasa.Hasilvalidasi media memilikikriteriacukupbaik, ahlimaterimemilikikriteriasangatbaik, danahlibahasamemilikikriteriasangatbaik.Hasilpenelitianterhadap guru padatingkatkeefektifanmemilikikriteriasangatefektif, tingkatkeefisienanmemilikikriteriasangatefisien, dantingkatkemenarikanmemilikikriteriasangatmenarik.Hasilpenelitianterhadapsiswapadatingkatkeefektifanmemilikikriteriasangatefektif, tingkatkeefisienanmemilikikriteriasangatefisien, dantingkatkemenarikanmemilikikriteriasangatmenarik. Pengembangan multimedia interaktifinidapatdigunakandalampembelajarandisekolahkhususnya di kelasempat, tetapialangkahbaiknya guru jugadapatmenambahkahataumenggunakan media lain padasaatpembelajaran. Temuan lain padasaatujicobayaituadanyakerjasamaantarasiswa yang harmonis, salingmembantudalamkegiatanbelajardanmembuatsiswalebihbersemangatbelajardibandingkansebelumsiswamenggunakan multimediasehinggadapatdikatakanbahwapengembangan multimedia interaktifinidapatdipakaisebagaipelengkapuntukmenunjangpembelajaran di dalamkelaskhususnyapadapembelajaran IPS temapahlawanku.

Manajemen pemasaran sekolah alam bilingual (Studi kasus di SDI Surya Buana Malang) / Ainun Nikmah

 

Kata kunci: manajemen pemasaran, sekolah alam bilingual Lembaga pendidikan keberadaanya sangat dibutuhkan masyarakat, akan tetapi sebaliknya masyarakat juga dibutuhkan oleh lembaga pendidikan. Agar penyelenggaraan pendidikan dapat berjalan secara maksimal maka keterlibatan semua pihak baik pemerintah, keluarga, swasta dan masyarakat umumnya sangat dibutuhkan oleh sekolah. Untuk meningkatkan hubungan yang baik antara masyarakat dan lembaga sekolah maka dibutuhkan komunikasi yang baik. Oleh karena itu disini peran serta Hubungan Masyarakat (Humas) sangat dibutuhkan. Setiap organisasi, dari kegiatan awal sampai akhir, akan melalui berbagai bentuk dan tahap kegiatan yang harus menyatu dan terpadu dalam rangka mencapai mutu terbaik. Perekat dari semua tahap kegiatan dan usaha itulah yang disebut dengan humas. Sedangkan untuk manajemen pemasaran itu sendiri adalah merupakan kegiatan penganalisaan, perencanaan, pelaksanaan, dan pengendalian program- program yang dibuat untuk membentuk, membangun dan memelihara, keuntungan dari pertukaran melalui sasaran pasar guna mencapai tujuan organisasi (perusahaan) jangka panjang (Assauri, 2002:12). Fokus penelitian ini adalah tentang bagaimana manajemen pemasaran di Sekolah Alam Bilingual SDI Surya Buana Malang, sedangkan fokus secara rinci dapat dijabarkan sebagai berikut: (a) proses perencanaan pemasaran di Sekolah Alam Bilingual SDI Surya Buana Malang; (b) teknik pemasaran di Sekolah Alam Bilingual SDI Surya Buana Malang; (c) teknik pengawasan pemasaran di Sekolah Alam Bilingual SDI Surya Buana Malang; (d) media yang paling efektif dalam pemasaran di Sekolah Alam Bilingual SDI Surya Buana Malang; (e) faktor pendukung dan penghambat dalam kegiatan manajemen pemasaran di Sekolah Alam Bilingual SDI Surya Buana Malang. Penelitian ini dilakukan dengan menggunakan pendekatan kualitatif. Jenis penelitian adalah studi kasus karena ada satu kasus pada satu objek penelitian, yaitu SDI Surya Buana Malang. Lokasi penelitian terletak di Jalan Simpang Gajayana IV/631 Malang. Peneliti berperan sebagai instrument kunci, dengan subjek peneliti Kepala Sekolah dan guru SDI Surya Buana Malang. Sumber data yang digunakan berupa kata-kata yang diperoleh melalui wawancara dan berupa tindakan yang diperoleh melalui kegiatan observasi dan pengamatan yaitu dengan keterlibatan peneliti mengamati secara langsung serta dokumen yang berkaitan dengan manajemen pemasaran. Data yang diperoleh dianalisis selama dan setelah pengumpulan data. Pengecekan keabsahan data dilakukan dengan tiga kriteria yaitu: kepercayaan penelitian, validitas, reliabilitas, dan objektivitas (Wiyono 2007:21). ii Hasil penelitian ini adalah manajemen pemasaran yang terdiri dari perencanaan, teknik pelaksanaan, teknik pengawasan, media yang paling efektif, serta faktor pendukung dan penghambat dalam manajemen pemasaran. Perencanaan disini meliputi: kegiatan yang harus dikerjakan adalah kegiatan memasarkan sekolah kepada masyarakat luas, kedua adalah dimana kegiatan itu akan dilakukan, salah satu kegiatannya saat sekolah mengundang masyarakat sekitar untuk datang ke sekolah dalam rangka sholat Idul Adha, ketiga adalah kapan waktunya adalah pada bulan April sampai dengan bulan juni, keempat adalah bagaimana cara memasarkan sekolah dengan menggunakan berbagai teknik serta alat-alat pemasaran, kelima adalah siapa saja orang-orang didalamya yaitu kepala sekolah dibantu oleh para pendidik beserta staf. Dan terakhir adalah mengapa pemasaran tersebut perlu dilakukan adalah dalam upaya agar sekolah mendapatkan siswa lebih banyak untuk bersekolah di SDI Surya Buana Malang ini. Pelaksanaanya dilakukan dengan menggunakan teknik serta alat dan media pemasaran mulai dari seperti penggunaan brosur, spanduk, getok tular atau dari orang ke orang, televisi, radio, majalah, kalender sekolah, buku profil, album kenangan, dan alat transportasi. Dana yang digunakan berasal dari yayasan serta sebagian berasal dari pemerintah. Teknik pengawasan dilakukan dengan dua teknik yaitu pengawasan secara langsung dan pengawasan tidak langsung. Pemilihan media yang paling efektif dalam menarik peserta didik yang berada di dekat sekolah adalah teknik getok tular atau dari mulut ke mulut, hal ini diketahui dari wawancara dengan berbagai narasumber. Sedangkan untuk yang berada jauh dari sekolah yang paling efektif adalah menggunakan media brosur. Faktor pendukung dan penghambat, faktor pendukungnya meliputi: (1) dukungan dari masyarakat luas, tokoh masyarakat, (2) dukungan dari siswa di Surya Buana Malang mulai dari TK, SDI, MTs, serta SMA (3) dukungan dari Yayasan Bahana Cipta Persada (4) dukungan dari Kepala Sekolah, para pendidik juga seluruh staf. Faktor penghambatnya meliputi: (1) banyak masyarakat di dekat sekolah akan tetapi mereka tidak menyekolahkan anaknya di sini, (2) persaingan dengan sekolah swasta, (3) letak sekolah yang terletak di dalam kampung sehingga belum banyak orang yang tahu bahwa ada sekolah Surya Buana. Berdasarkan hasil penelitian ini, maka disarankan kepada: (1) Kepala Sekolah SDI Surya Buana agar tetap mempertahankan serta meningkatkan manajemen pemasaran, lebih giat dalam memasarkan sekolahnya dengan menggunakan berbagai macam teknik dan media pemasaran yang ada. (2) Bagi Guru SDI Surya Buana Malang harus lebih giat dalam mendidik para peserta didik agar mereka dapat lebih berprestasi baik dalam segi bidang akademik maupun non akademik. (3) Bagi Orangtua Siswa hendaknya lebih selektif dalam memilih sekolah untuk anaknya, agar tidak salah pilih dalam menyekolahkan anaknya serta merasa puas terhadap prestasi yang telah dicapai dengan menyekolahkan anaknya pada sekolah yang berkualitas. (4) Jurusan Administrasi Pendidikan diharapkan dapat memberikan pemahaman yang lebih kepada para mahasiswa tentang manajemen pemasaran di lembaga pendidikan. (5) Bagi Peneliti selanjutnya diharapkan meneliti lebih baik dan lebih mendalam lagi mengenai manajemen pemasaran, akan tetapi pada latar penelitian yang berbeda tentunya pada sekolah yang berbeda.

Perencanaan desain uang kertas baru pecahan 20.000, 50.000, 100.000 bercorakkan budaya daerah / oleh Ainur Rofiq

 

Pengembangan buku guru dan buku siswa berbasis multiple inteligences, joyfull learning dan keunggulan lokal pada kelas IV tema Daerah Tempat Tinggalku / Febrianti Yuli Satriyani

 

ABSTRAK Satriyani, Febrianti Yuli, 2015. Pengembangan Buku Guru dan Buku Siswa BerbasisMultiple Intelligences, Joyfull Learningdan Keunggulan Lokal PadaKelas IV Tema Daerah Tempat Tinggalku. Tesis, Program Studi Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Sa’dun Akbar, M.Pd; (II) Dr. Titik Harsiati, M.Pd. Kata Kunci : Buku guru, Buku siswa, Multiple Intelligences, Joyfull Learning, Keunggulan Lokal Berdasarkan hasil observasi dan wawancara di tiga sekolah, ditemukan beberapa kendala pada proses pembelajaran, antara lain: (1) guru belum membuat perangkat pembelajaran (silabus modifikasi dan RPP), (2) pembelajaran terpusat pada guru dan siswa sebagai penerima pasif, (3) pembelajaran tematik yang terlaksana masih terkotak-kotak pada masing-masing mata pelajaran, (4) materi yang tersaji dalam buku terbitan pemerintah kurang sesuai dengan perkembangan kognitif siswa, khususnya pada kelas IV tema 8 (daerah tempat tinggalku).Materi yang dibahas dalam buku 70% tentang daerah-daerah yang jauh dengan lingkungan tempat tinggal siswa (Papua, Bali, Sumatera dan Jakarta).Tujuan penelitian ini yaitu untuk menghasilkan buku guru dan buku siswa berbasis multiple intelligences, joyfull learning dan keunggulan lokal pada tema daerah tempat tinggalku yang: (1) valid secara teoretik, (2) memiliki tingkat keterlaksanaan dan kemanfaatan yang tinggi, serta (3) efektif untuk mencapai tujuan pembelajaran. Penelitian ini termasuk penelitian pengembangan. Penelitian ini menggunakan model pengembangan penyederhanaan dari Borg & Gall yang meliputi: (1) studi pendahuluan, (2) perencanaan, (3) desain produk, (4) validasi produk, (5) uji coba produk, dan (6) produk akhir. Pada tahap perencanaa dan uji coba produk, agar lebih jelas peneliti menggunakan beberapa langkah yang dimodifikasi dari Dick & Carey. Hasil penelitian menunjukkan bahwa buku guru dan buku siswa yang dikembangkan memilikinilai yang sangat valid dengan persentase ketercapaian 92,5%, memiliki tingkat keterlaksanaan yang sangat baik denganpersentase ketercapaian 88%, sangat bermanfaat dengan persentase ketercapaiam 91% dan sangat efektif dengan persentaseketercapaian 91% untuk mencapai tujuan pembelajaran pada tema daerah tempat tinggalku di kelas IV MIT Ar-Roihan Kecamatan Lawang Kabupaten Malang. Dari hasil uji coba yang dilaksanakan, maka disarankan bagi guru untuk menggunakan buku guru dan buku siswa berbasis MI, JL dan KL sebagai salah sumber belajar karena terbukti sangat valid secara teoretik, memiliki nilai keterlaksanaan, kemanfaatan dan keefektifan yang sangat tinggi dalam mencapai tujuan pembelajaran.

Pengaruh strategi problem based learning dipadu jigsaw terhadap kemampuan berpikir kritis dan hasil belajar kognitif siswa kelas X SMA di Kabupaten Jember / Ray Sitta Nurmala

 

ABSTRAK Nurmala, Rayh Sitta. 2015. Pengaruh Strategi Problem Based Learning Dipadu Jigsaw terhadap Kemampuan Berpikir Kritis dan Hasil Belajar Kognitif Siswa Kelas X SMA di Kabupaten Jember. Tesis. Program Studi Pendidikan Biologi, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Aloysius Duran Corebima, M.Pd., (II) Dr. Ibrohim, M.Si. Kata kunci: strategi problem based learning, jigsaw, kemampuan berpikir kritis, hasil belajar kognitif Pendidikan merupakan suatu kebutuhan yang harus dipenuhi dalam proses kehidupan. Majunya suatu bangsa dipengaruhi oleh mutu pendidikan bangsa itu sendiri karena pendidikan yang tinggi dapat mencetak sumber daya manusia yang berkualitas. Masalah dalam dunia pendidikan saat ini adalah siswa kurang dilatih untuk mengembangkan kemampuan berpikirnya. Hal ini disebabkan guru masih menganggap memberikan informasi lebih penting daripada melatih kemampuan berpikir. Salah satu strategi pembelajaran yang dapat melatih siswa untuk mampu belajar mandiri, melatih kemampuan berpikir tingkat tinggi, dan diharapkan mampu meningkatkan hasil belajar siswa adalah strategi Problem Based Learning dipadu Jigsaw. Penelitian ini bertujuan untuk mengetahui pengaruh strategi Problem Based Learning dipadu Jigsaw terhadap kemampuan berpikir kritis dan hasil belajar kognitif siswa kelas X SMA di kabupaten Jember. Rancangan penelitian yang digunakan adalah eksperimen semu. Desain penelitian yang digunakan adalah pretest-posttest nonequivalent control group design. Populasi penelitian ini seluruh siswa kelas X SMA di kabupaten Jember tahun pelajaran 2014/2015. Sampel penelitian ini siswa kelas X IPA 3 sebagai kelompok kontrol, X IPA 1, X IPA 2 dan X IPA 4 sebagai kelompok eksperimen. Teknik pengambilan sampel dilakukan dengan menggunakan teknik simple random sampling. Teknik pengumpulan data dilakukan dengan memberikan tes uraian tertulis. Uji hipotesis menggunakan anakova. Sebelum dilakukan uji hipotesis dilakukan uji normalitas menggunakan Kolmogorov-Smirnov Test dan uji homogenitas menggunakan Levene’s Test untuk mengetahui data terdistribusi normal dan homogen. Berdasarkan hasil analisis data penelitian dan pembahasan, dapat disimpulkan bahwa hasil uji anakova untuk kemampuan berpikir kritis menunjukkan nilai p = 0,729 lebih besar dari α = 0,05, menunjukkan bahwa strategi pembelajaran tidak berpengaruh terhadap kemampuan berpikir kritis. Hasil uji anakova untuk hasil belajar kognitif menunjukkan nilai p = 0,037 lebih kecil dari α = 0,05, menunjukkan bahwa strategi pembelajaran berpengaruh terhadap hasil belajar kognitif.

Struktur atributif frasa bahasa Indonesia / Heny Sulistyowati

 

Kata kata kunci: struktur atributif, frasa Atributif merupakan konstituen penjelas yang menerangkan nomina dalam frasa nominal, frasa verbal, frasa ajektival atau kelas kata lain yang mempunyai fungsi menjelaskan. Letak atribut dapat berada di sebelah kiri inti, di sebelah kanan inti atau mengapit inti. Berdasarkan hal tersebut, penelitian struktur atributif frasa bahasa Indonesia penting dilakukan karena didasarkan alasan: (1) untuk mengetahui bermacam-macam fungsi atributif frasa, (2) untuk mengetahui distribusi unsur-unsur atributif setiap frasa, dan (3) untuk mengetahui hubungan makna struktur atributif setiap frasa. Oleh karena itu, penelitian ini bertujuan memperoleh deskripsi tentang: (1) fungsi atributif frasa bahasa Indonesia yang meliputi: (a) fungsi atributif frasa nominal, (b) fungsi atributif frasa verbal, dan (c) fungsi atributif frasa ajektival, (2) distribusi unsur atributif frasa bahasa Indonesia yang meliputi: (a) distribusi unsur atributif frasa nominal, (b) distribusi unsur atributif frasa verbal, dan (c) distribusi unsur atributif frasa ajektival, dan (3) hubungan makna struktur atributif frasa bahasa Indonesia yang meliputi: (a) hubungan makna struktur atributif frasa nominal, (b) hubungan makna struktur atributif frasa verbal, dan (c) hubungan makna struktur atributif frasa ajektival Penelitian ini menggunakan pendekatan kualitatif. Wujud data penelitian berupa wacana teks tulis yang diperoleh melalui teknik perekaman. Data dianalisis dengan menggunakan kajian distribusional. Prosedur analisis data dilakukan melalui empat tahap kegiatan, yaitu (1) pengumpulan data, (2) pereduksian data, (3) penyajian data, dan (4) penyimpulan temuan penelitian dan verifikasi. Hasil penelitian struktur atributif frasa dalam bahasa Indonesia ini meliputi: fungsi atributif frasa bahasa Indonesia, distribusi atributif frasa bahasa Indonesia, dan hubungan makna atributif frasa bahasa Indonesia. Fungsi atributif frasa bahasa Indonesia yang ditemukan meliputi: fungsi atributif frasa nominal, fungsi atributif frasa verbal, dan fungsi atributif frasa ajektival. Fungsi atributif frasa nominal berpola: (a) I(N)+A(N), (b) I(N)+ A(V), (c) I(N)+A(partikula, konjungsi), (d) I(N)+A(numeralia), dan (e) I(N)+ A(Aj.). Fungsi atributif frasa verbal berpola: (a) A(V)+I(V), (b) I(V)+A(Aj.), (c) I(V)+A (konjungsi), dan (d) I(V)+A(modal/aspek). Fungsi atributif frasa ajektival meliputi: ajektiva bertaraf dan ajektiva tidak bertaraf. Fungsi atributif frasa ajektival bertaraf berpola: (a) I+A, (b)A+I, (c) A+I+A, dan (d) A+A+I. Fungsi atributif frasa ajektival tidak bertaraf berpola: (a) A+I, (b) A+pengingkar (A)+I, c) A1+I+I+A2, dan (d) A+I+yang+A+I. Distribusi atributif frasa dalam bahasa Indonesia yang ditemukan meliputi: distribusi atributif frasa nominal, distribusi atributif frasa verbal, dan distribusi atributif frasa ajektival. Distribusi atributif frasa nominal meliputi: post atributif nominal dan pre atributif nominal. Distribusi atributif post atributif nominal berpola: (a) N1+N2, (b) N+A, (c) N+V, (d) N+pronomina persona, dan (e) N+pronomina demonstrativa. Distribusi atributif pre atributif nominal berpola: (a) N2+N1,dan (b) kata sandang+N. Distribusi atributif frasa verbal meliputi: post atributif verbal dan pre atributif verbal. Distribusi post atributif verbal berpola: (a) V+A, dan (b) V+frasa konjungsi. Distribusi pre atributif verbal berpola: (a) V1+V2, (b) aspek/modal+V, dan (c) pengingkar+V. Distribusi atributif frasa ajektival meliputi: post atributif ajektival dan pre atributif ajektival. Distribusi post atributif ajektival berpola: (a) A1+A2 dan (b) Aj.+N. Distribusi pre atributif ajektival berpola: (a) pengingkar+ajektival dan (b) perbandingan+ajektiva. Hubungan makna atributif frasa dalam bahasa Indonesia yang ditemukan dalam wacana naratif meliputi hubungan makna atributif frasa nominal, hubungan makna atributif frasa verbal, dan hubungan makna atributif frasa ajektival. Hubungan makna atributif frasa nominal menyatakan makna: (a) penerang, (b) pembatas, (c) penentu/penunjuk, (d) jumlah, dan (e) sebutan. Hubungan makna struktur atributif frasa verbal menyatakan makna : (a) kemungkinan, (b) kemampuan, (c) kepastian, (d) keinginan, (e) kesediaan, (f) keharusan, dan (g) keizinan. Hubungan makna atributif frasa ajektival menyatakan makna: (a) negatif, (b) tingkatan, (c) penentu sifat, (d) ukuran, (e) warna, (f) waktu, (g) jarak, (h) sikap batin, dan (i) cerapan. Hasil penelitian ini mempunyai implikasi teoretis dan praktis. Secara teoretis dapat meningkatkan kompetensi kebahasaan secara komprehensif dan menyeluruh. Secara praktis dapat dijadikan bahan kajian kompetensi kebahasaan dan kompetensi kemampuan berbahasa.

Pengaruh problem based learning dipadu dengan STAD berbantuan modul 6M terhadap keterampilan berpikir kritis dan hasil belajar siswa kelas VII SMP Negeri 13 Malang / R. Didi Kuswara

 

ABTRAK Kuswara, R. D. 2015. Pengaruh Problem-Based Learning Dipadu Dengan STAD Berbantuan Modul 6M Terhadap Keterampilan Berpikir Kritis dan Hasil Belajar Siswa Kelas VII SMP Negeri 13 Malang. Tesis, Program Studi Pendidikan Biologi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Hj. Mimien Henie Irawati Al-Muhdhar. M.S.,(II) Dr. Sueb, M.Kes. Kata kunci: problem-based learning, STAD, keterampilan berpikir kritis, hasil belajar SMP Negeri 13 Malang merupakan sekolah yang mengupayakan tercipanya lingkungan sekolah yang bersih dan sehat. Tercipatanya lingkungan sekolah yang bersih dan sehat tentu harus adanya pengelolaan lingkungan sekolah termasuk pengelolaan sampah, sehingga perlu adanya pengelolaan sampah di lingkungan sekolah yang menuntut keterlibatan seluruh warga sekolah, tidak terkecuali siswa. Oleh sebab itu, perlu adanya kegiatan pembelajaran dan buku pendukung yang berorientasi permasalahan lingkungan akibat sampah, seperti pembelajaran yang mengarahkan siswa untuk mampu memecahkan permaslahan lingkungan. Salah satunya model pembelajaran berbasis masalah yang dibantu dengan modul 6M. Penelitian ini bertujuan untuk mengetahui ada pengaruh problem-based learning dipadu STAD berbantuan modul 6M terhadap keterampilan berpikir kritis, dan hasil belajar siswa kelas VII SMP Negeri 13 Malang. Hasil belajar siswa yang diukur berupa pengetahuan, sikap, dan keterampilan. Penelitian ini termasuk dalam eksperimen semu (quasy experiment) dengan desain pretest posttest nonequivalent control group design. Populasi penelitian ini seluruh siswa kelas VII SMP Negeri 13 Malang tahun pelajaran 2014/2015. Sampel penelitian ini siswa kelas VIIB, VIIC, dan VIID yang dipilih secara cluster random sampling. Siswa kelas VIIB sebagai kelompok kontrol, VIIC dan VIID sebagai kelompok ekperimen. Teknik pengumpulan data menggunakan tes uraian, tes pilihan ganda, tes sikap (skala Likert), dan angket checklist manifestasi perilaku siswa. Uji hipotesis menggunakan analisis multivariat yakni manakova satu arah. Berdasarkan hasil analisis data uji manakova diperoleh nilai probabilitas untuk model pembelajaran p = 0,001, 0,005, 0,009, dan 0,002, dimana nilai p ini lebih kecil dari α = 0,05. Maka dapat disimpulkan, bahwa model pembelajaran berpengaruh terhadap keterampilan berpikir kritis dan hasil belajar siswa. Sedangkan berdasarkan uji lanjut Tukey menunjukkan bahwa model PBL dipadu STAD berbantuan modul 6M berbeda signifikan dengan model PBL dipadu STAD tanpa modul ataupun dengan metode diskusi-presentasi dari keterampilan berpikir kritis dan hasil belajar siswa, sedangkan model PBL dipadu STAD tanpa modul tidak berbeda signifikan dengan metode diskusi-presentasi dari semua aspek yang diukur.  

Pengembangan modul berbasis penelitian keragaman burung famili estrildidae berdasarkan analisis protein darah untuk mata kuliah bioteknologi di Universitas Negeri Malang / Eni Suyantri

 

ABSTRAK Suyantri, E. 2015. Pengembangan Modul Berbasis Penelitian Keragaman Burung Famili Estrildidae berdasarkan Analisis Protein Darah untuk Mata Kuliah Bioteknologi di Universitas Negeri Malang. Tesis, Program Studi Pendidikan Biologi Universitas Negeri Malang. Pembimbing: (1) Dr. Umie Lestari, M.Si, (2) Dr. Susriyati Mahanal, M.Pd Kata kunci: bioteknologi, haemoglobin, transferrin, post-transfferin, modul, four-D, Thiagarajan, keragaman, protein, darah, Estrildidae Bioteknologi telah tercantum sebagai salah satu matakuliah di Program Pendidikan Biologi Universitas Negeri Malang. Bioteknologi, sebagai sebuah teknologi, berkaitan dengan penerapan prinsip-prinsip saintifik untuk kemaslahatan orang banyak. Oleh karena itu masuknya bioteknologi ke dalam kurikulum universitas adalah suatu keharusan, karena bioteknologi menawarkan banyak hal, diantaranya adalah: keterampilan kerja laboratorium, integritas antara ilmu dan aplikasi, pemikiran tingkat tinggi dan peningkatan kesejahteraan. Namun, mahasiswa penempuh mata kuliah Bioteknologi masih memiliki pandangan yang abstrak terkait dengan peranan dan aplikasi bioteknologi dalam kehidupan sehari-hari. Selain itu, mahasiswa juga masih berangan-angan terkait dengan materi yang dipelajari, sehingga mahasiswa belum dapat berpikir nyata dan sulit bagi mahasiswa untuk memahami secara utuh peranan bioteknologi. Hal ini dikarenakan buku teks yang digunakan dalam pembelajaran masih bersifat teroritis. Buku teks yang digunakan telah menyajikan materi dan teori-teori dasar dalam bioteknologi secara lengkap, namun tidak dilengkapi dengan aplikasi nyata dalam kehidupan sehari-hari. Akibatnya, mahasiswa tidak mampu untuk mengimplementasikan materi dan konsep yang telah diperoleh dari matakuliah Bioteknologi. Pembelajaran berbasis riset atau penelitian, sangat tepat dikembangkan dalam pembelajaran Bioteknologi. Ciri utama pembelajaran Bioteknologi adalah pembelajaran yang sistematis mulai dengan fakta, konsep, prinsip, sampai dengan prosedur, sangat dekat dengan kegiatan-kegiatan riset, sehingga pengembangan pembelajaran berbasis riset sangat tepat dikembangkan pada pembelajaran Bioteknologi. Modul bioteknologi berbasis penelitian telah dikembangkan berdasarkan kebutuhan dan karakter mahasiswa Program Studi Pendidikan Biologi Universitas Negeri Malang. Mahasiswa membutuhkan modul berbasis penelitian yang mampu merangsang mahasiswa untuk berpikir kreatif dan nyata terkait aplikasi bioteknologi dalam kehidupan sehari-hari. Modul bioteknologi dikembangkan mengikuti alur Four-D (4-D) dari Thiagarajan, Semmel dan Semmel (1974). Modul berjudul “Modul Bioteknologi: Keragaman Burung Famili Estrildidae berdasarkan Analisis Protein Darah” disusun berdasarkan penelitian keragaman burung famili estrildidae berdasarkan analisis protein darah. Protein darah spesifik yang digunakan sebagai pendekatan keragaman pada burung famili estrildidae adalah Haemoglobin, Tranferrin dan Post-transfferin. Protein Haemolglobin muncul pada kisaran 63-65 kDa. Protein Transfferin muncul pada kisaran 83-85 kDa, dan tidak muncul pada bondol haji dan bondol jawa. Sedangkan protein Post-transfferin muncul pada kisaran 91-110 kDa Hasil analisis protein burung famili Estrildidae ini dapat dimanfaatkan sebagai data dasar tentang variasi genetik. Modul telah divalidasi oleh ahli materi bioteknologi dan ahli media dan pembelajaran. Modul juga telah diujicobakan pada mahasiswa kelompok sedang berjumlah 12 mahasiswa. Berdasarkan hasil validasi dari ahli materi diperoleh penilaian sebesar 84.09% dan dari ahli media dan pembelajaran sebesar 100%. Artinya, modul telah layak digunakan sebagai bahan ajar penunjang mata kuliah Bioteknologi. Kelebihan modul bioteknologi yang telah dikembangkan adalah 1) modul pembelajaran berbasis riset disusun secara sistematis untuk digunakan dosen dan mahasiswa dalam kegiatan perkuliahan, sehingga dosen dan mahasiswa mudah dalam menggunakannya dan 2) modul pembelajaran disusun berdasarkan hasil penelitian sehingga pembaca mendapatkan gambaran nyata dan langsung tahapan-tahapan pada penelitian. Kelemahan dalam modul bioteknologi ini adalah hanya disusun berdasarkan beberapa indikator saja karena hanya sebagai bahan ajar penunjang dan berdasarkan pada karakter mahasiswa program studi Pendidikan Biologi Universitas Negeri Malang, sehingga keberadaanya sesuai dengan karakter mahasiswa program studi Biologi Universitas Negeri Malang.

Hubungan pelaksanaan keselamatan dan kesehatan kerja dengan motivasi kerja karyawan di PT. Barata Indonesia (Persero) / oleh Kartika Larasati Soekardi

 

The effectiveness of debate in the speaking class of third semester students of English Letters Department at IAIN Sunan Ampel Surabaya / Fikri Yanda

 

Kata kunci: debat, presentasi, kemampuan berbicara Bahasa Inggris Penelitian ini bertujuan untuk menginvestigasi efektifitas debat pada kelas speaking Jurusan Sastra Inggris IAIN Sunan Ampel Surabaya pada mahasiswa semester tiga untuk meningkatkan kemampuan berbicara Bahasa Inggris mereka. Debat diharapkan menjadi metode pembelajaran speaking alternatif selain presentasi. Rumusan masalah penelitian adalah “Apakah mahasiswa yang diajari dengan metode debat berbicara Bahasa Inggris lebih baik daripada mereka yang diajari dengan metode presentasi?” Desain penelitian adalah quasi-eksperimen dengan grup pengendali beraturan. Subjek penelitian adalah 36 mahasiswa semester tiga. Mereka dibagi menjadi dua kelompok: kelompok eksperimen dan pengendali. Kelompok eksperimen sebanyak 19 mahasiswa, kelompok pengendali 17 mahasiswa. Data penelitian diambil dari nilai pra-tes dan pasca-tes mahasiswa. Pra-tes diadakan pada tanggal 12 Oktober 2012. Pasca-tes pada 14 Desember 2012. Pembelajaran menggunakan debat (kelompok eksperimen) dan presentasi (kelompok pengendali) diadakan selama delapan pertemuan atau dua bulan mulai 19 Desember 2012 hingga 7 Desember 2012. Untuk tujuan validitas data, aktifitas pembelajaran direkam dalam bentuk video. Hasil penelitian menunjukkan bahwa mahasiswa yang diajari dengan metode debat memiliki kemampuan berbicara lebih baik daripada mereka yang menggunakan presentasi. Dalam kata lain, metode debat lebih efektif daripada presentasi. Tingkat signifikansi (∞)signifikan pada p (0.006) < .05 dan thitung (2,901) > ttabel (2,032). Rata-rata Postest siswa kelas eksperimen (82.8772) lebih tinggi dari pada rata-rata Postest siswa kelas kontrol (77.8824). Dengan begitu, hasil penelitian member bukti bagi para pengajar bahwa metode debat sangat bermanfaat untuk meningkatkan kemampuan berbicara Bahasa Inggris mahasiswa. Penelitian ini menganjurkan para mahasiswa program Bahasa Inggris untuk menggunakan metode debat demi meningkatkan kemampuan berbicara Bahasa Inggris mereka. Semakin mereka berdebat (dalam Bahasa Inggris), semakin lancar mereka berbicara. Bagi para pengajar yang hendak menggunakan metode debat di dalam kelas speaking, mereka diharapkan mengetahui konsep debat yang harus memiliki dua sisi yang setuju dan tidak setuju terhadap topik yang diperdebatkan. Debat dalam konteks ini bukan untuk mencari siapa yang paling benar, tapi siapa yang memberikan argument paling rasional serta menyuguhkan bukti kuat untuk mendukung argumen-argumen yang disampaikan. Bagi para peneliti di masa yang datang, mereka bisa menggunakan metode dan instrumen yang berbeda untuk mendapatkan informasi yang lebih komprehensif tentang objek penelitian yang sama. Mereka juga bisa menggunakan hasil penelitian ini sebagai titik awal penelitian mereka.

Potensi sektor pariwisata, peluang dan pengembangannya untuk meningkatkan pendapatan asli daerah di Kabupaten Malang (studi kasus pada pengelolaan Pantai Balekambang) / Mohammad Rizal

 

Kata kunci: Potensi pariwisata, peluang, Pendapatan Asli Daerah Pembangunan nasional yang sedang dilaksanakan tidak terlepas dari peran serta daerah dalam turut mewujudkan tujuan pembangunan daerah secara utuh dan terpadu merupakan bagian internal dari pembangunan nasional. Untuk itu daerah yang diberi kewenangan untuk mengatur daerahnya sendiri sehingga diharapkan mempunyai kemampuan untuk menyediakan dan menggali potensi yang ada dan dapat dijadikan sumber keuangan. Salah satunya dengan memanfaatkan potensi dan peluang pariwisata.dengan dimanfaatkannya potensi dan peluang pariwisata menjadi suatu industri yang diharapkan mampu meningkatkan sumbangan Pendapatan Asli Daerah. Untuk mengetahui fokus dari penelitian ini, peneliti merumuskan masalah sebagai berikut. Bagaimana Potensi Sektor Pariwisata, Peluang dan Pengembangannya Dalam Meningkatkan Pendapatan Asli Daerah Di Kabupaten Malang? Untuk menjawab pertanyaan tersebut, penelitian ini dirancang dengan jenis penelitian deskrptif dengan mengabungkan metode kualitatif dan metode kuantitatif. Teknik analisis data menggunakan teknik analisis SWOT (Strength, Weakness, Opportunity, Treatment) dan analisis kontribusi. Penelitian ini dilakukan di Dinas Pariwisata Kabupaten Malang dan Pantai Balekambang. Dari hasil ini ditemukan bahwa rata-rata perkembangan retribusi sektor pariwisata sebesar 1,22% dan rata-rata kontribusi retribusi sektor pariwisata terhadap Pendapatan Asli Daerah adalah 0,03% . Retribusi Sektor Pariwisata dapat ditingkatkan minimal 0,10 dan maksimal sebesar 0,12%. Ada 2 jenis upaya yang bisa dilakukan untuk meningkatkan peluang pariwisata di Kabupaten Malang yaitu upaya intesifikasi dan eksentifikasi.

Peranan koordinasi dalam Perusahaan Negara Pos dan Giro Blitar / oleh Enny Widya Ekowati

 

Pengendalian mutu beton menggunakan metode Statistical Procces Control (SPC) pada proses produksi beton precast (studi kasus PT. Wijaya Karya Beton) / Agung Cahyo Utomo

 

ABSTRAK Utomo, Agung Cahyo. 2015. Pengendalian Mutu Beton Menggunakan Metode Statistical Procces Control (SPC) Pada Proses Produksi Beton Precast (Studi Kasus PT.Wijaya Karya Beton). Skripsi, Program Studi S1 Pendidikan Teknik Bangunan, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. R. M. Sugandi, M.T. (II) Drs.Sonny Wedhanto, M.T. Kata Kunci:Statistical Procces Control (SPC), Proses Produksi, Pengendalian Mutu Beton. Statistical Procces Control(SPC) adalah salah satu metode kendali proses yang dapat mendeteksi adanya kesalahan dini dalam proses produksi. Penelitian ini mencoba untuk menerapan metode SPC pada pengendalian kualitas kontrol produksi tiang pancang produksi dari PT.Wijaya Karya Beton. Disain penelitian ini adalah deskriptif kuantitatif, sampel diambil dari dokumen data inspeksi proses produksi milik Bagian Teknik dan Mutu PT.Wijaya Karya Beton. Pengolahan data menggunakan metode SPC, analisis dilakukan dalam dua carayaitu: Peta Kendalidan diagram X &R. Hasil penelitian: (1) Secara statistik tidak terjadi penyimpangan pada proses penulangan, placing, compacting dan curing. (2) Secara statistik pada proses batching dan mixing dikatakan tidak terkendali; enam indikator diagram kendali menunjukkan terjadinya penyimpangan, sebagian besar terjadi pada shift malam; penyebabnyaadalah 3M (man, machine, method); metode pengkondisian material dalam keadaan SSD menjadi indikasi utama terjadinya penyimpangan. (3) Kontrol proses produksi berdasarkan uji slump dan uji kuat tekan secara statistik terkendali. (4) Metode SPC terbukti mampu mengukur kinerja proses produksi agar terhindar dari penyimpangan.

Validasi media pembelajaran rumah pintar TK. Dharma Wanita 4 Kersikan Kabupaten Pasuruan / oleh Nunik Mufidah

 

Implementasi Model Pembelajaran Berbasis Proyek (MPBP) pada mata pelajaran Boga Dasar di SMK Kartika IV-1 Malang / Estika Mego Roshanti

 

ABSTRAK Roshanti, Estika Mego. 2015. Implementasi Model Pembelajaran Berbasis Proyek (MPBP) pada Mata Pelajaran Boga Dasar di SMK Kartika IV-1 Malang. Skripsi, Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dra. Nunung Nurjanah, M.Kes. (2) Lismi Animatul Chisbiyah, S.Pd., M. Pd. Kata Kunci: Model Pembelajaran Berbasis Proyek (MPBP), Boga Dasar, SMK Kartika IV-1 Malang Model Pembelajaran Berbasis Proyek (MPBP) di SMK Kartika IV-1 Malang diterapkan pada mata pelajaran boga dasar. Model Pembelajaran Berbasis Proyek menggunakan langkah-langkah sebagai berikut: mengidentifikasi masalah; membuat desain dan jadwal pelaksanaan proyek; melaksanakan penelitian; menyusun draf/prototipe produk; mengukur, menilai, dan memperbaiki produk; finalisasi dan publikasi produk. Tujuan penelitian ini adalah untuk mengetahui implementasi Model Pembelajaran Berbasis Proyek (MPBP) pada mata pelajaran boga dasar ditinjau dari aspek persiapan, pelaksanaan, dan evaluasi. Penelitian ini termasuk penelitian kuantitatif. Responden terdiri dari siswa kelas X jasa boga dan guru matapelajaran boga dasar. Teknik pengumpulan data menggunakan observasi, wawancara, dan dokumentasi. Analisis data yang digunakan dalam penelitian ini adalah deskriptif. Implementasi Model Pembelajaran Berbasis Proyek (MPBP) pada mata- pelajaran boga dasar di SMK Kartika IV-1 Malang dinyatakan sebagai berikut: (1) Persiapan guru dalam menerapkan Model Pembelajaran Berbasis Proyek (MPBP) 100 % sesuai; (2) Pelaksanaan Model Pembelajaran Berbasis Proyek (MPBP) 100 % sesuai; (3) Evaluasi hasil belajar siswa dengan menggunakan Model Pembelajaran Berbasis Proyek (MPBP) 100 % sesuai. Implementasi Model Pembelajaran Berbasis Proyek (MPBP) pada mata pelajaran boga dasar secara keseluruhan (aspek persiapan, pelaksanaan, dan evaluasi) 100 % sesuai.

Pengaruh strategi pembelajaran project based learning (PjBL) terhadap keterampilan metakognitif dan pemahaman konsep siswa kelas X SMA Negeri di Kota dan Kabupaten Malang / Maya Trisulistiyorini

 

Kata kunci: strategi pembelajaran Project Based Learning (PjBL), keterampilan metakognitif, pemahaman konsep Kegiatan belajar di sekolah ditujukan untuk mencapai tujuan pembelajaran. Guru harus memperhatikan kegiatan pembelajaran yang telah dilaksanakan agar tujuan pembelajaran dapat dicapai. Kebanyakan guru hanya melaksanakan kegiatan pembelajaran saja tanpa memperhatikan aspek yang harus dikembangkan dalam diri siswa. Aspek yang perlu dikembangkan adalah aspek keterampilan metakognitif dan aspek kognitif yang berhubungan dengan pemahaman konsep. Bila siswa memiliki keterampilan metakognitif yang baik akan mampu menjadi pebelajar yang mandiri, mampu merencanakan, memonitor dan mengevaluasi dalam kegiatan belajarnya. Siswa yang memiliki kemampuan kognitif yang lebih baik tentunya dapat dengan mudah menguasai konsep materi pelajaran. Salah satu alternatif yang dapat memberdayakan keterampilan metakognitif dan pemahaman konsep agar mengarah pada tujuan kurikulum adalah strategi pembelajaran Project Based Learning (PjBL). Keunggulan strategi ini adalah meningkatkan motivasi, meningkatkan kemampuan untuk memecahkan masalah, meningkatkan kemampuan untuk mencari informasi, meningkatkan kemampuan dalam mengatur waktu untuk menyelesaikan tugas, dan meningkatkan kejasama kelompok. Penerapan strategi pembelajaran PjBL dalam penelitian ditujukan untuk mengungkapkan pengaruhnya terhadap keterampilan metakognitif dan pemahaman konsep siswa. Penelitian dilakukan di SMA Negeri di Kota dan Kabupaten Malang pada Semester Genap Tahun Ajaran 2009/2010 dengan populasi penelitian adalah seluruh siswa di SMA Negeri 7 Malang, SMA Negeri 9 Malang dan SMA Negeri 1 Gondang Legi Malang dengan menggunakan kelas kontrol yaitu X-7, X-4, X-F dan kelas eksperimen yaitu X-3, X-7, X-8, X-A. Rancangan penelitian ini menggunakan rancangan penelitian eksperimen semu (quasi experiment) dengan desain penelitian menggunakan non equivalent control group design. Analisis yang digunakan adalah analisis anakova satu arah. Hasil penelitian menunjukkan bahwa strategi pembelajaran PjBL berpengaruh terhadap keterampilan metakognitif siswa. Siswa yang difasilitasi dengan strategi pembelajaran PjBL memiliki keterampilan metakognitif 41,1% lebih tinggi dibandingkan dengan siswa yang diberi strategi pembelajaran konvensional. Dilihat dari kemampuan kognitif yang berhubungan dengan pemahaman konsep siswa menunjukkan bahwa strategi pembelajaran PjBL berpengaruh terhadap kemampuan kognitif siswa. Siswa yang difasilitasi dengan strategi pembelajaran PjBL memiliki kemampuan kognitif 44,8% lebih tinggi dibandingkan dengan siswa yang diberi strategi pembelajaran konvensional. Berdasarkan hasil penelitian yang telah diperoleh, terlihat bahwa strategi pembelajaran PjBL dapat diandalkan dalam rangka meningkatkan keterampilan metakognitif dan pemahaman konsep. Melihat fakta yang telah ditunjukkan, maka diharapkan guru dapat menerapkan strategi pembelajaran PjBL dalam kegiatan pembelajaran di sekolah. Selain itu pengaturan alokasi waktu dan pemberian motivasi pada siswa juga harus diperhatikan agar pelaksanaan strategi pembelajaran berjalan dengan baik.

Pengembangan media pembelajaran interaktif berbasis WEB pada mata pelajaran simulasi digital untuk siswa kelas X SMK PGRI 3 Malang / Angga Widi Hosana

 

ABSTRAK Hosana, Angga Widi. 2015. Pengembangan Media PembelajaranInteraktifBerbasis Web pada Mata PelajaranSimulasi Digital UntukSiswaKelas X SMK PGRI 3 Malang. Skripsi. JurusanTeknikElektro.FakultasTeknik.UniversitasNegeri Malang. Pembimbing: (1) Dr.Eng. SitiSendari, S.T., M.T., (2) Dyah Lestari, S. T., M. Eng. Kata Kunci:pengembangan,media pembelajaran,web, schoology. MatapelajaranSimulasiDigital merupakansalahsatu matapelajaranwajibbagisiswasekolahmenengahkejuruan (SMK) yang menerapkansistemkurikulum 2013 (K13). Siswadituntutuntukmempelajari, menguasaidanmemahamikonsepdasartentangpenerapan media digital dalamkehidupansehari-hari. Berdasarkanhasilwawancara di SMK PGRI 3 Malang terdapatbeberapapermasalahandalampembelajaranSimulasi Digital yaitu: (1) Guru mengajardenganmetodekonvesionalyaitutatapmukadisertaipenugasan; (2) Tidakadanya media pembelajaraninteraktifselama proses pembelajaran, sehinggasiswakurangtermotivasidanmemahamimateri yang diajarkan. Dengan melihat kenyataantersebut, perludirancangmedia ajar berupa webagar kegiatan pembelajaran di kelasmaupun di luarkelasdapatberlangsungsecaraaktif, efektif, danbermanfaat. Penelitianinidilaksanakandengantujuanyaitu; Menghasilkan media pembelajaran media pembelajaran berbasis web pada mata pelajaran Simulasi Digital untuk siswa kelas X di SMK PGRI 3 Malang. Model pengembanganmedia pembelajaraninimengadaptasi model pengembangan ADDIE yangterdiridari 5tahapyaitu: (1)Analisiskebutuhan media pembelajaran; (2)Desain media pembelajaranberupaweb denganschoology; (3)Pengembanganmedia pembelajaranberbasisweb; (4)Implementasimedia pembelajaranberbasisweb; (5)Evaluasi. Proses evaluasidilakukanpadasetiaptahapannyayaitusebagaiberikut: (1) tahapanalisis, evaluasi yang dilakukandenganobservasidanwawancara; (2) tahapdesain, dilakukanvalidasiolehahlimateri; (3) tahappengembangandilakukanvalidasiolehahli media danahlimateri; (4) tahapimplementasi, media di ujicobakan di kelasdenganujicobakelompokkecildanujicobakelompokbesar. Berdasarkananalisis data yang telahdilakukan, diperolehpersentasehasilvalidasiahli media sebesar 91,20%, ahlimateri 93,05%, ujicobakelompokkecil 82,78%, danujicobalapangan 83,44%. Dari hasiltersebutdapatdisimpulkanbahwa media pembelajarantelahmemenuhikriteria valid dandapatdigunakandalam proses pembelajaran.

Kepuasan kerja karyawan sebagai pemediasi pengaruh gaya kepimpinan situasional terhadap komitmen organisasi terhadap komitmen organisasi (Studi pada karyawan tetap PT. Adiputro Wirasejati Malang) / Effendi Tri Krisdianto

 

Kata Kunci : Gaya Kepemimpinan Situasional, kepuasan kerja karyawan, komitmen organisasi. Keberhasilan dalam suatu organisasi ditentukan oleh gaya kepemimpinan dan peranan dari karyawan. Agar karyawan dapat bekerja dengan baik dan mencapai prestasi kerja yang diharapkan, maka peranan pemimpin dalam memimpin dan memotivasi bawahannya sangat menentukan, karena karyawan merupakan aset perusahaan yang dinamis dan selalu berkembang. Dalam arti yang luas kepemimpinan dapat dipergunakan setiap orang dan tidak hanya terbatas berlaku dalam suatu organisasi atau kantor tertentu, meleinkan kepemimpinan bisa terjadi di mana saja asalkan seseorang menunjukkan kemampuannya dalam mempengaruhi orang lain untuk mencapai tujuan tertentu. Penelitian ini dilakukan di PT. Adi Putro Wirasejati Malang pada bulan Mei sampai dengan Juli 2010. Subjek dalam penelitian ini adalah Karyawan tetap PT.Adi Putro Wirasejati. Karyawan PT.Adi Putro Wirasejati Malang yang berjumlah 214 orang. Sedangkan sampelnya diambil sebanyak 67 dan teknik pengambilan sampel menggunakan propotional random sampling. Analisis data yang dipakai adalah analisis jalur (path analysis) yang merupakan suatu bentuk terapan dari analisis regresi berganda (multiple regression analysis). Dalam penelitian ini mempunyai variabel bebas yaitu gaya kepemimpinan situasional (X), variabel intervening yaitu kepuasan kerja karyawan (Z) dan variabel terikat yaitu komitmen organisasi (Y). Data yang diperoleh dengan menggunakan beberapa cara, antara lain : angket atau kuesioner, wawancara atau interview, dan observasi. Instrumen penelitian ini menggunakan item-item dari penelitian terdahulu yang telah teruji, sehingga uji coba kuesioner untuk menguji instrumen tidak perlu dilakukan. Sedangkan untuk uji validitas dan reliabilitas tetap dilakukan untuk menguji validitas dan reliabilitas data yang diperoleh. Berdasarkan teknik analisis statistik deskriptif diketahui bahwa sebanyak 54 orang Karyawan PT.Adi Putro Wirasejati Malang setuju bahwa gaya kepemimpinan situasional yang diterapkan di perusahaan cukup baik, sebanyak 61 orang Karyawan PT.Adi Putro Wirasejati Malang setuju bahwa mereka memiliki kepuasan kerja yang tinggi, Sementara sekitar 59 orang yang lain mempunyai komitmen organisasi yang tinggi. Sedangkan berdasarkan teknik analisis inferensial atau analisis regresi berganda dengan menggunakan taraf kesalahan 5%, dapat diketahui variabel gaya kemimpinan (X) mempunyai nilai sig t signifikansi α (0,000 < 0,05), sehingga dapat disimpulkan bahwa variabel gaya kepemimpinan (X) berpengaruh secara signifikan terhadap kepuasan kerja (Z) secara langsung. Variabel kepuasan kerja karyawan (Z) mempunyai nilai sig t signifikansi α (0,000 < 0,05), sehingga dapat disimpulkan bahwa variabel kepuasan kerja (Z) berpengaruh secara signifikan terhadap komitmen organisasi (Y) secara langsung. Variabel gaya kepemimpinan situasional (X) mempunyai nilai sig t < signifikansi α (0,001 < 0,05), sehingga dapat disimpulkan bahwa variabel gaya kepemimpinan situasional (X) berpengaruh secara signifikan terhadap prestasi kerja (Y) secara langsung. Adapun saran yang dapat diberikan peneliti adalah dengan meningkatkan komitmen organisasi, hendaknya perusahaan lebih memperkuat keterikatan karyawan terhadap perusahaan, karena kemungkinan tingkat komitmen organisasi karyawan tersebut dikarenakan mereka adalah karyawan tetap. Secara umum hal ini menjadi generalisasi bahwa karyawan yang berada pada posisi “aman” adalah mereka yang mempunyai tingkat komitmen tinggi.

Penggunaan media pembelajaran untuk materi pergelaran tari di SMA Negeri 8 Malang / Nisa Etiska Sholihah

 

ABSTRAK Sholihah, Nisa Etiska. 2015. Penggunaan Media Pembelajaran Seni Tari untuk Materi Pergelaran Tari Di SMA Negeri 8 Malang. Skripsi, Jurusan Seni Dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Tjijtik Sriwardhani, M.Pd (II) Hartono, S.Sn, M.Sn. Kata Kunci: Media Pembelajaran, Pergelaran Tari, SMA. Salah satu sekolah yang menerapkan seni tari sebagai mata pelajaran dengan menggunakan kurikulum 2013 adalah SMA Negeri 8 Malang. Berdasarkan observasi SMA Negeri 8 Malang selalu mengikuti berbagai perlombaan tari dan mendapatkan kejuaraan. Salah satu faktor pendukung dalam pengembangan mata pelajaran seni tari adalah fasilitas pembelajaran seperti studio tari yang kedap suara yang tidak dimiliki oleh sekolah lain serta media pembelajaran berbasis IT . Dari latar belakang tersebut peneliti akan meneliti bagaimana penggunaan media pembelajaran dalam pembelajaran seni tari di SMA Negeri 8 Malang dari guru merencanaan penggunaan media pembelajaran, melaksanakan penggunaan media pembelajaran, dan evaluasi penggunaan media pembelajaran di SMA Negeri 8 Malang. Tujuan penelitian ini adalah untuk mendeskripsikan penggunaan media dalam pembelajaran seni tari yang terdiri dari perencanaan media pembelajaran, pelaksanaan media pembelajaran, serta evaluasi media pembelajaran yang dilakukan oleh guru dalam proses belajar mengajar. Penelitian ini menggunakan pendekatan deskriptif kualitatif dengan sumber data dari guru seni tari, peserta didik dan dokumentasi sekolah. Pengumpulan data menggunakan observasi, wawancara dan dokumentasi. Teknik analisis data yang digunakan dalam penelitian ini yaitu analisis data model Sugiyono dengan tahap reduksi data, penyajian data, dan penarikan kesimpulan terkait dengan penggunaan media pembelajaran di SMA Negeri 8 Malang. Sedangkan validitas data menggunakan trianggulasi metode. Hasil penelitian adalah: pertama, Perencanaan media pembelajaran terdapat dalam RPP yang meliputi berbagai jenis media meliputi DVD Player, internet dan studio tari yang disesuaikan dengan kebutuhan materi pergelaran tari. Media pembelajaran yang digunakan guru dalam menyampaikan materi pergelaran tari menggunakan LCD dan sound system yang bersifat klasikal agar jelas dalam menyampaikan materi dan contoh. Namun ditemukan kesalahan pada perencanaan media pembelajaran yakni studio tari sebagai media pembelajaran, seharusnya masuk sebagai sarana dan prasarana karena tidak dapat menyampaikan pesan. Kedua, pelaksanaan pembelajaran yang dilakukan telah mencakup 5M. Proporsi media dalam 5M yakni siswa mengamati video tari melalui media DVD atau internet, menanya yakni siswa menanyakan pada guru unsur-unsur dalam tari yang diamati pada media tersebut,mengeksplorasi yakni siswa mencari gerak dalam tarian yang diamati, mengasosiasi yakni siswa membandingkan gerak satu dengan yang lain, mengomunikasikan yakni mempresentasikan hasil merangkai gerak dengan menggunakan media DVD Player untuk iringan musik. Namun ditemukan kurangnya pemanfaatan media pembelajaran TIK melalui jaringan internet sehingga pembelajaran hanya bersifat tatap muka. Ketiga Evaluasi dilakukan dengan cara melihat hasil belajar siswa melalui penggunaan media yang dipakai untuk mengetahui keefektifan media yang digunakan berdasarkan tujuan pembelajarannya. Saran dalam penelitian ini adalah pemahaman penggunaan dan pemanfaatan media pembelajaran oleh guru mata pelajaran seni tari untuk lebih ditingkatkan lagi sehingga pembelajaran menjadi menjadi optimal dan hasil belajar yang diinginkan tercapai

Pengaruh pembelajaran kimia dengan LC-5E berkonteks SSI terhadap pemahaman hakikat sains, keterampilan berpikir kritis, dan penguasaan konsep kelarutan siswa SMA / Halimah Mustika Nurhayati

 

ABSTRAK Nurhayati, Halimah Mustika. 2016. Pengaruh Pembelajaran Kimia dengan LC-5E Berkonteks SSI terhadap Pemahaman Hakikat Sains, Keterampilan Berpikir Kritis, dan Penguasaan Konsep Kelarutan Siswa SMA. Tesis, Program Studi Pendidikan Kimia, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Sri Rahayu, M.Ed., Ph.D, (II) Dr. Yahmin, M.Si Kata Kunci: LC-5E, SSI, hakikat sains, berpikir kritis, penguasaan konsep, kelarutan Sains selalu mengalami perkembangan untuk memenuhi kebutuhan masyarakat. Begitu pula dengan tujuan pendidikan sains yang selalu berkembang searah dengan perkembangan sains. Tujuan pendidikan sains berawal dari upaya untuk memahami alam dan berkembang ke arah pemanfaatan pengetahuan di masyarakat. Perkembangan ini kemudian memunculkan konsep literasi sains, yaitu suatu istilah luas mengenai sains yang meliputi perkembangan sains, aspek sosial sains dan kemampuan membuat keputusan. Dengan demikian literasi sains merupakan kemampuan menerapkan pengetahuan sains untuk mengambil keputusan terhadap segala sesuatu tentang alam dan perubahannya. Hal ini mengakibatkan banyak peneliti menganggap literasi sains merupakan tujuan pendidikan sains. Akan tetapi berdasarkan hasil PISA, literasi sains siswa di Indonesia masih sangat rendah. Untuk meningkatkan literasi sains dapat dilakukan dengan memasukkan aspek-aspek literasi sains dalam pembelajaran. Aspek utama literasi sains adalah konten sains, pemahaman hakikat sains dan kemampuan berpikir kritis. Upaya meningkatkan pemahaman hakikat sains dapat dilakukan dengan mengeksplisitkannya dalam pembelajaran. Penggunaan pembelajaran yang melibatkan proses sains dan penggunaan konteks SSI dalam pembelajaran dapat membantu mengeksplisitkan hakikat sains. Konteks SSI merupakan isu-isu sosial terkait sains yang ada dimasyarakat. Adanya konteks SSI dan pembelajaran yang melibatkan proses sains seperti LC-5E juga akan meningkatkan keterampilan berpikir kritis dan penguasaan konsep siswa.Penelitian ini bertujuan untuk mengetahui pengaruh pembelajaran kimia dengan LC-5E berkonteks SSI terhadap pemahaman hakikat sains, keterampilan berpikir kritis, dan penguasaan konsep kelarutan siswa SMA. Penelitian ini merupakan penelitian kuantitatif. Data diperoleh dari jawaban siswa terhadap tes keterampilan berpikir kritis (r=0,7319), tes penguasaan konsep kelarutan (r=0,7448) dan angket pemahaman hakikat sains (r=0,7450). Dalam melakukan pengumpulan data, digunakan rancangan penelitian eksperimental semu pretes-posttestcontrol group design yang melibatkan tiga kelas yaitu kelas eksperimen I yang dibelajarkan dengan LC-5E berkonteks SSI, kelas eksperimen II yang dibelajarkan dengan LC-5E tanpa konteks SSI, dan kelas kontrol yang dibelajarkan dengan pembelajaran konvensional. Populasi yang digunakan adalah siswa SMA Negeri 1 Boyolangu Tulungagung. Sampel penelitian dipilih dari populasi dengan teknik convenient sampling, dimana sampel dipilih berdasarkan ketersediaan dalam populasi. Data yang diperoleh dianalisis dengan analisis kuantitatif melalui uji prasyarat dan uji hipotesis. Hasil uji prasyarat menunjukkan bahwa data berdistribusi normal dan homogen, sehingga dapat diuji hipotesis dengan analisis parametrik. Analisis parametrik yang sesuai untuk desain tiga kelas dan menggunakan pretes-pascates adalah analisis kovarian (ANCOVA) dengan data pretes sebagai kovariat.Berdasarkan analisis data dapat diketahui sebagai berikut:(a)terdapat perbedaan rata-rata pemahaman hakikat sains siswa kelas XI SMA yang dibelajarkan dengan LC-5E berkonteks SSI (56,75), LC-5E tanpa konteks SSI (47,00) dan metode konvensional (45,04), dimana perbedaan signifikan secara statistik terjadi pada kelas yang dibelajarkan dengan LC-5E berkonteks SSI dengan kelas yang dibelajarkan dengan LC-5E tanpa konteks SSI maupun kelas konvensional; (b) terdapat perbedaan rata-rata keterampilan berpikir kritis siswa kelas XI SMA yang dibelajarkan dengan LC-5E berkonteks SSI (60,74), LC-5E tanpa konteks SSI (53,11) dan metode konvensional (43,89), dimana perbedaan signifikan secara statistik terjadi pada kelas yang dibelajarkan dengan LC-5E berkonteks SSI dengan yang dibelajarkan menggunakan metode konvensional; (c) terdapat perbedaan rata-rata penguasaan konsep kelarutan siswa kelas XI SMA yang dibelajarkan dengan LC-5E berkonteks SSI (68,26), LC-5E tanpa konteks SSI (59,77) dan metode konvensional (47,09), dimana perbedaan signifikan terjadi pada kelas yang dibelajarkan dengan dengan LC-5E berkonteks SSI maupun LC-5E tanpa konteks SSI dengan kelas yang dibelajarkan menggunakan metode konvensional.Selanjutnya untuk mengetahui kebermaknaan perbedaan efek tiap kelompok indikator pada kelas eksperimen dilakukan uji effect size dengan mengelompokkan setiap instrumen penilaian yang digunakan pada kelompok indikator tertentu. Pada analisis effect size di setiap variabel menunjukkan beberapa indikator memberikan effect size besar, sedang dan kecil. Effect size pemahaman hakikat sains kelas yang dibelajarkan dengan LC-5E berkonteks SSI tergolongbesar (1,562), sedangkan effect size pemahaman hakikat sains kelas yang dibelajarkan dengan LC-5E tanpa SSI tergolong kecil (0,204). Effect size keterampilan berpikir kritis kelas yang dibelajarkan dengan LC-5E berkonteks SSI tergolongbesar (1,040), sedangkan effect size keterampilan berpikir kritis yang dibelajarkan dengan LC-5E tanpa SSI tergolong kecil (0,369). Effect size penguasaan konsep kelarutan kelas yang dibelajarkan dengan LC-5E berkonteks SSI tergolongbesar (1,390), sedangkan effect size penguasaan konsep kelarutan yang dibelajarkan dengan LC-5E tanpa SSI tergolong sedang (0,661). Dengan demikian dapat disimpulkan bahwa penggunaan LC-5E berkonteks SSI dalam pembelajaran dapat meningkatkan pemahaman hakikat sains, keterampilan berpikir kritis dan penguasaan konsep siswa.

Persepsi siswa terhadap pembelajaran pendidikan kewarganegaraan di SMAN 1 Asembagus Situbondo / Anita Eka Irianti

 

Kata Kunci: Persepsi Siswa, Pembelajaran PKn Mata Pelajaran Pendidikan Kewarganegaraan (Citizenship Education) merupakan mata pelajaran yang memfokuskan pada pembentukan warga negara yang memahami dan mampu melaksanakan hak-hak dan kewajibannya untuk menjadi warga negara yang baik, cerdas, terampil, dan berkarakter yang diamanatkan oleh Pancasila dan UUD 1945. Namun, dalam prosesnya hasil survei peneliti baik dari pengalaman sewaktu PPL maupun data-data dari internet, selama ini pembelajaran PKn masih bersifat monoton dan kurang menarik. Hai ini disebabkan beberapa kendala antara lain: (1) guru mata Pelajaran PKn masih mengalami kesulitan dalam mengaktifkan siswa untuk terlibat langsung dalam proses penggalian dan penelaahan bahan pelajaran, (2) sebagian siswa memandang mata pelajaran Pendidikan Kewarganegaraan sebagai mata pelajaran yang bersifat konseptual dan teoritis, (3) praktik kehidupan di masyarakat baik dalam bidang politik, ekonomi, sosial budaya, hukum, agama seringkali berbeda dengan wacana yang dikembangkan dalam proses pembelajaran di kelas. Bertolak dari hal tersebut dilakukan penelitian tentang persepsi siswa terhadap pembelajaran Pendidikan Kewarganegaraan di SMAN 1 Asembagus Situbondo. Penelitian ini bertujuan untuk mengetahui: (1) persepsi siswa terhadap materi pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, (2) persepsi siswa terhadap metode yang digunakan dalam pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, (3) persepsi siswa terhadap media yang digunakan dalam pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, (4) persepsi siswa mengenai sikap guru dalam pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, (5) persepsi siswa mengenai evaluasi hasil pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo. Penelitian ini dilaksanakan di SMAN 1 Asembagus. Metode penelitian yang digunakan adalah deskriptif kuantitatif. Populasi dalam penelitian ini berjumlah 11 kelas atau 366 siswa, sedangkan sampelnya diambil 6 kelas atau 201 siswa. Rancangan penelitian ini menggunakan jenis pendekatan deskriptif kuantitatif. Data dalam penelitian diperoleh dengan menggunakan instrumen angket tertutup, yang kemudian dianalisis dengan menggunakan persentase. Hasil penelitian menunjukkan bahwa (1) sebanyak 57,71% siswa memiliki persepsi yang sangat baik terhadap materi pelajaran Pendidikan i ii Kewarganegaraan(PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, dikatakan sangat baik karena siswa menunjukkan persepsi yang sangat baik dari indikator yang sudah ditetapkan dengan tepat dan baik, yaitu sangat tertarik, sangat senang, mempunyai pandangan sangat baik, mempunyai penilaian sangat baik, berperilaku sangat baik, dan sangat antusias, (2) sebanyak 47,26% siswa memiliki persepsi yang sangat baik terhadap metode yang digunakan dalam pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, dikatakan sangat baik karena siswa menunjukkan persepsi yang sangat baik dari indikator yang sudah ditetapkan dengan tepat dan baik, yaitu sangat tertarik, sangat senang, mempunyai pandangan sangat baik, mempunyai penilaian sangat baik, berperilaku sangat baik, dan sangat antusias, (3) sebanyak 46,27% siswa memiliki persepsi yang sangat baik terhadap media yang digunakan dalam pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, dikatakan sangat baik karena siswa menunjukkan persepsi yang sangat baik dari indikator yang sudah ditetapkan dengan tepat dan baik, yaitu sangat tertarik, sangat senang, mempunyai pandangan sangat baik, mempunyai penilaian sangat baik, berperilaku sangat baik, dan sangat antusias, (4) sebanyak 47,76% siswa memiliki persepsi yang sangat baik terhadap sikap guru dalam pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, dikatakan sangat baik karena siswa menunjukkan persepsi yang sangat baik dari indikator yang sudah ditetapkan dengan tepat dan baik, yaitu sangat tertarik, sangat senang, mempunyai pandangan sangat baik, mempunyai penilaian sangat baik, berperilaku sangat baik, dan sangat antusias (5) sebanyak 51,24% siswa memiliki persepsi yang sangat baik terhadap kegiatan evaluasi hasil pembelajaran pelajaran Pendidikan Kewarganegaraan (PKn) yang diajarkan di SMAN 1 Asembagus Situbondo, dikatakan sangat baik karena siswa menunjukkan persepsi yang sangat baik dari indikator yang sudah ditetapkan dengan tepat dan baik, yaitu sangat tertarik, sangat senang, mempunyai pandangan sangat baik, mempunyai penilaian sangat baik, berperilaku sangat baik, dan sangat antusias. Berdasarkan hasil penelitian ini, disarankan supaya guru menjelaskan proses pembelajaran secara lebih baik, menyiapkan situasi belajar yang lebih kondusif, memberikan petunjuk yang lebih jelas mengenai metode yang digunakan, menggunakan metode pembelajaran yang bervariasi, menggunakan media pembelajaran yang tepat sehingga mampu membantu pemahaman siswa, memberikan motivasi yang yang lebih besar kepada siswa, membuat soal-soal tes yang sesuai dengan kemampuan siswa, dan segera memberikan balikan atau hasil belajar kepada siswa.

Pengaruh learning cycle 5-E berkonteks SSI terhadap pemahaman hakikat sains, keterampilan berfikir kritis, dan penguasaan konsep larutan penyangga dan hidrolisis garam siswa SMA / Eris Ratnawati

 

ABSTRAK Ratnawati, Eris. 2016. Pengaruh Learning Cycle -5E Berkonteks SSI terhadap Pemahaman Hakikat Sains, Keterampilan Berpikir Kritis, dan Penguasaan Konsep Larutan Penyangga dan Hidrolisis Garam Siswa SMA.Tesis, Program Studi Pendidikan Kimia, Pascasarjana, Universitas Negeri Malang, Pembimbing : (I)Prof.Sri Rahayu, M.Ed, Ph.D (II) Dr. Hj. Fauziatul Fajaroh, M.S. Kata Kunci :Learning Cycle-5E,Socioscientific Issues, Hakikat Sains, Ketrampilan BerpikirKritis, Penguasaan Konsep, Larutan Penyangga, Hidrolisis Garam Hakikat sains,keterampilanberpikirkritis, dan penguasaankonsepmerupakankomponendalamliterasisains. Olehsebabitu, pembelajaran yang dapatmeningkatkan hakikat sains,keterampilanberpikirkritis, dan penguasaankonsepdiperlukanuntukmenciptakangenerasi yang berliterasi sains,diantaranyamelaluipenerapanpembelajaranberkontekssocioscientific issues (SSI). Salah satumaterikimia yang sesuaidibelajarkandengankonteks SSI adalahlarutan penyangga dan hidrolisis garam.Penelitianinibertujuanmengetahuiperbedaanhakikat sains, keterampilanberpikirkritis, dan penguasaan konsep siswa yang dibelajarkandengan model pembelajaranLearning Cycle-5Eberkonteks SSI, model pembelajaran Learning Cycle-5E, danmodel pembelajarankonvensionalpadamaterilarutan penyangga dan hidrolisis garam. Desainpenelitian yang digunakanadalaheksperimentalsemupretes dan postes.Sampelpenelitianterdiridaritigakelas, yaitukelas XI MIA-3 (n=36) yang dibelajarkandengan model pembelajarankonvensional, kelas XI MIA-4 (n=36) yang dibelajarkan dengan model pembelajaran Learning Cycle-5E, dankelas XI MIA-5 (n=36) yang dibelajarkandengan model pembelajaranLearning Cycle-5Eberkonteks SSI. Sampeldipilihdenganteknikconvenience sampling.Data penelitiandiperolehdarihasilangket berskala Likert (R=0,883), tesketerampilanberpikirkritis(R=0,7558), dan tes penguasaan konsep (R=0,882) yang dikembangkan oleh peneliti. Data dianalisisdengan ANCOVA satujalur, uji lanjut post hoc LSD, dan effect size. Hasilpenelitianmenunjukkanbahwaada perbedaansignifikan pemahamanhakikatsains, ketrampilan berpikir kritis, dan penguasaan konsep antarasiswakelasXI yangdibelajarkandengan model pembelajaranLearning Cycle-5Eberkonteks SSI, model pembelajaranLearning Cycle-5E , dan model pembelajarankonvensional. Effect size dariaspekhakikatsains yang berkontribusibesaradalahmetodeilmiah, empiris, inferensi, dimensisosialsains, danpenerapansainsdalambidangsosbud.Effect size dariindikatorberpikirkritis yangberkriteriabesaryaitu menganalisisargumen, melakukandeduksidanmenilaihasildeduksi, melakukaninduksi,mendefinikanistilahdanmempertimbangkandefinisimenggunakankriteria yang tepat, memutuskansuatutindakan; danberinteraksidengan orang lain. Effect size darikelompoksumbateri yangberkriteriabesaryaituprinsipkerjalarutanpenyanggadanperhitungan pHlarutanpenyangga.

Perkembangan bentuk penyajian Kesenian Jaranan Tril pada Paguyuban Turonggo Anom Budoyo Desa Rejowinangun Kecamatan Kademangan Kabupaten Blitar tahun 1971-2015 / Fenda Anindia Putri

 

ABSTRAK Putri, Fenda Anindia, 2015. Perkembangan Bentuk Penyajian Kesenian Jaranan Tril pada Paguyuban Turonggo Anom Budoyo Desa Rejowinangun Kecamatan Kademangan Kabupaten Blitar Tahun 1971-2015. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Dra. Hj. Endang Wara Suprihatin D.P, M.Pd, (II) Rully Aprilia Zandra, S.Pd, M.Pd, M.Sn. Kata Kunci: perkembangan, Jaranan Tril, bentuk penyajian. Kesenian Jaranan Tril merupakan salah satu seni pertunjukan kuda lumping di Blitar. Berdasar observasi awal peneliti didapati bahwa Jaranan Tril pada tahun 1971 ditarikan oleh laki-laki dewasa saja, sedangkan tahun 2015 ditarikan oleh anak-anak. Sejalan dengan hal tersebut bentuk penyajian yang disajikan Jaranan Tril dari tahun 1971 hingga 2015 disajikan berbeda-beda. Dapat dikatakan bahwa telah terjadi perkembangan pada kesenian Jaranan Tril dari tahun 1971-2015. Maka dari fenomena tersebut, peneliti tertarik melakukan penelitian lebih lanjut tentang perkembangan bentuk penyajian kesenian Jaranan Tril pada paguyuban Turonggo Anom Budoyo dari tahun 1971-2015. Penelitian ini bertujuan untuk (1) Mendeskripsikan bentuk penyajian kesenian Jaranan Tril pada paguyuban Turonggo Anom Budoyo Rejowinangun Kecamatan Kademangan Kabupaten Blitar tahun 1971-2015. (2) Mendeskripsikan faktor-faktor yang mempengaruhi perkembangan kesenian Jaranan Tril pada paguyuban Turonggo Anom Budoyo Desa Rejowinangun Kecamatan Kademangan Kabupaten Blitar. Penelitian ini menggunakan jenis penelitian kualitatif deskriptif. Lokasi penelitian berada pada paguyuban Turonggo Anom Budoyo Desa Rejowinangun Kecamatan Kademangan Kabupaten Blitar. Narasumber dalam penelitian ini adalah Purnomo, Salan, Katirin, Pitoyo. Prosedur pengumpulan data dilakukan dengan metode observasi, wawancara, dan dokumentasi. Kegiatan analisis data dimulai dari tahap pengumpulan data, tahap reduksi, tahap penyajian data, serta tahap penarikan kesimpulan. Pengecekan keabsahan data menggunakan trianggulasi metode dan triangulasi sumber. Hasil penelitian menunjukkan bahwa, 1) Perkembangan bentuk penyajian kesenian Jaranan Tril tahun 1971-2015 meliputi perkembangan gerak tari, tata busana, tata rias, properti dan musik iringan pada Jaranan Tril; 2) Faktor-faktor yang mempengaruhi perkembangan bentuk penyajian kesenian Jaranan Tril yaitu faktor internal dari kebutuhan paguyuban dan faktor eksternal yaitu masyarakat dan peran Kepala Desa. Kesenian Jaranan Tril mengalami perkembangan bentuk penyajian dari tahun 1971-2015. Untuk peneliti lain, peneliti menyarankan untuk meneliti lebih luas tentang Jaranan Tril khususnya mengenai struktur penyajian Jaranan Tril dan asal-usul Jaranan Tril.

Perubahan konseptual mahasiswa pada topik kemagnetan melalui penggunaan program umpan balik / Reny Mufidah

 

ABSTRAK Reny, Mufidah. 2017. Perubahan Konseptual Mahasiswa pada Topik Kemagnetan Melalui Penggunaan Program Umpan Balik. Tesis. Program Studi Pendidikan Fisika, Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Dr. Sutopo, M.Si, (II) Dr. Wartono M.Pd Kata Kunci: kemagnetan, perubahan konseptual Perbedaan konseptual setiap siswa harus diatas agar tidak terjadi miskonsepsi yang berkepanjangan pada siswa. Konsep-konsep pada materi kemagnetan yang kompleks dan abstrak, serta menekankan kemampuan mengaitkan antar konsep sehingga sering terjadi perbedaan konsepsi pada siswa. Program umpan balik dihadirkan sebagai salah satu alat belajar untuk menguatkan konsep dan mengatasi permasalahan perbedaan konsepsi siswa. Penelitian bertujuan mengeksplorasi penggunaan program umpan balik terhadap perubahan konseptual dan menguatkan konsep kemganetan siswa secara mendalam. Penelitian menggunakan rancangan penelitian mixed method dengan desain embedded experimental. Subjek penelitian terdiri atas 13 mahasiswa pendidikan fisika Universitas Negeri Malang yang mengambil matakuliah Fisika Dasar III pada semester genap tahun akademik 2015/2016. Perubahan konseptual yang dialami siswa ditinjau melalui dua pendekatan yakni secara kualitatif dan kuantitatif yang didasarkan pada hasil tes siswa. Analisis kualitatif memaparkan perubahan penguasaan konsep siswa, sedangkan analisis kuantitatif menekankan hasil statistik perubahan konseptual siswa. Tingkat penguasaan siswa dianalisis menggunakan perhitungan statistik n-gain dan non-parametric wilcoxon. Disimpulkan hasil penelitian sebagai berikut: (1) terdapat perbedaan signifikan terhadap hasil tes konseputual siswa materi kemagnetan, dengan nilai signifikansi 0.001 menggunakan uji non-parametric wilcoxon dan n-gain ternormalisasi 0,3 (sedang), (2) mahasiswa telah mampu memperbaiki pemahamannya terkait arah gaya magnet yang bekerja pada partikel, (3) mahasiswa mampu memperbaiki pemahaman terkait gaya magnet tidak merubah besar kelajuan, hanya merubah arah, namun masih terdapat beberapa mahasiswa yang kesulitan memperbaiki konsep medan magnet yang dihasilkan oleh dua kawat berarus, (4) mahasiswa mengalami kesulitan dalam topik torka, terutama dalam menentukan besar dan arah torka pada loop berarus dalam medan magnet homogen, (5) sebagian kecil mahasiswa yang mampu memperbaiki pemahamannya terkait efek hall dan hukum ampere. Adanya penggunaan program umpan balik, hanya memiliki pengaruh dan peningkatan sedikit pada mahasiswa dalam memperbaiki pemahaman kemagnetan.

Pengembangan media pembelajaran seni musik dengan menggunakan macromedia flash 8 di SMPN 10 Malang / Satriah

 

ABSTRAK Satriah. 2015. Pengembangan Media Pembelajaran Seni Musik dengan Menggunakan Macromedia Flash di SMPN 10 Malang. Skripsi, Jurusan Pendidikan Seni Tari dan Musik Fakultas Sastra Universitas Negeri Malang. Pembimbing (1) Dra. Ninik Harini, M.Sn (II) Tri Wahyuningtyas, S.Pd. M.Si. Kata kunci : media pembelajaran, materi seni musik, macromedia flash. Pengembangan media pembelajaran ini untuk meningkatkan pemahaman materi seni musik pada mata pelajaran seni budaya kelas 1 SMPN 10 Malang. Berdasarkan hasil observasi di lapangan di SMPN 10 Malang pada mata pembelajaran seni budaya, diketahui bahwa penggunaan media pembelajaran sangat terbatas. Karena kegiatan proses pembelajaran hanya menggunakan buku teks. Dengan dikembangkannya media pembelajaran macromedia flash 8 akan lebih memudahkan siswa untuk memahami suatu materi yang nantinya proses pembelajaran ini akan mencapai tujuan pembelajaran. Penelitian ini bertujuan untuk : (1) mengembangkan macromedia flash dalam mata pelajaran seni musik di SMPN 10 Malang. Penelitian ini menggunakan metode model pengembangan Research and Development ( R&D ) dari Borg dan Gell dalam Ardhana (2002:9). Subjek penelitian adalah : siswa kelas VII I SMPN 10 Malang, dan guru seni budaya SMPN 10 Malang. Data penelitian menggunakan data kualitatif dan kuantitatif,diperoleh melalui observasi, wawancara, dan angket pertanyaan. Sedangkan kuantitatif diperoleh melalui dari hasil analisis data. Data yang telah didapat kemudian dianalisis dan dirancang menjadi perangkat lunak multimedia yang digunakan untuk sistem pembelajaran. Hasil penelitian dan pengembangan ini adalah macromedia flash. Hasil uji coba produk dapat disimpulkan sebagai berikut, berdasarkan penilaian ahli materi menyatakan valid dengan persentase 93,75%, penilaian ahli media menunjukkan media pembelajaran macromedia flashvalid dengan persentase 88,3%, sedangkan berdasarkan uji coba kelompok kecil menyatakan valid dengan persentase 90% dan uji coba kelompok besar menyatakan cukup valid dengan persentase 75,3%. Berdasarkan kesimpulan penelitian tersebut, dapat disarankan bagi:(1) Bagi siswa diharapkan lebih aktif dan kreatif dalam belajar dengan adanya media pembelajaran macromedia flash.(2) Bagi guru diharapkan dapat menyiapkan media untuk bahan ajar agar dalam proses belajar tidak cenderung menggunakan buku teks, seperti penulis buat yaitu menyiapkan bahan ajar media pembelajaran macromedia flash.(3) Bagi sekolah diharapkan dapat menyiapkan peralatan yang akan dibutuhkan dalam penggunaan proses belajar mengajar.

Analisis kandungan logam berat timbal (Pb) pada proses pengolahan kupang merah (musculista senhausia) / Hikmatunisa Afit Riadi

 

ABSTRAK Riadi, Hikmatunisa Afit. 2016. Analisis Kandungan Logam Berat Timbal (Pb) Pada Proses Pengolahan Kupang Merah (Musculista senhausia). Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Drs. Agus Dharmawan, M.Si, (II) Dr. Betty Lukiati, M.S Kata Kunci: Kandungan logam berat Pb, kupang merah, proses pengolahan kupang. Penelitian yang telah dilakukan sebelumnya menyatakan bahwa kupang merah sebagai bahan baku makanan tradisional mengandung logam berat. Hal ini dapat menyebabkan kekhawatiran bagi konsumen dan masyarakat pelaku usaha yang bergerak dibidang pengolahan kupang merah. Penelitian ini bertujuan untuk mengetahui kandungan logam berat Pb pada daging daging dan air (kuah) kupang merah. Penelitian deskriptif dengan pendekatan kuantitatif dengan pengambilan sampel daging kupang segar, daging kupang rebus, daging kupang bumbu, dan air (kuah) kupang merah diuji dengan menggunakan Atomic Absorption Spectrophotometry. Hasil penelitian menunjukkan bahwa kandungan logam berat Pb sebesar 0.5666 mg/L pada daging kupang segar, 0.5632 mg/L pada daging kupang rebus, 0.5188 mg/L pada daging kupang bumbu, 0.5162 mg/L pada air sisa rebusan kupang dan 0.4342 pada air (kuah) kupang merah masih berada dibawah ambang batas BPOM RI sebesar 1.5 ppm. Proses pengolahan makanan kupang merah dapat menurunkan kandungan logam berat Pb pada daging dan air kuah kupang merah, namun setiap tahap pada proses pengolahan tidak menunjukkan penurunan yang signifikan.

Macapat gaya Malang di Desa Karanganyar Kecamatan Poncokusumo Kabupaten Malang / Ivandra Kusuma Rahmandika

 

ABSTRAK Rahmandika, Ivandra Kusuma. 2015. Macapat Gaya Malang di Desa Karanganyar Kecamatan Poncokusumo Kabupaten Malang. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Dra. Ninik Harini, M.Sn, (II) Hartono, S.Sn.,M.Sn. Kata kunci : Macapat, Gaya, Malang. Musik sebagai ekspresi manusia yang bersifat estetis merupakan bagian yang tidak terpisahkan dalam kehidupan manusia di masyarakat yang penuh makna. Macapat gaya Malang merupakan sebuah musik tradisional yang memiliki ciri khusus, yaitu memiliki gaya lagu yang berbeda dengan Macapat di daerah lain. Desa karanganyar tepatnya di Jalan R.A. Kartini No. 2 terdapat seorang seniman Macapat gaya Malang yang bernama Supatman. Beliau belajar Macapat gaya Malang dari Bapaknya sendiri sejak usia 17 tahun. Namun seiring perkembangan zaman, Macapat gaya Malang di desa tersebut mulai tergeser, hal tersebut disebabkan oleh beberapa faktor yang mempengaruhi. Rumusan masalah yang diambil dalam penelitian ini adalah bagaimana minat masyarakat terhadap Macapat gaya Malang dan apa saja faktor-faktor yang mempengaruhi Macapat gaya Malang di Desa Karanganyar Kecamatan Poncokusumo Kabupaten Malang. Tujuan penelitian ini, yaitu mengungkap kesenjangan yang terjadi antara Macapat gaya Malang dengan masyarakat di desaKaranganyar. Penelitian ini menggunakan metode kualitatif deskriptif, dalam arti peneliti mendeskripsikan fenomena yang terjadi di masyarakat. Teknik pengumpulan data dilakukan dengan metode observasi, wawancara, dan dokumentasi. Proses analisis data dimulai dari tahap pengumpulan data, tahap reduksi, tahap penyajian data, serta tahap penarikan kesimpulan. Pengecekan keabsahan data dilakukan dengan triangulasi sumber, dan triangulasi metode. Hasil penelitian ini menunjukkan Macapatgaya Malang di Desa Karanganyar Kecamatan Poncokusumo Kabupaten Malang. Sikap masyarakat terhadap Macapat gaya Malang saat ini sangat memprihatinkan, karena masyarakat kurang peduli terhadap kesenian tradisional yang hampir punah tersebut dan mulai meninggalkan kebiasaan-kebiasaan yang dahulu sering dilakukan oleh sesepuh mereka. Hal tersebut terjadi karena beberapa faktor yang mempengaruhi, diantaranya terdapat kesenian lain yang berkembang dan menurut masyarakat lebih menarik dibandingkan dengan Macapat gaya Malang dan juga kebiasaan masyarakat yang mulai berubah seiring perkembangan zaman. Berdasarkan hasil penelitian ini, penulis menyarankan kepada seluruh masyarakat khusunya generasi muda di desa Karanganyar untuk mempelajari dan melestarikan Macapat gaya Malang, karena dengan mempelajari Macapat gaya Malang selain kita melaksanakan tangung jawab sebagai warga negara yang baik juga dapat menanamkan nilai moral yang terkandung di setiap kata dalam Macapat gaya Malang tersebut.

Pengembangan media bimbingan autoplay tentang karakter tanggung jawab siswa SMP berbasis cerita rakyat / Desy Susilowati

 

ABSTRAK Susilowati, Desy. 2016. Pengembangan Media Bimbingan Autoplay tentang Karakter Tanggung Jawab Siswa SMP Berbasis Cerita Rakyat. Jurusan Bimbingan dan Konseling, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Muslihati, S.Ag., M.Pd (II) Yuliati Hotifah, S.Psi., M.Pd Kata Kunci: karakter tanggung jawab, media bimbingan autoplay, cerita rakyat. Nilai-nilai yang dikembangkan pada pendidikan karakter baik dalam pendidikan formal maupun nonformal, diantaranya: jujur, tanggung jawab, cerdas, sehat dan bersih, peduli, kreatif dan gotong royong. Berdasarkan hasil analisis kebutuhan yang dilancarkan oleh konselor SMP N 2 Malang, menunjukkan rendahnya pencapaian tugas perkembangan siswa terdapat pada aspek kesadaran tanggung jawab. Sehingga karakter tanggung jawab siswa perlu dikembangkan. Upaya pendidikan karakter agar bersifat efektif maka konselor dapat mengusahakan implementasi berbagai metode misalnya dengan membaca cerita atau dongeng yang sesuai. Pesatnya perkembangan teknologi saat ini menjadikan siswa lebih memilih teknologi berbasis komputer daripada dalam bentuk cetak. Tujuan dari penelitian ini adalah menghasilkan media bimbingan autoplay tentang karakter tanggung jawab siswa SMP berbasis cerita rakyat yang layak digunakan untuk memberikan layanan bimbingan dan konseling Model prosedural penelitian pengembangan ini mengadaptasi 7 dari 10 langkah penelitian Borg & Gall (1983), yaitu (1) penelitian dan pengumpulan data, (2) perencanaan, (3) pengembangan draf produk, (4) uji coba lapangan awal, (5) merevisi hasil uji coba, (6) uji coba lapangan, dan (7) penyempurnaan produk hasil uji coba lapangan. Produk pengembangan ini terdiri dari media bimbingan dan buku panduan konselor, yang keduanya telah divalidasi oleh ahli materi dan ahli media, serta telah diuji cobakan pada calon pengguna, yaitu konselor dan siswa. Selain itu penelitian pengembangan ini juga menghasilkan inventori karakter tanggung jawab sebagai instrumen evaluasi yang telah diuji reliabilitas dan validitasnya. Hasil validasi dari ahli materi, ahli media dan uji calon pengguna yang dinilai dari aspek ketepatan, kegunaan, kemudahan dan kemenarikan memperoleh hasil rata-rata skor 3,57 dengan kriteria sangat layak. Maka dapat disimpulkan bahwa produk pengembangan ini sangat layak digunakan sebagai media bimbingan dalam memberikan layanan bimbingan tentang karakter tanggung jawab. Saran bagi konselor diharapkan menggunakan produk dalam layanan bimbingan kelompok/klasikal pada bidang pribadi sosial, serta mampu bekerjasama dengan guru mata pelajaran lain agar mampu memaksimakan media yang dikembangkan. Bagi peneliti selanjutnya, disarankan agar memperhatikan spesifikasi komputer yang digunakan untuk membuat dan mengoperasikan media agar tidak lambat ketika dioperasikan. Selain itu perlu dilakukan uji keefektifan produk dengan menggunakan penelitian sejenisnya, melanjutkan pada tahap 8, 9 dan 10 pada model prosedural penelitian pengembangan Borg & Gall.

Peningkatan kekuatan dan kekakuan balok I (I-joist) dengan perkuatan bilah bambu petung / Danang Faizal Rachman

 

ABSTRAK Rachman, Danang F. 2016. Peningkatan Kekuatan dan Kekakuan Balok I (I-Joist) dengan Perkuatan Bilah Bambu Petung. Skripsi, Program Studi S1 Pendidikan Teknik Bangunan Fakultas Teknik Universitas Negeri Malang. Pembimbing (I) Dr. Karyadi, M.P., M.T. (II) Drs. Eko Suwarno, M.Pd Kata kunci : kekuatan, kekakuan, balok I, perkuatan, bilah. Penelitian tentang balok I dengan perkuatan lentur dari bambu lamina berbentuk pelupuh tidaklah efisien, sehingga guna mengatasi permasalahan tersebut dalam penelitian ini digunakan perkuatan lentur dari bilah bambu petung sebagai upaya meningkatkan kekuatan dan kekakuan balok I. Bambu lamina yang terbuat dari bilah bambu terbukti lebih stabil dan kuat dibandingkan dengan bambu lamina yang terbuat dari pelupuh. Penelitian ini dilakukan guna mengetahui peningkatan kekuatan dan kekakuan balok I tanpa perkuatan terhadap balok I dengan perkuatan bilah bambu petung laminasi arah horisontal dan vertikal. Ditinjau dari hasil analitis dan uji lentur balok I dengan atau tanpa perkuatan. Penelitian ini menggunakan rancangan penelitian eksperimen. Data hasil uji pendahuluan digunakan untuk analitis nilai beban maksimum. Dan untuk pengujian dilakukan di Laboratoirum Struktur Teknik Sipil Universitas Negeri Malang. Data hasil analitis dan uji lentur balok I dengan dan tanpa perkuatan bilah bambu petung dibandingkan berdasarkan nilai beban maksimum (P Maks), Modulus of Rupture (MOR), dan Modulus of Elasticity (MOE). Hasil dari penelitian menunjukkan (1) prosentase beda rerata hasil analitis terhadap hasil uji lentur balok I tanpa perkuatan berturut-turut pada nilai P Maks, MOR, dan MOE sebesar 4,93 %, 5,16 %, dan 9,74 % lebih kecil hasil uji lenturnya. (2) Sedangkan untuk balok I dengan perkuatan bilah bambu petung laminasi arah horisontal dan arah vertikal berturut-turut pada nilai P Maks, MOR, dan MOE sebesar 4,26 %, 4,48 % dan 6,03 % lebih kecil hasil uji lenturnya untuk arah horisontal, serta untuk arah vertikal berturut-turut sebesar 11,05 %, 11,34 %, dan 7,52 % lebih kecil hasil uji lenturnya. (3) Peningkatan P Maks balok I tanpa perkuatan terhadap balok dengan perkuatan bilah bambu petung laminasi horisontal dan vertikal sebesar 130,45 % dan 100,76 %. (4) Dan untuk peningkatan kekakuan balok I sebesar 3,50 % dan 2,07 %.

Pengembangan modul pembelajaran keterampilan menyimak dan berbicara bahasa Mandarin untuk siswa SMA kelas X tema ... (identitas diri) / Sarah Aulia Wibowo

 

ABSTRAK Wibowo, Sarah Aulia. 2016. Pengembangan Modul Pembelajaran Keterampilan Menyimak dan Berbicara Bahasa Mandarin untuk Siswa SMA Kelas X Tema个人信息 (Identitas Diri). Skripsi, Program Studi Pendidikan Bahasa Mandarin, Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: Dr. Primardiana H.W., M.Pd Kata Kunci: pengembangan, modul, pembelajaran bahasa Mandarin Tujuan dari penelitian pengembangan ini adalah menghasilkan produk bahan ajar berupa modul pembelajaran keterampilan menyimak dan berbicara bahasa Mandarin untuk siswa SMA kelas X tema identitas diri. Dalam mengembangkan modul pembelajaran, pengembang menggunakan model pengembangan ADDIE dari Dick & Carey. Data penelitian ini diperoleh dari angket dan observasi. Produk pengembangan ini divalidasi oleh tiga validator yang terdiri dari validator ahli media, ahli materi (dosen dan guru), dan diujicobakan pada peserta didik kelas X IBB 2 SMA Laboratorium UM. Penelitian dan pengembangan ini menghasilkan produk berupa modul pembelajaran keterampilan menyimak dan berbicara bahasa Mandarin. Tema yang disajikan pada modul ini adalah个人信息 (identitas diri) yang dibagi menjadi tiga subtema, yaitu salam sapaan, menanyakan kabar, dan perkenalan jati diri. Latihan yang ada pada modul pembelajaran ini dilengkapi dengan soal latihan untuk pelafalan, kosakata, dan tata bahasa. Modul pembelajaran ini terdiri dari tiga bagian, yaitu (1) bagian awal yang terdiri dari petunjuk penggunaan modul serta daftar ragam jenis kata (此类简称表), (2) bagian inti berisi kumpulan materi dan soal latihan yang disajikan untuk keterampilan menyimak (听力) dan berbicara (说话), serta latihan tentang penguasaan kosakata dan gramatika, (3) bagian akhir yang terdiri dari glosarium (词汇表), kunci jawaban (练习答案), serta teks audio (听力录音文本).

Perkembangan musik Jaranan Jawa pada Hrup Jaranan Darmo Putro tahun 1990-2015 Desa tenon Kecamatan Papar Kabupaten Kediri / Mohammad Setia Arya Hady Purwanto

 

ABSTRAK Purwanto, Mohammad Setia Arya Hady. 2015. Perkembangan Musik Jaranan Jawa pada Grup Jaranan Darmo Putro Tahun 1990-2015 desa Tanon Kecamatan Papar Kabupaten Kediri. Skripsi, Jurusan Seni dan Desan Universitas Negeri Malang. Pembimbing: (1) Drs. Robby Hidajat, M.Sn, (2) Hartono, S.Sn, M.Sn. Kata Kunci : Perkembangan, Musik Jaranan Jawa, desa Tanon, Darmo Putro Kediri adalah salah satu kota di Provinsi Jawa Timur yang banyak kesenian musik diantaranya adalah musik Jaranan Jawa. Kesenian Musik Jaranan Jawa merupakan bagian dari kesenian jaranan. Jaranan jawa merupakan kesenian rakyat kediri. Kesenian ini diawali dari pemuda karang taruna yang senang dengan jaranan. Pada saat itu masyarakat membutuhkan hiburan kesenian jaranan yang lebih menarik dari yang ada. Saat ini kesenian musik jaranan jawa grup Darmo Putro menyajikan pengemasan musik yang mengkolaborasikan musik pentatonis dengan diatonis. Hal ini menjadi alasan peneliti untuk menggali lebih dalam lagi tentang Perkembangan Musik Jaranan Jawa pada perkumpulan Darmo Putro tahun 1990-2015 di desa Tanon. Tujuan penelitian yaitu: 1) Mendeskripsikan Perkembangan musik Jaranan Jawa pada grup Jaranan Darmo Putro di desa Tanon kecamatan Papar kabupaten Kediri; 2) Mendeskripsikan faktor yang mempengaruhi perkembangan musik Jaranan Jawa pada grup Darmo Putro di desa Tanon kecamatan Papar kabupaten Kediri; 3) Mendeskripsikan bentuk musik Jaranan Jawa pada grup Jaranan Darmo Putro di desa Tanon kecamatan Papar kabupaten Kediri. Penelitian ini termasuk jenis penelitian deskriptif kualitatif. Lokasi penelitian ini berada di grup jaranan Darmo Putro desa Tanon kecamatan Papar. Teknik pengumpulan data dalam penelitian ini menggunakan teknik observasi, wawancara dan dokumentasi. Kegiatan analisis data di mulai dari tahap reduksi, tahap penyajian data, serta tahap penarikan simpulan. Pengecekan keabsahan data menggunakan triangulasi metode dan triangulasi sumber. Hasil penelitian menunjukkan bahwa, 1) Perkembangan musik Jaranan Jawa pada grup Darmo Putro menggunakan instrumen musik kendhang, bonang, gong, saron, demung, kendhang ketipung, gitar elektrik, bass, keyboard, dan drum; 2) Faktor-faktor yang mempengaruhi perkembangan musik Jaranan Jawa yaitu faktor internal dari seniman, kebutuhan ekonomi, serta pelestarian seni jaranan dan faktor eksternal yaitu permintaan masyarakat; 3) Bentuk musik jaranan jawa ditinjau dari instrumen serta lagu, mengalami perubahan pengemasan lagu yang dipengaruhi masuknya instrumen diatonis. Berdasarkan hasil penelitian ini, diharapkan akan ada penelitian yang lebih lanjut dan lebih menyempurnakan hasil penelitian ini, serta dapat menumbuhkan kesadaran masyarakat Kediri agar melestarikan kesenian jaranan khususnya memberikan sumbangan ide kreatif untuk kemajuan musik pengiring jaranan tersebut.

Perbandingan efektivitas model pembelajaran jigsaw dengan model pembelajaran student team achievement divisions (STAD) dalam kemampuan berargumentasi siswa kelas VIII SMP Negeri 4 Kepanjen / Ima Verantika

 

Kata Kunci : Model Pembelajaran Jigsaw, Model Pembelajaran STAD, Kemampuan Berargumen, Pembelajaran Berbicara. Minat dan kemampuan siswa dalam berargumentasi siswa di sekolah masih rendah. Keterampilan berargumentasi yang termasuk dalam kegiatan berbicara masih dianggap sulit oleh siswa. Ketidaktahuan ini refleksi dari ketidak tahuan siswa tentang apa yang harus dibicarakan, untuk apa dibicarakan, ada pada latihan (praktik) berbicara. Kalaupun ada latihan, kegiatan tersebut tidak efektif dan tidak manarik bagi siswa. Di samping itu, teknik mengajar guru kurang bervariasi. Pernyataan ini dapat dibuktikan dari hasil pretes berbicara siswa dalam kemampuan berargumentasi, dalam pretes tersebut masih banyak siswa yang tersendat-sendat dalam berbicara, tidak mengembangkan isi argumennya dengan fakta dan contoh-contoh, serta masih banyak siswa yang menggunakan bahasa yang tidak baku dalam menyampaikan argumen. Jika hal itu terus terjadi maka tujuan pembelajaran berbicara tidak akan pernah tercapai, siswa akan tetap gagap dan gugup dalam berbicara. Oleh sebab itu, dibutuhkan pemilihan model pembelajaran yang efektif dan membuat siswa tertarik, lebih siap dan merangsang siswa untuk aktif berbicara khususnya dalam berargumentasi. Model pembelajaran Jigsaw dan model pembelajaran STAD adalah salah satu model pembelajaran yang biasanya digunakan untuk mengajarkan kemampuan berbicara, tetapi tidak pernah terpikir oleh guru manakah di antara kedua model pembelajaran tersebut yang lebih efektif digunakan untuk pembelajaran berbicara khususnya dalam berargumentasi. Tujuan penelitian ini adalah (1)mengetahui perbedaan kemampuan berargumentasi siswa yang diajarkan dengan menggunakan model pembelajaran diskusi kelompok dengan siswa yang diajarkan dengan model pembelajaran Jigsaw, (2) mengetahui perbedaan kemampuan berargumentasi siswa yang diajarkan dengan model pembelajaran diskusi kelompok dengan siswa yang diajarkan dengan model pembelajaran STAD, (3) mengetahui kemampuan berargumentasi siswa yang diajarkan dengan menggunakan model pembelajaran Jigsaw dengan siswa yang diajarkan dengan model pembelajaran STAD dan, (4) mengetahui kefektifan antara model pembelajaran jigsaw dengan model pembelajaran STAD dalam kemampuan berargumentasi siswa kelas VIII SMP Negeri 4 Kepanjen. Penelitian ini menggunakan metode penelitian eksperimen komparatif. Penelitian eksperimen murni digunakan untuk mengetahui pengaruh model pembelajaran Jigsaw terhadap kemampuan berargumentasi, pengaruh model pembelajaran STAD terhadap kemampuan berargumentasi dan pengaruh model pembelajaran diskusi kelompok terhadap kemampuan berargumentasi. Dalam penelitian eksperimen terdapat kelompok eksperimen dan kelompok kontrol, jadi dalam penelitian ini untuk kelompok eksperimennya terdapat dua kelas yaitu kelas dengan model Jigsaw dan model STAD, sedangkan untuk kelompok kontrol adalah kelas dengan model pembelajaran diskusi kelompok. Instrumen yang digunakan untuk mengambil data adalah tes, lembar observasi, wawancara dan dokumentasi. Hasil penelitian tentang perbandingan efektivitas antara model pembelajaran Jigsaw dengan model pembelajaran STAD setelah pengujian hipotesis diketahui bahwa perbandingan antara kelas yang diajarkan dengan model pembelajaran Jigsaw sebesar 87.45 lebih tinggi dibadingakan dengan ratarata siswa yang diajarkan dengan model pembelajaran diskusi kelompok yaitu sebesar 77.38. Untuk rata-rata kemampuan siswa yang dibandingkan antara siswa yang diajarkan dengan model pembelajaran STAD sebesar 83.40 juga lebih tinggi daripada rata-rata kemampuan siswa yang diajarkan dengan model pembelajaran diskusi kelompok. Dari paparan data di atas dapat diketahui bahwa rata-rata kemampuan siswa yang diajarkan dengan model pembelajaran Jigsaw lebih tinggi daripada siswa yang diajarkan dengan model pembelajaran diskusi kelompok dan model pembelajaran STAD. Hasil penelitian tersebut menunjukkan bahwa model pembelajaran Jigsaw lebih efektif digunakan dalam kemampuan berargumentasi. Berdasarkan hasil penelitian saran yang diajukan sebagai berikut (1) Guru mata pelajaran Bahasa dan Sastra Indonesia, hendaknya menjadikan penelitian ini sebagai masukan untuk menambah pengetahuan dan kreatifitas dalam memilih model pembelajaran di sekolah, (2) Untuk peneliti selanjutnya disarankan untuk menggunakan model pembelajaran lain agar siswa memiliki kemampuan berargumen yang lebih baik dan diharapkan menggunakan instrument penelitian dengan aspek penilaian yang lebih rinci baik dari segi kebahasaan dan nonkebahasaan.

Studi karakteristik lalu lintas dan tingkat pelayanan ruas jalan lingkar Universitas Brawijaya / Nur Afidah Rizky Amalia

 

ABSTRAK Amalia, NurAfidahRizky. 2012. StudiKarakteristikLaluLintasdan Tingkat PelayananRuasJalanLingkarUniversitasBrawijaya. Skripsi, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Pranoto, S.T., M.T.(II) Drs. H. Sugiyanto, S.T., M.T. Kata kunci :KarakteristikLaluLintas, Tingkat Pelayanan, JalanLingkarUniversitasBrawijaya Peningkatan volume lalu-lintas yang tidakseimbangdenganpeningkatankapasitasdankinerjajalandanbercampurnyapenggunaanlahanmenimbulkanpermasalahanlalu-lintasruasjalan lingkar UB (Jalan Veteran, JalanGajayana, Jalan MT. Haryono, danJalanMayjenPanjaitan).Parameter karakteristiklalu-lintas yang merupakan faktor penting dalam perencanaan lalu-lintas adalah volume, kecepatan, dan kepadatan. Fungsi utama dari suatu jalan adalah memberikanpelayanan transportasi sehingga pemakai jalan dapat berkendaraan dengan aman dan nyaman. Kondisipelayananjalanmecerminkantingkatpelayananjalan yang diperoleh.Tingkat pelayananjalandipengaruhiolehkapasitasdanderajatkejenuhan. Tujuan dari penelitian ini adalah untuk: (1) Mengetahuikarakteristiklalu-lintasjalanlingkar UB; (2) Mengetahuitingkatpelayananruasjalanlingkar UB. Metodedalam penelitian ini dilakukan dengansurvei volume kendaraan,kecepatankendaraan, hambatan samping, sertageometri jalan.Analisis data menggunakanManual Kapasitas Jalan Indonesia (MKJI, 1997). Data penelitian didapat dengan melakukan surveitraffic counting pada hari Selasa, Rabu, danKamis pukul 06.00-08.00 dan 16.00-18.00. Hasil penelitian menunjukkan bahwa: (1) Karakterisktiklalu-lintasuntukjalanlingkar UB, rata-rata volume kendaraan yang melintas 2237,29 smp/jam, kecepatan rata-rata padaruasjalantersebut 24,55 km/jam, dankepadatan rata-rata 91,86 smp/km. Volume terbesarterjadipadaJalan Veteran 3795,7smp/jam, kecepatantertinggiterjadipadaJalan Veteran 34,67 km/jam, dankepadatantertinggiterjadipadaJalanGajayana 127,22 smp/km. (2)Rentangtingkatpelayananuntukruasjalanlingkar UB daritingkat B sampaidengantingkat F. Tingkat pelayananjalantertinggiterjadipadaJalanGajayana,saatpagiharidengantingkat F dansaat sore haridengantingkat D.

Hubungan pola asuh orang tua, peran guru, dan lingkungan terhadap kemandirian belajar siswa SMK Jurusan Teknik Bangunan Kabupaten dan Kota Blitar / Amir Aly Dwiyusufiocta Zucsas

 

ABSTRAK Zucsas, Amir AlyDwiyusufiocta. 2016. HubunganPolaAsuh Orang Tua, PeranGuru, danLingkunganterhadapKemandirianBelajarSiswaSMK JurusanTeknikBangunanKabupatendan Kota Blitar. Skripsi, Program Studi S1 PendidikanteknikBangunan, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: (I) Dr. H. Ahmad Dardiri, M.Pd., (II) Drs.Sutrisno, S.T., M.Pd. Kata Kunci: polaasuh orang tua, peran guru, lingkungan, kemandirianbelajar Kemandirianbelajarmerupakansikaptanggungjawabseseorang agar anaktidaktergantungpada orang lain, percayadiriakantugas yang dihadapidanmampumemecahkanmasalahsendiri. Kemandirianbelajardapatditentukanolehpolaasuh orang tuamulaidariperhatian, membimbing, mendidik, mengurus, danmelatihperilakuuntukmembentukkemandirianbelajarpadaanaknya. Peran gurujugapentingdalammembentukkemandirianbelajarsiswadenganmemberikanpengajaran, pendidikan, danbimbingan. Lingkungandisekitarmerupakantempatbelajar yang dapatmempengaruhiperkembangankemandirianbelajarsiswa. Tujuanpenelitianiniadalahuntukmengetahuihubunganpolaasuh orang tuaterhadapkemandirianbelajar, hubunganperan guru terhadapkemandirianbelajar,hubunganlingkunganterhadapkemandirianbelajar, danadaatautidaknyahubunganpolaasuh orang tua, peran guru, danlingkunganterhadapkemandirianbelajarsiswa SMK JurusanTeknikBangunanKabupatendanKota Blitar. Penelitianinimenggunakanrancanganpenelitiandeskriptifkorelasional yang mendeskripsikanhasilpenelitianhubunganpolaasuh orang tua, peran guru, danlingkunganterhadapkemandirianbelajarsiswa. Jumlahrespondensebanyak 220 siswadarikelas X dan XI. Teknikpengambilansampelmenggunakan random sampling. Pengumpulan data menggunakankuisioner. Analisismenggunakandeskriptif, korelasibivariate,dankorelasiganda. Hasilanalisismenunjukkanadahubunganpositifdansignifikanpolaasuh orang tuaterhadapkemandirianbelajardengannilai 0,000<0,05. Adahubunganpositifdansignifikanperan guru terhadapkemandirianbelajardengannilai 0,001<0,05. Adahubunganpositifdansignifikanlingkunganterhadapkemandirianbelajardengannilai 0,000<0,05. Adahubunganpolaasuh orang tua, peran guru, danlingkunganterhadapkemandirianbelajardengannilaisignifikan 0,000<0,005. Berdasarkanhasilpenelitiandisarankan: Pertama,kepada orang tuasiswaperlumeningkatkanpolaasuhnyakarenapolaasuh orang tuaberpengaruhterhadapkemandirianbelajarsiswanya, semakintinggipolaasuh orang tuasemakintinggi pula kemandirianbelajarsiswa.Kedua,kepada guru perlumeningkatkan proses mengajarkarenaperan guru berpengaruhterhadapkemandirianbelajarsiswanya, semakintinggiperan guru mengajarsemakintinggi pula kemandirianbelajarsiswa.Ketiga,lingkungan yang baikberpengaruhterhadapkemandirianbelajarsiswanya, semakintinggilingkungan yang baiksemakintinggi pula kemandiriansiswa.

Fungsi tari Tayub Blitaran dalam upacara adat Siraman Gong Kyai Pradah di Desa Kalipang Kecamatan Sutojayan Kabupaten Blitar / Tegar Anom Sandyaninggar

 

ABSTRAK Anom, Tegar Sandyaninggar. 2015. “Fungsi Tari Tayub Blitaran Dalam Upacara Siraman Gong Kyai Pradah Di Desa Kalipang Kecamatan Sutojayan Kabupaten Blitar”.Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (1) Dra. Ninik Harini, M.Sn, (2) Tri Wahyuningtyas, S.Pd, M.Si. Kata kunci: Tayub, Fungsi, Upacara Adat, Blitar. Tari Tayub blitaran merupakan sebuah karya seni tari Tayub dengan gaya kabupaten Blitar yang berarti memiliki perbedaan dari tari Tayub pada umumnya. Tayub khas Blitar beradaptasi dengan selera masyarakatnya seperti, busana yang digunakan serta iringan musik dan urutan penyajiannya. Tari Tayub tersebut juga dihadirkan dalam rangkaian sebuah upacara adat yang disebut siraman gong kyai Pradah. Dilaksanakan di desa Kalipang kecamatan Sutojayan kabupaten Blitar. Dimungkinkan bahwa tari Tayub Blitaran ini membawa simbol khusus atas kehadirannya dalam rangkaian acara inti upacara adat tersebut. Hal itulah yang membuat peneliti mengkaji lebih dalam mengenai tari Tayub gaya Blitar. Penelitian ini bertujuan untuk mendiskripsikan fungsi tari Tayub Blitaran dalam rangkaian upacara adat siraman gong kyai Pradah. Secara khusus peneliti meninjau langsung dalam fungsi hiburan dan dalam fungsi ritual. Penelitian ini menggunakan jenis penelitian kualitatif. Pengumpulan data dilakukan dengan teknik observasi, wawancara dan dokumentasi dalam bentuk foto. Instrumen penelitian adalah peneliti sendiri. Kegiatan analisis data menggunakan diskriptif kualitatif dengan tahap pengumpulan data, tahap reduksi, tahap penyajian data, serta tahap penarikan simpulan. Pengecekan keabsahan data dilakukan dengan menggunakan triangulasi sumber dan triangulasi metode. Hasil penelitian mengenai fungsi tari Tayub Blitaran dalam upacara adat tersebut, memiliki dua fungsi yaitu: Fungsi ritual Tayub Blitaran sebagai salah satu syarat dari pelaksanaan ritual adat ini, karena berhubungan erat dengan serat kekancingan pusaka gong kyai Pradah juga sebagai komunikasi spiritual kepada leluhur desa Kalipang. Serta fungsi hiburan yang menampilkan kebersamaan antara penari dan penonton pada sesi perayaan selamatan. Struktur penyajiannya diawali dengan tarian waraanggana, bagian tengah gedhok, bagian akhir tayuban, tata busana serta musik pengiring tarian dengan gendhing Blitar kawentar. Kesenia tayub Blitaran dalam upacara Siraman Gong Kyai Pradah ini dianggap penting keberadaannya oleh masyarakat setempat selain sebagai fungsi ritual juga sebagai fungsi hiburan. disarankan sebagai usaha melestarikan kesenian daerah dapat dilakukan penelitian lanjutan sebagai usaha pengembangan pertunjukan Tayub Blitaran, lebih mengapresiasi seni pertunjukan daerah setempat dan memperkenalkan ke daerah lain dalam lingkup yang lebih luas.

Pengaruh pembelajaran berbasis masalah melalui blended learning terhadap hasil belajar biologi siswa SMA Negeri 1 Kepanjen kelas XI / Romi Farada Septiawan

 

ABSTRAK Septiawan, Romi Farada. 2015. Pengaruh Pembelajaran Berbasis Masalah Melalui Blended Learning Terhadap Hasil Belajar Biologi Siswa Sma Negeri 1 Kepanjen Kelas XI. Skripsi. Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Hadi Suwono, M.Si, (II) Dra. Amy Tenzer, M.S. Kata Kunci: Pembelajaran berbasis masalah, blended learning, hasil belajar Berdasarkan hasil observasi yang dilakukan peneliti di SMA Negeri 1 Kepanjen diketahui bahwa hasil belajar siswa masih kurang karena siswa menganggap biologi sebagai pelajaran menghafal tanpa mengerti dan memahami suatu konsep. Penelitian tentang pengaruh pembelajaran berbasis masalah melalui blended learning terhadap hasil belajar siswa perlu dilakukan untuk mengatasi permasalahan tersebut. Salah satu model pembelajaran biologi yang bisa digunakan adalah pembelajaran berbasis masalah melalui blended learning. Pembelajaran ini terdiri dari pembelajaran tatap muka dan pembelajaran online. Melalui pembelajaran tersebut diharapakan dapat meningkatkan hasil belajar siswa kelas XI SMA Negeri 1 Kepanjen. Penelitian ini merupakan penelitian eksperimental semu. Desain penelitian yang digunakan adalah nonequivalent control group design. Artinya, dalam penelitian ini dibagi menjadi tiga kelas, yaitu kelas eksperimen I (Pembelajaran berbasis masalah melalui blended learning), kelas eksperimen II (Pembelajaran berbasis masalah), dan kelas kontrol. Penelitian dilakukan di SMA Negeri 1 Kepanjen dengan kelas eksperimen I kelas XI IPA 3, kelas eksperimen II kelas XI IPA 4, dan kelas kontrol kelas XI IPA 2. Data dianalisis menggunakan uji prasyarat yaitu uji normalitas dan uji homogenitas, kemudian dilanjutkan dengan uji hipotesis menggunakan anakova dan uji lanjut beda nyata terkecil pada SPSS 16.0 for Windows. Berdasarkan hasil penelitian diketahui bahwa (1) pembelajaran berbasis masalah melalui blended learning berpengaruh meningkatkan hasil belajar pengetahuan siswa pada materi sel; (2) pembelajaran berbasis masalah melalui blended learning berpengaruh meningkatkan hasil belajar sikap siswa pada materi sel; (3) pembelajaran berbasis masalah melalui blended learning berpengaruh meningkatkan hasil belajar keterampilan siswa pada materi sel. Berdasarkan penelitian ini disarankan guru perlu menerapkan pembelajaran berbasis masalah melalui blended learning sebagai salah satu alternatif pembelajaran untuk meningkatkan hasil belajar siswa.

Pengembangan paket IPA terpadu berbasis inkuiri dengan tema cahaya sebagai peluang untuk meningkatkan pemahaman konsep siswa SMP kelas VIII semester II / Riski Lutfiani

 

ABSTRAK Lutfiani, Riski. 2016. Pengembangan Paket IPA Terpadu Berbasis Inkuiri dengan Tema Cahaya Sebagai Peluang untuk Meningkatkan Pemahaman Konsep Siswa SMP Kelas VIII Semester II. Skripsi, Program Studi Pendidikan IPA, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (I) Dr. Supriyono Koes H., M.Pd., M.A. (II) Metri Dian Insani, S.Si, M.Pd. Kata kunci: paket IPA terpadu, inkuiri, pemahaman konsep, cahaya Prinsip pembelajaran IPA berdasarkan kurikulum 2013 disarankan dengan menggunakan pembelajaran berbasis discovery/inkuiri. Langkah-langkah inkuiri yang digunakan sangat bermanfaat bagi siswa untuk mengembangkan proses berpikirnya dalam memecahkan masalah. Inkuiri juga terbukti mampu melatih siswa untuk berpikir tingkat tinggi, metakognisi, dan keterampilan proses sains. Sebagai penunjang dalam kegiatan pembelajaran berbasis inkuiri maka diperlukan bahan ajar yang menuntut siswa menemukan konsep melalui metode ilmiah berupa paket IPA terpadu berbasis inkuiri. Tujuan penelitian ini adalah mengembangkan paket IPA terpadu berbasis inkuiri sebagai peluang untuk meningkatkan pemahaman konsep siswa materi cahaya serta mengetahui kelayakan paket pembelajaran yang dikembangkan. Model pengembangan yang digunakan dalam penelitian dan pengembangan ini adalah ADDIE yang meliputi tahap analisis (analysis), perencanaan (design), pengembangan (development), implementasi (impelementation) dan evaluasi (evaluations). Kelayakan dari paket pembelajaran yang dikembangkan dapat diketahui dari uji validasi dan uji coba kelompok kecil. Uji validasi dilakukan oleh dua validator yaitu pertama oleh ahli paket pembelajaran dari dosen Pendidikan Fisika UM dan ahli praktisi lapangan oleh dua guru SMP/MTs. Uji kelompok kecil dilaksanakan dengan melibatkan 12 orang siswa SMP Negeri 2 Tumpang kelas VIII yang telah menempuh materi cahaya. Kriteria kelayakan hasil uji validasi dan uji kelompok kecil untuk tiap angket, yaitu 4,20-5,00 untuk kriteria sangat layak, 3,40-4,10 untuk kriteria layak, 2,60-3,30 untuk kriteria cukup layak, 1,80-3,20 untuk kriteria tidak layak, dan 1,00-1,70 untuk kriteria sangat tidak layak. Hasil pengembangan berupa paket IPA terpadu berisi materi cahaya berbasis inkuiri yang terdiri dari buku pegangan siswa dan buku panduan guru. Setiap topik pada paket pembelajaran ini berisi paparan materi dalam bentuk lembar kerja siswa untuk melakukan percobaan kemudian diakhiri dengan soal evaluasi untuk menguji pemahaman siswa. Hasil uji kelayakan oleh ahli paket pembelajaran dan ahli praktisi lapangan diperoleh skor rata-rata 4,35 untuk buku pegangan siswa, hasil validasi buku pegangan guru diperoleh skor rata-rata 4.26 dan hasil uji kelompok kecil diperoleh skor rata-rata 4,32. Berdasarkan hasil penilaian tersebut maka paket pembelajaran yang dikembangkan telah memenuhi kriteria sangat layak.

Pengembangan sistem informasi pendukung keputusan penggunaan alat inventaris untuk pembelajaran di SMK Negeri 9 Malang / Setyo Bagus Fristanto

 

ABSTRAK Fristanto, Setyo Bagus. 2015. Pengembangan Sistem Informasi Pendukung Keputusan Penggunaan Alat Inventaris untuk Pembelajaran di SMK Negeri 9 Malang. Skripsi. Jurusan Teknik Informatika, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs. Setiadi Cahyono Putro, M.Pd., M.T., (2) I Made Wirawan, S.T, S.S.T., M.T. Kata Kunci: Sistem Informasi, Sistem Pendukung Keputusan, Decision Support System (DSS), Sarana dan Prasarana, Inventaris Sekolah. SMK Negeri 9 Malang merupakan sekolah tinggi yang masih mengadakan pembukuan secara manual dan berkala terhadap alat inventaris sekolah, sehingga pihak sekolah masih merasa kesulitan dalam membuat laporan, pencetakan label inventaris dan pendataan data barang. Dengan adanya sistem informasi ini Kepala Sekolah dapat mengetahui perubahan atau kondisi alat inventaris yang membutuhkan tindakan lebih lanjut dengan memanfaatkan fasilitas sistem pendukung keputusan, selain itu guru menjadi lebih aktif dalam merawat sarana dan prasarana sekolah. Metode penelitian yang digunakan adalah metode penelitian pengembangan. Pengembangan sistem ini merujuk pada model pengembangan waterfall yang terdiri dari 5 tahap pengembangan, yaitu: (1) Analisis kebutuhan, (2) Perancangan sistem dan software, (3) Implementasi dan uji coba unit,(4) Integrasi dan uji coba sistem, dan (5) Operasi dan pemeliharaan. Subyek uji coba pada penelitian ini terdiri dari (1) Kepala Sekolah,(2) Wakil Kepala bidang Sarana dan Prasarana,(3) Guru,(4) Administrator dan (5) Ahli rekayasa perangkat lunak. Hasil yang dicapai dari pengembangan ini adalah tersedianya sistem informasi yang telah diuji validitasnya, sehingga layak digunakan oleh sekolah. Hasil pengujian kepada user Kepala Sekolah diperoleh 12 kelas uji tentang kesesuaian output sistem informasi mendapat persentase 100%, hasil pengujian kepada user Waka Sarana Prasarana diperoleh 11 kelas uji tentang kesesuaian output sistem informasi mendapat persentase 100%, hasil pengujian kepada user Guru diperoleh 7 kelas uji tentang kesesuaian output sistem informasi mendapat persentase 100%, hasil pengujian kepada userAdministrator diperoleh 10 kelas uji tentang kesesuaian output sistem informasi mendapat persentase 100%. Sehingga dapat disimpulkan dari pengolahan data keseluruhan kelas uji diperoleh persentase tingkat kesesuaian output sistem informasi sebesar 100% yang berarti bahwa Sistem Informasi Inventaris yang dikembangkan sudah termasuk dalam kualifikasi valid, secara fungsional sistem sudah dapat menghasilkan output yang diharapkan.

Centralizer dari grup hingga / Kristina Candra Ayu Winarno

 

ABSTRAK Winarno, Kristina Candra Ayu. 2016. Centralizer dari Grup Hingga. Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Indriati Nurul Hidayah, S.Pd., M.Si. Kata Kunci: grup, grup hingga, centralizer, isomorfisma. Jika diketahui grup G hingga dan x∈G, maka C(x)={y∈G│xy=yx} menyatakan centralizer dari x di G. C(x) merupakan subgrup dari G. Himpunan centralizer-centralizer dari x di G yang berbeda dinamakan Cent(G). Banyak anggota dari Cent(G) dilambangkan dengan |Cent(G) |. Grup dengan |Cent(G) | tertentu akan mempunyai karakteristik yang tertentu pula. Pada tulisan ini akan dibahas karakteristik dari grup hingga dengan |Cent(G) |=n dengan n=1,2,3,4.

Penerapan kemampuan menjelaskan untuk meningkatkan motivasi dan hasil belajar biologi siswa kelas X-1 SMA Laboratorium Universitas Negeri Malang / Pipit Maidayanti

 

Kata kunci: strategi penyelesaian konflik, harta warisan, kerabat, taneyan lanjang Tatanan rumah pada pemukiman tradisional Madura, yang lazim disebut taneyan lanjang, adalah salah satu contoh hasil olah budaya yang lebih didasarkan kepada makna yang mendasari pola pemikiran masyarakatnya yang menjunjung tinggi nilai kekerabatan. Taneyan Lanjang merupakan suatu kumpulan rumah yang terdiri atas keluarga- keluarga yang mengikatnya. Satu kelompok rumah terdiri atas 2 sampai 10 rumah, atau dihuni sepuluh keluarga yaitu keluarga batih yang terdiri dari orang tua, anak, cucu, cicit dan seterusnya. Jadi hubungan keluarga kandung merupakan ciri khas dari kelompok ini. Terkait dengan pembagian harta warisan, keberadaan taneyan lanjang justru menjadi indikator kerentanan munculnya konflik antar kerabat. Konflik pembagian harta warisan antar kerabat sulit dielakkan apalagi dalam kehidupan bersama dalam taneyan lanjang, namun dapat dicegah ataupun bila telah terlanjur terjadi dapat diatasi dengan stategi yang tepat. Konflik sendiri bukanlah sesuatu yang harus dihindari. Dengan strategi penyelesaian konflik yang tepat, pihak konflik dapat memperoleh dampak positif terutama terhadap selamatnya hubungan kekerabatan dalam taneyan lanjang itu sendiri. Fokus dalam penelitian ini adalah: (1) Bentuk konflik pembagian harta warisan antar kerabat dalam taneyan lanjang, (2) Motif dan sumber penyebab konflik pembagian harta warisan antar kerabat dalam taneyan lanjang, (3) Pihak-pihak yang terlibat konflik pembagian harta warisan antar kerabat dalam taneyan lanjang, (4) Bentuk-bentuk strategi penyelesaian konflik pembagian harta warisan antar kerabat dalam taneyan lanjang, dan (5) Dampak-dampak yang timbul dari penerapan strategi penyelesaian konflik pembagian harta warisan yang dilakukan antar kerabat dalam taneyan lanjang. Jenis pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif berperspektif etnografi dengan model penelitian studi kasus. Berdasarkan teknik purposive sampling, dipilih tiga orang untuk menjadi subyek penelitian. Adapun metode pengumpulan data yang digunakan adalah: (1) Wawancara mendalam, dan (2) Observasi nonpartisipan. Data yang diperoleh dianalisis secara constant comparative method. Teknik pengecekan keabsahan data yang digunakan adalah: (1) Ketekunan pengamatan, (2) Generalisasi Empiris, (3) Triangulasi sumber dan, (4) Kecukupan referensial. Hasil penelitian yang diperoleh adalah: (1) Bentuk konflik pembagian harta warisan dalam taneyan lanjang terdiri dari dua bentuk konflik yaitu (a) Konflik dengan saudara kandung yang terjadi pada dua subyek penelitian, yaitu pada kasus subyek 1 dan kasus subyek 2. Pada kasus subyek 1, konflik terjadi akibat pengalihan rumah warisan kakek, yang semula ditempati subyek kemudian dialihkan pada kakak subyek. Pada subyek 2, konflik diawali oleh permintaan kakak subyek agar anaknya yang akan menikah menempati rumah peninggalan orangtua mereka yang saat itu ditempati oleh subyek. Adapun subyek diminta untuk pindah dan tinggal bersama saudara yang lain, (b) Konflik dengan keponakan, konflik ini terjadi pada subyek 3, konflik diawali dari gugatan pihak keponakan untuk meminta harta warisan yang telah dihibahkan oleh subyek; (2) Motif dan sumber penyebab konflik pembagian harta warisan antar kerabat dalam taneyan lanjang diinisiasi oleh satu motif yaitu motif penguasaan harta warisan oleh salah satu pihak kerabat yang dalam hal ini bersumber dari faktor (a) Sistem pembagian yang tidak transparan dan cenderung diputuskan secara sepihak, (b) Tidak adanya bukti secara tertulis yang sah secara hukum, (c) Ketidakadilan pembagian warisan; (3) Pihak-pihak yang terlibat dalam konflik pembagian harta warisan dalam taneyan lanjang meliputi (a) Taretan dhalem meliputi ibu, suami, saudara kandung dan paman subyek. Taretan dhalem terlibat pada semua kasus subyek yaitu, pada subyek 1, 2 dan 3, (b) Taretan jau yaitu sepupu empat generasi atau empat pupuan. Taretan jau terlibat pada kasus subyek 3, dalam hal ini ia berperan sebagai pihak penengah konflik dan (c) Oreng lowar kyai dan kepala desa setempat. Oreng lowar terlibat pada kasus subyek 3, yang berperan sebagai pihak saksi pada keputusan hasil rundingan pada kasus subyek 3; (4) Bentuk-bentuk strategi penyelesaian konflik yang digunakan subyek penelitian dalam konflik pembagian harta warisan dalam taneyan lanjang adalah (a) Yielding, dilakukan oleh subyek 1 dengan tujuan untuk menyelamatkan hubungan kekerabatan dengan saudara kandung daripada mempertahankan aspirasinya (b) Contending- withdrawing, terjadi pada subyek 2, pada awalnya kedua pihak saling mempertahankan aspirasi masing-masing, kemudian berakhir dengan dengan saling menarik diri, (c) Contending -problem solving, tahapan ini dilalui oleh subyek 3. Pada awal konflik, kedua pihak saling bersikeras pada aspirasinya masing-masing, namun intervensi pihak ketiga penengah konflik berhasil dilakukan, pada akhirnya dapat diambil keputusan yang dapat diterima oleh kedua pihak yang bertikai ; (5) Dampak-dampak yang timbul dari penerapan strategi penyelesaian konflik pembagian harta warisan dalam taneyan lanjang antara lain dapat (a) Mempererat hubungan kekerabatan, hal ini terjadi pada subyek 3, (b) Keretakan hubungan kekerabatan, hal ini terjadi pada subyek 2, (c) Perubahan sikap yaitu pemisahan ruang dapur, terjadi pada subyek 1 dan 2, dan soker, terjadi subyek 2 dan 3, (d) Kerusakan harta benda, hal ini terjadi pada kasus subyek 2. Saran yang diajukan oleh peneliti adalah: Perlunya mempersiapkan hal kewarisan, pihak terkait dalam hal ini pemilik warisan ataupun pewaris dapat melakukan pencatatan mengenai warisan yang dimilikinya yang sah secara hukum. Adapun pihak pemerintah terdekat, yaitu aparat desa dapat mengkoordinasikan cara-cara pelaksanaan pencatatan yang benar, sosialisasi mengenai pentingnya pencatatan bisa dilakukan dalam program-program musyawarah desa. Sebagai figur yang sangat berpengaruh pada masyarakat Madura, kyai dalam hal ini dapat menjembatani dan memberikan solusi-solusi yang tepat pada kasus-kasus konflik yang terjadi. Keterbatasan dalam penelitian yang hanya sampai pada tujuan deskriptif-interpretif pada strategi penyelesaian konflik dapat dikembangkan dengan penelitian lebih lanjut dan mendalam dengan tujuan kritis untuk mengusahakan transformasi personal dan sosial yang mengarah pada transformasi konflik dengan menggunakan teknik snowball, dengan tujuan dapat memperkaya informasi mengenai informan penelitian.

Software analisis dan desain balok struktur baja berdasarkan SNI 1729-2015 menggunakan bahasa pemrograman fortran / Muhammad Nizar

 

ABSTRAK Nizar, Muhammad. 2016. Software AnalisisdanDesainBalokStruktur Baja berdasarkan SNI 1729-2015 mengggunakan Bahasa Pemrograman Fortran. Skripsi, Program Studi S1 Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Karyadi, M.P., M.T. (II) Ir. Edi Santoso, M.T. Kata Kunci: Analisis, Desain,Balok, ,SNI 1729-2015,Fortran Balokadalahkomponenstruktur yang memikulbeban-bebangravitasi, sepertibebanmatidanbebanhidup (Setiawan, 2008). Padasebuahbangunanbalokberfungsimenahanbebanlantai yang kemudianditeruskankekolom.Dalam pelaksanaannya balok dapat menggunakan berbagai jenis material,namununtukmendapatkankuattarik yang tinggidanmembutuhkanwaktu yang relatifcepatmakabajaadapilihan yang tepat. Denganditerbitkannyapertaturanterbarutentangstrukturbajayaitu SNI 1729-2015 makaperludibuat software yang menerapkan SNI tersebut. Perencanaan yang seharusnyamemakanwaktu lama akanmenjadijauhlebihsingkatdantelitidenganadanya software. FORTRAN atau Formula Translation adalah salah satu bahasa pemrograman yang cukup tua, yang digunakan untuk membuat software. Tujuan dari penelitian ini adalah membuat suatu program yang digunakan untuk analisis dan desain profil WF balok baja berdasarkan SNI 1729-2015 dengan bantuan bahasa pemrograman Fortran. Program digunakan untuk menganalisis dan mendesain balok baja menggunakan profil WF. Analisis yang dimaksud adalah melakukan perhitungan terhadap profil WF apakah baja yang digunkan aman sebagai balok. Sedangkan desain yang dimaksud adalah menentukan profil WF yang aman untuk digunakan pada balok. Hasil analisis perhitungan program dan validasi dengan perhitungan manual (SNI 1729-2002 dan SNI 1729-2015) menunjukkan perbedaan nilai yang sangat kecil 0,9-1, maka dapat disimpulkan program berjalan dengan benar. Hasil desain perhitungan program dapat menghasilkan profil yang aman dan 19%-29% lebih efisien dibandingkan validasi dengan perhitungan manual (SNI 1729-2002).

Pembelajaran matematika dengan strategi REACT untuk memahamkan siswa dalam mempelajari materi luas di kelas III B SD Al Ikhlash Lumajang / Cici Chusnul Khotimah

 

ABSTRAK Khotimah, Cici Chusnul, 2015. PembelajaranMatematikadenganStrategi REACT untukMemahamkanSiswadalamMempelajariMateriLuas di Kelas III SD Al IkhlashLumajang.Tesis. Program StudiPendidikanMatematika, PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. I Nengah Parta, M.Si, (II) Dra. Santi Irawati, M.Pd, Ph.D Kata Kunci: pembelajaranmatematika SD, Relating Experiencing Applying Communicating Transferring(REACT), luas daerah persegi panjang Dari hasilobservasi di kelasIIISekolahDasarAl Ikhlash Lumajangdiperoleh data mengenaipermasalahan yangberkaitandenganpembelajaranyaitusiswa kesulitan pada saat mempelajari materi luas. Pembelajaran hanya menekankan pada hafalan rumus dan mengaplikasikannya pada soal rutin. Siswa tidak diberikan kesempatan untuk menggali informasi untuk menemukan sendiri konsep materi luas daerah persegi panjang dan persegi. Hal tersebut mengakibatkan siswa tidak memahami konsep tentang luas dan kesulitan menyelesaikan permasalahan yang berkaitan dengan materi luas khususnya pada soal non rutin. Olehkarenaitu, rumusanmasalahdalampenelitianiniadalah “bagaimana pembelajaran matematika dengan strategi REACT yang dapat memahamkan siswakelas III SD Al Ikhlash Lumajang dalam mempelajarimateri luas?” Penelitian ini adalah penelitian tindakan kelas yang bertujuan untuk mendeskripsikanlangkah-langkahpembelajaranmatematikamelaluistrategi REACT yang dapatmemahamkansiswakelas III SD Al IkhlashLumajangdalammempelajarimateriluas. Berikut ini adalah langkah-langkahpembelajaranmatematikamelaluistrategi REACT yang dapatmemahamkansiswakelas III SD Al IkhlashLumajangdalammempelajarimateriluas: 1)Relatingdilakukandengancaramemberikancontohsoalmotivasi dan meminta siswamenentukanluaspermukaanbenda-benda di sekitarmereka.2)Experiencing dilakukandengancaramemberi kesempatan siswauntukmenemukansendirikonseptentangluasmelalui pemberian benda manipulatif.Selainitu, siswajugadiberikanpengalamanuntuk menentukan luas benda-benda di sekitarmereka yang berbentukdaerahpersegipanjangataupersegi.3)Applyingsiswadimintauntukmenyelesaikansoalluas yang disajikandalambentuksoalcerita. Siswadiberikankesempatanuntukmenyelesaikansoaltersebutsecaraberkelompok dansecaraindividu. 4) Cooperatingmemberikan kesempatansiswauntuk belajar secaraberkelompok. Poinaktifataupenghargaan lain diberikanpadasiswa untukmembangkitkansemangatkerjasama. 5) Transferringpadapenelitianinidilakukandenganmemberikankesempatansiswauntukmenemukanpola-polasehingga dapatmenentukancaramenghitungluasdengancaraperkalian. Selainitu, siswajugadiberisoal non rutin yang berasaldarisoalolimpiade. Berdasarkan hasil analisa data dari penelitian ini diperoleh informasi bahwa pembelajaran matematika pada materi luas dengan menggunakan strategi REACT dapat memahamkan siswa. Hal ini ditunjukkan oleh rata-rata penilaianaktifitasrelating, experiencing, applying, cooperating, dantransferring siswapadalembarpengamatanaktifitassiswamencapaikriteriatinggi. Skorpengamatanaktifitas guru mencapaikriteriatinggi. Hasil tes akhir siswa, 83% dari jumlah siswa di kelastidak kurang dari KKM yaitu 70.

Penerapan model pembelajaran kooperatif team games Tournament (TGT) untuk meningkatkan motivasi dan aktivitas siswa biologi SMA Negeri 10 Malang / Martha Christina

 

Kata Kunci : Pembelajaran kooperatif model Team Games Tournament (TGT), motivasi belajar, aktivitas belajar Berdasarkan hasil observasi awal dengan guru mata pelajaran biologi kelas XI IPA 3 SMA Negeri 10 Malang diketahui bahwa SMA Negeri 10 Malang menggunakan Kurikulum Tingkat Satuan Pendidikan (KTSP) dan metode yang digunakan sudah bervariasi mulai dari belajar kelompok (10%) dan praktikum (10%), namun guru masih sering menggunakan metode ceramah. 80% peran guru masih dominan dalam proses pembelajaran sehingga siswa menjadi pasif dan tidak terlibat langsung dalam proses belajar mengajar. Berdasarkan pengalaman peneliti selama menjadi guru PPL SMA Negeri 10 Malang, kelas XI IPA 3 menunjukkan bahwa siswa kurang tertarik terhadap pembelajaran biologi. Ketidaktertarikan siswa dapat dilihat dari suasana kelas maupun aktivitas siswa selama kegiatan pembelajaran berlangsung. Siswa sering berbicara sendiri, tidak memperhatikan penjelasan guru, dan bersikap pasif sehingga suasana kelas menjadi gaduh. Hal ini menunjukkan bahwa motivasi belajar siswa rendah sehingga perlu ada variasi model pembelajaran untuk meningkatkan motivasi dan aktivitas belajar siswa. Team Games Tournament (TGT) sebagai salah satu model pembelajaran yang menggunakan pendekatan pembelajaran kooperatif diharapkan dapat memotivasi siswa agar dapat lebih aktif meskipun mereka bekerja dalam bentuk kelompok. Setiap anggota kelompok dalam TGT berjuang demi kelompoknya agar dapat bersaing untuk memperoleh penghargaan sedangkan masing-masing anggota kelompok juga saling mendukung sehingga dengan TGT dapat terjalin kerjasama dan kolaborasi yang baik dan dapat menghindarkan siswa bersikap pasif dalam kelompok. Melalui pembelajaran yang menyenangkan, diharapkan siswa akan lebih termotivasi dalam belajar sehingga secara tidak langsung akan meningkatkan hasil belajarnya. Penelitian ini merupakan penelitian deskriptif, jenis penelitian ini adalah Penelitian Tindakan Kelas yang bertujuan untuk meningkatkan motivasi dan aktivitas siswa SMA Negeri 10 Malang. Penelitian ini dilakukan dalam 2 siklus tindakan yang terdiri dari 4 kali pertemuan. Setiap siklus meliputi tahapan perencanaan, pelaksanaan, observasi, dan refleksi. Subjek penelitian ini adalah siswa kelas XI IPA 3 SMA Negeri 10 Malang semester genap tahun ajaran 2009/2010 yang berjumlah 39 siswa dengan materi Sistem Reproduksi. Pengambilan data dilaksanakan bulan Maret-Mei 2010. Instrumen yang digunakan dalam penelitian ini adalah lembar observasi motivasi siswa, lembar observasi aktivitas siswa, lembar observasi kegiatan guru, dan catatan lapangan. Analisis data dilakukan dengan analisis deskriptif kualitatif dan teknik persentase. ii Hasil penelitian menunjukkan bahwa pembelajaran dengan menggunakan model pembelajaran kooperatif TGT dapat meningkatkan motivasi dan aktivitas siswa biologi SMA Negeri 10 Malang. Hasil pembelajaran dilihat dari keseluruhan aspek motivasi belajar secara klasikal mengalami peningkatan sebesar 11,62% yaitu dari 72,64% pada siklus I menjadi 84,26% pada siklus II. Aktivitas belajar siswa secara klasikal mengalami peningkatan sebesar 22,98% yaitu dari 62,56% pada siklus I menjadi 85,54% pada siklus II. Berdasarkan hasil penelitian, disarankan beberapa hal sebagai berikut: (1) Guru biologi hendaknya menerapkan model pembelajaran kooperatif TGT dalam proses pembelajaran karena dapat meningkatkan motivasi dan aktivitas siswa biologi. (2) Guru yang menerapkan model pembelajaran kooperatif TGT harus dapat lebih merata dalam mengelola kelas sehingga seluruh siswa memperoleh perhatian yang sama dan akhirnya dapat meningkatkan motivasi dan aktivitasnya dalam kegiatan pembelajaran. (3) Guru hendaknya pandai menggunakan waktu dalam pelaksanaan model pembelajaran kooperatif TGT karena model pembelajaran ini membutuhkan waktu yang relatif lama.

Endomorfisma pada semigrup perkalian dari matriks atas lapangan / Lisanatun Kasanah

 

ABSTRAK Kasanah, Lisanatun. 2016. EndomorfismapadaSemigrupPerkaliandariMatriksatasLapangan. Skripsi, JurusanMatematika, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: Dr.rer.nat. I Made Sulandra, M.Si. Kata Kunci: homomorfisma, endomorfisma, semigrupperkalianmatriks, lapangan. MisalkanF adalah suatu lapangan,n∈Zdengan n≥3, danM_n (F) adalah himpunanmatriksberukurann×n atas F. M_n (F)dilengkapi dengan operasi kali (baku) darimatriksmembentuksuatusemigrup, yaituhimpunantidakkosongdengansatuoperasibiner yang asosiatif. Suatupemetaanf:M_n (F)→M_n (F)disebutendomorfismajikauntuksetiapA dan BdiM_n (F)berlaku f(AB)=f(A)f(B). MisalkanP∈GL_n (F),δ:F→F adalah endomorfisma lapangan, θ:F→F adalah endomorfisma semigrup, serta π∶ F→GL_s (F)∪{0} adalah homomorfisma semigrup dengan π(1)=1dan π(0)=0, dan r,s adalah bilangan bulat nonnegatif yang memenuhi r+s≤n. JikauntuksetiapA∈M_n (F), f:M_n (F)→M_n (F) merupakan pemetaan yang didefinisikansatudari lima pengaitanberikut, f(A)=PA^δ P^(-1) f(A)=P((Adj(A) )^T )^δ P^(-1) f(A)=θ(det⁡(A) )PA^δ P^(-1) f(A)=θ(det⁡(A) )P((Adj(A) )^T )^δ P^(-1) f(A)=P[I_r ⨁ π(det⁡(A) ) ⨁ 0] P^(-1) makaf merupakan suatu homomorfisma semigrup. Padaskripsiiniakandikajibeberapapemetaan yang merupakanendomorfismapadasemigrupperkaliandarimatriksataslapangan. Dalampembuktianendomorfismasemigruptersebutdisusunjugabeberapa lemma pendukungbesertapembuktiannya.

Pengembangan modul berbasis potensi daerah Malang kelas IV semester II dengan tema tempat tinggalku / Kardiana Metha Rozhana

 

ABSTRAK Rozhana, Kardiana Metha. 2015. Pengembangan Modul Berbasis Potensi Daerah Malang Kelas IV Semester II dengan Tema Tempat Tinggalku. Tesis. Jurusan S2 Pendidikan Dasar, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Muakibatul Hasanah, M.Pd, (2) Dr. Muhana Gipayana, M.Pd. Kata Kunci : Pembelajaran Tematik, Potensi Lokal, Modul. Permasalahan yang terjadi di SDN Bareng 3 Kota Malang yaitu guru masih memerlukan sumber lain untuk menunjang kegiatan belajar mengajar, bahan ajar dari Kemendikbud masih sedikit menjunjung sifat kontekstual, walaupun sudah ada lembar kerja siswa (LKS) tapi materi masih sedikit dan belum ada muatan lokal, dan penggunaan bahan ajar kurang memperhatikan karakteristik, kebutuhan, dan lingkungan tempat tinggal siswa. Sedangkan dilihat dari segi buku paket dari Kemendikbud pada tema sembilan diketahui beberapa kekurangan yaitu pemetaan Kompetensi Dasar pada buku guru kurang tepat, indikator belum bersifat kontekstual sehingga siswa belum tahu potensi apa yang dimiliki daerahnya, dan materi kurang menunjang pembelajaran. Sedangkan dilihat dari kondisi lapangan yaitu guru belum maksimal mengaitkan materi dengan lingkungan siswa di Daerah Malang. Tujuan dari penelitian dan pengembangan yang akan dilakukan peneliti yaitu menghasilkan modul pembelajaran tematik berbasis potensi Daerah Malang yang memiliki kelayakan dari aspek isi/materi, bahasa, desain, kepraktisan, dan keefektifan. Metode penelitian yang digunakan dalam penelitian ini yaitu metode penelitian dan pengembangan (Research and Development) modifikasi Borg & Gall yaitu: studi pendahuluan dengan melakukan studi pustaka teori dan studi lapangan dari hasil observasi dan wawancara guru dan siswa, perencanaan dengan menganalisis silabus dan jaringan Kompetensi Dasar pembelajaran tematik kemudian menganalisis pembelajaran pada buku paket dan menentukan karakteristik dan lingkungan siswa, pengembangan draf awal merupakan langkah-langkah membuat peta Kompetensi Dasar dan membuat peta konsep materi dalam satu tema, uji ahli meliputi ahli isi/materi, bahasa, dan desain, uji kelompok kecil dilakukan dengan siswa kelas IV sebanyak 10 siswa, uji lapangan terbatas dilakukan sebanyak 30 siswa dalam satu kelas, dan penyempurnaan akhir merupakan perbaikan yang diperoleh dari saran uji coba. Jenis data yang diperoleh dari hasil uji coba produk pengembangan modul berbasis potensi Daerah Malang dibagi menjadi dua jenis yaitu data kuantitatif dan kualitatif. Teknik analisis data yang digunakan meliputi reduksi data, penyajian data, dan penarikan kesimpulan. Instrumen pengumpulan data dalam penelitian ini melalui angket uji ahli isi/materi, bahasa, desain, kepraktisan, dan keefektifan. Modul yang dikembangkan memiliki beberapa spesifikasi yang dilihat dari isi/materi meliputi aspek ekonomi, budaya, teknologi informasi dan komunikasi, ekologi, hasil bumi, kreasi seni, tradisi, budaya, pelayanan, jasa, SDA, dan SDM. dilihat dari spesifikasi desain meliouti gambaran cover, proporsi gambar, dan bentuk tulisan yang digunakan. Spesifikasi bahasa meliputi penggunaan bahasa sesuai dengan ejaan yang disempurnakan (EYD). Hasil analisis data aspek uji isi/materi menunjukkan bahwa aspek isi/materi berkualifikasi sangat layak dan dapat diimplementasikan (88,3%), aspek uji bahasa menunjukkan bahawa aspek bahasa berkualifikasi sangat layak dan dapat diimplementasikan (96,4%), aspek uji desain menunjukkan bahwa desain berkualifikasi layak dan dapat diimplementasikan (73,4%), aspek uji kepraktisan menunjukkan kualifikasi bawa kepraktisan sangat layak dan dapat diimplementasikan (92,4%), dan uji keefektifan menunjukkan bahwa keefektifan menunjukkan kategori efektif (84,7%). Produk modul yang dikembangkan hanya terdiri empat muatan yaitu PPKn, Bahasa Indonesia, IPS, dan IPA pada tema sembilan yaitu Tempat Tinggalku. Modul ini perlu dikembangkan dengan muatan pembelajaran lain yang sesuai dengan tema tersebut. Produk modul ini hanya diuji cobakan sampai uji coba lapangan terbatas, Produk modul ini merupakann contoh pengembangan modul tematik, sehingga dapat dijadikan acuan untuk mengembangkan modul tematik lainnya lainnya.

Analisis penggunaan e-money pada mahasiswa Universitas Negeri Malang / Budi Akbar

 

ABSTRAK Akbar, Budi. 2016. AnalisisPenggunaan E-money PadaMahasiswaUniversitasNegeri Malang.Skripsi, JurusanEkonomi Pembangunan, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (1) Dr. DwiWulandari, S.E., M.M, (2) Thomas Soseco, S.E., M.Sc. Kata Kunci: E-money, Penggunaan, MahasiswaUniversitasNegeri Malang Perkembanganteknologidaninformasimembawaperubahanpadaaspek-aspeksertasendi-sendikehidupanmanusia.Produkuang yang merupakanelemenutamadalamperekonomian pun mengalamiperubahanpesatyang semulahanyaberupauangkertasdanlogamhinggaberubahmenjadipembayaran non tunai yang biasadisebute-money.UniversitasNegeri Malang merupakansalahsatukampuspendidikanternama di Indonesia denganakreditasiAsertaturutaktifdalampengenalane-money kepadamahasiswamelaluikerjasamadenganpihak bank BRI padatahun 2014. Fokuspenelitianiniadalahmengetahuikondisimahasiswa UM dalamkemudahanpenggunaane-moneydalamkehidupansehari-hari, mengetahuiseberapabesarkepercayaanmahasiswa UM bahwasistem yang digunakansesuaidengan yang diharapkan, mengetahuiseberapabesarmanfaatsertaperanproduktersebutdalamtransaksimahasiswa UM menggunakane-money. Penelitianinimenggunakanrancanganpenelitiankualitatifdenganjenispenelitianfenomologi. Data yang digunakandalampenelitianinidiperolehsecaralangsungmelaluikegiatanwawancara, observasidandokumentasi. Hasilpenelitianmenunjukanbahwapenggunaane-moneypadamahasiswa UM berjalandenganbaiknamunmasihkurangdalam proses sosialisasi. Padaaspekkemudahanpenggunaan, e-moneymemudahkanmahasiswadalambertransaksisehari-harimeskipunmasihsebagaialatpembayaransekundersetelahuangtunai.Padaaspekkepercayaan yang diberikanolehmahasiswa UM terhadapproduke-moneycukupbesarkarenainstrumenatauchipdalamperangkat yang merekagunakanbelumpernahmengalamikerusakansertatahan lama bahkanhinggaduatahunpemakaian. Padaaspekmanfaatpenggunaane-moneybagikehidupansehari-harimahasiswa UM dirasacukupberguna, selainbisamenutupikekuranganuangtunaisaatberbelanja juga bisadigunakanpadalebihdarisatumerchantsepertidi beberapa minimarket sekitarkampus UM sertabeberapakantinfakultas. Saran untukUniversitasadalahmelakukantindaklanjutsosialisasikemasing-masingfakultasgunamengunggahminatmahasiswauntukmencobae-moneysehinggapertanyaan yang lebihluasseputarproduke-moneybisadipahamidenganbaik.Sedangkan, saran untukmahasiswaadalahdenganmeningkatkanantusiasmedansikappekaterhadapinformasiterkaitproduk-produkbaruterutamae-money yang menjadisalahsatu agenda khususkampusdalammenciptakanmasyarakatdenganpembayaran non-tunai.

Penyusun sistem informasi pariwisata untuk mendukung promosi objek wisata di Kabupaten Mojokerto / Amelia Pratiwi

 

Kata Kunci: Pariwisata, Sistem Informasi Geografis (SIG) Pariwisata di Kabupaten Mojokerto sangat beragam namun masih memerlukan pengembangan terutama pada objek wisata yang mempunyai potensi dan promosi wisatanya, hal ini dikarenakan informasi tentang objek wisata tersebut masih kurang. Untuk lebih mengembangkan pariwisata di Kabupaten Mojokerto diperlukan suatu informasi yang lebih informatif sehingga dapat memberikan kemudahan bagi wisata- wan. Permasalahan yang dikaji dalam penelitian ini adalah: (1)Apakah penggunaan sistem informasi pariwisata berbasis data spasial dapat membantu inventarisasi objek wisata di Kabupaten Mojokerto? (2)Bagaimana promosi objek wisata di Kabupaten Mojokerto? Penelitian ini bertujuan: (1) Melakukan inventarisasi objek wisata di Kabupaten Mojokerto. (2)Melakukan penyusunan informasi periwisata berbasis data spasial di Kabupaten Mojokerto. Ruang lingkup penelitian ini adalah objek wisata di wilayah Kabupaten Mojo- kerto. Populasi dalam penelitian ini adalah objek wisata yang ada di tiga kecamatan di Kabupaten Mojokerto yaitu Kecamatan Trawas, Kecamatan Pacet, dan Kecamatan Trowulan. Pengambilan sampel dilakukan dengan cara purposive sampling. Pengumpulan data yang digunakan dalam penelitian ini adalah dokumentasi dan ob- servasi. Metode analisis data yang digunakan adalah analisis dengan SIG dan analisis deskriptif. Dalam analisis SIG peta RBI Digital 1 : 25000 terbitan BAKORSUL- TANAL tahun 2001 wilayah Kabupaten Mojokerto didigitasi ulang dan divalidasi dengan menggunakan software arcview 3.3. Peta yang sudah didigitasi ulang dan di- validasi kemudian diberi animasi menggunakan Macromedia flash. Berdasarkan hasil anaisis, objek wisata yang ada di Kabupaten Mojokerto ter- bagi atas objek wisata yang sangat berpotensi, berpotensi, cukup berpotensi dan ku- rang berpotensi. Untuk itu dalam pengembangannya perlu adanya pioritas. Selain itu juga untuk promosi yang ada di Kabupaten Mojokerto perlu adanya penyempurnaan dengan memanfaatkan aplikasi SIG yang menggunakan Arcview dan macromedia flash sehingga dapat disajikan informasi pariwisata yang cepat dan data yang dihasil- kan lebih menarik serta para wisatawan dapat dengan mudah mengakses informasi pariwisata Kabupaten Mojokerto. Saran yang dapat diberikan adalah dalam pengembangan onjek wisata sebaiknya lebih dipioritaskan pada objek wisata yang mempunyai potensi tinggi dan peningka- tan aksesibilitas, akomodasi, pengusahaan daya tarik wisata dan promosi objek wi- sata.

Pengaruh pembakaran pada temperatur 400C terhadapo kuat tekan beton dengan bahan tambahan fly ash dan serbuk batu damping / Abraham Adi Narwastu

 

ABSTRAK Narwastu, Abraham Adi. 2016. Pengaruh Pembakaran pada Temperatur 400°C terhadap Kuat Tekan Beton dengan Bahan Tambah Fly Ash dan Serbuk Batu Gamping. Skripsi, Program Studi S1 Teknik Sipil Fakultas Teknik Universitas Negeri Malang. Pembimbing (I) Drs. Ir. H. Sudomo, M.T. (II) Drs. Wahjo Hendarto Yoh, M.T. Kata Kunci:pembakaran, temperatur, 400°C, kuat tekan, fly ash, serbuk batu gamping, beton. Kuat tekan beton akan terpengaruh oleh panas. Akibat panas, beton akan mengalami retak, terkelupas (spalling), dan kehilangan kekuatan. Guna meminimalisir kehilangan kuat tekan beton, maka penggunaan bahan-bahan alternatif perlu dicoba. Salah satu solusi pemecahan masalah di atas adalah dengan penggunaan limbah abu terbang (fly ash) dan serbuk batu gamping sebagai bahan tambahan yang dapat meningkatkan kuat tekan beton. Tujuan penelitian ini adalah untuk mengetahui pengaruh penambahan fly ash dan serbuk batu gamping dalam menghadapi perubahan temperatur dengan caramembandingkan hasil kuat tekan antara beton normal yang tidak dibakar dan dibakar dengan beton campuran yang tidak dibakar dan dibakar. Metode penelitian yang digunakan adalah metode eksperimental. Penelitian dilakukan dengan melakukan uji kuat tekan pada 40 silinder beton ukuran 15cm x 30cm. Kelompok kontrol adalah 20 beton normal yang tidak diberi tambahan fly ash dan serbuk batu gamping, kelompok eksperimen adalah 20 benda uji yang diberi 25% fly ash dan 15% serbuk batu gamping. Hasil penelitian menunjukkan bahwa terdapat perbedaan kuat tekan beton dalam keadaan tidak dibakar antara beton normal dan beton dengan penambahan fly ash dan serbuk batu gamping, yaitu berturut-turut sebesar 256.65 kg/cm2dan325.85 kg/cm2atau mengalami peningkatan kuat tekan sebesar 26,86% akibat penambahan 25% fly ash dan 15% serbuk batu gamping. Tidak terdapat pebedaan perubahan nilai kuat tekan beton akibat pembakaran antara beton normal dan beton dengan tambahan fly ash dan serbuk batu gamping. Akibat pembakaran pada suhu 400°C selama satu jam, beton normal dan beton dengan tambahan 25% fly ash dan 15% mengalami penurunan nilai kuat tekan sebesar 5,1737% dan 5,1672%.

Uji perkuat balok beton bertulang dengan Glass Fiber Reinforced Polymer (GFRP) akibat beban lentur / Jasmono Budi Santoso

 

ABSTRAK Santoso, Jasmono Budi. 2016. Uji Perkuatan BalokBetonBertulangDenganMenggunkanGlass Fiber Reinforced Polymer (GFRP) Akibat Beban Lentur. Skripsi, Program Studi S1 Teknik Sipil, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I)Drs. AdjibKarjanto, S.T., M.T.(II) Drs. Ir. H. Sudomo, M.M.T. Kata kunci:BetonBertulang, KuatLentur,Perkuatan,Glass Fiber Reinforced Polymer (GFRP), Epoxy (perekat) Beton merupakan material komposit yang terdiri dari beberapa material. Sebagai material komposit, sifat beton sangat bergantung pada sifat unsur masing-masing serta interaksi antar material tersebut. Ada 3 macam campuran yang hasilkan dari bahan-bahan tersebut, yaitu pasta semen, mortar dan beton. Beton bertulang adalah suatu kombinasi antara beton dan baja, dimana tulangan baja berfungsi menyediakan kuat tarik dan beton untuk kuat tekan. Contoh nyata dari aplikasi beton bertulang adalah untuk struktur balok. balok merupakan bagian struktur yang digunakan sebagai dudukan lantai dan pengikat kolom lantai atas. .Sekarang ini telah banyak inovasi yang dilakukan untuk memperkuat suatu stuktur yang mengalami penurunan atau kerusakan akibat pembebanan yang berlebihan juga akibat fungsi bangunan yang berubah dari perencanaan atau desain. kualitas akibat pembebanan yang berlebihan juga akibat usia struktur yang sudah tidak layak lagi. Perkuatan adalah salah satu cara yang dapat dilakukan untuk mengembalikan atau menambah kekuatan struktur yang telah mengalami kerusakan akibat lenturan yang terjadi pada balok tersebut.Tujuandaridilakukanperkuatanadalahuntukmengembalikanataubahkanmeningkatkankemampuanbalokbetonbertulang yang telahmengalamikerusakanakibatbeban yang berlebihdanlenturan yang terjadipadabaloktersebut. Langkahpengujianinidimulaidariuji material, yaituujitariktulanganbaja Ø10 mm dan Ø6 mm danujikuattekanbetonsilinder. Kemudianpengujiandilanjutkandenganujibalokbetonbertulang normal dengandimensi b = 100 mm, h = 150 mm, dan l = 1000 mm dengantujuanmencarikuattekanmaksimal, kuatlentur, danlelehnyatulanganbajasampaibetonretak. BerdasarkanpengujiantersebutbalokbetonmengalamiretaksehinggadilakukanperkuatanmenggunakanGlass Fiber Reinforced Polymer (GFRP) yang kemudianakandiujilagidengantujuanmencaribebanmaksimalsertakuatlenturpadabalokbetonbertulangperkuatan. Hasildaripenelitianmenunjukkanbahwabalok beton bertulang normal BL-1, BL-2, BL-3 mampu menahan beban masing-masing sebesar 37.1 kN, 40.1 kN, 41.1 kN. Sedangkan pada balok perkuatan BP-1, BP-2, BP-3, mampu menahan beban masing-masing sebesar 60.30 kN, 65.50 kN, 68.00 kN. Untuk hasil lendutan maksimum balok bertulang normal BL-1, BL-2, BL-3 masing-masing sebesar 2.12 mm, 2.25 mm, dan 1.59 mm. sedangkan lendutan maksimum pada balok perkuatan BP-1, BP-2, BP-3 masing-masing adalah 2.62 mm, 2.77 mm, 2.77 mm.

Pengembangan pembelajaran konstruktivistik pada mata pelajaran ekonomi / Heni Purwa Pamungkas

 

ABSTRAK Pamungkas, Heni Purwa. 2016. Pengembangan Pembelajaran Konstruktivistik pada Mata Pelajaran Ekonomi. Tesis. Program Studi S2 Pendidikan Ekonomi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Dr. Mit Witjaksono, MS., Ed. (2) Prof. Dr. Hj. Sri Umi Mintarti W, SE., MP., Ak Kata Kunci: Pembelajaran Konstruktivistik, Pembelajaran Ekonomi Ciri utama kurikulum 2013 adalah menganut dasar bahwa pengetahuan tidak dapat dipindahkan begitu saja dari guru ke siswa. Siswa merupakan subjek yang memiliki kemampuan untuk secara aktif mencari, mengolah, mengkonstruksi, dan menggunakan pengetahuan. Berkenaan dengan dasar tersebut, maka pembelajaran yang ideal harus menganut beberapa prinsip seperti yaitu: (1) berpusat pada peserta didik; (2) mengembangkan kreativitas peserta didik; (3) menciptakan kondisi menyenangkan dan menantang; (4) bermuatan nilai, etika, estetika, logika, dan kinestika, dan (5) menyediakan pengalaman belajar yang beragam melalui penerapan berbagai strategi dan metode pembelajaran yang menyenangkan, kontekstual, efektif, efisien, dan bermakna. Penelitian ini merupakan penelitian pengembangan yang bertujuan untuk mengembangkan perangkat pembelajaran konstruktivistik pada mata pelajaran ekonomi. Model pengembangan dilakukan dengan menggunakan model Design Based Research yang terdiri dari 6 fase. Uji coba produk dilakukan melalui tahap uji coba ahli materi, praktisi, dan lapangan (siswa). Hasil penelitian menunjukkan bahwa perangkat pembelajaran konstruktivistik yang dikembangkan sangat layak untuk diujicobakan. Hal ini dapat dilihat dari persentase validasi ahli materi sebesar 98,7% dan validasi praktisi sebesar 87,5%. Selain itu, berdasarkan ujicoba lapangan, persentase respon siswa sebesar 93,33%. Persentase ini dapat diartikan bahwa siswa menyukai pembelajaran konstruktivistik. Saran untuk pengembangan selanjutnya yaitu pembelajaran konstruktivistik dapat dikembangkan untuk materi-materi lainnya. Selain itu, pembelajaran konstruktivistik pada mata pelajaran ekonomi dapat dikombinasikan model pembelajaran lainnya seperti model pembelajaran berbasis masalah, model pembelajaran berbasis proyek, atau model pembelajaran berbasis inkuiri.

Pengembangan modul pembelajaran berbasis penemuan terbimbing materi trigonometri bagi peserta didik kelas X di MAN 3 Malang / Asna Bariroh

 

ABSTRAK Bariroh, Asna. 2015. Pengembangan Modul Pembelajaran Berbasis Penemuan Terbimbing Materi Trigonometri bagi Peserta Didik Kelas X di MAN 3 Malang. Tesis, Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing (1) Dr. Abdur Rahman As’ari, M.Pd, M.A., (2) Dr. rer. nat. I Made Sulandra, M.Si. Kata Kunci: Pengembangan, modul pembelajaran, penemuan terbimbing, trigonometri. Tujuan dari penelitian ini adalah mengembangkan modul pembelajaran berbasis penemuan terbimbing materi trigonometri bagi peserta didik kelas X di MAN 3 Malang yang valid, praktis, dan efektif. Model yang digunakan adalah model 4-D (Four-D Models) yang terdiri dari empat tahap, yaitu:pendefinisian (define), perancangan (design), pengembangan (develop), dan penyebaran (disseminate). Akan tetapi dalam penelitian ini hanya dilakukan tiga tahap pertama, sedangkan pada tahap penyebaran (disseminate) tidak dilakukan karena hasil pengembangan tidak disebarluaskan,melainkan hanya digunakan untuk kepentingan penelitian. Subyek yang digunakan untuk uji coba adalah peserta didik kelas X di MAN 3 Malang tahun pelajaran 2014/2015 yang berjumlah 26 orang. Sedangkan untuk menilai kualitas modul, maka dikembangkan pula rencana pelaksanaan pembelajaran (RPP) dan instrumen penelitian berupa lembar validasi, lembar observasi, angket, dan tes penguasaan hasil belajar (TPHB). Modul berbasis penemuan terbimbing memuat lima kegiatan, yaitu (1) mengamati, (2) menganalisis, (3) membuat kesimpulan, (4) mengomunikasikan, dan (5) mengerjakan latihan soal. Dengan kegiatan-kegiatan yang terdapat dalam modul diharapkan dapat membantu peserta didik untuk belajar lebih mandiri tanpa banyak bimbingan dari guru dan mampu mengonstruk pemahamannya secara mandiri terhadap materi trigonometri. Berdasarkan uji validasi oleh dua orang ahli/ praktisi disimpulkan bahwa modul, RPP, dan instrumen penelitian memenuhi kriteria kevalidan. Untuk menentukan kepraktisan dan keefektifan modul dilakukan uji coba. Kepraktisan modul diperoleh dari hasil observasi aktifitas guru dan peserta didik serta hasil wawancara dengan guru. Sedangkan keefektifan modul diukur dari angket respon peserta didik dan TPHB. Berdasarkan uji kepraktisan dan uji keefektifan, disimpulkan bahwa modul memenuhi kriteria kepraktisan dan keefektifan. Sehingga dapat disimpulkan bahwa modul yang dikembangkan valid, praktis, dan efektif. Saran pembelajaran dengan menggunakan modul ini adalah: (1) guru harus mampu mengatur waktu, karena pembelajaran menggunakan modul ini membutuhkan waktu yang lebih lama, (2) guru perlu memperhatikan secara khusus bagi peserta didik yang berkemampuan rendah. Hal ini dilakukan agar mereka selalu termotivasi untuk ikut terlibat dalam proses pembelajaran.

Pengembangan bahan ajar berbasis cerita untuk menanamkan literasi ekonomi pada siswa sekolah dasar / Bayu Permata

 

ABSTRAK Permata, Bayu. 2016. Pengembangan Bahan Ajar Berbasis Cerita Untuk Menanamkan Literasi Ekonomi Pada Siswa Sekolah Dasar Kelas V. Prodi S2 Pendidikan Ekonomi, Jenjang Magister, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. hari wahyono, M.pd., (II) Dr. H.Cipto Wardoyo, S.E., M.Pd., M.Si., AK, CA. Kata Kunci : Bahan ajar berbasis cerita, Literasi ekonomi Literasi ekonomi adalah sebuah pengetahuan ekonomi yang terkait dengan tingkah laku seseorang dalam melakukan kegiatan sehari-harinya. Salah satu contoh dari literasi ekonomi adalah lebih mengutamakan kebutuhan dari pada keinginan. Pada konteks siswa SD maka siswa bisa diberikan pemahaman untuk mengutamakan kebutuhan daripada keinginan, menyisihkan sebagian uang saku untuk ditabung atau keperluan lain dalam menunjang pendidikannya. Ketika siswa sudah memahami literasi ekonomi, maka siswa diharapkan mampu untuk mengelola keuangannya. Artinya bahwa siswa mampu membuat sebuah keputusan yang sifatnya memenuhi kebutuhan bukan memenuhi keinginan. Salah satu caranya, melalui penggunaan bahan ajar sebagai pembelajaran yang berisi tentang materi literasi ekonomi, konsep yang akan dirancang sesuai kurikulum 2013. Metode yang digunakan untuk pengembangan bahan ajar adalah pendekatan Design Based Research (DBR) yang memiliki ciri khusus yaitu sebuah model penelitian pengembangan produk berdasarkan kebutuhan dan yang dibutuhkan serta melibatkan dan berkolaborasi dengan pengguna hasil pengembangan (praktisi). Pendekatan Design Based Research terdiri dari enam fase, yaitu: (1) mengidentifikasi masalah; (2) merumuskan produk pengembangan; (3) desain dan pengembangan produk; (4) uji coba produk; (5) evaluasi hasil uji coba produk; (6) mengkomunikasikan hasil. Hasil validitas yang diuji oleh ahli rancangan pembelajaran layak digunakan dengan beberapa revisi. Hasil Produk pengembangan yang telah divalidasi oleh ahli telah dilakukan analisis dan hasil analisisnya sebanyak 75,2%, hal ini menunjukkan bahwa rancangan materi dari buku ajar ini masuk dalam katagori layak digunakan dengan catatan direvisi. Adapun beberapa hal yang telah direvisi adalah (1) pada judul perlu dimunculkan untuk siswa sekolah dasar kelas berapa;(2) konsistensi penggunaan huruf perlu dicermati;(3) layout desain cover perlu memperhatikan pusat paragraf. Dari hasil ahli materi produk pengembangan yang telah divalidasi oleh ahli telah dilakukan analisis dan hasil analisisnya sebanyak 78,4% hal ini menunjukkan bahwa rancangan materi dari buku ajar ini masuk dalam katagori layak digunakan dengan catatan direvisi. Adapun beberapa hal yang telah direvisi adalah (1) alur cerita belum tampak;(2) alur cerita ditambah lebih jelas.Dengan demikian bahan ajar cerita bergambar dapat meningkatkan motivasi belajar siswa. Hal ini dibuktikan dengan tingkat presentase angket respon siswa mencapai 78,91% yang termasuk dalam katagori baik. Selanjutnya bahan ajar cerita bergambar dapat meningkatkan pemahaman siswa dalam belajar tentang literasi ekonomi. Hal ini dibuktikan dengan tingkat presentase angket respon siswa mencapai 75,35% yang termasuk dalam katagori baik.

Westernizing, localizing, or thrusting personal "agenda"? a case of English teacher's agency in one Islamic International School in Batu / Panji Agnyoto

 

ABSTRAK Agnyoto, Panji. 2015. Westernizing, Localizing, or Thrusting Personal “Agenda”? A Case of English Teacher’s Agency in One Islamic International School in Batu. Thesis. Program Studi S2 PendidikanBahasaInggris.UniversitasNegeri Malang. Pembimbing: (I) Prof. Dr. YazidBasthomi, M.A. (II) Dr. EkaningDewantiLaksmi, M.A., M.P.d. Kata Kunci: westernizing, localizing, thrusting personal agenda, teacher’s agency, Islamic international school. Budayaseringkalimenjadistandarkebenaranbagi para penganutnya. Dalampembelajaranbahasakeduamaupunbahasaasing, para guru menghadapikendaladalammemutuskanmuatanbudayaantarabudayalokaldenganbudayaasing yang hendakditekankandalampembelajaran. Membawakontenbudayalokaldapatmenguatkanidentitas para siswaatau paling tidakmengurangipotensi ego budayadiantara para siswaataupun guru itusendiri. Namun, fokusterhadapkontenlokaltidakdapatmembantusiswauntukterbukamenerimaperbedaanbudaya yang bisajadiakanmerekaalami di masadepannya. Di sisilain, menekankanpembelajaranpadakontenbudayaasingdapatmemberikanpemahamanperbedaanantarbudayasertadapatmeningkatkankompetensibahasa. Kendatidemikian, kontenbudayaasingdapatmemicupencemaranbudayasertaidentitassiswakarenamemilikiperbedaan yang cukupmencolokdenganbudayalokal. Beberapa guru lainnyamemilihuntukmenekankankeduakontenasingdanlokal. Namun, sejauhmanakeduanyadiintegerasikanmasihmenyisakandilema. Penelitianinibertujuanmelakukaneksplorasiseputarcara guru memanfaatkankontenbudayadalampembelajaranbahasa. Penelitiankualitatifdeskriptifinimembahaskontenbudayadariduaperspektif, tinjauankritisdanlintasbudaya, denganmenggunakandesainstudikasus. Setelahmengumpulkan data melaluiobservasi, interview, dantelaahdokumenresmi, sertamenganalisanya, penelitimenemukanbahwakeduakontenlokalasingdanlokalsama-samadiangkatdalampembelajaran. Namun di saat yang samadipertentangkandenganpenekanan di salahsatusisi yang condongpadaprinsippribadinya. Dari implementasitersebut, jelaslahbahwa guru tidakmenekankanpendekatanlintasbudayadenganmenanamkannegosiasibudaya. Selaintemuantersebut, dinamikakecenderunganbudaya yang diadopsioleh guru tersebut pun cukupnampak di mana guru tersebutmengalamiperubahandalamprilakudanpemikirannya. Perubahantersebutdisebabkanolehfaktor internal daneksternal. Sebagaimanaprinsipdinamika yang terusmengalamiperubahan, sikapinkonsistensiditunjukkandengankonflikprinsippribadidengankeduakontenbudaya, lokaldanasing. Inkonsistensijuganampakdarisikap yang berbedaterhadapsiswaantara di dalamdan di luarlingkungansekolah. Dari temuandandiskusi di atas, guru maupunpenelitidiharapkan, ketikamelakukanpenelitiantindakankelas, tidakhanyamencariteknikpengajaran yang efektif, tapijugamencari model pembelajaranberbasispertimbanganbudayadanidentitas. Hal inipentinguntukdilakukanmengingathasilakhirdarisebuahpembelajaranbukansajadalamaspekkognitifindividusiswasemata, akantetapijugaaspeksosialbudaya. Untukmemahamidinamikaunsurbudayadanimplikasinyadalambidangpendidikan, penilitianberikutnyadiharapkanbisamengangkatunsur-unsur guru dalam proses pembelajaran, pengambilkebijakan di institusisekolahdalam proses satuanpendidikan, maupun orang tuadalam proses penanamanidentitassiswa.

Hubungan Tungkai, kekuatan otot tungkai dan daya ledak otot tungkai dengan kecepatan lari 60 meter (studi pada siswa putra kelas VIII di SMP Negeri 1 Sutojayan Blitar tahun ajarn 2012/2013 / Nitcia Puji Astuti

 

ABSTRAK Astuti, Nitcia Puji. 2013. Hubungan Panjang Tungkai, Kekuatan Otot Tungkai dan Daya Ledak Otot Tungkai dengan Kecepatan Lari 60 Meter (Studi Pada Siswa Putra Kelas VIII di SMP Negeri 1 Sutojayan Blitar Tahun Ajaran 2012/2013).Skripsi, Program Studi Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang.Pembimbing: (1) Dra.Sulistyorini, M.Pd, (2) Drs. Tatok Sugiarto,S.Pd,M.Pd Kata Kunci: Panjang Tungkai, Kekuatan Otot Tungkai, Daya Ledak Otot Tungkai, dan Kecepatan Lari 60 Meter Kekuatan kerja fisik dalam olahraga prestasi merupakan komponen yang sangat penting, demikian halnya dengan atletik khususnya sprint. Kondisi fisik yang baik merupakan salah satu unsur pendukung dalam pencapaian prestasi yang optimal, oleh karenanya peningkatan maupun pemeliharaan merupakan dua aspek yang penting yang dilakukan secara continue dan berkesinambungan meskipun dilakukan dengan sistem prioritas sesuai dengan kekhususan masing-masing cabang olahraga. Kekuatan kondisi fisik merupakan modal utama dalam pencapaian prestasi olahraga. Penelitian ini bertujuan untuk mengetahui ada tidaknya hubungan antara variabel bebas dengan variabel terikat, yaitu panjang tungkai (variabel bebas/X ), kekuatan otot tungkai (variabel bebas /X ), dan daya ledak otot tungkai (variabel bebas/X3) dengan kecepatan lari 60 meter (variabel terikat/Y), baik secara parsial maupun simultan. Penelitian ini termasuk jenis penelitian kuantitatif dengan metode penjelas (explanatory research). Populasi dalam penelitian ini adalah seluruh siswa kelas VIII di SMP Negeri 1 Sutojayan Blitar Tahun Ajaran 2012/2013 yang berjumlah 200 siswa. Sedangkan sampel dalam penelitian ini adalah sejumlah 35 siswa. Hasil pengujian hipotesis menunjukkan bahwa korelasi antara panjang tungkai dengan kecepatan lari 60 meter adalah sebesar 0.224 dengan taraf signifikan 0.046, lebih kecil dari 0.05, hal ini menunjukkan bahwa terdapat hubungan yang erat antara panjang tungkai dengan kecepatan lari 60 meter; korelasi antara kekuatan otot tungkai dengan kecepatan lari 60 meter adalah sebesar 0.33 dengan taraf signifikan 0.32, lebih kecil dari 0.05, hal ini menunjukkan bahwa terdapat hubungan yang erat antara kekuatan otot tungkai dengan kecepatan lari 60 meter; korelasi antara Daya ledak otot tungkai dengan kecepatan lari 60 meter adalah sebesar 0.36 dengan taraf signifikan 0.42, lebih kecil dari 0.05. Hal ini menunjukkan bahwa terdapat hubungan yang erat antara daya ledak otot tungkai dengan kecepatan lari 60 meter; nilai R= 0.738, menunjukkan bahwa terdapat hubungan yang cukup kuat antara panjang tungkai (X1), kekuatan otot tungkai (X2) dan daya ledak otot tungkai (X3) secara bersama-sama terhadap kecepatan lari 60 meter (Y). Peneliti menyarankan beberapa hal diantaranya adalah: (1) Untuk mendukung kemampuan dalam melakukan gerakan olahraga, dibutuhkan latihan kondisi fisik yang bagus. (2) Bagi guru olahraga untuk selalu mendukung kekuatan kondisi fisik siswa, untuk mencapai prestasi lari yang optimal. (3) Peneliti selanjutnya untuk menggunakan populasi dengan lingkup yang lebih luas, mengambil sampel tidak berdasarkan jenis kelamin, serta mengembangkan permasalahan terkait dengan penelitian ini dengan cara menambah variabel yang belum dibahas dalam penelitian ini.

Pengembangan Accounting Board Game (ABG) sebagai media pembelajaran siklus akuntansi perusahaan jasa dan dagang / Nanang Dani Rasidi

 

ABSTRAK Rasidi, Nanang Dani. 2016. Pengembangan Accounting Board Game (ABG) Sebagai Media Pembelajaran Siklus Akuntansi Perusahaan Jasa dan Dagang. Tesis. Jurusan Pendidikan Ekonomi, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Wahjoedi, M.E, M.Pd, (II) Prof. Dr. Sri Umi Mintarti Wijaya, SE. MP.Ak. Kata kunci: gamification, board game, simulasi, pendidikan akuntansi, siklus akuntansi perusahaan jasa, siklus akuntansi perusahaan dagang, permainan edukatif. Penelitian ini bertujuan untuk menghasilkan media pembelajaran Accounting Board Game (ABG) yang layak pakai. ABG dikembangkan dengan latar belakang adanya stereotip bahwa akuntansi itu membosankan, komplek, dan kurang menarik, sulitnya mencari tempat Praktik Kerja Lapangan (PKL) yang sesuai dengan kompetensi, dan kegemaran usia pelajar bermain game. Keterbatasan utama dari penelitian ini adalah dalam mengukur efektifitas media pembelajaran, karena hanya menggunakan Penelitian Tindakan Kelas (PTK), dimana idealnya menggunakan eksperimen dengan kelas kontrol dan pembanding. Penelitian ini merupakan penelitian pengembangan (R&D) dengan menggunakan konsep gamification. Gamification merupakan konsep yang sangat sesuai jika melakukan pengembangan media pembelajaran, dan mentransformasikannya dalam suatu kegiatan berbentuk game. Model pengembangan yang digunakan adalah model hybrid dari Kapp. Model hybrid dipilih karena pendekatan ini sangat sesuai apabila melakukan pengembangan menggunakan konsep gamification. Tahapan pengembangan produk ABG melalui 9 tahapan pengembangan, yang terdiri dari: 1) Menentukan tujuan pembelajaran, 2) Menentukan jenis konten yang akan di ajarkan, 3) Mendesain game, 4) Membuat purwarupa game, 5) Uji perseorangan dan revisi, 6) Uji produk pada kelompok kecil dan revisi, 7) Finalisasi produk, 8) Validasi ahli dan revisi, 9) Implementasi dan revisi akhir. Validasi dilakukan oleh ahli akuntansi, ahli media pembelajaran, dan praktisi/guru. Tahapan implementasi dilakukan di SMKN 1 Bondowoso. Berdasarkan hasil validasi ahli, ABG sangat layak untuk di uji cobakan atau digunakan dalam pembelajaran di kelas. Dari hasil penelitian dapat disimpulkan bahwa ABG sangat menyenangkan, memotivasi. Unsur simulasi dan kompetensi tambahan dalam ABG memberikan kesempatan praktik dan membawa suasana PKL ke dalam kelas. Selain permainan ABG yang atraktif namun juga efektif dalam dalam memberikan perubahan sikap, perbaikan pengetahuan, dan pengembangan keterampilan peserta didik terkait penerapan dari teori dan konsep akuntansi.

Analisis kesalahan siswa kelas VIII SMP pada materi aljabar serta proses scaffoldingnya / Annisa Nur Ramadhani

 

ABSTRAK Ramadhani, AnnisaNur. 2015. AnalisisKesalahanSiswa Kelas VIII SMP pada Materi Aljabar serta ProsesScaffolding-nya. Tesis, Prodi PendidikanMatematika, Pascasarjana, UniversitasNegeri Malang. Pembimbing: (I) Prof. Dr. Ipung Yuwono, M.S, M.Sc, (II) Dr. Makbul Muksar, S.Pd, M.Si. Kata Kunci: analisis kesalahan, aljabar, scaffolding. Saat mempelajari aritmetika siswa hanya mengenal simbol-simbol angka yang mewakili bilangan tertentudanmerekahanyaterfokuspadahasiloperasibilangantersebut. Padahal saat mempelajari aljabar mereka mulai dikenalkan dengan simbol-simbol huruf yang sifatnya abstrak dan lebihditekankanpada pemahaman aspek relasi suatu operasi. Oleh karena itu, saat mulai mempelajari aljabar banyak siswa yang melakukan kesalahan.Kesalahan tersebut harus segera diatasi agar siswamempunyai persiapan yang baik saat mempelajari materi aljabar berikutnya. Sebelum memberikan bantuan kepada siswa untuk menyadari kesalahannya, perlu untuk dianalisis terlebih dahuluhal-hal yang menjadi penyebab terjadinya kesalahan.Salah satu alternatif bantuan yang dapat diberikan kepada siswa ialah scaffolding.Tujuan penelitian ini ialah untuk mendeskripsikan kesalahan-kesalahan siswa Kelas VIII SMP saat mengerjakan soalaljabar, penyebab terjadinya kesalahan, serta proses scaffolding yang sesuai untuk membantu siswa menyadari kesalahannya. Untuk mencari subjek yang akan diberi scaffolding dan diwawancarai, peneliti memberikan soal tes aljabar kepada seluruh siswa Kelas VIIIA dan VIIIB. Peneliti memilih dua subjek pada masing-masing tipe kesalahan. Jawaban yang dituliskan oleh subjekdianalisis menggunakan teknik analisis yang terdiri dari dua kegiatan, yaitu mendaftardugaan-dugaanpenyebabkesalahandanmenyusunrencanametode untukmembuatsiswamenyadarikesalahannyadandapatmenuliskanjawaban yang benardenganmengacupadapedomanscaffolding. Berdasarkanhasilscaffolding, penelitimenetapkanpenyebabkesalahan-kesalahan yang dilakukanolehsiswa. Berdasarkan temuan di lapangan, peneliti mendeskripsikan kesalahan-kesalahan siswaKelas VIII SMP pada materi aljabar. Kesalahan siswa dalam memahami makna variabel yaitu anggapan bahwa variabel adalah sesuatu yang harus dicari nilainya atau variabel sebagai bilangan tertentu. Penyebab kesalahan siswa dalam memahami makna variabel yaitu: (1) kegagalan dalam mengaitkansoal dengan konsep-konsep yang telah dipelajari sebelumnya, (2) ketidakmampuan berimajinasi tentang kemungkinan-kemungkinan nilai variabel, atau (3) kurangnya penguasaan materi aritmetika dasar.Kesalahan-kesalahan prosedural pada materi aljabar yang dilakukan oleh siswa, yaitu: (1) ada suku pada bentuk aljabar yang tidak dikalikan dengan bilangan pengali, (2) hasilpenjumlahanbentukaljabardituliskanberupapenggabungan setiap sukuyang ada, atau (3) penyederhanaan bentuk aljabar secara asal-asalan. Penyebab kesalahan prosedural yang dilakukan oleh siswa yaitu: (1) kegagalan dalam mengaitkan soaldengan konsep-konsep yang telah dipelajari sebelumnya, (2) terpengaruh dengan pengetahuannya saat mempelajari aritmetika, yaitu terfokus pada hasil yang berupa bilangan tertentu (3) ketidaktelitian dalam mengoperasikan bentuk aljabar, (4) kurang menguasai prosedur menyederhanakan bentuk aljabar yang berupa pecahan, (5) tidak mampu memfaktorkan bentuk aljabar.Kesalahan siswa dalam menyelesaikan persamaan linier satuvariabel yaitu tidak “mengubah tanda” saat melakukan “pindah ruas”.Penyebab kesalahan siswa dalam menyelesaikan persamaan linier satu variabel adalah: (1) penggunaan “pindah ruas” tanpa mengecek dengan konsep “pindahruas” yang benar atau (2) kurangnya penguasaan materi aritmetika dasar.Untuk membantu subjek menyadarikesalahannyadandapatmenuliskanjawaban yang tepat, penelitimemberikanscaffolding level 2, yaitu reviewing dan restructuring.Setelahsubjekdiberikanscaffolding, merekasudahtidakmelakukankesalahanlagiatausetidaknyakesalahannyaberkurang. Pada kasus kesalahan dalam memahami makna variabel, subjek sudah mulai mendaftar kemungkinan-kemungkinan nilai variabel namun masih belum dapat membuat kesimpulan. Pada kasus kesalahan prosedural, subjek sudah mampu mengalikan dan menjumlahkan bentuk aljabar namun ketika menyederhanakan bentuk aljabar yang berupa pecahan, mereka mengabaikn syarat bahwa penyebut tidak boleh nol. Pada kasus kesalahan dalam menyelesaikan persamaan linier satu variabel, subjek sudah mampu mendapatkan selesaian dengan tepat.

Analisis buku ajar ... (gaoji hanyu) dengan kurikulum 2013 dan teori antje benedix / Amalia Putri Iriani

 

ABSTRAK Iriani, Amalia Putri. 2016. Analisis Buku Ajar “高级汉语”(Gaoji Hanyu) dengan Kurikulum 2013 dan Teori Antje Benedix. Skripsi, Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang, Pembimbing (I) Dr. Primardiana H.W., M.Pd. Kata Kunci: analisis, buku ajar, buku ajar “高级汉语”(Gaoji Hanyu), Kurikulum 2013, teori Antje Benedix Tujuan penelitian ini adalah untuk mendeskripsikan kesesuaian buku ajar“高级汉语”(Gaoji Hanyu) kelas XII dengan Kurikulum 2013 dan teori Antje Benedix. Kesesuaian buku ajar dengan Kurikulum 2013 dianalisis berdasarkan KI, KD, dan materi pembelajaran yang tercantum dalam silabus bahasa Mandarin kelas XII Kurikulum 2013. Analisis dengan menggunakan teori Antje Benedix (2007) meliputi: (1) organisasi dan struktur bahan ajar; (2) teks-teks dan isi; (3) kosakata; (4) gramatika; (5) aksara Han; dan (6) tipe latihan. Hasil analisis diperiksa keabsahan datanya oleh triangulator sebelum memasuki tahap display data. Hasil analisis dengan Kurikulum 2013 menunjukkan bahwa meskipun sebagian besar materi pembelajaran yang tersaji dalam buku ajar sesuai dengan silabus bahasa Mandarin kelas XII Kurikulum 2013, namun buku ajar “高级汉语”(Gaoji Hanyu) kelas XII tidak menyajikan materi maupun soal latihan yang sesuai dengan topik yang tercantum dalam sebagian besar KD Kurikulum 2013. Hasil analisis dengan teori Antje Benedix juga menunjukkan bahwa buku ajar “高级汉语”(Gaoji Hanyu) kelas XII memenuhi dua aspek dari total enam aspek teori Benedix, yaitu aspek kosakata dan aspek gramatika. Adapun aspek organisasi dan struktur bahan ajar, aspek teks-teks dan isi, aspek aksara Han, dan aspek tipe latihan dari teori Benedix tidak terpenuhi.

Visualisasi komik digital interaktif tentang air zamzam mukjizat Siti Hajar bagi anak SD / Ulfi Nuraini

 

ABSTRAK Nuraini, Ulfi, 2015. Visualisasi Komik Digital Interaktif Tentang Air Zamzam Mukjizat Siti Hajar Bagi Anak SD. Tugas Akhir, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (1) Drs. Didiek Rahmanadji,M.Pd(II) Andy Pramono S.Kom, M.T, Kata Kunci: Visualisasi, Komik Digital Interaktif, Air Zamzam Judul penulisan tugas akhir ini adalah “Visualisasi Komik Digital Interaktif Tentang Air Zamzam Bagi Anak SD. Hal-hal yang melatarbelakangi pembuatan komik digital ini adalah dikarenakan media berupa film animasi 2d yang menyajikan kisah air zamzam masih kurang menarik, besarnya peminat komik di Indonesia, dan tidak adanya keterlibatan pembaca dengan cerita. Dengan menyesuaikan perkembangan zaman, maka dipilihlah media komik digital interaktif dalam memvisualisasikan kisah Nabi Ibrahim tentang “Air Zamzam, Mukjizat Siti Hajar”. Sehingga melalui perancangan ini dapat menghasilkan sebuah produk yang dapat diminati masyarakat khususnya anak-anak. Metode perancangan komik digital interaktif ini menggunakan perancangan prosedural bersifat deskriptif dengan menyusun langkah-langkah pengerjaan yang harus diikuti. Sedangkan proses perancangan terdiri dari tiga tahap, yaitu pra produksi, produksi, dan pasca produksi. Pada tahap pra produksi mencakup skenario, diagram alir, sketsa komik, desain karakter, desain lingkungan, desain tombol, desain interface, dan desain bubble. Tahap produksi mencakup pewarnaan, scripting, audio, dan animasi. Sedangkan tahap pasca produksi mencakup uji coba dan publish. Berdasarkan latar belakang diatas, maka perancangan ini menghasilkan sebuah produk komik digital interaktif tentang air zamzam mukjizat Siti Hajar. Dengan komposisi yang tepat, media ini dapat menjadi media alternatif dalam menyajikan cerita Islami pada anak secara efektif. Selain itu, media pendukung lain yang dihasilkan berupa buku komik cetak, stiker, dan gantungan kunci.

Pelaksanaan model pembelajaran cooperative integrated reading and composition (CIRC) untuk meningkatkan motivasi dan hasil belajar ekonomi siswa kelas X MAN Malang 1 / Sri Wahyuni

 

Kata Kunci: pembelajaran kooperatif model cooperative integrated reading and composition (CIRC), motivasi belajar, hasil belajar. Berdasarkan studi pendahuluan yang telah dilakukan di MAN Malang 1 diperoleh informasi bahwa pembelajaran ekonomi sudah mulai menggunakan variasi bentuk model-model pembelajaran, namun dalam pelaksanaannya masih belum maksimal. Hal ini karena masih ada beberapa siswa yang pasif dan kurang termotivasi selama proses pembelajaran berlangsung, terutama pada siswa kelas XE yang mempunyai indikasi lebih dominan dibanding enam kelas lainnya. Oleh karena itu, peneliti melaksanakan pembelajaran kooperatif model cooperative integrated reading and composition (CIRC) yang dapat memperbaiki proses belajar mengajar di kelas XE tersebut. Pembelajaran kooperatif model cooperative integrated reading and composition adalah strategi pembelajaran dimana para siswa aktif bekerja sama dalam kelompok kecil yang dimulai dengan pembagian kelompok secara heterogen ,pemberian wacana/kliping yang berkaitan dengan materi, berpikir bersama/diskusi, menulis hasil diskusi dan mempresentasikan hasil diskusi. Penelitian ini bertujuan untuk menjawab pertanyaan: (1) Bagaimana pelaksanaan pembelajaran kooperatif model cooperative integrated reading and composition pada siswa kelas XE MAN Malang 1 pada mata pelajaran ekonomi? (2) Apakah pelaksanaan pembelajaran model cooperative integrated reading and composition dapat meningkatkan motivasi belajar siswa kelas XE MAN Malang 1 dalam mata pelajaran ekonomi? (3) Apakah pelaksanaan pembelajaran kooperatif model cooperative integrated reading and composition dapat meningkatkan hasil belajar siswa kelas XE MAN Malang 1 dalam mata pelajarn ekonomi? Subyek penelitian ini adalah siswa kelas XE MAN Malang 1 dengan jumlah 35 siswa. Jenis penelitian yang digunakan adalah penelitian tindakan kelas (PTK) dengan dua siklus. Teknik analisa data yang digunakan untuk hasil belajar digunakan rata-rata nilai hasil tes. Sedangkan instrumen yang digunakan adalah observasi untuk mengetahui motivasi belajar siswa dan observasi kegiatan guru. Hasil belajar diperoleh dengan memberikan tes disetiap akhir siklus. Hasil penelitian menunjukkan bahwa pembelajaran kooperatif model cooperative integrated reading and composition dapat meningkatkan motivasi belajar siswa yang ditunjukkan oleh peningkatan persentase seluruh aspek motivasi belajar siswa yang diamati yaitu 74,05% dengan kategori tinggi pada siklus I meningkat menjadi 85,32% dengan kategori sangat tinggi pada siklus II. Dengan pelaksanaan pembelajaran kooperatif model cooperative integrated reading and composition hasil belajar siswa juga mengalami peningkatan. Hasil belajar dari nilai rata-rata sebesar 79,94 dengan kategori baik pada siklus I i ii meningkat menjadi 86,56% dengan kategori baik sekali pada siklus II, terjadi peningkatan sebesar 8,28%. Adapun saran yang dapat diberikan kepada peneliti selanjutnya adalah: (1) Bagi guru mata pelajaran ekonomi di MAN Malang 1 disarankan untuk melaksanakan pembelajaran kooperatif model cooperative integrated reading and composition sebagai salah satu alternatif pembelajaran di dalam kelas dalam rangka meningkatkan motivasi dan hasil belajar ekonomi siswa, (2) Pelaksanaan pembelajaran kooperatif model cooperative integrated reading and composition hendaknya dilakukan secara bertahap sesuai dengan langkah-langkahnya agar mendapatkan hasil yang optimal, (3) Pelaksanaan pembelajaran kooperatif model cooperative integrated reading and composition hendaknya disesuaikan dengan materi yang akan diajarkan, lingkungan belajar siswa, dan ketersediaan waktu yang cukup, (4) Penelitian ini hendaknya dapat digeneralisasikan ke seluruh kelas X – XII MAN Malang 1.

Pengembangan skenario pembelajaran ekonomi berbasis proyek analitik melalui metode inkuiri-diskoveri di sekolah menengah atas / Achmad Miftachul Huda

 

ABSTRAK Huda, Achmad Miftachul. 2016. Pengembangan Skenario Pembelajaran Ekonomi Berbasis Proyek Analitik Melalui Metode Inkuiri-Diskoveri di Sekolah Menengah Atas, Tesis. Jurusan Pendidikan Ekonomi, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Mit Witjaksono, M.S., Ed, (2) Prof. Dr. Sri Umi Mintarti W., S.E., M.P., Ak. Kata Kunci: Pembelajaran Berbasis Proyek, Inkuiri-Diskoveri, Kemampuan Berfikir Analitik. Memahami permasalahan ekonomi tak hanya dengan mengetahui konsep-konsep dasar ekonomi saja, tapi diperlukan juga kemampuan berfikir analitik dalam memecahkan permasalahan ekonomi, yakni kemampuan untuk merinci/menguraikan suatu keadaan menurut bagian-bagian yang lebih kecil serta mampu memahami antar bagiannya. Dalam menjawab permasalahan ini, peneliti mengembangkan produk berupa skenario pembelajaran ekonomi berbasis proyek analitik melalui metode inkuiri-diskoveri, produk ini merupakan memadukan model pembelajaran berbasis proyek dengan kemampuan berfikir analitik, sedangkan metode inkuiri-diskoveri digunakan untuk menunjuang proses pencarian informasi dalam pengerjaan proyek. Penelitian ini bertujuan untuk menghasilkan produk berupa skenario pembelajaran ekonomi berbasis proyek analitik melalui metode inkuiri-diskoveri. Prosedur pengembangan menggunakan pendekatan Design Based Research (DBR) yang mana terdiri dari 6 tahap, yakni: 1) identifikasi masalah, 2) merumuskan produk, 3) mendesain produk, 4) uji coba, 5) avaluasi kelayakan, 6) mengkomunikasikan hasil. Hasil pengembangan divalidasi kelayakannya oleh ahli dan praktisi. Data hasil validasi ahli, praktisi dan uji coba lapangan akan dijadikan dasar untuk melakukan revisi atau perbaikan skenario pembelajaran ekonomi yang sedang dikembangkan. Untuk tim ahli peneliti melakukan konfirmasi kepada ahli materi pendidikan ekonomi yang mana didapati kelayakannya sebesar 100% dan ahli teknologi pendidikan didapati kelayakannya sebesar 84%, serta dari praktisi didapati sebesar 100%. Data uji coba lapangan berupa hasil penilaian sikap yang mana telah tercapai sebesar 96,5%, hasil penilaian keterampilan yang mana telah tercapai sebesar 94,8%, dan hasil penilaian pengetahuan yang mana telah tercapai sebesar 85,3%. Tak hanya data hasil uji coba lapangan saja, namun peneliti melengkapi data ini dengan lembar respon siswa yang mana peneliti bagi ke dalam tiga tingkat, yakni yang pertama untuk tingkat minat telah tercapai 80,2%, tingkat manfaat telah tercapai 84%, dan yang terakhir tindak lanjut telah tercapai 92,6%. Berdasarkan hasil pengembangan yang telah peneliti kembangkan, terdapat beberapa saran atas pembelajaran ini, antara lain: 1) Pemanfaatan skenario pembelajaran ekonomi berbasis proyek analitik ini perlu dikembangkan lebih lanjut. 2) Materi yang digunakan harus cocok dengan skenario pembelajaran yang dikembangkan. 3) Alokasi waktu yang digunakan harus sesuai dengan kemampuan peserta didik. 4) Pembelajaran perlu diperhatikan kelancaran sarana media elektronik yang inovatif dan kreatif.

Efektifitas penerapan Peraturan Pemerintah No. 46 Tahun 2013 terhadap penerimaan pajak penghasilan badan di Kantor Pelayanan Pajak (KPP) Batu / Tiara Rahma Nastiti

 

ABSTRAK Nastiti, Tiara Rahma. 2015. Efektifitas Penerepan Peraturan Pemerintah No. 46 Tahun 2013 Terhadap Penerimaan Pajak Penghasilan Badan di Kantor Pelayanan Pajak (KPP) Pratama Batu. Tugas Akhir. Program Studi Diploma Akuntansi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Dosen Pembimbing Sulastri S.Pd, MSA. Kata kunci:Peraturan Pemerintah No. 46 Tahun 2013, peningkatan penerimaan pajak. Kontribusi penerimaan pajak dari Pajak Penghasilan Badan pada kelas penerimaan rendah sangat kecil yaitu 5% dari total penerimaan pajak. Oleh karena itu upaya yang dilakukan Pemerintah adalah menerbitkan Peraturan Pemerintah No. 46 Tahun 2013 mengenai pajak penghasilan atas penghasilan usaha yang diterima atau yang diperoleh Wajib Pajak yang memiliki peredaran bruto kurang dari 4,8 milyar dalam setahun, dikenakan 1% dari peredaran brutonya. Teknik pengumpulan data dalam penulisan Tugas Akhir ini adalah observasi, interview, dokumentasi dan metode pustaka. Tugas Akhir ini bertujuan untuk: (1) Untuk mengetahui penerapan Peraturan Pemerintah No. 46 Tahun 2013 di KPP Pratama Batu (2) Untuk mengetahui tingkat efektifitas Peraturan Pemerintah No. 46 Tahun 2013 di Kantor Pelayanan Pajak Pratama Batu. Metode pemecahan masalah yang digunakan adalah dengan cara mengumpulkan data mengenai prosedur pelaksanaan dan menjabarkan data hasil pelaksanaan Peraturan Pemerintah No. 46 Tahun 2013 di KPP Pratama Batu.Data pada penelitian ini meninjau keefektifitasan PP 46 tahun 2013 sebelum dan sesudah diterapkan. Upaya pengenalan PP 46 tahun 2013 adalah sosialisasi, pengenalan melalui media elektronik dan media cetak, penyebaran leaflet. Dari ketiga upaya tersebut, terdapat peningkatan penerimaan pajak selama penerapan PP 46 tahun 2013 dilaksanakan. Realisasi penerimaan pajak sesuai dengan PP no 46 Tahun 2013 sudah melampaui target yang telah ditetapkan. Hal ini karena Kota Batu merupakan Kota Pariwisata sehingga sangat mendukung adanya pengaruh penerapan PP no 46 tahun 2013 dengan semakin bertambahnya penerimaan pajak dari awal penerapan.

Sofware analisis dan desain kolom struktur baja berdasarkan SNI 1729:2015 menggunakan bahasa pemrograman fortran 95 / Danang Prakoso

 

ABSTRAK Prakoso, Danang. 2016. Software AnalisisdanDesainKolomStruktur Baja Berdasarkan SNI 1729:2015 MenggunakanBahasaPemrograman FORTRAN 95.Skripsi, Program Studi S1 Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I)Dr. Karyadi, M.P., M.T.,(II) Ir. Edi Santoso, M.T. Kata Kunci : analisis, desain, FORTRAN,sni 03-1729-2002,sni 1729:2015, software, kolom Analisis perhitungan dan perencanaan untuk kolom struktur baja dapat dihitung menggunakan metode manual ataupun dengan bantuan program komputer.Software untuk analisis dan desain perancangan kolom baja masih menggunakan SNI baja terdahulu yaitu SNI 1729-2002. Maka dari itu dibutuhkan software untuk analisis dan mendesain kolom struktur baja menggunakan SNI baja terbaru, yaitu SNI 1729:2015. Adapun tujuan penulisan skripsi ini adalah membuat suatu program yang digunakan untuk menganalisis dan mendesain kolom struktur baja berdasarkan SNI 1729:2015 dengan bantuan bahasa pemrograman FORTRAN. Program yang dibuatbertujuanuntukanalisisdandesainprofilkolombaja. Perhitungan program untukanalisisyaitubertujuanuntukmenganalisisprofildenganbeban yang sudahdirencanakan, sedangkanuntukperhitungan program desainyaitumenentukanprofilkolombajayang amandigunakandenganbeban yang telahdirencanakan. Kesimpulan dari penelitian iniberupaperbandinganhasilanalisisperhitunganprogram denganperhitungan manualmenggunanakan SNI 1729: 2015, didapatperbedaannilaisekitar 0,99 - 1,039untukperhitungananalisis. Hal inidikarenakanadanyaperbedaanpembulatannilaisaatmenghitungsatuan. Sedangkanuntukperhitungandesain, profil yang didapatdariperhitungan programlebihekonomisdaripadaperhitungan manual, haliniterlihatdariprofil yang didapatdariperhitungan program lebihkecildaripadaperhitungan manual. Selainekonomisdenganperhitungan program akanlebihefisiendidapatprofil yang amandaripadaperhitunganmanual .

Peran ibu rumah tangga dalam kegiatan domestik, produktif dan sosial kemasyarakatan (studi kasus di Desa Banjarjo Kecamatan Padangan Kabupaten Bojonegoro) / Nur Almaida

 

ABSTRAK Almaida, Nur. 2016. Peran Ibu Rumah Tangga Dalam Kegiatan Domestik, Produktif dan Sosial Kemasyarakatan (Studi Kasus Di Desa Banjarjo Kecamatan Padangan Kabupaten Bojonegoro). Tesis Jurusan Pendidikan Ekonomi Pascasarjana Universitas Negeri Malang. Pembimbing (1) Prof. Dr. Sri Umi Mintarti W,S.E.,M.P.,Ak (2) Prof. Dr. Wahjoedi, M.E, M.Pd Kata Kunci: Peran Ibu Rumah Tangga, Pendidikan Ekonomi Keluarga Keluarga adalah unit terkecil masyarakat yang memegang peranan penting dalam proses pendidikan informal. Ibu rumah tangga pekerja sektor informal merupakan anggota keluarga yang memiliki peran dan tanggung jawab ganda terhadap keluarganya, ibu menjunjung tinggi perannya sebagai ibu yang mengurus semua pekerjaan rumah tangga disisi lain ibu juga berperan melakukan kegiatan produktif sebagai upaya meningkatkan kemakmuran keluarga. Gejala ini menarik untuk dikaji secara mendalam terkait perannya dalam kegiatan domestic, produktif dan sosial kemasyarakatan, peran ekonominya dalam memenuhi kebutuhan keluargaserta perannya dalam memberikan pengetahuan pendidikan ekonomi keluarga kepada anak. Penelitian ini termasuk penelitian kualitatif dengan pendekatan studi kasus (case study). Penelitian ini dilakukan di desa Banjarjo Kecamatan Padangan Kabupaten Bojonegoro. Analisa data yang digunakan dalam penelitian ini meliputi: data reduction, data display, conclusing drawing/verivication. Subyek dalam penelitian ini adalah ibu rumah tangga. Prosedur pengumpulan data dalam penelitian ini adalah dengan observasi, wawancara dan dokumentasi. Hasil penelitianmenjelaskan bahwa (1) adanya kerja sama pembagian peran yang setara dan seimbang dalam melakukan kegiatan domestik, produktif dan sosial kemasyarakatan.Penelitian tentang pembagian peran dapat memberikan kontribusi dalam konteks pendidikan informal dilingkungan keluarga, proses pembagian peran memberikan pemahaman-pemahaman secara teoritis dimana pembagian peran tersebut mengajarkan bagaimana mendistribusikan tugas dalam rangka menjaga efisiensi dan keseimbangan system keluarga dan masyarakat. Pembagian peran didalam keluarga juga memberikan kontribusi dalam Konteks pendidikan informal dari segi praktis yaitu melalui proses nyata yang dilakukan ibu rumah tangga dalam membagi peran dalam kegiatan domestik, produktif dan sosial kemasyarakatan. (2) Ibu rumah tangga dalam memberikan pengetahuan pendidikan ekonomi keluarga kepada anak menunjukkan bahwa pemberian pendidikan ekonomi kepada anak melalui keteladanan membuat anak belajar kegigihan ibu dalam bekerja, anak bisa mengetahui cara mengelola usaha, anak bisa mandiri, bertanggung jawab, disiplin dan menerima apa adanya, Penjelasan verbal yang diberikan ibu rumah tangga yang bekerja membuat anak paham dalam penggunaan uang, paham dengan kondisi keuangan keluarga, paham bagaimana susahnya mendapatkan uang, Tuntunan perilaku yang relevan yang di berikan oleh ibu rumah tangga yang bekerja membuat anak terbiasa untuk menabung, selektif dalam pemilihan barang dan terbiasa mengatur uang yang dimiliknya. Berdasarkan hasil penelitian disarankan: (1) ada baiknya IRT tetap menjaga, memelihara dan menghargai hubungan yang sudah terbangun baik antara IRT dengan anggota keluarga ataupun bukan anggota keluarga. (2) bagi ibu rumah tangga yang memberikan pengetahuan pendidikan ekonomi kepada anak sebaiknya tetap mempertahankan untuk tetap memberikan pendidikan ekonomi keluarga kepada anak agar anak terbiasa bijak dalam menggunakan uang. (3) bagi kalangan pemerhati wanita, pemerintah, dinas terkait dan kalangan akademisi dapat memberikan perhatian, dan pendampingan secara konsisten. (4)Bagi Peneliti lain: Ketika peneliti lain ingin melakukan penelitian yang sejenis hendaknya peneliti bisa mengembangkan dan menemukan faktor-faktor lain selain faktor-faktor yang telah di temukan dalam penelitian ini.

Modeling, compositing dan editing film animasi tentang "dampak negatif teknologi komunikasi terhadap remaja" / Mawadatul Setiawan

 

ABSTRAK Setiawan, Mawadatul, 2015.ModelingFilm Animasi 3Dimensi TentangDampak Teknologi Komunikasi terhadap Remaja. Tugas Akhir, Jurusan Seni dan Desain, Fakultas Sastra, Universitas NegeriMalang. Pembimbing: (1) Andy Pramono S.Kom, M.T, (II) Mitra Istiar Wardhana, S.Kom, M.T Kata Kunci:Modeling3D, Teknologi, Komunikasi, Remaja, Film. Modeling Film Animasi 3 Dimensi Dampak Teknologi Komunikasi terhadap Remaja ini ditujukan untuk membentuk kesadaran akan bagaimana masyarakat harus mulai memperhatikan tentang bagaiman hubungan antar manusia yang lain agar memperkecil kesenjangan sosial yang sekarang terjadi di masyarakat. Proses visualisasi film animasi 3 dimensi dampak teknologi komunikasi terhadap remaja ini mempunyai 3 tahap perancangan, yaitu pra produksi, produksi, dan pasca produksi. Sedangkan model perancangan yang digunakan adalah model prosedural yang bersifat deskriptif, yaitu menggariskan langkah-langkah yang harus diikuti untuk menghasilkan produk. Perancangan ini menghasilkan sebuah model 3d untuk animasi 3 dimensi yang menceritakan seorang anak yang sibuk dengan handphone dan acuh terhadap lingkungan sekitar. Dan juga menghasilkan beberapa media pendukung untuk memperkenalkan hasil dari perancangan iniseperti cover dvd, dan cd label yang di desain sesuai dengan hasil dari perancangan visual animasi.

Upaya peningkatan hasil belajar melalui pembelajaran kooperatif TAI dan TGT pada mata pelajaran Pengetahuan Bahan Makanan (PBM) di SMK Hidayatul Mubtadi'in Singosari / Fella Septa Wanda

 

ABSTRAK Wanda, Fella Septa. 2016. Upaya Peningkatan Hasil Belajar Melalui Pembelajaran Kooperatif TAI dan TGT Pada Mata Pelajaran Pengetahuan Bahan Makanan di SMK Hidayatul Mubtadi’in Singosari. Skripsi, Program Studi S1 Pendidikan Tata Boga, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dra. Teti Setiawati, M.Pd, (II): Dr. Rina Rifqie Mariana, M.P. Kata Kunci: model pembelajaran TAI, model pembelajaran TGT, hasil belajar Ketuntasan hasil belajar pada mata pelajaran Pengetahuan Bahan Makanan masih rendah, salah satu faktor penyebabnya karena partisipasi aktif siswa dalam kegiatan pembelajaran kurang. Salah satu metode pembelajaran yang dapat meningkatkan partisipasi aktif siswa melalui pembelajaran kooperatif, diantaranya model Teams Assisted Indovidualized (TAI) dan Teams Games Tournament (TGT). Model TAI mengkondisikan masing-masing anggota kelompok memiliki peran tanggung jawab individu melalui tutor sebaya. Sedangkan model TGT mengutamakan kerjasama kelompok melalui aktivitas belajar dengan permainan. Tujuan dari penelitian ini adalah untuk mengetahui perbedaan peningkatan hasil belajar melalui penerapan model pembelajaran TAI dibandingkan dengan TGT pada mata pelajaran Pengetahuan Bahan Makanan di SMK Hidayatul Mubtadi’in. Jenis penelitian yang dilakukan adalah pre experimental design dengan model one group pretest-posttest design. Penelitian ini melibatkan dua kelas eksperimen dengan penerapan model pembelajaran yang berbeda. Jumlah populasi sebanyak 54 siswa, terdiri 28 siswa kelas eksperimen 1, dan 26 siswa kelas eksperimen 2. Pengumpulan data berupa tes formatif pilihan ganda yang akan dianalisis peningkatannya dan diuji beda dengan t test. Hasil analisis data menunjukkan bahwa terjadi peningkatan hasil belajar pada kedua kelas eksperimen. Peningkatan hasil belajar pada kelas ekperimen 1 melalui model TAI sebesar 20,75, sedangkan pada kelas eksperimen 2 melalui model TGT sebesar 21,77. Ketuntasan belajar kelas TAI 82,2%, dan 76,9% pada kelas TGT. Berdasarkan perhitungan uji perbedaan, diketahui thitung 1,069 < ttabel 2,002, sehingga tidak terdapat perbedaan peningkatan hasil belajar yang signifikan antara model pembelajaran TAI dan TGT pada mata pelajaran Pengetahuan Bahan Makanan di SMK Hidayatul Mubtadi’in.

Hubungan aktualisasi diri dengan kepercayaan diri pada siswa yang mengikuti kegiatan ekstrakurikuler di SMA Darul Ulum 1 unggulan BPP Rejoso-Peterongan Jombang / Irwan Prasetyo

 

Kata kunci: aktualisasi diri, kepercayaan diri, remaja, ekstrakurikuler. Aktualisasi diri merupakan kemampuan individu untuk menggali dan mengembangkan segenap potensi yang dimiliki untuk menjadi diri sendiri dan untuk meningkatkan kualitas hidupnya. Kepercayaan diri merupakan perasaan puas dan yakin akan kemampuan yang dimiliki dan berusaha mengembangkan penilaian positif terhadap diri sendiri dan lingkungan. Kercayaan diri merupakan aspek kepribadian manusia yang berfungsi penting untuk mengaktualisasikan potensi yang dimilikinya. Penelitian ini bertujuan untuk: (1) mengetahui aktualisasi diri siswa yang mengikuti ekstrakurikuler, (2) mengetahui kepercayaan diri siswa yang mengikuti ekstrakurikuler, (3) mengetahui apakah ada hubungan antara aktualisasi diri dengan kepercayaan diri pada siswa yang mengikuti ekstrakurikuler. Subyek penelitian adalah siswa SMA Darul Ulum 1 Unggulan BPP Rejoso-Peterongan Jombang yang mengikuti kegiatan ektrakurikuler, sebanyak 70 siswa sebagai sampel penelitian. Data penelitian diperoleh dengan menggunakan dua skala yaitu Skala Aktualisasi Diri dan Skala Kepercayaan Diri. Tehnik analisis data menggunakan Analisis Diskriptif dan Uji Korelasional Product Moment. Hasil Penelitian menunjukkan bahwa 32 siswa (45,7%) memiliki aktualisasi diri tinggi, 38 siswa (54,3%) memiliki aktualisasi diri sedang dan tidak ada siswa yang memiliki aktualisasi dengan klasifikasi rendah. Serta 15 siswa (21,4%) memiliki kepercayaan diri tinggi, 55 siswa (78,6%) memiliki kepercayaan diri sedang, dan tidak ada yang memiliki kepercayaan diri rendah. Hasil penelitian korelasional Product Moment didapatkan nilai rxy = 0,646 dengan taraf probability sebesar 0,000 (sig < 0,05). Hal ini menunjukkan adanya korelasi positif antara aktualisasi diri dengan kepercayaan diri, yaitu semakin tinggi skor aktualisasi diri siswa maka akan semakin tinggi skor kepercayaan diri siswa. Berdasarkan penelitian tersebut peneliti menyarankan kepada beberapa pihak yaitu: 1) Bagi Sekolah Agar mencari informasi mengenai siswa serta memberikan penguatan-penguatan positif misalnya memberikan beasiswa untuk setiap prestasi yang didapatka, bagi siswa yang memiliki aktualisasi diri dan kepercayaan diri yang rendah bisa menjadi tinggi serta menyusun strategi pembelajaran yang efektif untuk siswa. 2) Bagi Siswa Agar remaja mampu berusaha mengenali diri, lebih mencintai dirinya, memahami dirinya, mulai menyusun tujuan hidup yang yang ingin dicapai. 3) Bagi Orang tua agar mampu motivator dan mencintai anaknya tanpa syarat dan tanpa mebanding-bandingkan dengan orang lain. 4)Bagi Peneliti Selanjutnya diharapkan diharapkan dapat mengadakan penelitian pada subjek yang lebih luas dan menggunakan instrumen pengumpulan data yang lebih beragam.

Identifikasi miskonsepsi siswa SMA pada mata pelajaran ekonomi menggunakan tes diagnostik two-tier multiple choice / Derra Setya Wardany

 

ABSTRAK Wardany, Derra Setya. 2016. Identifikasi Miskonsepsi Siswa SMA pada Mata Pelajaran Ekonomi Menggunakan Tes Diagnostik Two-Tier Multiple Choice. Tesis. Jurusan Pendidikan Ekonomi, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Wahjoedi, M.E, (II) Prof. Dr. Sri Umi Mintarti W, S.E., M.P., Ak. Kata Kunci : Miskonsepsi, Tes Diagnostik Two-Tier Multiple Choice Penguasaan konsep yang benar akan sangat berpengaruh kepada siswa ke depannya. Sebab konsep yang tertanam pada pemikiran siswa itulah yang nanti akan dibawa ke dalam pengaplikasian di kehidupan sehari-hari. Salah satu mata pelajaran yang terkait langsung di kehidupan sehari-hari siswa adalah mata pelajaran ekonomi. Pada mata pelajaran ekonomi khususnya pada tingkat SMA/MA terdapat banyak konsep dan teori ekonomi yang tidak hanya bersifat menghafal kata-kata saja, namun juga terdapat konsep hitungan serta gambar kurva ataupun diagram. Kurikulum 2013 yang saat ini diterapkan di sekolah menitikberatkan pada kemandirian siswa dalam membangun pemahamannya sendiri menjadikan siswa rentan mengalami miskonsepsi pada materi mata pelajaran ekonomi. Terdapat beberapa cara untuk dapat mendeteksi miskonsepsi siswa salah satunya dengan tes diagnostik. Tujuan dari penelitian ini adalah untuk mengetahui bagaimanakah miskonsepsi siswa SMA pada mata pelajaran ekonomi berdasarkan hasil identifikasi menggunakan tes diagnostik Two-Tier Multiple Choice, faktor apa sajakah yang menjadi penyebab terjadinya miskonsespsi siswa SMA pada mata pelajaran ekonomi, serta bagaimanakah solusi pemecahan permasalahan miskonsepi siswa SMA pada mata pelajaran ekonomi. Penelitian ini menggunakan desain penelitian kualitatif dengan lokasi penelitian berada di SMAN 1 Malang. Sumber data peneletian ini merupakan sumber data primer yang diperoleh melalu hasil tes diagnostik dan wawancara. Instrumen tes diagnostik dianalsis menggunakan uji validitas, uji reliabilitas, daya pembeda, tingkat kesukaran soal, dan efektivitas fungsi opsi. Sedangkan hasil wawancara diolah dengan mereduksi data, penyajian data, dan penarikan kesimpulan. Triangulasi sumber dan member check dilakukan untuk mengecek keabsahan data. Hasil dari penelitian ini menunjukkan bahwa: 1) Miskonsepsi siswa SMA pada mata pelajaran ekonomi berdasarkan hasil identifikasi menggunakan tes diagnostik Two-Tier Multiple Choice tergolong dalam kategori sedang. Dimana menunjukkan siswa paling banyak mengalami miskonsepsi pada kategori konsep teori, yakni sebesar 64%. Diikuti oleh kategori persamaan matematis sebesar 14%, kategori grafis kurva sebesar 11%, kategori istilah sebesar 7%, dan miskonsepsi siswa paling sedikit adalah kategori gambar yakni sebesar 4%; 2) Faktor penyebab terjadinya miskonsespsi siswa SMA pada mata pelajaran ekonomi ada tiga, yaitu siswa, guru, dan sumber belajar; dan 3) Solusi pemecahan permasalahan miskonsepi siswa SMA pada mata pelajaran ekonomi adalah dengan meningkatkan kesiapan siswa dalam mengikuti pembelajaran, memperbaiki sistem pembelajaran di kelas dimana ada beberapa hal yang perlu dihindari oleh guru dan yang sebaiknya dilakukan oleh guru, mengecek kembali sumber belajar.

Uji antara hasil belajar menggunakan model pembelajaran inkuiri terbimbing dengan hasil belajar menggunakan model pembelajaran direct instruction pada mata pelajaran Sensor dan Aktuator ditinjau dari segi motivasi tinggi dan motivasi rendah di SMK PGRI 3 Malang / Siti K

 

ABSTRAK Zahro, SitiKholifatuz. 2015. Uji Beda antara Hasil Belajar Menggunakan Model Pembelajaran Inkuiri Terbimbing dengan Hasil Belajar Menggunakan Model Pembelajaran Direct Intructionpada Mata Pelajaran Sensor dan Aktuator Ditinjau dari Segi Motivasi Tinggi dan motivasi Rendah di SMK PGRI 3 Malang. Skripsi. Program StudiPendidikanTeknikElektro. JurusanTeknikElektro. FakultasTeknik. UniversitasNegeri Malang.Pembimbing (I) Drs. Fx. Budi Raharjo, M.Pd, (II) Drs. Hari Putranto. Kata Kunci :InkuiriTerbimbing, Direct Instruction, Hasil Belajar, Motivasi Untuk mencapai kompetensi mengoperasikan sistem sensor pada mata pelajaran sensor dan aktuator ada dua cara yaitu: dengancarasiswadibimbinglangkah per langkahdenganmenerapkan model pembelajarandirect instructiondansiswadibimbinguntukmenemukanpenyelesaianmasalah yang diberikandenganmenerapkan model pembelajaraninkuiriterbimbing. Tujuanpenelitianiniadalahuntuk(1) mengetahuaiadanyaperbedaanantara hasil belajar model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction ditinjau dari segi motivasitinggi;(2) mengetahuaiadanyaperbedaanantara hasil belajar model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction ditinjau dari segi motivasirendah;dan(3) mengetahui adanya perbedaan hasil belajar menggunakan model pembelajaran Inkuiri Terbimbing dengan hasil belajar menggunakan model pembelajaran Direct Instruction. PenelitianinimenggunakanjenispenelitianExperiment dengandesainpenelitianpretest-posttest control group. Populasidalampenelitianiniadalahseluruhsiswakelas X SMK PGRI 3 Malang jurusanElektronika Industritahunajaran 2014/2015.Sampeldalampenelitianiniadalahdarisiswakelas X SMK PGRI 3 Malang, kelas X EI-A sebagaikelaseksperimen yang diberikanperlakuanmodel pembelajaranInkuiriTerbimbingdankelas X EI-B sebagaikelaskontrol yang diberikanperlakuan model pembelajaranDirect Instruction. Dalam penelitian ini sampeldiambilsecaraacak. Pengujianhipotesismenggunakanindependent sample t-test. Hasildalampenelitianiniadalah: (1) terdapat perbedaan antara model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction dari segi motivasi tinggi pada mata pelajaran sensor dan aktuator; (2) terdapat perbedaan antara model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction dari segi motivasi rendah pada mata pelajaran sensor dan aktuator; (3) terdapat perbedaan antara hasil belajar siswa yang menggunakan model pembelajaran Inkuiri Terbimbing dengan hasil belajar siswa yang menggunakan model pembelajaran Direct Instructionpada mata pelajaran sensor dan aktuator.

Pengaruh persepsi konsumen tentang pesan iklan televisi terhadap keputusan pembelian kartu perdana simpati (studi pada mahasiswa sastra Jurusan Seni dan Desain Universitas Negeri Malang) / Adi Setiawan

 

Kata kunci: Pesan iklan, keputusan pembelian Dalam memperkenalkan produk baru sebuah perusahaan akan membuat sebuah iklan yang dapat menarik perhatian masyarakat dan membuat produk tersebut dapat diterima dengan mudah oleh masyarakat. Persaingan yang semakin ketat di dunia pertelekomunikasian sekarang ini sangat ketat dan kompetitif ini membuat pelaku pasar lebih berpacu dan terus bersaing untuk dapat bertahan di dunia bisnisnya. Perusahaan provider telekomunikasi terbesar di Indonesia Telkomsel mengeluarkan produk barunya yang bertema Simpati 5000. Produk ini ditujukan untuk kaum pelajar, maka iklan tersebut dikemas dengan sedemikian rupa agar dapat dengan mudah membuat masyarakat membeli produk tersebut. Tujuan penelitian ini adalah untuk (1) mengetahui pesan iklan kartu perdana simpati terbaru terhadap keputusan pembelian konsumen, (2) mengetahui pengaruh persepsi konsumen terhadap iklan kartu perdana simpati terbaru dalam keputusan pembelian konsumen secara parsial dan simultan. Penelitian ini merupakan penelitian penjelasan atau explanatory research, yaitu penelitian yang menjelaskan hubungan kausal atau hubungan sebab akibat antara variabel-variabel melalui pengujian hipotesa pada data yang sama. Sedangkan berdasarkan tingkat eksplanasi atau penjelasan, jenis penelitian yang digunakan adalah penelitian yang digunakan adalah penelitian asosiatif, yaitu penelitian yang bertujuan untuk mengetahui hubungan atau pengaruh antara dua variabel atau lebih. Populasi yang dipilih adalah seluruh mahasiswa Sastra jurusan Seni dan Desain pengguna kartu Simpati yang ada di Universitas Negeri Malang yang jumlahnya tidak dapat diketahui dengan pasti. Teknik pengambilan sampel penelitian ini menggunakan teknik simple random sampling dengan menggunakan rumus penentuan sampel dari Daniel dan Terrel sehingga didapat sampel sebanyak 100 responden. Analisis data menggunakan regresi berganda dengan bantuan SPSS for Windows Release 16.0 dengan taraf signifikansi 5%. Setelah melalui proses pengolahan data diketahui hasil penelitian menyatakan bahwa sebesar 63% keputusan pembelian kartu perdana simpati dipengaruhi atau dapat dijelaskan secara simultan oelh variabel isi pesan, struktur pesan, format pesan dan sumber pesan, Hasil penelitian ini adalah : (1) Pengaruh iklan (isi pesan, struktur pesan, format pesan, dan sumber pesan) kartu perdana Simpati terbaru kurang berpengaruh dikarenakan model pesan yang kurang mendukung dalam penyampaian isi pesan kartu Simpati terbaru. (2) Pengaruh iklan kartu perdana Simpati yang berpengaruh secara simultan adalah isi pesan dan sumber pesan sedangkan struktur pesan dan format pesan tidak berpengaruh. (3) Dari segi kualitas iklan Simpati yang terbaru cukup baik namun masih banyak kekurangan di dalam iklan tersebut seperti kualitas model iklan yang ditampilkan kurang membuat masyarakat tertarik meskipun model pesan tersebut sedang naik daun. Berdasarkan hasil penelitian ini, saran yang dapat disampakan penulis adalah sebagai berikut : (1) Sebaiknya iklan Simpati 5000 lebih diperbaiki lagi dalam segi struktur pesan, sumber pesan dan format pesannya agar masyarakat mudah memahami dan tertarik dengan iklan Simpati seperti penyampaian iklan yang menarik dan mudah dipahami oleh masyarakat. (2) Dalam menampilkan iklan Simpati 5000 sebaiknya menyisipkan lebih banyak lagi pesan moral kepada masyarakat, tidak hanya menekankan pada hiburan dan promosinya saja melainkan dari segi moral juga harus ditambah. (3) Dalam isi pesan iklan Simpati 5000 sudah baik sehingga masyarakat mudah paham dan mengerti serta tetap mendapatkan kepercayaan dari masyarakat akan produk Simpati. Kebanyakan iklan kartu selular sekarang ini banyak yang membohongi masyarakat sehingga kepercayaan akan iklan juga menurun, apabila tidak dikemas dengan baik maka iklan tersebut mudah dilupakan dan produk tersebut akan ditinggalkan oleh masyarakat.

Penerapan model pembelajaran project based learning untuk meningkatkan keaktifan dan hasil belajar Teknik Mikroprosesor di SMK Muhammadiyah 7 Gondanglegi Malang / Alvin Zuhair

 

ABSTRAK Zuhair, Alvin. 2015. Penerapan Model Project Base Learning UntukMeningkatanKeaktifandanHasilBelajarTeknikMikroposesor Di SMK Muhammadiyah 7 Gondanglegi Malang. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Dr. H. Tri Atmadji Sutikno, M.Pd. (II) Drs. Puger Honggowiyono, M.T Kata Kunci: Project Base Learning, Keaktifan, HasilBelajar Pembelajaran berbasis proyek (PjBL) dilakukan untuk memperdalam pengetahuan dan keterampilan yang diperoleh dengan cara membuat karya atau proyek yang terkait dengan materi ajar dan kompetensi yang diharapkan dimiliki oleh peserta didik.Penelitian tindakan kelas merupakan penelitian yang bersifat reparatif. Jadipenelitiantindakankelasadalahstudisistematisterhadappraktikpembelajarandikelasdengantujuanuntukmemperbaikiataumeningkatkankeaktifanataukualitas proses pembelajarandanhasilbelajarsiswadengantindakantertentu Penelitian ini merupakanpenelitiankualitatif. Penggunaan metode Project Base Learning ini bertujuan untuk meningkatkan keaktifan dan hasil belajar siswakelas X Otrotonik pada mata diklat teknik mikroposesor di SMK Muhammadiyah 7 Gondanglegi Malang yang mempunyai nilai rata- rata dibawah standar kkm. Instrumen penelitian yang digunakan dalam penelitian ini adalahlembarobservasi, lembarpenilaian,dan angket. Hasil dari penelitian ini menunjukkan bahwa Prosetase hasil pengamatan keaktifan belajar siswa pada siklus pertama siklus sebesar 81,5% dan menigkat pada siklus kedua dengan prosentase sebesar 95,4%,selanjutnya siklus ketiga mengalami kenaikan menjadi 100 %. ProsentaseHasilbelajarsiswajugamengalamikenaikansecaraberkalabaik ituhasilbelajarranah pengetahuan, sikap, dan keterampilan. Kesimpulan dari penelitian ini adalah secara umum penerapan metode pembelajaran Project Base Learning untuk meningkatkan keaktifan dan hasil belajar siswa kelas X otrotonik di SMK muhammadiyah 7 Gondanglegi Malang pada mata diklat teknik mikroposesor telah berjalan dengan baik danmenunjukanpeningkatandanhasilbelajaryang baik pula. Saran dari penelitian ini adalah pada proses belajar mengajar di kelas guru harus selalu berinteraksi dengan siswa, karena dengan komunikasi yang baik dapat terjadi timbal balik antara guru dengan siswa. Siswa bisa lebih terbuka kepada guru ketika menghadapi kesulitan dalam proses belajar mengajar. Sehingga siswa dapat lebih aktif selama pembelajaran berlangsung

Pengendalian biaya dan waktu pada pelaksanaan Proyek Pembangunan Gedung Kuliah Bersama (Gedung B) Universitas Islam Malang dengan metode nilai hasil / Beni Prima

 

ABSTRAK Prima,Beni. 2015. Pengendalian Biaya dan Waktu pada Pelaksanaan Proyek Pembangunan Gedung Kuliah Bersama atau Gedung B Universitas Islam Malang dengan Metode Nilai Hasil. Pembimbing: (1) Drs. Made Wena, M.Pd.,M.T, (II) Drs. Ir. Sudomo, M.MT. Kata Kunci: metode nilai hasil, pengendalian biaya, pengendalian waktu, Malang Metode Nilai hasil merupakan suatu metode pengendalian biaya dan waktu yang dapat digunakan untuk memberikan informasi mengenai status kinerja proyek pada suatu periode pelaporan, memberikan informasi prediksi biaya yang dibutuhkan, memberikan informasi prediksi waktu untuk penyelesaian seluruh pekerjaan berdasarkan indikator kinerja saat pelaporan, biaya aktual yang telah diserap suatu pekerjaan, informasi variansi biaya dan jadwal yang mencerminkan adanya under run (lebih cepat dan lebih murah) atau over run (lebih lambat dan lebih mahal). Penelitian ini dilaksanakan dengan tujuan untuk menganalisis beberapa hal yang mencakup ACWP (Actual Cost Work Performanced), BCWP (Budgeted Cost Work Performanced), BCWS (Budgeted Cost Work Schedule). Penelitian ini menggunakan rancangan penelitian kuantitatif. Data penelitian yang berupa progres pelaksanaan proyek selama pelaporan. Pengumpulan data dilakukan dengan melakukan observasi dan dokumentasi secara langsung dengan kontraktor yang bersangkutan dan mengumpulkan data laporan pengawasan dari konsultan pengawas proyek. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, tahap analisis data, serta tahap pembahasan data. Berdasarkan hasil analisis data yang dilakukan, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, biaya pelaksanaan proyek (EAC) yang didapatkan adalah sebesar Rp. 9.028.681.000,00dibanding dengan nilai kontrak sebesar Rp. 8.837.501.000,00. Kedua, waktu penyelesaian proyek mengalami keterlambatan selama 21 hari kalender setelah adanya adendum sehingga total keseluruhan pelaksanaan yang awalnya 272 hari kalender menjadi 293 hari kalender. Ketiga, berdasarkan simpulan pertama dapat diketahui bahwa kontraktor pelaksana mengalami kerugian sebesar Rp. 191.181.000,00.

Pengaruh dana pihak ketiga dan penawaran kredit terhadap fungsi intermediasi keuangan perbankan (studi kasus pada bank yang listing di BEI tahun 2007-2009) / Dewi Rositasari

 

Kata Kunci : Dana Pihak Ketiga, Penawaran Kredit dan Intermediasi Penelitian ini dilatarbelakangi dengan pemikiran bahwa bank masih belum optimal melakukan fungsi intermediasi keuangannya. Jumlah dana masyarakat yang berhasil dikumpulkan oleh perbankan tidak seluruhnya dapat disalurkan ke bentuk kredit Oleh karena itu pihak bank mengelola dana tersebut untuk disalurkan sesuai dengan permintaan dari masyarakat. Penelitian ini bertujuan untuk mengetahui pengaruh dana pihak ketiga (X1) dan penawaran kredit (X2) terhadap fungsi intermediasi keuangan perbankan (Y). Jenis penelitian ini adalah penelitian kuantitatif yaitu metode penelitian yang berlandaskan pada filsafat positivisme, digunakan untuk meneliti pada populasi atau sampel tertentu dan analisis data bersifat kuantitatif dengan tujuan untuk menguji hipotesis yang telah ditetapkan. Sampel yang digunakan dalam penelitian ini berjumlah 18 bank dari 30 bank sebagai populasi penelitian. Metode pengumpulan data yang digunakan dalam penelitian ini adalah metode dokumentasi yang merupakan metode dengan cara mengumpulkan dokumendokumen yang berupa catatan-catatan, grafik, gambar, dan lain sebagainya yang digunakan untuk memperoleh data yang berkaitan dengan gambaran umum perusahaan. Data tersebut meliputi laporan keuangan yang dipublikasikan oleh masing-masing bank dan data yang dipublikasikan oleh Bank Indonesia selama periode 2007-2009. Analisis data menggunakan uji asumsi klasik yaitu uji normalitas, uji multikolinieritas, uji heterokedastisitas dan uji autokorelasi serta menggunakan analisis regresi linier berganda dengan uji regresi secara parsial (uji t) dan uji regresi secara simultan (uji F). Pengolahan data yang dilakukan peneliti dibantu dengan program SPSS 17 For Windows. Hasil Penelitian ini dapat disimpulkan bahwa dana pihak ketiga secara parsial tidak berpengaruh terhadap intermediasi keuangan perbankan dengan tingkat signifikansi variabel dana pihak ketiga sebesar 0,291 > 0,05 sehingga Ha ditolak dan Ho diterima, sedangkan penawaran kredit secara parsial berpengaruh terhadap intermediasi keuangan perbankan dengan tingkat signifikansi 0,039 < 0,05 sehingga Ho ditolak dan Ha diterima. Tetapi secara simultan kedua variabel tersebut yaitu dana pihak ketiga dan penawaran kredit berpengaruh terhadap intermediasi keuangan perbankan dengan tingkat signifikansi 0,012 < 0,05 sehingga Ho ditolak dan Ha diterima. Berdasarkan kesimpulan diatas, penulis dapat mengimplikasikan bahwa untuk meningkatkan fungsi intermediasi keuangannya, maka bank dapat menambah penawaran kredit meskipun harus mengubah struktur modal. Apabila penambahan kredit tidak diimbangi dengan kenaikan penawaran kredit yang dilakukan oleh pihak bank, maka intermediasi keuangan perbankan tidak dapat berjalan dengan baik.

Pengembangan bahan ajar ekonomi berbasis nilai budaya Jawa untuk siswa SMP / Siti Maimunah Purnamasari

 

ABSTRAK Purnamasari, SitiMaimunah. 2016. PengembanganBahan Ajar EkonomiBerbasisNilaiBudayaJawaUntukSiswa SMP. Tesis. Program StudiPendidikanEkonomi, PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. HariWahyono, MPd, (II) Dr. DwiWulandari, S.E, M.M Pengaruh globalisasi yang masuk ke dalam diri tiapsiswa Indonesia begitukuat, sehinggamembuatbanyakgenerasimuda Indonesia seakan-akankehilanganjatidiri. Dari waktukewaktu, para generasipenerus bangsaterlihat lupa akankepribadianbangsa. Tingkah laku yang ditunjukan para generasipenerusbangsatidakmencerminkanperilakubangsa Indonesia. Arusglobalisasi yang terjadisekarangini, melumpuhkansendi-sendibangsauntukmaudangiatmempelajaridan mengamalkan nilai-nilai yang terkandungdalambudayabangsa. Penelitianinibertujuanuntukmenghasilkanprodukberupabahan ajar ekonomi yang berbasisnilai-nilaibudayajawa. Dimanasiswanantinyadapatmempelajariilmuekonomitanpameninggalkannilaibudaya yang ada di daerahnyadanmemilikisikapbijakdalamberekonomi. Penelitianinimerupakanpenelitianpengembangan. Pengembangan yang digunakandalampenelitianinimenggunakan model pengembangan DBR (Design Based Research).Metodepenelitianinidigunakanuntukmenghasilkanproduktertentu, danmengujikeefektifanproduk yang dihasilkan. Terdapat 6 fasedalampenelitianini, yaitu: 1)Identifikasimasalah 2) Merumuskanprodukpengembangandanberkolaborasidenganpraktisi, 3) Desain&pengembanganbahan ajar ekonomiberbasisnilaibudayaJawa, 4) Ujicobaprototipepembelajaran, 5) Evaluasikelayakanprototipepembelajaran, 6) Penyempurnaanprototipedanmengkomunikasikannya. Ujicobadilakukankepada 35 siswa SMP danujiahlidilakukanolehahlimateridanahlimedi. Hasilpenelitiandariangketvalidasiolehpakarahlimateridanahlimedia sertatanggapan guru bahan ajar mendapatkanpresentase 85% dandinyatakanlayak, untukselanjutnyadigunakandalampembelajaran. Dari hasilpembelajaran di dalamkelasdapatdilihatbahwapengembanganpembelajaranekonomiberbasisnilaibudayaJawatelahmampumemberikanpengetahuandanmenambahkanwawasansertaaktualisasipadadirisiswa. Kata kunci:pengembanganbahan ajar, bahan ajar ekonomi,nilaibudayaJawa

Analisis kebutuhan ruang parkir pada pasar tradisional Kota Malang / Firda Pradika Darmayanti

 

ABSTRAK Darmayanti, Firda, Pradika. 2014. Analisis Kebutuhan Ruang Parkir Pada Pasar Tradisional Kota Malang. Skripsi, Program Studi S1 Pendidikan Teknik Bangunan, Jurusan Teknik Sipil, Fakultas Teknik Universitas Negeri Malang. Pembimbing (I) Pranoto, S.T., M.T., (II) Drs. Boedi Rahardjo, M. Pd, M.T. Kata Kunci: Kebutuhan ruang parkir, Pasar Tradisional. Pasar tradisional merupakan fasilitas umum yang mempunyai daya tarik cukup besar bagi masyarakat karena erat kaitannya dengan proses pemenuhan kebutuhan harian, di mana kegiatan tersebut akan menimbulkan tarikan perjalanan yang menyebabkan pemusatan pengunjung. Maka salah satu permasalahan yang muncul adalah perparkiran. Semakin banyak pengunjung yang datang, maka semakin besar kebutuhan ruang parkir. Tujuan dari penelitian ini adalah mengetahui karakteristik parkir yang meliputi volume parkir, akumulasi parkir, durasi parkir, angka pergantian parkir (parking turn over) dan indeks parkir, dan mengetahui kebutuhan satuan ruang parkir (SRP)kendaraan bermotor pada pasar tradisional kota Malang. Hasil penelitian menunjukkan bahwa karakteristik parkir: 1) Volume parkir tertinggipasar Bunulrejo: mobil 92 kend dan sepeda motor 886 kend, pasar Madyopuro: mobil 188 kenddan sepeda motor 992 kend, pasar Merjosari: mobil 182 kend dan sepeda motor 1744 kend. 2) Akumulasi maksimum pasar Bunulrejo: mobil 19 kend pukul 07.00-08.00 WIB dan sepeda motor 311 kend pukul 06.00-07.00 WIB, pasar Madyopuro: mobil 85 kend pukul 06.00-07.00 WIB dan sepeda motor 424 kendpukul 06.00-07.00 WIB, pasar Merjosari: mobil 71 kendpukul 07.00-08.00 WIB dan sepeda motor 732 kend pukul 06.00-07.00 WIB.3) Durasi rata-rata 30-60 menit. 4) Angka pergantian parkir tertinggi mobil 4,60 kend/SRP dan sepeda motor pada pasar 3,18 kend/SRP. 5) Indeks parkir mobil ≤ 100% dan sepeda motor ≥ 100%. Kebutuhan satuan ruang parkir berdasarkan LAT adalah parkir mobil pasar Bunulrejo 0,46 SRP/100 M2, Madyopuro 1,62 SRP/100 M2 dan Merjosari 0,91/100 M2 . Parkir sepeda motor pasar Bunulrejo 7,54 SRP/100 M2, Madyopuro 8,09 SRP /100 M2 dan Merjosari 9,33 SRP/100 M2. Sedangkan berdasarkan LAE/100M2: parkir mobil pasar Bunulrejo 0,51 SRP/100 M2, Madyopuro 1,84 SRP/100 M2 dan Merjosari 1,00 SRP/100 M2. Parkir sepeda motor pasar Bunulrejo 8,27 SRP/100 M2, Madyopuro 9,17 SRP/100 M2 dan Merjosari 10,36 SRP/100 M2. Kebutuhan lahan parkir pada pasar Bunulrejo untuk mobil minimal2,7% dan maksimal 5,7%, sepeda motor minimal 6,8% dan maksimal11,3%. Pasar Madyopuro untuk mobil minimal 12,4% dan maksimal 20,2%, sepeda motor minimal 7,9% dan maksimal12,2%. Pasar Merjosari untuk mobil minimal 6,7% dan maksimal 11,4%, sepeda motor minimal 9,0% dan maksimal 13,9%. Berdasarkan hasil penelitian tersebut saran yang dapat diberikan adalah petugas parkir lebih aktif dalam merapikan kendaraan, pembuatan marka parkir, dan dipisahkan tempat parkir antara pedagang dan pembeli, dan diperlakukan tarif progresif.

Profil pendidikan ekonomi keluarga miskin / Rahmawati

 

ABSTRAK Rahmawati. 2016. Profil Pendidikan Ekonomi Keluarga Miskin. Tesis. Program Studi Pendidikan Ekonomi, Pascasarjana Universitas Negeri Malang Pembimbing (I) Dr.Hari Wahyono,M.Pd dan Pembimbing (II) Dr.Agung Haryono S.E, M.P.Ak Kata Kunci : Pendidikan Ekonomi, Keluarga Miskin Keluarga adalah lembaga pertama dalam melaksanakan pendidikan pada anak. Keluarga memberikan pengaruh pada pembentukan watak dan kepribadian anak yang penting bagi perkembangan anak. Pendidikan ekonomi di lingkungan keluarga penting adanya dalam menumbuhkan nilai dan perilaku berekonomi secara rasional di setiap anggota keluarga. Pengasuhan orang tua merupakan peletak dasar perkembangan dan pembentukan pribadi seorang anak untuk mampu hidup secara mandiri dalam kehidupan sehari-hari, tentunyakemandirian seorang anak terlihat dari kemampuannya melakukan kegiatan sehari-hari didalam rumah. Penelitian ini termasuk penelitian kualitatif dengan pendekatan fenomenologi.Bertujuan mendeskripsikan gambaran realitas sosial dan pemaknaan subjektif informan terteliti terhadap pengalaman-pengalaman yang terkait dengan pendidikan ekonomi dalam lingkungan keluarga miskin. Subjek penelitian ini berjumlah 6 informan yakni orang tua dari berbagai tingkat pendidikan dan latar belakang penghasilan keluarga. Teknik pengumpulan data dalam penelitian ini adalah dengan observasi partisipasif, observasi non partisipasif,wawancara dan dokumentasi. Berdasarkan hasil studi penelitian diperoleh temuan 1) cara memperoleh penghasilan keluarga miskin per/hari ataupun per/minggu dengan memanfaatkan tabunganpribadidi rumah(uang yang sengaja disisihkan dari sisa pengelolaan penghasilan), memanfaatkan hasil panen untuk memenuhi kebutuhan keluarga sehari-hari dengan menjualnya sesuai dengan kondisi pembiayaan pengeluaran kebutuhan,memanfaatkan hasil panen berikutnya dengan melakukan peminjamandisertai perjanjian pelunasan, 2) pengelolaan penghasilankeluarga yang paling utama antara lain untuk kebutuhan pembiayaan sekolah anak, selanjutnya kebutuhan konsumsi keluarga dan kebutuhan sosial, 3) pelaksanaan pendidikan ekonomi anak selalu beriringan dengan kondisi aktivitas orang tua, adanya keterbukaan keuangan keluarga, adanya perintah pembiasaan rajin menabung dan pembiasaan berhemat dari orang tua, adanya pitutur (nasehat) dari orang tua dalam ketelitian memanfaatkan uang untuk membeli barang secara selektif, dan membeli barang untuk kegunaan secara jangka panjang. Berdasarkan hasil temuan penelitian, maka disimpulkan,1)Pengalaman orang tua keluarga miskin dalam memperoleh penghasilan, penghasilan yang diperoleh dalam seminggu hanya 3 hingga 4 hari kerja. Perolehan penghasilan yang diperoleh hari ini hanya akan mencukupi kebutuhan untuk hari ini dan esok hari, 2)Pengalaman orang tua keluarga miskin dalam mengelola penghasilan keluarga, difokuskan pada tiga pembiayaan kebutuhan, yaitu pembiayaan kebutuhan sekolah anak, kebutuhan pembiayaan konsumsi keluarga, dan pembiayaan kebutuhan sosial dan 3) Proses pendidikan ekonomi keluarga miskin, yaitu arahan, nasehat dan contoh nyata dari orang tua. Dalam aktifitasnya, dalam membelajarkan pendidikan ekonomi cenderung tidak terjadwal dan bergantung pada aktifitas yang sedang berlangsung, seperti aktifitas pada pagi hari adanya nasehat untuk menabung (uang saku), untuk menyisihkan sebagian uang sakunya. Pada malam hari adanya keterbukaan keuangan keluarga, penjelasan verbal orang tua dalam menanamkan sikap mandiri di dalam rumah dengan memberikan tugas untuk menyelesaikan pekerjaan rumah tangga seperti mencuci baju, menyapu rumah, memasak sewaktu orang tua bekerja maupun saat libur sekolah.

Pengaruh curing menggunakan air laut terhadap kuat tekan beton dari berbagai merek semen yang dipasarkan di Kota Malang / Oktavianus Putra Mini.

 

ABSTRAK Putra, Oktavianus. 2015. PengaruhCuring Menggunakan Air LautTerhadapKuatTekanBeton Dari BerbagaiMerk Semen Yang Dipasarkan Di Kota Malang. Skripsi, Program Studi S1 PendidikanTeknikBangunan, FakultasTeknik, UniversitasNegeri Malang. Pembimbing : (I) Drs. Sonny Wedhanto, M.T. (II) Ir. Edi Santoso, M.T Kata Kunci :KuatTekanBeton, Curing Air Laut Keterbatasan air tawardilokasiproyekmemaksapenggunaan air lautuntukbeberapapekerjaanbetontidakdapatdielakkan,diantaranyauntukperawatan (curing) betonpascapengecoran.Penelitianinidilakukanuntukmengetahuipengaruhcuring menggunakanair lautterhadapkuattekanbeton. Sampelmenggunakansilinderbetonukuranstandar, dibuatdariberbagaimerk semen yang dipasarkan di Kota Malang.Jumlahsampelsebanyaklimabuahuntukmasing-masingmerek semen.Durasicuring 7, 14, dan 28 hari. Hasilpenelitian, kekuatantekanbetonmengalamipenurunan.Menggunakansemen TigaRoda:betonumur 14 harimengalamipenurunan25,9% darikuattekanumur 7 hari;danumur 28 harimengalamipenurunan10,31%dariumur 14 hari. Menggunakan semen Holcim:umur 14 harimengalamikenaikan20,31% darikuattekanumur 7 hari; danumur 28 harimengalamipenurunan7,87% dariumur 14 hari.Menggunakan semen Gresik:umur 14 harimengalamipenurunan 2,75% dariumur 7 hari;danumur28 harimengalamipenurunan 30,68% dariumur 14 hari.

Perancangan logo sebagai identitas 'Michelle Cake' dan implementasinya / Calla Diny Faradibah

 

ABSTRAK Faradibah, Calla Diny. 2016. Perancangan LogotypeSebagaiIdentitas ‘Michelle Cake’ Dan Implementasinya.Skripsi, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang.Pembimbing: (I) Drs. Sarjono, M.Sn, (II) Mohammad Sigit, S.Sn. Kata kunci: Perancangan, Logo, Identitas, Michelle Cake. Michelle Cake merupakan usaha mikro yang berkonsentrasi pada pengolahan makanan ringan, khususnya kue, yang berlokasi di Kota Surabaya. Usaha mikro yang berawal dari bisnis online dan akan segera membuka gerainya ini, membutuhkan sebuah identitas yang memiliki konsep kuat, sehingga mampu untuk memperkenalkan identitasnya kepada masyarakat dan menciptakan identitas yang sesuai dengan karakteristik bidang usaha serta visi misi perusahaan. Perancangan ini menghasilkan logo yang dapat mempresentasikan atau mewakili visi misi serta tujuan perusahan, yaitu menyajikan kue dengan cita rasa lezat dan nikmat, yang dibuat dari bahan alami, berkualitas, higenis serta harga yang terjangkau. Selanjutnya, logo diimplementasikan pada media cetak untuk memperkenalkan dan membangun identitas perusahaan, yang berupa baliho, poster, x-banner, brosur, dan paper bag. Hasil perancangan ini diharapkan dapat menjadi media edukasi dan referensi untuk perancangan produk sejenis.

Pemanfaatan sumber belajar lingkungan dalam pembelajaran ekonomi di SMA / Annisya'

 

ABSTRAK Annisya’, 2016. PemanfaatanSumberBelajarLingkungandalamPembelajaranEkonomi di SMA. Tesis, Program StudiPendidikanEkonomi, PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. Hari Wahyono, M.Pd., (II) Dr. SugengHadiUtomo, M.S. Kata kunci:sumberbelajarlingkungan, pembelajarankontekstual, pembelajaranekonomi. Pembelajaranekonomi yang dilakukan di SekolahMenengahAtasseharusnyamenjadisebuahpembelajaran yang mampumemberikanmakna yang mendalambagi para pesertadidik. Proses pembelajaran yang dilakukanoleh guru danpesertadidikharusnyabisamembuatsiswamemperolehpengalaman-pengalaman yang bermanfaatbagikehidupannya. Sumberbelajardanpendekatanpembelajarannya juga harusmemperhatikankarakteristikpesertadidik yang diajar. Pemanfaatansumberbelajarlingkungansertapenerapanpembelajaransecarakontekstual (contextual learning) akanmelibatkanpesertadidikdenganaktifdalamproses pembelajaransehinggapesertadidikakanmemperolehpengalaman – pengalamanbelajar yang sesuaidengantujuanpembelajaran. Penelitianinibertujuanuntukmendapatkanpemahaman yang mendalamtentang 1) bagaimanakahpemanfaatansumberbelajarlingkungandalampembelajaranekonomi di SMA Negeri 8 Malang, 2)faktor yang mempengaruhi guru dalammemanfaatkansumberbelajarlingkungandalampembelajaranekonomi. Pendekatan yang digunakandalampenelitianiniadalahpendekatandeskriptifkualitatif. Prosedur yang digunakandalampengumpulan data adalahdenganmenggunakanteknikwawancara, observasidanstudidokumen. Sumber data dalampenelitianiniadalahkepalasekolah, guru dan para pesertadidik di SMA Negeri 8 Malang serta pihak terkait yang ada di lokasi sumber belajar lingkungan.Penelitianinimengarahkanpenulissebagaiinstrumenkunci. Analisis data dalampenelitianinimenggunakanbeberapalangkahyaitureduksi data, penyajian data daninterpretasipenarikankesimpulan. Metodepengecekankeabsahan data dalampenelitianinimenggunakantekniktriangulasi, yang mana triangulasiinidilakukanpadasumber data, data itusendiri, sertametode yang dilakukan. Hasilpenelitianmenunjukkanbahwapemanfaatansumberbelajarlingkunganpelaksanaanpembelajaranekonomisudahdilakukanwalaupunbelummaksimal. Keberadaansekolah yang cukupstrategisdenganpusat-pusatsumberbelajar yang bisadimanfaatkanolehpesertadidik, motivasi untuk peserta didik, pemahaman peserta didik yang lebih baik, serta pengalaman yang didapatkan oleh guru dan peserta didikmenjadikan guru berinisiatifuntukselalu berusaha memanfaatkan sumber belajar lingkungan yang ada di sekitar sekolah dalam proses belajarmengajar. Dari hasilpenelitian yang telah dilakukan, maka disarankan: 1) Guru hendaknya lebih memaksimalkan proses pembelajaran yang bisa dikaitkan dengan sumber belajar yang ada di lingkungan sekitar sekolah untuk dapat mencapai tujuan pembelajaran yang seperti diharapkan.Guru hendaknya mengurangi penggunaan metode ceramah dalam pembelajaran. Hal ini dikarenakan dalam pembelajaran yang efektif haruslah lebih berfokus pada apa yang dilakukan peserta didik (student center). Guru harus lebih bisa berpikir dengan kreatif dalam menyusun perencanaan pembelajaraan yang akan digunakan dalam pembelajaran. 2) Guru, komite sekolah dan instansi atau tempat yang akan dijadikan sebagai sumber belajar lingkungan dalam proses pembelajaran ekonomi diharapkan mempunyai hubungan kerjasama dan komunikasi yang baik.

Pengaruh penggunaan LKS terhadap prestasi belajar trigonometri siswa kelas II Madrasah Aliyah Khairuddin Gondanglegi Kabupaten Malang
oleh Nur Azizah

 

Kenyataan di lapangan menunjukan bahwa LKS telah banyak digunakan hampir semua SMA dan Mata pelajaran. Hal ini dapat dipahami sebagai suatu penerimaan terhadap CBSA. Sementara di pihak lain, laporan mengenai keberhasilan penggunaan LKS pada mata pelajaran matematika telah ada. Atas dasar kenyataan tadi, akhirnya diadakan penelitian ini.

Kesesuaian isi tema IPA dalam majalah anak-anak dengan pokok-pokok bahasan dalan kurikulum bidang studi IPA SD / oleh Marsudi Widodo

 

Proses within solution posing siswa SMP terhadap materi bangun ruang dan scaffoldingnya / Anita Puspitasari

 

ABSTRAK Puspitasari. Anita 2016. Proses Within Solution Posing Siswa SMPTerhadap MateriBangun Ruang dan Scaffolding-nya. Tesis, Program Studi Pendidikan Matematika, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M. Pd., (II) Dra. Santi Irawati, Ph.D. Keywords:Within Solution Posing, Bangun Ruang, Scaffolding. Setiap kurikulum yang diberlakukan mengisyaratkan pentingnya mengembangkan kemampuan berfikir kreatif.Kemampuan siswa untuk berfikir kreatif dapat dikembangkan dengan belajar matematika. Salah satu bagian atau cabang dalam matematika yang penting untuk dipelajari oleh siswa adalah geometri. Berdasarkan pengalaman dan pernyataan guru matematika di SMP Islam Hasanuddin menyimpulkan bahwa pemahaman siswa dalam materi bangun ruang rendah bahkan siswa sulit untuk mengajukan masalah karena tidak terbiasa. Siswa harusnya dibiasakan mengajuan masalah karena dengan meningkatkan kemampuan pengajuan masalah dapat meningkatkan kemampuan pemecahan masalah juga. Selain itu kegiatan pengajuan masalah merupakan aktivitas yang dilakukan oleh siswa dalam kurikulum yang diterapkan di Indonesiatiga tahun terakhir ini. Guru SMP Islam Hasanuddin harus siap untuk membiasakan siswa mengajukan masalah sekaligus memberikan bantuan supaya siswa dapat mengajukan masalah.Oleh karena itu proses mengajukan masalah siswa sangat penting dianalisis sehingga guru mempunyai dasar untuk melakukanscaffolding kepada siswa SMP Islam Hasanuddin. Pengajuan masalah atau problem posing mempunyai 3 tipe, yaitu pree solution posing, within solution posing, dan post solution posing. Dalam penelitian ini dipilih tipe within solution posing dikarenakan siswa terbiasa melihat informasi dan soal sehingga mempermudah untuk membiasakan siswa mengajukan masalah. Penelitian ini bertujuan untuk mendeskripsikan proses within solution posingsiswa SMP terhadap materibangun ruangsebelum dan sesudah dilakukanscaffolding. Penelitian ini menggunakan rancangan deskriptif kualitatif. Metode pengumpulan data dilakukan dengan tes tulis dan wawancara. Penelitian ini melibatan 36 siswa kelas IX yang dikelompokkan menjadi 3 kelompok berdasarkan kemampuannya yaitu 2 siswa yang berkemampuan tinggi, 2 siswa yang berkemampuan sedang dan 2 siswa yang berkemampuan rendah. Keenam siswa yang dipilih diberi soal penyelesaian masalah, lembar pelacak, melakukan wawancara untuk mengetahui proses within solution posing dan menentukan scaffolding yang tepat untuk tiap subyek, kemudian melakukan scaffolding yang telah ditentukan. Hasil penelitian menunjukkan bahwa proses within solution posing sebelum dilakukan scaffolding dalam menyelesaikan soal siswa SMP Islam Hasanuddin Dau Malang berawal dari adanya stimulus yaitu soal yang diberikan, memahami apa yang diketahui dan yang ditanyakan, menentukan langkah penyelesaian, menyelesaikan soal dengan langkah yang ditentukan, dan menentukan within solution posing. Proses within solution posing sesudah dilakukan scaffolding berawal dari adanya stimulus yaitu soal yang diberikan, menentukan dan menuliskan within solution posing, menjawab within solution posing yang sudah ditentukan, menentukan dan menulis within solution posing lain yang terkait, dan menjawab kembali within solution posingyang baru saja ditentukan. Scaffolding yang dilakukan untuk KT, KS dan KR berupa scaffolding level 1 (Enviromental provisions), level 2 (explaining, reviewing, dan restructuring), dan level 3 (Developing conceptual thingking) dilakukan sebelum dan saat memunculkan within solution posing soal cerita yang diberikan. Scaffolding yang dilakukan untuk KT dan KS hampir sama namun berbeda dengan KR. KT dan KS tidak membutuhkan scaffolding untuk within solution posing awal, sedangkan KR masih membutuhkan scaffolding. KR juga membutuhkan scaffolding level 1 (Enviromental provisions), level 2 (explaining, reviewing, dan restructuring), dan level 3 (developing conceptual thinking) untuk memunculkan within solution posing yang jawabannya merupakan jawaban akhir soal yang diberikan, sedangkan KT dan KS hanya membutuhkan scaffolding level 2 (explaining dan restructuring).

Pengaruh lingkungan sosial, intensitas pendidikan ekonomi keluarga, dan modernitas individu terhadap sikap berekonomi rasional melalui gaya hidup sebagai variabel intervening / Ika Wijayanti Anggraeni

 

ABSTRAK Anggraeni, IkaWijayanti. 2016. PengaruhLingkunganSosial, IntensitasPendidikanEkonomiKeluarga, danModernitasIndividuterhadapSikapBerekonomiRasionalmelalui Gaya HidupsebagaiVariabel Intervening.JurusanPendidikanEkonomi, Program PascasarjanaUniversitasNegeri Malang. Pembimbing (1) Dr. HariWahyono, M.Pd (2) Dr. H. Cipto Wardoyo,SE,M.Pd,M.Si.Ak.CA Kata Kunci: lingkungansosial, intensitaspendidikanekonomikeluarga, modernitasindividu, gayahidup, sikapberekonomirasional Perilakukonsumsisiswa SMA saatinisecaraempirikterlihatmempunyaiperilakukonsumtif yang tinggi, terlihatpadaperilakusiswa yang terbiasamakan di restoranatau café-café, jalan-jalandanberbelanja di Mall memilikiberbagaijenishandphone, berbelanjalewat online danberbagaimacambarang-barang yang lain. Kegiatanekonomitersebutadalahsalahsatugayahidupremajasaatini .Sehinggaakanmempengaruhisikapsiswa yang rasional. Penelitianinibertujuanuntukmenjelaskan: 1)pengaruhlingkungansosialterhadapgayahidupsiswa; 2)pengaruhintensitaspendidikanekonomikeluargaterhadapgayahidupsiswa; 3)pengaruhmodernitasindividuterhadapgayahidupsiswa; 4)pengaruhlingkungansosialterhadapsikapberekonomirasionalsiswa; 5)pengaruhintensitaspendidikanekonomikeluargaterhadapsikapberekonomirasionalsiswa; 6)pengaruhmodernitasindividuterhadapsikapberekonomirasionalsiswa; 7)pengaruhgayahidupterhadapsikapberekonomirasionalsiswa; 8)pengaruhlingkungansosialterhadapsikapberekonomirasionalmelauigayahidupsiswa; 9)pengaruhintensitaspendidikanekonomikeluargaterhadapsikapberekonomirasionalmelauigayahidupsiswa; 10)pengaruhmodernitasindividuterhadapsikapberekonomirasionalmelaluigayahidupsiswa. Penelitianinimenggunakanpendekatankuantitatif.Populasidalampenelitianadalahsiswajurusan IPS SMA NegerikabupatenBondowosotahunajaran 2015-2016 denganpopulasi 1275 siswadengansampelsebanyak 125 responden. Penarikansampelmenggunakantehnikproportional random sampling.Tehnikpengumpulan data menggunakanangketdengan model skalalikertdenganlimajawabanpertanyaantertutup. Tehnikanalisis data menggunakanSEM dengan LISREL 8.8. Hasilanalisis data menunjukkan : 1) lingkungansosialberpengaruhpositifterhadapgayahidupsiswa, 2) intensitaspendidikanekonomikeluargaberpengaruhpositifterhadapgayahidupsiswa, 3) modernitasindividutidakberpengaruhterhadapgayahidupsiswa, 4) lingkungansosialberpengaruhpositifterhadapsikapberekonomirasionalsiswakelas, 5) intensitaspendidikanekonomikeluargaberpengaruhpositifterhadapsikapberekonomirasionalsiswa, 6) modernitasindividutidakberpengaruhpositifterhadapsikapberekonomirasionalsiswa, 7) gayahidupberpengaruhpositifterhadapsikapberekonomirasionalsiswa, 8) lingkungansosialmelaluigayahidupberpengaruhsignifikanterhadapsikapberekonomirasionalsiswa, 9) intensitaspendidikanekonomikeluargamelaluigayahidupberpengaruhsignifikanterhadapsikapberekonomirasionalsiswa, 10) modernitasindividumelaluigayahidupberpengaruhtidaksignifikanterhadapsikapberekonomirasionalsiswa Hasilpenelitianinimenunjukkanbahwadalammelakukanaktivitasekonomisiswa agar bersikaprasional, denganmemprioritaskanantarakebutuhan yang utamadengankebutuhanlainnya, sehinggadapatmemberikanpemahamankepadasiswauntukmenjauhiperilakukonsumtif , yang salahsatunyadapatdiminimalisirdenganmenerapkanmateriperilakukonsumsirasional yang telahdiajarkan di sekolah, selainitusiswaselakukonsumenyang tergolongremajajugahendaknyadapatmempergunakanuangsaku yang diberikan orang tuadenganbaikdantidakmudahterbujukiklan yang menggiurkan. Di dalamkeluargahendaknyadiberikanpendidikanekonomiuntukmengetahuiartipentingnyapendidikanekonomikeluargaterhadapgayahidupsertadampaknyapadasikapberekonomirasionalsehinggadapatdijadikanmasukantentangpentingnyaketerlibatandanperanserta orang tuadalampeningkatanpendidikanekonomi di keluarga.

Pengaruh model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan outdoor study terhadap hasil belajar IPS (studi pada siswa kelas VIII SMP Negeri 2 Tuban) / Asih Sukma

 

ABSTRAK Sukma, Asih. 2016. Pengaruh Project Based Learning (PjBL) dengan Pendekatan Saintifik berbantuan Outdoor Study terhadap Hasil Belajar IPS (Studi pada Siswa Kelas VIII SMP Negeri 2 Tuban). Tesis. Program Studi Pendidikan Dasar IPS, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Nyoman Sudana Degeng M.Pd., (II) Prof. Dr. Sudarmiatin M.Si. Kata Kunci: PjBL, Saintifik, Hasil Belajar IPS Pembelajaran yang terjadi di kelas merupakan tanggung jawab guru, karena itu guru wajib mengelola kelas tersebut dengan baik. Salah satu cara adalah dengan penerapan model-model pembelajaran yang ada sehingga siswa tidak merasa bosan dan mampu mencapai tujuan belajar. Model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study membantu siswa belajar dengan suasana yang menyenangkan dan lebih aktif.Melalui outdoor study siswa mendapatkan pengetahuannya langsung dari sumber belajar, sehingga menjadi pengalaman tak terlupakan sepanjang hayat. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study terhadap Hasil Belajar IPS pada siswa kelas VIII SMP Negeri 2 Tuban.Penelitian ini termasuk jenis penelitian eksperimen semu (quasi experiment) dengan subjek penelitian kelas VIIIC sebagai kelas eksperimen 1, kelas VIIIA sebagai kelas eksperimen 2 dan kelas VIIIB sebagai kelas kontrol. Kelas eksperimen 1 mendapat perlakuan model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study, kelas eksperimen 2 mendapat perlakuan model Project Based Learning (PjBL) dengan pendekatan saintifik, dan kelas kontrol mendapat perlakuan model konvensional. Data penelitian berupa hasil belajar siswa (pretes dan postes) dan angket respon siswa.Uji hipotesis penelitian ini menggunakan ANOVA (Analysis of Varians) dan regresi linier sederhana. Analisis data pada penelitian ini menggunakan bantuan program SPSS for windows versi 16. Hasil uji hipotesis dengan menggunakan ANOVA menunjukkan tingkat signifikan antara (1) model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study dan kelas Project Based Learning (PjBL) dengan pendekatan saintifik sebesar 0,631 atau p>0,05 artinya tidak terdapat perbedaan signifikan, (2) model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study dan model konvensional sebesar 0,046 atau p<0,05 artinya terdapat perbedaan signifikan, (3) model Project Based Learning (PjBL) dengan pendekatan saintifik dan model konvensional sebesar 0,014 atau p<0,05 artinya terdapat perbedaan signifikan, dan hasil uji linier sederhana diperoleh nilai signifikan sebesar 0,019 atau p<0,05 artinya terdapat pengaruh positif signifikan antara model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study terhadap hasil belajar IPS . Hasil penelitian menunjukkan: (1) tidak terdapat perbedaan yang signifikan hasil belajar antara kelas yang menggunakan model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study dan kelas yang menggunakan model Project Based Learning (PjBL) dengan pendekatan saintifik. Perbedaan hasil belajar tersebut dibuktikan dengan hasil gain score kelas eksperimen 1 lebih rendah dari hasil gain score kelas eksperimen 2, (2) terdapat perbedaan yang signifikan hasil belajar antara kelas yang menggunakan model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study dan kelas yang menggunakan model konvensional. Perbedaan hasil belajar tersebut dibuktikan dengan hasil gain score kelas eksperimen 1 lebih besar dari hasil gain score kelas kontrol, (3) terdapat perbedaan yang signifikan hasil belajar antara kelas yang menggunakan model Project Based Learning (PjBL) dengan pendekatan saintifik dan kelas yang menggunakan model konvensional. Perbedaan hasil belajar tersebut dibuktikan dengan hasil gain score kelas eksperimen 2 lebih besar dari hasil gain score kelas kontrol, dan (4) terdapat pengaruh positif signifikan model Project Based Learning (PjBL) dengan pendekatan saintifik berbantuan Outdoor Study terhadap hasil belajar IPS. Saran untuk penelitian ini adalah sebaiknya melibatkan observer pada saat melakukan kegiatan outdoor, penyusunan soal harus berbasis pendekatan saintifik dan bersifat kontekstual, dan pada format penulisan laporan sebaiknya tetap memasukkan unsur-unsur IPS.

Analisis ukiran di sentra "Meberl Ukir Antik" Piranha Malang / Lia Khoirun Nisa'

 

ABSTRAK Nisa’. LiaKhoirun. 2015. AnalisisUkiran di Sentra “MebelUkirAntik” Piranha Malang. Skripsi, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Dra. Ida SitiHerawati Abdullah, M. Pd, (II) Drs. AAG. RaiArimbawa, M.Sn. Kata Kunci: Motif hiasukiran, PrinsipOrganisasiEstetik, MebelUkirAntik Ukiranadalahhiasanatauornamen yang terbentukdariteknikpemahatanukirterhadappermukaan media kerasataulunaksehinggamenghasilkanhiasanbervolumecekungdancembungkarenasusunan-susunanbidangdangaris yang dihiasidariteknikpengukirantersebut. Motif ukiransangatberanekaragamcoraknya, setiapdaerahmemilikicirikhastersendiri, begitujugasetiapmebelmempunyaikekhasantersendiridilihatdaricorakmotifnya. Penelitianinidilaksanakandengantujuan: (1) Mendeskripsikan motif ukiran; (2) Mendeskripsikanprinsiporganisasiestetik“MebelUkirAntik”. Lokasipenelitianiniberalamatkandi Jl. Piranha Atas no 79, Rt 06 Rw 01 Kelurahan Tunjung SekarBlimbing Malang.Penelitianinimenggunakanpenelitiandeskriptifkualitatif. Instrumenpenelitianmenggunakaninstrumen formatobservasidanwawancara. Pengumpulan data dilakukandenganmenggunakanteknikobservasipadakelimaprodukkaryayaituukiranmejakursi, asbaknaga, pigurabarongan, tiangbenderanaga, dangagangpintu. Subyekpenelitiandilakukandenganwawancarakepada Ahmad KasimdanKrisbianto. Analisis data dilakukandengantahapreduksi, penyajian, dankesimpulan. Pengecekankeabsahantemuanmenggunakantrianggulasisumberdanmetode. Penelitianinidiperolehhasil (1) Motif ukiran yang terdapat di “MebelUkirAntik”inimempunyai motif hiasgeometris, organis, danfiguratif. Motif hiasgeometristerdiridarimotif hias meander,pilin, jlamrang,lereng, danbuah. Motif hiasorganisterdiridarimotif hiaspatra, lung, sulur,ikal/ukel,trubusan, sulur-suluran,endong, dancula. Motif hiasfiguratifterdiridari barong/kalapadaukiranpigura, danbentuknaga.Bagian-bagian motifpadaukiranterdiridari motif utama, motif pendukung, danisiandalamukiran. Motif utamaterdiridari motif hiasbunga, kala/mukanaga,lereng,lambang, danukel/ikal. Motif pendukungterdiridarimotif hiaspatra, lung, sulur, sirip, danpilin. Isiandalamukiranterdiridarimotif hiasukel/ikal, jlamrang, buah, dansuluran. (2) Prinsiporganisasiestetikukiranberupaprinsipkeselarasan yang dicapaidenganperulanganbentuk motif hiasnya; prinsipkeseimbangan yang cenderungpadakeseimbangan formal/simetris; prinsipkesebandingan yang dicapaidenganpenyesuaianukuran motif utamadan motif pendukungpadaukiran; prinsipritme/iramadicapaidenganperulanganbentuk motif hiasukiran yang berbedaukuran; danprinsipemphasis/pusatperhatianterciptadariteksturdan motif utamaukiransertatitikpusatperhatiandanfokustertentu yang terdapatpadaukiran. Berdasarkanhasilpenelitianinidiharapkanukiraninibisamenjadisebuahpengetahuan yang bermanfaatdandapatdijadikanbahanpembelajarankesenian di sekolah. Apabilapeneliti lain inginmelakukanpenelitiansejenisdenganobjekatausubjek yang berbeda, skripsiinibisadigunakansebagaireferensidanperbandingan yang nantinyadapatdikembangkanlagimenjadilebihbaik.

Wisata bahari Kabupaten Donggala sebagai suplemen bahan ajar mata kuliah geografi pariwisata / Arifuddin Abd. Muis

 

ABSTRAK Abd Muis, Arifuddin. 2016.WisataBahariKabupatenDonggalasebagaiSuplemenBahan ajar Mata KuliahGeografiPariwisata.Tesis,JurusanPendidikanGeografi, PascasarjanaUniversitasNegeri Malang. Pembimbing: (1) Prof. Dr. Sumarmi, M.Pd,(2) Drs. I. komangAstina M.S., Ph.D Kata Kunci:bahan ajar, pengembangan, geografipariwisata Pembelajaran yang baikdapatmenunjangterhadapkualitaspendidikansehinggaperluadanyaacuan yang layakdalampembelajaran. Masalahpokok yang adapadabidangpendidikansaatiniadalahpendidiksalahmemilihacuanataupuntidakmemilikibahan ajar yang kontekstualuntukdimanfaatkandalammemberikanmateridengantepatkepadapesertadidik. Mengembangkanbahan ajar merupakansalahsatucarauntukmeningkatkanataumenjagakualitasdanefisiensidalampembelajaran. SecaraumumBahan ajar matakuliahgeografipariwisatabelumkontekstualkhususnyapadamaterikebijakandanstrategipengembanganpariwisata di provinsi Sulawesi tengah. Berdasarkanhasilanalisismasalahdankebutuhanterhadapbahan ajar cetak, materiatauinformasi yang disampaikanbelummemberikanteori yang sesuaidengankondisi yang ada di sekitarmahasiswa. Olehkarenaitu, pengetahuantentangdaerahpesisirdanlautKabupatenDonggalauntuk di kembangkanmenjadiEkowisatabahari,dapatdimanfaatkandandikemassebagaisuplemenbahan ajarmatakuliahgeografipariwisata. Sehinggadenganpenelitianpengembanganiniselainmendapatkanpenambahanreferensibahan ajar yang kontekstual, mahasiswajugadapatturutberperanaktifdalammemajukanpariwisata yang ada di daerahnyakhususnya di provinsi Sulawesi tengah. Penelitian dan pengembangan ini mengadopsi model Borg & Gall. Prosedurpenelitianterdiridarisepuluhlangkah,namunhanyadilakukantujuhlangkah. Hal ini disebabkan karakteristik kurikulum dan karakter setiap mahasiswa berbeda, serta melalui 3 kali revisi dan divalidasi oleh ahli. Model buku yang diadopsi yaitu versi dikti. Produk divalidasi beberapa ahli yaitu ahli materi, desain pembelajaran, bahasa, praktisi sebelum diujicoba dalam kelompok kecil yaitu 10 mahasiswa dengan status yang sedang mengikuti maupun yang sudah lulus mata kuliah geografi pariwisata. Data hasil validasi dan uji coba berupa saran, tanggapan, dan penilaian sebagai dasar untuk merevisi produk. Hasil uji coba menunjukkan bahwa produk bahan ajar cetak yang dikembangkan mendapat respon positif dari validator dan mahasiswa. Produk secara keseluruhan mendapatkan persentase 81,73% dan sangat layak untuk digunakan sebagai bahan ajar. Produk yang divalidasi oleh ahli menunjukkan persentase 80,63% dengan kualifikasi sangat layak untuk digunakan kelompok kecil. Persentase yang didapatkan dari hasil uji coba lapangan sebesar 86,15%. Pengembangan bahan ajar ini diharapkan dapat menjadi dorongan terhadap dosen dan mahasiswa untuk lebih kreatif danmemanfaatkanlingkungansekitarsebagaisumberbelajar. Saran diseminasi sebaiknya dilakukan sampai pada tahap evaluasi sumatif untuk mengetahui efektivitas bahan ajar. Saran pengembangan sebaiknya: 1) penerapan tes skala kelompok yang besar, 2) dilakukan eksperimen terhadap produk yang dihasilkan untuk mendapatkan hasil yang lebih sempurna terhadap beberapa aspek.

Pengaruh model pembelajaran kooperatif tipe Two Stay Two Stray (TSTS) terhadap proses dan hasil belajar geografi siswa SMA / Bandarusin

 

ABSTRAK Bandarusin. 2016. Pengaruh Model Pembelajaran Kooperatif Tipe Two Stay Two Stray Terhadap Proses dan Hasil Belajar Geografi Siswa SMA. Tesis, Prodi Pendidikan Geografi Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Sugeng Utaya, M. Si, (2) Prof. Dr. Budijanto, M. Sos. Kata kunci: Model Pembelajaran Kooperatif Tipe Two Stay Two Stray, Proses dan Hasil Belajar. Berdasarkan observasi yang dilakukan ditemukan bahwa, dalam suasana belajar kelompok, siswa kurang aktif karena dominasi siswa yang pintar. Hal tersebut menyebabkan anggota kelompok yang lainya menjadi pasif. Untuk mengatasi masalah kurang aktifnya siswa dalam belajar guru perlu menerapkan model pembelajaran. Salah satu model yang dapat membangkitkan keaktifan belajar siswa adalah dengan menerapkan model pembelajaran Two Stay Two Stray. Timbulnya keaktifan belajar pada pembelajaran Two Stay Two Stray karena masing-masing anggota memiliki peran yang harus dijalani sebagai bentuk tanggung jawabnya terhadap kelompok. Peran tersebut berupa penyampaian ide, sebagai tamu, dan sebagai penerima tamu. Penelitian ini bertujuan untuk mengetahui pengaruh model pembelajaran Two Stay Two Stray terhadap proses dan hasil belajar geografi siswa SMA. Penelitian ini merupakan penelitian eksperimen semu (quasi eksperimen) dengan Pretest-Posttest Control Group Design. Penelitian dilakukan di SMA Negeri 4 Praya Kabupaten Lombok Tengah dengan subjek penelitian siswa kelas XI IPS tahun ajaran 2015/2016. Penentuan subjek penelitian berdasarkan nilai rata-rata UAS siswa yang hampir sama pada pelajaran geografi. Kelas eksperimen dan kelas kontrol ditentukan secara acak. Hasilnya adalah kelas XI IPS 3 sebagai kelas eksperimen dan kelas XI IPS 4 sebagai kelas kontrol. Hasil dari penelitian ini adalah (1) ada pengaruh model pembelajaran kooperatif tipe Two Stay Two Stray terhadap proses belajar geografi siswa SMA. Pembelajaran Two Stay Two Stray mengakibatkan siswa aktif dalam mengikuti pembelajaran. (2) Ada pengaruh model pembelajaran kooperatif tipe Two Stay Two Stray terhadap hasil belajar geografi siswa SMA. Pembelajaran Two Stay Two Stray mampu meningkatkan pemahaman siswa terhadap materi, sehingga memudahkan siswa dalam mengerjakan soal yang diberikan. Saran yang bisa disampaikan dalam penelitian ini adalah (1) bagi guru: dalam membelajarkan siswa supaya berjalan dengan baik seyogyanya guru geografi dalam menyampaikan materi yang membutuhkan keaktifan siswa, guru menerapkan pembelajaran TSTS. Melalui model ini proses belajar dan hasil belajar lebih baik. (2) Bagi peneliti selanjutnya: untuk menguji pengaruh pembelajaran TSTS pada lokasi, jenjang pendidikan, dan materi lain. Menambah variabel lain seperti motivasi, keaktifan, kemampuan, pemecahan masalah dan lain-lain.

Pengembangan sistem informasi administrasi perpustakaan berbasis web di SMP Ar-Rohmah Boarding School, Dau Malang / Ali Azyumardi Azra

 

ABSTRAK Azyumardi Azra, Ali. 2015.Pengembangan SistemInformasi Administrasi Perpustakaan Berbasis Web Di SMP AR-Rohmah Boarding School, Dau Malang. Proposal Skripsi. Program Studi Pendidikan Teknik Informatika, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I)M. Zainal Arifin S.Si, M.Kom. (II) M. JauharulFuady S.T., M.T. Kata Kunci : sistem informasi, administrasi, perpustakaan,sekolah, web. Sistem informasi administrasi perpustakaan adalah suatu sistem yang memuat informasi-informasi tentang segala transaksi administrasi perpustakaan sekolah. Sistem informasi ini dirancang untuk digunakan pada sekolah-sekolah yang sudah maju dan memiliki syarat penggunaan sistem informasi. Sistem informasi ini dapat digunakan oleh operator, admin, siswa sekolah yang bersangkutan. Masing-masing siswa yang terdaftar memiliki akun untuk dirinya sendiri dan bersifat pribadi. Penelitian dan pengembangan ini dilaksanakan karena proses administrasi perpustakaan di SMP Ar-Rohmah Boarding School Dau Malang mengalami permasalahan. Permasalahan tersebut antara lain banyak buku hilang, data transaksi yang hilang karena ditulis dengan kertas, dan pencatatan administrasi perpustakaan yang tidak rutin. Penelitian dan Pengembangan ini dilaksanakan dengan tujuan untuk mengembangkan suatu sistem informasi yang awalnya dilakukan dengan pencatatan transaksi perpustakaan seperti peminjaman dan pengembalian buku secara tertulis pada sebuah kertas menjadi laporan administrasi perpustakaan sekolah pada sebuah web sistem informasi dengan penambahan fitur-fitur tambahan di dalamnya, sehingga manajemen administrasi perpustakaan sekolah yang bersangkutan dapat menjadi lebih mudah, efisien,efektif dan rutin dalam pencatatan administrasi perpustakaan. Metode penelitian yang digunakan adalah metode penelitian dan pengembangan atau Research and Development (R&D).Menurut Sugiono (2012:297), metode penelitian dan pengembangan adalah metode penelitian yang digunakan untuk menghasilkan produk tertentu dan menguji keefektifan produk tersebut. Dalam hal prosedur penelitian pengembangan, Sommerville (Dalam jurnal oleh Sigit Prayitno Trihandoko,2012) mengungkapkan bahwa siklus R &D tersusun dalam beberapa langkah penelitian dan pengembangan yang disebut model Pengembangan waterfall. Model pengembangan produk yang digunakan adalah model waterfall. Pengembangan dilakukan melalui 5 tahapan, yaitu analisa kebutuhan, desain sistem dan antarmuka perangkat lunak,implementasi dan pengujian kode program, integrasi dan pengujian produk, penerapan dan perawatan produk. Produk dari penelitian ini berupa sistem informasi berbasis web dan menggunakan basis data untuk menyimpan informasi. Hasil dari penelitian dan pengembangan ini adalah sebuah sistem informasi administrasi perpustakaan yang berbasis web dengan penambahan fitur-fitur baru di dalamnya untuk Sekolah Menengah Pertama (SMP)Ar-Rohmah Boarding School Dau Malang.  

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |