Pengembangan inventori kreativitas siswa SMA Negeri di Malang / Mita Widianasari

 

ABSTRAK Widianasari, Mita. 2009. Pengembangan Inventori Kreativitas Siswa SMA Negeri di Malang. Skripsi, Jurusan Bimbingan Konseling dan Psikologi, Program Studi Bimbingan dan Konseling, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Henny Indreswari M.Pd, (II) Drs. Harmiyanto. Kata kunci: kreativitas, inventori, pengembangan pada jenjang sekolah lain baik sekolah dasar, menengah maupun perguruan tinggi, desain produk pengembangan dirancang lebih menarik, menggunakan variasi teknik analisis yang lain. Di samping itu, mengingat perkembangan teknologi yang semakin canggih disarankan produk dapat dikembangkan melalui program dalam bentuk softwareKreativitas merupakan aspek yang sangat penting dalam kehidupan. Tanpa adanya kreativitas, kehidupan merupakan sesuatu yang bersifat pengulangan terhadap pola-pola yang sama. Kreativitas sangat dibutuhkan oleh siswa SMA dalam memenuhi salah satu tugas perkembangan dalam kehidupan, baik dalam bidang pribadi, sosial, belajar, maupun kariernya. Alat yang dibutuhkan konselor dapat berbentuk inventori, namun kenyataan di lapangan inventori mengenai kreativitas belum dikembangkan, oleh sebab itu inventori kreativitas ini dikembangkan. Dalam pengembangan inventori kreativitas ini khusus pada bagaimana tingkat validitas, reliabilitas, dan norma yang digunakan. Pengembangan ini dibatasi pada konstruk kreativitas subteori komponensial yang menghubungkan inteligensi dengan dunia internal individu, khususnya mekanisme mental yang menggiring perilaku kurang inteligen. Subteori ini dikhususkan pada tiga komponen dalam (a) belajar bagaimana melakukan, (b) merencanakan apa dan bagaimana cara melakukan, dan (c) mengaktualisasikan (Sternberg, 1985). Pengembangan inventori kreativitas ini mempunyai tujuan untuk menghasilkan inventori yang: (1) memiliki validitas tinggi; (2) memiliki reliabilitas tinggi; (3) menetapkan norma; (4) menghasilkan produk; (5) mengetahui gambaran kreativitas siswa SMA Inventori kreativitas diuji tingkat konsistensi internalnya dengan menggunakan rumus Product Moment Pearson, dengan taraf signifikansi P<0,05. Inventori juga diuji tingkat reliabilitasnya dengan menggunakan rumus Alpha Cronbach. Polpulasi pengembangan adalah siswa SMA kelas X di Malang tahun ajaran 2009/2010, subyek pengembangan sebanyak 375 siswa diambil dengan teknik proportional cluster area random sampling. Hasil pengembangan menunjukkan bahwa: (1) Inventori kreativitas memiliki tingkat validitas yang tinggi, memenuhi syarat konsistensi internal pada P<0,05; (2) inventori kreativitas memiliki tingkat reliabilitas yang tinggi α = 0,873; (3) Inventori kreativitas memiliki ketepatan norma yang diwujudkan dalam bentuk norma persentil dengan kategorisasi tinggi, sedang, dan rendah. Berdasarkan hasil pengembangan, disarankan: 1) hasil produk pengembangan dapat digunakan konselor sebagai salah satu alat pengumpul data pribadi untuk mengetahui tingkat kreativitas siswa; 2) diharapkan konselor melakukan kerja sama dengan pihak sekolah agar mampu memberikan sarana dan prasarana untuk memfasilitasi para siswa baik yang memiliki tingkat kreativitas rendah, sedang maupun yang tinggi; 3) bagi pengembang selanjutnya, hendaknya menindaklanjuti hasil pengembangan dengan terus melakukan pengembangan, baik dalam konstruk teoritis berdasar teori Robert J. Sternberg maupun teori kreativitas yang lain. Selain itu, subyek pengembangan diharapkan lebih diperluas i

Penerapan model pembelajaran kooperatif teknik jigsaw dan teknik STAD terhadap peningkatan motivasi dan hasil belajar pada mata pelajaran penyajian makanan (studi penelitian pada siswa kelas X Resto 2 SMKN 2 Malang) / Erma

 

ABSTRAK Erma. 2009. “Penerapan Model Pembelajaran Kooperatif teknik JIGSAW dan teknik STAD Terhadap Peningkatan Motivasi Dan Hasil Belajar pada mata pelajaran penyajian makanan (Studi Siswa Kelas X Resto 2 Sekolah Menengah Kejuruan Negeri 2 Malang).” Skripsi, Program Studi S1 Pendidikan Tata Boga Jasa Restoran Teknologi Industri, Fakultas Teknik Universitas Negeri Malang. Pembimbing: (1) Dr. Etta Mamang Sangaji, M. Si ,(2) Dra. Wiwik wahyuni, M.Pd. Kata kunci: pembelajaran kooperatif, Jigsaw, STAD. Berdasarkan hasil pengamatan di lapangan menunjukkan bahwa motivasi belajar mata pelajaran penyajian makanan peserta didik sedikit rendah, salah satu penyebab rendahnya motivasi belajar pada mata pelajaran penyajian makanan ini adalah kecenderungan menerapkan metode pembelajaran yang tidak variatif atau konvensional. Usaha meningkatkan motivasi belajar peserta didik mata pelajaran penyajian makanan, dapat dilakukan dengan cara menerapkan pembelajaran kooperatif teknik Jigsaw dan teknik STAD yang melibatkan peserta didik sehingga baik secara langsung maupun tidak langsung mengembangkan sikap sosial antar sesama peserta didik sebagai latihan hidup dalam suatu masyarakat yang nyata. Pendekatan yang digunakan dalam penelitian ini adalah mixing reserch dengan jenis penelitian tindakan kelas (PTK). Data penelitian dikumpulkan melalui: 1) observasi, 2) wawancara, 3) angket, 4) catatan lapangan 5) dokumentasi, dan 6) hasil uji hipotesa. Subjek penelitian adalah siswa kelas X Resto 2 di SMKN 2 Malang. Teknik analisis data dilakukan dengan mengunakan hasil uji compremean dari perbandingan teknik jigsaw dan teknik STAD. Hasil penelitian menunjukkan bahwa 1) pembelajaran kooperatif teknik Jigsaw dan teknik STAD kepada peserta didik secara umum mengalami peningkatan dalam meningkatkan hasil belajar siswa, 2) kerjasama peserta didik dalam pembelajaran ini juga berlangsung dengan baik, dimana peserta didik tidak membedakan kemampuan akademik, latar belakang sosial, maupun jenis kelamin, tetapi lebih didorong oleh rasa tanggung jawab mereka dalam menyelesaikan tugas; 3) motivasi peserta didik dalam penerapan pembelajaran kooperatif teknik Jigsaw dan teknik STAD sudah baik, hal ini ditunjukkan dengan berdasarkan perolehan skor dan persentase, dari 36 siswa kelas X Resto 2 yang mengisi angket motivasi belajar, dengan hasil presentase yang meningkat. Kesimpulan yang dapat diambil adalah penerapan pembelajaran kooperatif teknik Jigsaw dan teknik STAD pada mata pelajaran penyajian makanan dapat meningkatkan hasil belajar dan motivasi siswa yang dibuktikan dengan kerjasama peserta didik dalam menyelesaikan tugas dengan baik. Beberapa saran yang dapat peneliti sampaikan yaitu: 1)Bagi siswa hendaknya lebih aktif dalam pembelajaran, baik dalam melaksanakan percobaan maupun diskusi didalam kelas. 2)Bagi peneliti lain, jika ingin menggunakan pembelajaran penyajian makanan dengan teknik jigsaw dan teknik STAD hendaknya dilakukan pada pokok bahasan yang berbeda.

Kritik sosial dalam novel Wasripin & Satinah karya Kuntowijoyo / Zainul Fuadi

 

ABSTRAK Fuadi, Zainul. 2009. Kritik Sosial dalam Novel Wasripin & Satinah Karya Kuntowijoyo. Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: Dr. Maryaeni, M.Pd. Kata Kunci: kritik sosial, novel, sosiologi sastra Kritik sosial adalah sindiran maupun tanggapan yang ditujukan pada sesuatu yang terjadi dalam masyarakat. Kritik sosial muncul ketika terjadi ketidakpuasan terhadap realitas kehidupan yang dinilai tidak selaras. Adanya pelanggaran-pelanggaran dalam kehidupan masyarakat akan memunculkan kritik dalam kalangan masyarakat itu sendiri. Kritik sosial yang membangun tidak hanya berisi kecaman, celaan, atau tanggapan terhadap situasi tertentu, tetapi juga berisi inovasi sosial sehingga tercapai sebuah harmonisasi sosial. Kritik dapat disampaikan secara langsung maupun tidak langsung. Media yang tersedia untuk menyampaikan kritik juga cukup beragam. Karya sastra merupakan salah satu media untuk menyampaikan kritik sosial secara tidak langsung. Kritik sosial banyak dijumpai dalam karya sastra sebagai bentuk gambaran realita sosial di masyarakat. Novel merupakan salah satu jenis karya sastra yang berisi kehidupan manusia melalui tokoh dan pelaku tidak menutup kemungkinan banyak mengandung kritik sosial. Penelitian ini bertujuan untuk mendeskripsikan kritik sosial di Indonesia dalam novel Wasripin & Satinah karya Kuntowijoyo yang meliputi (1) deskripsi kritik pengarang terhadap kebijakan politik pemerintah, (2) deskripsi kritik pengarang terhadap kebijakan penguasa, (3) deskripsi kritik pengarang terhadap kebijakan penegak hukum, (4) deskripsi kritik pengarang terhadap kebijakan pimpinan militer, dan (5) deskripsi kritik pengarang terhadap kehidupan rakyat jelata. Penelitian ini termasuk kualitatif karena prosedur penelitian tersebut menghasilkan data deskripsi tentang kata-kata tertulis. Sedangkan pendekatan yang digunakan adalah pendekatan sosiologi sastra. Data dalam penelitian ini adalah paparan berupa dialog, monolog, dan narasi dalam novel Wasripin & Satinah karya Kuntowijoyo. Sedangkan sumber data dalam penelitian ini berupa novel Wasripin & Satinah karya Kuntowijoyo setebal 256 halaman. Novel ini pertama kali diterbitkan oleh Penerbit Buku Kompas Jakarta, September 2003 dengan penyelia naskah Kenedi Nurhan, ilustrasi dan desain sampul Taufan Arifin serta penata teks Ratno. Dalam penelitian ini, peneliti bertindak sebagai instrumen utama atau human instrument. Pengumpulam data dalam penelitian ini menggunakan teknik tekstual, yaitu menganalisis atau menelaah tuturan bahasa yang berupa dialog, monolog dan narasi dalam novel Wasripin & Satinah karya Kuntowijoyo yang mengandung kritik sosial dengan prosedur (1) membaca secara intensif karya sastra yang dikaji, (2) menafsirkan data yang diperoleh dari novel berdasarkan indikator yang telah ditentukan, dan (3) mengklasifikasi data berupa dialog, monolog maupun narasi yang mengandung kritik terhadap kebijakan politik pemerintah, kritik terhadap kebijakan penguasa, kritik terhadap kebijakan penegak hukum, kritik terhadap kebijakan pimpinan militer, dan kritik terhadap kehidupan rakyat jelata. Deskripsi yang diperoleh dari hasil analisis adalah deskripsi (1) kritik terhadap kebijakan politik pemerintah yang meliputi (a) pemanfaatan tokoh yang populer yang tidak relevan dengan kepentingan politik partai, (b) adanya praktek pelanggaran-pelanggaran peraturan pemilihan umum yang dilakukan oleh partai politik maupun calon-calon wakil rakyat. Wujud nyata dari pelanggaran kampanye dapat berupa pencurian start kampanye, kampanye terselubung, dan politik uang (money politic), (c) adanya campur tangan kepentingan politik dalam menentukan suatu kebijakan, dan (d) adanya tindakan tidak etis bahkan tindak kriminal yang dilakukan oleh partai politik untuk menjatuhkan lawan politiknya; (2) kritik terhadap kebijakan penguasa yang meliputi (a) pelanggaran terhadap hak rakyat yang dilakukan oleh penguasa seperti pembatalan pemberian bintang jasa kepada Wasripin dan (b) penyalahgunaan kekuasaan oleh penguasa untuk kepentingan tertentu baik individu maupun kelompok; (3) kritik terhadap kebijakan penegak hukum yang meliputi (a) penyalahgunaan aturan hukum yang dilakukan oleh pihak-pihak yang memegang jabatan tertentu dan (b) adanya pelanggaran prosedur hukum, terutama yang dilakukan oleh aparat penegak hukum itu sendiri; (4) kritik terhadap kebijakan pimpinan militer yang meliputi (a) intervensi yang dilakukan oleh militer ke dalam kehidupan masyarakat cukup dominan dan (b) campur tangan militer dalam persoalan politik; dan (5) kritik terhadap kehidupan rakyat jelata yang berupa berupa ketidakadilan dan penderitaan-penderitaan yang telah mereka alami, seperti kemiskinan, penindasan, tindak kejahatan, dan perlakuan diskriminatif. Berdasarkan hasil analisis dapat disimpulkan bahwa novel Wasripin & Satinah karya Kuntowijoyo tersebut sarat akan muatan kritik sosial. Namun, hasil penelitian yang diperoleh ini masih bersifat terbuka. Artinya, terbuka kemungkinan lain bagi siapa saja yang menganalisis karya sastra tersebut dari sudut pandang yang berbeda. Oleh sebab itu, penulis menyarankan adanya penelitian lanjutan untuk meneliti karya sastra tersebut dari sudut pandang dan pendekatan yang berbeda secara utuh, misalnya dari segi humanisme maupun kultur Jawa. Selain itu, hasil penelitian ini diharapkan dapat bermanfaat bagi pengajar sastra, pembaca sastra, dan kritikus sastra.

Pemenuhan standar sarana dan prasarana praktik program keahlian teknik komputer dan jaringan (TKJ) pada Sekolah Menengah Kejuruan (SMK) se-malang Raya / Wahyu Andreas

 

ABSTRAK Andreas, Wahyu. 2009. Pemenuhan Standar Sarana dan Prasarana Praktik Program Keahlian Teknik Komputer dan Jaringan (TKJ) pada Sekolah Menengah Kejuruan (SMK) se-Malang Raya. Tesis, Program Studi Pendidikan Kejuruan, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Haris Anwar Syafrudie, M. Pd., (II) Hakkun Elmunsyah, S.T, M.T. Kata kunci : sarana dan prasarana praktik, pemenuhan Peranan pemenuhan sarana dan prasarana turut menentukan kualitas dari proses belajar mengajar disekolah. Hal ini dapat dilihat dari hasil penelitian yang pernah dilakukan oleh Cahyono (2005) yang menunjukkan bahwa sarana dan prasarana belajar berhubungan positif dengan prestasi belajar siswa. Dengan demikian pembinaan kemampuan guru dalam mengelola sarana dan prasarana memang diperlukan dalam rangka peningkatan mutu pendidikan di sekolah, namun dalam rangka itu pula di sekolah perlu adanya layanan profesional di bidang sarana dan prasarana (Gorton dalam Bafadal, 2004) Penelitian ini bertujuan untuk: (1) mendeskripsikan pemenuhan standar kuantitas sarana praktik program keahlian TKJ, (2) mendeskripsikan pemenuhan standar kuantitas prasarana praktik program keahlian TKJ, (3) mendeskripsikan pemenuhan standar kualitas prasarana praktik program keahlian TKJ di SMK se-Malang Raya. Rancangan penelitian yang digunakan adalah deskriptif. Subyek dalam penelitian ini adalah 19 SMK yang mempunyai program keahlian TKJ se-Malang Raya. Instrumen yang digunakan dalam penelitian ada tiga jenis, yaitu kuesioner pemenuhan pemenuhan standar kuantitas sarana, kuesioner pemenuhan standar kuantitas prasarana dan angket pemenuhan standar kualitas prasarana praktik program keahlian TKJ. Hasil penelitian ini adalah : 1) secara umum, program keahlian TKJ kurang memenuhi standar kuantitas sarana praktik program keahlian Teknik Komputer dan Jaringan. 2) secara umum, program keahlian TKJ kurang memenuhi standar kuantitas prasarana praktik program keahlian Teknik Komputer dan Jaringan. 3) secara umum, program keahlian TKJ memenuhi standar kualitas prasarana praktik program keahlian Teknik Komputer dan Jaringan. Berdasarkan temuan penelitian ini, disarankan agar: 1) dapat menjadi pertimbangan bagi kepala dinas pendidikan se- Malang Raya dalam penentuan kebijakan pada penambahan sarana dan prasarana praktik. 2) pihak sekolah melakukan usaha untuk meningkatkan pemenuhan standar sarana dan prasarana praktik program keahlian TKJ. Beberapa cara yang bisa dilakukan antara lain dengan cara melakukan kerjasama dengan dunia usaha dan dunia industri. Pihak sekolah perlu membuka kesempatan kepada pihak orang tua siswa yang berkeinginan untuk mengambil peranan dalam rangka pemenuhan standar sarana dan prasarana praktik ini. Selain itu pihak sekolah juga perlu mengefektifkan peranan manajemen sekolah untuk peningkatan fasilitas melalui efisiensi pembiayaan. 3) dilakukan penelitian lanjut yang bertujuan untuk mengetahui pengaruh pemenuhan standar sarana dan prasarana praktik terhadap pencampaian kompetensi siswa.

Peningkatan motivasi dan hasil belajar matematika melalui teknik reinforcement pada siswa kelas IB SDN Bareng 3 Kota Malang / Devy Shinta Harmayanti

 

ABSTRAK Harmayanti, Devy Shinta. 2009. Peningkatan Motivasi Dan Hasil Belajar Matematika Melalui Teknik Reinforcement Pada Siswa Kelas IB SDN Bareng 3 Kota Malang. Skripsi Program Studi S1 PGSD, Jurusan KSDP, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (1) Drs. H. Sutarno, M.Pd, (2) Dr. Sa’dun Akbar, M.Pd. Kata Kunci : Motivasi dan Hasil Belajar, Teknik Reinforcement Siswa yang memiliki motivasi rendah menampakkan keengganan, cepat bosan, dan berusaha menghindar dalam kegiatan belajar. Lebih jauh situasi belajar yang tidak didasari motivasi yang mendalam, siswa akan acuh tak acuh. Siswa akan belajar dalam keadaan yang kurang lebih memaksanya untuk belajar. Siswa terus melakukan pekerjaannya karena percaya pada gurunya, bukan karena siswa tersebut melihat guna pekerjaan yang dilakukannya. Dengan demikian ada motivasi, tetapi motivasi itu tidak mendalam dan tidak memaksa sifatnya. Mencermati fakta di atas, betapa pentingnya teknik reinforcement yang merupakan salah satu teknik peningkatan dan pemeliharaan perilaku. Masalah pokok dalam penelitian ini adalah : (1) Bagaimana penggunaan teknik reinforcement untuk meningkatkan motivasi dan hasil belajar matematika siswa kelas IB SDN Bareng 3 Malang? (2) Apakah pemberian teknik reinforcement bisa meningkatkan motivasi belajar siswa kelas IB SDN Bareng 3 Malang? (3) Apakah pemberian teknik reinforcement bisa meningkatkan hasil belajar matematika siswa kelas IB SDN Bareng Malang? Tujuan penelitian adalah (1) mendeskripsikan penggunaan teknik reinforcement dalam meningkatkan motivasi dan hasil belajar matematika siswa kelas IB SDN Bareng 3 Malang. (2) mendeskripsikan peningkatan motivasi belajar matematika melalui teknik reinforcement pada siswa kelas IB SDN Bareng 3 Malang. (3) mendeskripsikan peningkatan hasil belajar matematika melalui teknik reinforcement pada siswa kelas IB SDN Bareng 3 Malang. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK). Penelitian ini direncanakan dalam 3 siklus. Pelaksanaan tindakan meliputi 4 langkah, yaitu : (1) Rencana, (2) Pelaksanaan, (3) Evaluasi, (4) Refleksi. Berakhir tidaknya suatu siklus berdasar pada tercapainya KKM 60, dengan asumsi 90% siswa mencapai hasil tes di atas 60. Subyek penelitian ini adalah siswa kelas I B SDN Bareng 3 Malang yang berjumlah 35 siswa. Lokasi penelitian Jalan Kawi Selatan No. 20 Malang. Prosedur pengumpulan data berupa soal–soal tes dan observasi motivasi dan hasil belajar siswa. Instrument pengumpul data dalam penelitian ini adalah soal–soal tes matematika. Hasil yang diperoleh dalam penelitian ini menunjukkan bahwa pembelajaran melalui teknik reinforcement dapat meningkatkan motivasi dan hasil belajar matematika siswa kelas IB SDN Bareng 3 Malang dengan peningkatan rata–rata, yaitu : 68 (tes pra tindakan siklus I) ; 83 (tes siklus II) ; 91 (tes siklus III). Hal ini menunjukkan bahwa motivasi dan hasil belajar siswa pada tiap siklus mengalami peningkatan dan mencapai kriteria keberhasilan. Berdasarkan hasil penelitian yang telah didapatkan, maka dapat disimpulkan bahwa pemberian teknik reinforcement dapat meningkatkan motivasi dan hasil belajar matematika siswa kelas I B SDN Bareng 3 Malang.

Upaya meningkatkan keterampilan pembelajaran perkalian melalui penggunaan jari-jari tangan pada siswa kelas IV SDN Pukul Kabupaten Pasuruan / Mukhdori

 

ABSTRAK Mukhdori. 2009 . Upaya Meningkatkan Keterampilan Pembelajaran Perkalian Melalui Penggunaan Jari Tangan Pada Siswa Kelas IV SDN Pukul Kecamatan Kraton Kabupaten Pasuruan. Skripsi, Jurusan s1 Pendidikan Guru Sekolah Dasar FIP Universitas Negeri Malang. Pembimbing (I) Dra. Endang Setyo Winarni, M.Pd. Pembimbing (II) Drs. Rumidjan, M.Pd. Kata Kunci: Keterampilan , Pembelajaran, Perkalian, Jari Tangan. Pembelajran pada tingkat Sekolah Dasar merupakan tahapan penting bagi siswa, karena proses pembelajaran pada tahap ini dapat mempengaruhi pola belajar pada tahap selanjutnua. Pada tingkat awal, pemahaman siswa yang benar terhadap suatu konsep sangat penting sebagai modal dasar bagi penguasaan konsep yang lebih besar. Namun demikian masih banyak siswa kelas IV yang belum paham tentang perkalian. Ketidak pahaman mereka disebabkan oleh cara penyajian materi yan kurang menarik, sehingga tidak memotivasi minat siswa dalam belajar. Berdasarkan fenomena tersebut peneliti mencoba inovasi baru dengan menggunakan jari tangan sebagai alternatif dalam pembelajaran perkalian. Pembelajaran perkalian dengan menggunakan jari tangan diharapkan akan mempermudah siswa dalam memahami materi, sehingga akan memperoleh hasil belajar yang optimal sesuai dengan tujuan yang ditentukan. Penelitian ini bertujuan untuk 1). Mendeskripsikan pemahaman pembelajaran perkalian sebelum menggunakan jari-jari tangan dalam mata pelajaran matematika siswa kelas IV SDN Pukul Kabupaten Pasuruan. 2). Mendeskripsikan pelaksanaan pembelajaran perkalian dengan menggunakan jari-jari tangan dalam mata pelajaran matematika siswa kelas IV SDN Pukul Kabupaten Pasuruan. 3) Mendeskripsikan penggunaan jari-jari tangan dalam meningkatkan hasil belajar matematika siswa kelas IV SDN Pukul Pasuruan. Rancangan dalam penelitian ini menggunakan penelitian tindakan kelas. Instrumen pengumpulan data berupa tes, yaitu ulangan harian I dan ulangan harian II. Untuk menganalisa data dari hasil ulangan pada penelitian ini menggunakan penilaian acuan kriteria. Penilaian acuan kriteria yang digunakan adalah ketuntasan belajar perorangan (75%) dan ketuntasan kelas atau kelompok (80%). Pelaksanaan pembelajaran dibagi dalam 1 siklus, yang terdiri dari 4 tahapan, yaitu 1) perencanaan, 2) pelaksanaan, 3) pengamatan, 4) refleksi. Tindakan awal dilaksanakan denganmenggunakan pembelajaran konvensional. Perolehan hasil belajar pada tindakan pembelajaran konvensional dinyatakan yang belum tuntas, sehingga perlu dilaksanakan perbaikan pada siklus 1 yang terbagi dalam 5 kali pertemuan dan diakhiri dengan ulangan harian II. Waktu yang digunakan dalam penelitian ini 5 minggu. Hasil yang diperoleh dari penelitian ini adalah peningkatan pengusaan pembelajaran perkalian dengan menggunakan jari tangan siswa dalammata pelajaran matematika kelas IV SDN Pukul Kecamatan Kraton Kabupaten Pasuruan tahun 2009. Peningkatan pemahaman tersebut dapat dilihat dari ketuntasan belajar siswa pada pembelajaran konvensional sebesar 27,5 %, dan pada siklus I meningkat lagi menjadi 82,5%. Dengan perolehan tersebut pembelajaran dapat dikatan berhasil tuntas. Berdasarkan hasil penelitian ini disimpulkan bahwa dalam pembelajaran perkalian penggunaan metode dan strategi yang menarik sangat penting. Karena hal itu akan membangkitkan minat belajar dan akan membantu siswa lebih mudah menguasai materi yang diberikan. Dengan menggunakan kalkulator ekonomis isyarat jari-jari tangan, disarankan kepada guru agar tercapai tujuan pembelajaran intuk: 1) menguasai dan memantapkan konsep perkalian dasar 6 s/d 10. 2) menghafalkan rumus-rumus perkalian, 3) teliti dalam menjumlahkan, 4) materi pembelajaran hendaknya diberikan tahap demi tahap sesuai tingkat kesulitan materi. Dengan demikian disaran kan agar guru hendaknya menggunakan jari-jari tangan pada materi perkalian dalam pembelajaran matematika kelas IV. Disarankan bagi peneliti lain, agar penelitian ini dapat dijadikan sebagai bahan pertimbangan dan acuan dalam penelitian selanjutnya, sehingga hasilnya dapat dijadikan pedoman dan pengembangan profesi serta meningkatkan prestasi belajar siswa.

Using films to improve the ability of the eight graders ot MTs Negeri Planjan Kesugihan Cilacap in writing narrative paragraphs / Akhmad Fauzan

 

ABSTRAK Fauzan, Akhmad. 2009. Menggunakan Film untuk Meningkatkan Kemampuan Siswa Kelas 8 MTs Negeri Planjan Kesugihan Cilacap dalam Menulis Paragraf Narasi. Tesis. Program Pasca Sarjana Jurusan Pendidikan Bahasa Inggris, Universitas Negeri Malang. Pembimbing: (1) Dra. Utami Widiati, M.A., Ph.D (2). Dr. Sri Rachmajanti, Dip. TESL.,M.Pd Kata kunci: films, kemampuan menulis, paragraph narrative. Penelitian ini dilaksanakan berdasarkan pada permasalahan yang dialami oleh peneliti sebagai guru Bahasa Inggris di MTs Negeri Planjan Kesugihan Cilacap. Berdasarkan hasil stui pendahuluan siswa kelas VIII MTs Negeri Planjan Kesugihan Cilacap, menunjukkan bahwa kemampuan menulis teks narrative siswa kelas VIII E masih kurang memuaskan dan siswa mempunyai motivasi yang rendah dalam proses belajar dan mengajar. untuk mengatasi masalah tersebut peneliti menggunakan film teknik. Teknik ini dipilih karena dapat merangsang siswa untuk lebih aktif dalam kegiatan menulis sehingga kemampuan menulis mereka dapat meningkat. Rumusan masalah dari penelitian ini adalah “Bagaimana film bisa meningkatkan kemampuan siswa dalam menulis siswa MTs Negeri Planjan Kesugihan Cilacap dalam menulis paragraph narrative?”. Penelitian ini menggunakan desain penelitian tindakan kelas secara kolaborasi. Dalam penelitian ini, peneliti dan kolaborator bekerja sama dalam menyusun rencana pelajaran, mengimplementasikan tindakan, mengamati tindakan, dan melakukan refleksi. Subjek penelitian ini adalah siswa kelas VIII E pada MTs Negeri Planjan Kesugihan Cilacap tahun ajaran 2008-2009. Penelitian ini dilaksanakan dalam dua siklus dengan mengikuti prosedur penelitian tindakan yaitu perencanaan, pelaksanaan, observasi, dan refleksi. Prosedur penerapan media film dalam pembelajaran menulis pada penelitian ini adalah sebagai berikut: (1) mengawali pelajaran dengan ice breaking,(2) mengelompokan anak-anak dengan cara memberi daftar kata kunci.(3) menyuruh anak-anak duduk berkelompok, terdiri dari empat sampai lima orang setiap kelompoknya,(4) menyuruh anak-anak untuk membaca daftar kata dipandu oleh , (5). menampilkan gambar sesuai dengan tema , (6) menapilkan model teks, (6) menayangkan narrative film pendek secara lambat atau bahkan berhenti pada bebarapa kejadian dan mengisi narrative chart berkelompok, (8) Siswa menjawab pertanyaan bersama anggota kelompoknya, (9) Siswa mengembangkan draft berdasarkan jawaban-jawaban pada pertanyaan, (10) Siswa diminta untuk merevisi dan mengedit draft yang telah mereka buat, (11) Siswa diberi kesempatan untuk menampilkan karya tulisnya, Hasil penelitian ini menunjukkan bahwa strategi ini dapat meningkatkan kemampuan siswa dalam menulis paragraf narrative. Peningkatan tersebut dapat dilihat dari nilai tes rerata siswa pada siklus 1,dan siklus 2.Nilai rerata siswa pada sikulus 1 adalah 61dan pada siklus 2 menjadi 72. Selain itu film juga mampu meningkatkan keaktifan dan motivasi siswa selama pembelajaran menulis. Hal ini dapat dilihat dari prosentase keterlibatan siswa pada siklus1 yaitu 63% dan 70% pada siklus 2. Berkaitan dengan response siswa, 86% menyatakn termotivasi pada siklus 1 dan 87% pada siklus 2. Berdasarkan temuan di atas, beberapa saran dikemukakan.Bagi guru bahasa inggris, untuk menerapkan media film dalam mengajar menulis. Kepada pihak sekolah untuk menyediakan media pembelajaran seperti halnya computer dan LCD proyektor Ketiga, bagi peneliti mendatang, disarankan melakukan studi semacam ini dengan ketrampilan dan type teks yang berbeda.

Tari reyog Tulungagung sebagai sumber pengembangan gerak tari reyog mayoret dalam materi pengembangan diri seni tari di SMPN 1 Srengat Blitar / Novyta Mijil Purwana IS.

 

ABSTRAK Purwana, Novyta, Mijil. 2009. Tari Reyog Tulungagung sebagai Sumber Pengembangan Gerak Tari Reyog Mayoret dalam Materi Pengembangan Diri Seni Tari di SMPN 1 Srengat Blitar. Skripsi, Program Studi Pendidikan Seni Tari Jurusan Seni Desain Fakultas Sastra Universitas Negeri Malang. Pembimbing: (I) Drs. Soerjo Wido Minarto, M.Pd., (II) Drs. Supriyono. Kata Kunci: reyog tulungagung, reyog mayoret, pengembangan diri Kegiatan Pengembangan Diri di SMPN 1 Srengat Blitar merupakan kegiatan yang bertujuan untuk mengembangkan kemampuan siswa. Pencapaian yang diharapkan adalah kemampuan dalam menari dan pengalaman ketrampilan seni siswa.Materi yang digunakan adalah tari Reyog Mayoret yang bersumber dari tari Reyog Tulunggagung. Penulisan ini bertujuan mendeskipsikan struktur tari Reyog kendhang dan ragam geraknya serta memaparkan hasil dan proses penerapan pengambangan tari Reyog kendhang menjadi tari Reyog mayoret. Penelitian ini merupakan penelitian developmental atau penelitian pengembangan dengan mengembangkan tari tradisi daerah setempat menjadi bentuk tari pendidikan sebagai bahan ajar siswa dalam kegiatan pengembangan diri. Lokasi peelitian berada di SMPN 1 Srengat Blitar dengan subyek penelitian adalah siswa pengembangan diri kelas VII dan VIII. Tari Reyog Mayoret mengembangkan beberapa gerak dari Reyog Tulungagung, yaitu gerak gembyangan, menthokan, andul, midhak kecik, ngungak sumur, gejoh bumi, baris, kejang dan lilingan. Berdasarkan penelitian hasil penelitian dapat disarankan agar dilakukan pengembangan tari berdasar Reyog Tulungagung lebih lanjut. Misalnya pengembangan dalam musik, busana dan property. Dalam penyampaian materi terhadap anak hendaknya tidak terlalu kaku atau jangan memaksakan suatu gerakan jika siswa mengalami kesulitan. Koreografer hendaknya membuat gerakan yang sesuai dengan karekteristik siswa.

Improving the ability of the third-year students of MA Tarbiyatul Wathon Gresik in writing narrative texts through peer feedback / Mohammad Faizal Mubarok

 

ABSTRACT Mubarok, Mohammad Faizal. 2009. Improving the Ability of the Third-Year Students of MA Tarbiyatul Wathon Gresik in Writing Narrative Texts through Peer Feedback. Thesis, English Language Education, Graduate Program, State University of Malang. Advisors: (I) Utami Widiati, M.A., Ph.D. (II) Prof. Drs. Bambang Yudi Cahyono, M.Pd, M.A., Ph.D. Key words: writing ability, narrative texts, peer feedback As a part of the stages in the writing process, feedback is crucial in assisting students to improve their writing. Students generally intend their texts to be read by their teacher in order to view how the teacher responds to their work and to learn from these responses to improve their drafts. However, based upon the preliminary study conducted in my English class, the third year students of MA Tarbiyatul Wathon Gresik, and my experience as an English teacher in that school, I had found that many of these students were incapable of improving their initial drafts particularly narrative drafts after gaining feedback from me, their teacher. The source for the students’ problem might lie in the ineffective feedback offered by me. In response to that problem, peer feedback in the form of revising checklists was proposed as the solution. The salient point of this strategy is that it mainly provides a means of improving the students’ initial drafts. For that reason, the present study, then, is intended to improve the ability of the third-year students of MA Tarbiyatul Wathon Gresik in writing narrative texts through peer feedback. To attain the purpose, I employed collaborative classroom action research as the design of this study following four stages: planning, implementing, observing, and reflecting. This study, furthermore, was only carried out within two cycles as the criteria of success had been attained in the second cycle. Each cycle comprised three meetings. The subjects of the research were the third-year students of MA Tarbiyatul Wathon Gresik of the 2008/2009 academic year. The data were collected through the following instruments: observation checklists, field notes, questionnaires, interview, and the students’ written work. The data taken from field notes and interview were analyzed qualitatively and descriptively, while the data through observation checklists, questionnaires and writing test were analyzed and presented quantitatively and descriptively. The result of this study illustrates that the implementation of peer feedback in teaching writing can improve the students’ writing skill and successfully encourage them to actively and enthusiastically take part in the teaching-learning process of writing. The students’ improvement in writing narrative texts was reflected on their writing achievement. Their writing achievement had met the criteria of success in that 26 students or 81% of the students obtained score equal to or greater than 60. In addition, in terms of the students’ involvement in the teaching-learning process, the students’ part-taking, interest and enthusiasm in the overall activities of the teaching-learning process were very good, or 87% of the students were actively involved in the teaching-learning process activities. It means that the criteria of success in terms of their participation in the teaching-learning process had been met. The implementation of peer feedback in the present study follows these procedures: (1) assigning students to groups of four, (2) inviting the students in groups of 4 to arrange the jumbled paragraphs into good order, (3) asking the students to take part in a teacher-students conference actively by giving comments related to the correct arrangement of the jumble paragraph, (4) having them write the topic within 1-5 minutes, (5) getting the students to write their initial plan, (6) asking them to compose their first draft, (7) discussing the meaning of items on revising checklist, (8) ordering them to read and offer feedback to the sample of the draft through the revising checklist sheet, (9) inviting the students to discuss the sample of the draft in the group, (10) ordering them to share ideas in conjunction with the students’ feedback to the selected draft as the class discussion, (11) having them read and give feedback on their peers’ drafts, (12) getting them to talk about each others’ drafts by giving comments and suggestion on their classmates’ drafts through elaborating on their checklists, (13) asking them to revise and improve their draft based on their peers’ feedback, and (14) ordering them to rewrite their drafts as their final draft. Referring to the strengths of implementing this strategy in the present study, I would like to suggest that peer feedback can be utilized as an alternative solution especially for English teachers who have similar problems in the teaching of writing. In implementing the strategy, nevertheless, the teachers are suggested to model and teach the students the way how to respond to their peers drafts before implementing the strategy, control the activities of peer feedback, group them based on their English performance, point to one of them to lead the discussion, activate the students’ participation in peer feedback activities, place their position as the facilitator in the teaching-learning process and set the time allocation properly especially in reading and offering feedback on the basis of the students’ ability. Meanwhile, for the future-researchers, they are recommended to conduct classroom action research by means of this strategy in the teaching of writing with other text types and expand their focus on all writing aspects: content, organization, grammar, vocabulary, and mechanics. They are also suggested to conduct this classroom action research by employing peer feedback in the teaching of other language skills.

Sifat organoleptik stick susu dengan menggunakan jenis susu yang berbeda / Yaumi Faizah

 

ABSTRAK Faizah, Yaumi. 2009. Sifat Organoleptik Stick Susu dengan Menggunakan Jenis Susu yang Berbeda. Tugas Akhir, Jurusan Teknologi Industri Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Ir. Budi Wibowotomo, M.Si, (II) Ir. Ummi Rohajatien, M. P. Kata kunci: stick, susu kambing, susu sapi, susu kedelai. Stick adalah makanan ringan (makanan camilan) yang digoreng dengan rasa gurih, aroma cukup kuat, teksturnya renyah, berbentuk batang panjang dan dengan warna kuning cerah. Stick yang banyak dipasarkan saat ini beraneka macam seperti stick keju (cheese stick) dan stick gurih. Stick keju menggunakan keju sebagai penguat rasa, aroma, tekstur dan warna. Sedangkan, stick gurih yang beredar saat ini menggunakan penyedap rasa sebagai penguat rasa dan penyedap rasa kurang baik untuk kesehatan. Sebagai alternatif dapat digunakan bahan yang dapat memperkuat rasa, aroma, tekstur dan warna stick. Bahan tersebut berupa susu. Susu merupakan sumber protein, lemaknya dapat memberikan rasa gurih dan dapat sebagai alternatif rasa gurih, aroma yang kuat, dan membantu pembentukan tekstur stick. Selain lemak kandungan karbohidrat dalam susu dapat memberikan warna pada stick jika bereaksi dengan panas. Susu yang digunakan dalam penelitian ini adalah susu kambing, susu sapi dan susu kedelai. Ketiga susu tersebut dipilih karena memiliki kandungan lemak dan karbohidrat yang bervariasi dan aroma yang kuat. Penelitian ini merupakan penelitian eksperimen dalam pembuatan stick yang menggunakan jenis susu yang berbeda, yaitu susu kambing, susu sapi, dan susu kedelai. Tujuan penelitian ini adalah untuk mengetahui sifat organoleptik stick susu yang meliputi rasa, aroma, tekstur dan warna. Data hasil penelitian diperoleh dari hasil pengisian format penilaian uji organoleptik, yaitu meliputi uji mutu hedonik dan uji hedonik. Data akan dianalisis menggunakan analisis sidik ragam dan Duncan’s Mutiple Range Test (DMRT). Panelis yang digunakan adalah panelis agak terlatih sebanyak 20 orang dengan tiga kali pengulangan. Hasil uji mutu hedonik menunjukkan bahwa terdapat perbedaan yang sangat nyata terhadap rasa, aroma, tekstur, dan warna dengan menggunakan susu kambing, susu sapi dan susu kedelai. Rasa yang paling gurih (3,62) diperoleh pada perlakuan yang menggunakan susu kambing. Aroma yang paling kuat (3,02) diperoleh pada perlakuan yang menggunakan susu kambing. Tekstur yang paling renyah (3,67) diperoleh pada perlakuan yang menggunakan susu kambing. Warna yang paling kuning cerah (3,87) diperoleh pada perlakuan yang menggunakan susu kedelai. Hasil uji hedonik menunjukkan bahwa stick yang menggunakan susu yang berbeda akan menghasilkan tingkat kesukaan panelis terhadap rasa, aroma, dan tekstur yang berbeda sangat nyata, sedangkan pada warna menunjukkan tidak berbeda nyata. Rasa yang paling disukai panelis (3,32) adalah stick yang menggunakan susu kambing. Aroma yang paling disukai panelis (2,97) adalah stick yang menggunakan susu kambing. Tekstur yang paling disukai panelis (3,38) adalah stick yang menggunakan susu kambing. Warna yang paling disukai panelis (2,85) adalah stick yang menggunakan susu sapi. Saran bagi peneliti selanjutnya, untuk meneliti tentang jenis susu lain yang dapat dijadikan alternatif pembuatan stick, misalnya susu yang berasal dari kacang-kacangan. Selain itu untuk mendapatkan hasil yang mempunyai rasa, aroma dan tekstur yang paling baik disarankan menggunakan susu kambing dan untuk menghasilkan warna stick kuning cerah disarankan menggunakan susu kedelai.

The effects of multimedia to assist the teaching of descriptive paragraph writing at SMP 37 Semarang / Nur Khamim

 

ABSTRACT Khamim, Nur. 2009. The Effects of Multimedia to Assist the Teaching of Descriptive Paragraph Writing at SMPN 37 Semarang. Thesis. Graduate Program in English Language Education, State University of Malang. Advisors: (1) Dr. Yazid Basthomi, M.A., (2) Drs. Fahrurrazy, M.A., Ph.D. Key words: multimedia, non-multimedia, effect, achievement, attitude This study was an investigation on the effects of media – multimedia and non-multimedia – on the writing ability of descriptive paragraph by seventh grade students of SMPN 37 Semarang in the 2008/2009 academic year. This study employed a quasi-experimental design. Eighty students selected from two hundreds and thirty eight students from two classes took part in this study. They were divided into two groups of control and experimental group based on their original classes. A pretest was given prior the treatment to know the initial mastery of writing ability to ensure the equality between groups. A posttest was administered after the experimentation to measure the effect of treatment. The other three instruments in this study were questionnaire, observation checklist, and observation field to predict students’ attitude (positive and negative) and motivation toward the implementation of the main treatment (multimedia). In order to compare the mean scores, an analysis of covariance (ANCOVA) was performed with the pre-test scores as the covariate. The analysis results indicated that multimedia had a significant effect on the writing score achievement, that was the students who exposed to the main treatment of multimedia gain higher scores on the overall scores and the aspects of adequacy and relevance of content, compositional organization, adequacy of vocabulary for purpose, and grammar as compared to the control variable of non-multimedia. In other words, the implementation of multimedia in writing class is more effective than non-multimedia to increase achievement. Concerning students’ attitude toward the implementation of multimedia in writing class, an analysis on the students’ answer in response to the questionnaire found that most of the students tended to have positive value to it. In the questionnaire which included five factors on the relationship between multimedia and English learning in the classroom – interesting manners, media effect on understanding learning content, media effect on learning atmosphere, factors influenced learning, and the application in real setting – almost all of the participants were strongly positive. Furthermore, the observations by collaborator found that the experimental group was more motivated than the control group which was indicated by the higher scale of active participation in the learning process. The pedagogical implications and suggestions for further research are presented in the final paper. A practical contribution of this study suggested that the use of multimedia in writing class may be favourable to English teaching and learning. Furthermore, this study also suggested several directions for future study related to the research design, the study coverage and homogeneity phenomenon of the experimental group after the treatment which was found in this study.

Pengaruh perubahan daya reaktif beban terhadap arus keluaran trafo / Zainul Arifin Aba

 

Kata Kunci: media pembelajaran, ensiklopedia, merakit PC Salah satu kompetensi dasar yang diajarkan di SMK 2 Singosari adalah merakit Personal Komputer. Kompetensi ini adalah kompetensi dasar yang harus dimiliki oleh siswa SMK 2 Singosari. Dari hasil wawancara dan observasi dengan guru mata pelajaran Teknik Komputer dan Jaringan, pada proses pembelajaran Merakit PC (Personal Computer) masih bersifat konvensional. Di mana pembelajaran di kelas masih menggunakan metode ceramah dan hanya menggunakan power point. Hal ini yang menyebabkan minat belajar dari siswa menjadi kurang. Selain itu juga siswa banyak yang tidak mengerti istilah-istilah yang ada pada materi Perakitan Personal Computer (PC). Hal ini ditunjukan pada hasil post-test rata-rata siswa yang menunjukan kurang dari KKM yaitu di bawah 75. Dalam pembelajaran di sekolah, ensiklopedia dapat menjadi referensi bagi guru dan siswa. Ensiklopedia memberikan penjelasan secara mendalam dari suatu istilah Tujuan pengembangan media ini adalah tersedianya media pembelajaran pada materi Merakit PC. Spesifikasi media ini terdapat penjelasan istilah dari materi, latihan soal, dan video tutorial. Pengembangan media ini merujuk pada model yang dikembangkan oleh Sadiman. Prosedur pengembangannya meliputi: (1) identifikasi kebutuhan; (2) perumusan tujuan; (3) perumusan butir-butir materi; (4) perumusan alat pengukur keberhasilan; (5) desain media; (6) pembuatan media; (7) validasi ahli ahli media dan materi; (8) uji coba; (9) revisi (10) modifikasi media; dan (11) media siap digunakan. Desain uji coba meliputi uji coba ahli media, ahli materi, uji coba kelompok kecil, dan uji coba lapangan. Instrumen yang digunakan berupa kuisioner/angket. Adapun jenis data pada penelitian ini adalah deskriptif kualitatif, yaitu penjabaran atau menggambarkan data yang ada di lapangan dengan metode angket. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis data yang sesuai untuk menganalisis hasil kuisioner adalah analisis deskriptif kualitatif dengan persentase jawaban pada masing-masing item. Hasil validasi ahli media dengan presentase kelayakan media 100%. Hasil validasi ahli materi dengan presentasi kelayakan materi 92,86%. Hasil uji coba kepada responden/siswa diperoleh hasil sebagai berikut: kelompok kecil 91,7% dan kelompok besar (lapangan) 92,05%. Dengan demikian dinyatakan bahwa media pembelajaran yang dikembangkan sudah memenuhi kriteria layak dan secara keseluruhan dinyatakan baik serta dapat diujicobakan lebih luas agar nantinya bisa digunakan dalam pembelajaran.

Perancangan saluran bawah tanah pada sisi out going trafo 20 KV / Dedi Trias Styawan

 

ABSTRAK Styawan, Dedi. Trias. 2009. Perancangan Saluran Bawah Tanah Pada Sisi Out Going Trafo 20 kV. Proyek Akhir. Jurusan Teknik Elektro Fakultas Teknik Uni versitas Negeri Malang. Pembimbing: (I) Drs. Puger Honggowiyono P., M.T. ( II) Arif Nur Afandi, S.T., M.T. Kata Kunci: Distribisi Listrik, Perancangan, Penghantar Bawah Tanah Untuk mengantisipasi ketidakstabilan dan kontinyuitas tenaga listrik, dituntut adanya peningkatan pelayanan sistem kelistrikan yang andal dan keamanan yang memadai, tanpa mengesampingkan segi keindahan serta peningkatan kapasitas yang sudah ada, maka sistem jaringan transmisi bawah tanah merupakan solusi terbaik untuk mengatasi perm asalahan diatas. Dibandingkan dengan transmisi udara, saluran bawah tanah sebenarnya mempunyai keunggulannya yang lebih menonjol, yaitu saluran bawah tanah tidak terpengaruh oleh cuaca buruk seperti taufan, hujan angin dan bahaya petir, sehingga kemungkina n terjadi gangguan akibat bencana alam tersebut sangat kecil. Perancangan saluran bawah tanah pada gedung G1, G2 dan G3 Fakultas T eknik Universitas Negeri Malang ini dimulai dari studi literature, digunakan untuk memahami bagaimana perancangan saluran baw ah tanah dapat dirancang dengan baik dan benar serta mematuhi peraturan-peraturan yang telah ditetapkan. Seperti penentuan kuat hantar arus pada penghantar, penentuan pembebanan, kapasiatas busbar dan fuse, perancangan grounding, perancangan PHB serta pene ntuan lokasi untuk perancangan saluran bawah tanah. Hasil perancangan di peroleh 5 tahap, (1) luas penampang yang dipakai pada saluran utama sebesar 25 mm2sedangkan untuk saluran cabang menggunakan penghantar dengan luas penampang 16 mm2, (2) Busbar yang dipakai dalam kotak PHB menggunakan konduktor tembaga persegi empat dengan luas penampang sebesar 99,1 mm2, (3) Untuk mendapatkan tahanan pentanahan 5 Ω digunakan batang elektroda sebanyak 4 batang, dengan kedalaman 5 m. Sedangkan pentanahan peralatan men gunakan sistem PNP, (4) fuse utama dan fuse cabang di sesuaikan dengan arus masing-masing beban atau KHA terus-menerus dari fuse sama dengan nilai arus pengenalnya , (5) perancangan PHB TR disesuaikan dengan standar PLN.

Sistem keamanan tempat penyimpan uang dengan menggunakan RFID dan kata kunci / Muh. Ali Mufrodi

 

ABSTRAK Mufrodi, Muh. Ali. 2009. Sistem Keamanan Tempat Penyimpan Uang dengan Menggunakan RFID dan Kata Kunci. Tugas Akhir Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Dyah Lestari S.T., M.Eng. (II) Hary Suswanto S.T., M.T. Kata Kunci: Sistem Keamanan Tempat Uang, Kartu RFID, Mikrokontroler AT89S51 Perkembangan teknologi yang semakin maju mempermudah manusia dalam menjalankan aktivitas. Salah satu bentuk pengembangan teknologi yakni sistem keamanan tempat penyimpan uang yang dapat diakses secara otomatis. Sistem keamanan tempat penyimpan uang sekarang ini masih dilakukan secara manual dan waktu yang dibutuhkan terlalu lama, seperti sistem keamanan tempat penyimpan uang dengan kunci berkode dan kunci gembok. Sistem keamanan tempat penyimpan uang dengan kunci berkode saat ini masih banyak kelemahannya diantaranya pengunciannya terlebih dahulu mencocokkan nomer yang diinginkan dengan cara manual dan membutuhkan waktu yang lebih lama. Sedangkan menggunakan kunci gembok masih banyak kelemahannya juga diantaranya pengunciannya masih memakai kunci. Maka penggunaan tenaga manusia dapat digantikan dengan menggunakan elektronik yang lebih efisien dan efektif. Dengan alat yang dilengkapi keamanan menggunakan RFID dapat digunakan dengan mudah dalam penyimpanan maupun pengambilan uang. Prinsip kerja dari desain Sistem Keamanan Tempat Penyimpan Uang menggunakan RFID dan Kata Kunci ini adalah, apabila kartu RFID didekatkan dengan pembaca RFID maka penbaca RFID akan mendeteksi nomer kartu yang tersimpan di dalam mikroprosesor kartu, kemudian nomer kartu dikirimkan ke mikrokontroler AT89S51 melalui pin serial. Hasil pembacaan pembaca RFID akan diproses mikrokontroler yang sudah berisi basis data, Apabila data yang dibaca pada kartu RFID terdeteksi oleh mikrokontroler, maka pintu tempat penyimpan uang akan terbuka, pintu tempat penyimpan uang akan tertutup setelah kartu RFID didekatkan kembali. Jika kartu RFID tidak terdeteksi maka alarm akan berbunyi. Kesimpulan dari hasil penelitianini adalah sebagai berikut; RFID bisa digunakan sebagai piranti pengenal pada objek yang telah terdaftar atau sesuai dengan data yang ada pada mikrokontroler. Kemudian mikrokontroler akan menggerakkan motor DC untuk membuka atau menutup pintu loker jika RFID Reader mendeteksi kartu RFID yang terdaftar.

Manajemen penyelenggaraan pendidikan model kelas layanan khusus (Studi multisitus di SDN Kotalimo 10 Mekar dan SDN Tanjungan 5 Mekar) / M. Shodiq Abdul Wahid

 

ABSTRAK M. Shodiq, A.W. 2008 . Manajemen Penyelenggaraan Pendidikan Model Kelas Layanan Khusus (Studi Multisitus di SDN Kotalimo 10 Mekar dan SDN Tanjungan 5 Mekar). Disertasi, Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Willem Mantja, M.Pd, (II) Prof. Dr. Salladien, (III) Prof. Dr. H. Ibrahim Bafadal, M.Pd Kata-kata kunci: manajemen sekolah, sekolah dasar, kelas layanan khusus (klk) Pemerintah senantiasa berupaya agar program pendidikan wajib belajar 9 tahun berhasil dengan baik. Keberhasilan itu salah satunya ditandai dengan terbukanya kesempatan bagi semua golongan masyarakat untuk mendapatkan layanan pendidikan. Fakta di lapangan menunjukkan bahwa masih ada masyarakat dari golongan ekonomi lemah yang tidak dapat mengeyam dan melanjutkan pendidikan dasar – termasuk dalam kategori ini adalah anak-anak rawan putus sekolah yang bekerja di jalanan. Berbagai pendekatan telah dilakukan agar anak-anak tersebut bisa mendapatkan pendidikan dasar sebagaimana anak-anak usia sekolah lainnya. Kelas Layanan Khusus (KLK) adalah salah satu dari program pemerintah yang dilaksanakan di beberapa kota untuk memberikan layanan pendidikan bagi anak-anak dengan kondisi tersebut di atas. Keberhasilan salah satu SD di Kota Mekar dalam menyelenggarakan program KLK ini menjadikan SD tersebut sebagai percontohan nasional dalam penyelenggaraan KLK. Hal ini terbukti dengan kepercayaan pemerintah pusat untuk menambah sebuah lokasi lagi di kota yang sama sebagai penyelenggara program KLK. Atas dasar keberhasilan inilah dilakukan penelitian untuk mengetahui manajemen pengelolaan KLK pada dua SD tersebut. Adapun tujuan yang akan dicapai dalam penelitian ini adalah: (1) mendeskripsikan peran kepala sekolah pendidikan model Kelas Layanan Khusus di kedua lokasi penelitian (2) mendiskripsikan pola pengadaan tenaga pendidikan model Kelas Layanan Khusus di sekolah dasar ke dua lokasi penelitian. (3) mendiskripsikan pola rekruitmen, pengelolaan dan evaluasi peserta didik pendidikan model Kelas Layanan Khusus di sekolah dasar di kedua lokasi penelitian, yang meliputi: a) mendiskripsikan kendala-kendala yang dihadapi pengelola program dalam melaksanakan Kelas Layanan Khusus, b) mendiskripsikan upaya-upaya yang dilakukan oleh pengelola program dalam mengatasi kendala-kendala yang ditemui dalam melaksanakan Kelas Layanan Khusus. (4) mendeskripsikan peran masyarakat dalam pengelolaan pendidikan Kelas Layanan Khusus di kedua lokasi penelitian. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi multisitus pada SDN Kutolimo 10 Mekar dan SDN Tanjungan 5 Mekar. Sebagai informan adalah kepala sekolah, guru, dewan sekolah, tokoh masyarakat, orang tua siswa dan petugas pada unit pelaksana teknis dinas pendidikan kecamatan. Teknik analisa data, induktif deskriptif dengan alur reduksi data, penyajian data, dan penarikan kesimpulan, untuk data digunakan uji trianggulasi. Penelitian berbentuk multisitus, maka ada dua analisis data yang digunakan yaitu analisis dalam situs dan analisis lintas situs. Temuan penelitian ini menunjukkan bahwa: (1) peran kepala sekolah di kedua lokasi penelitian dapat ditandai dengan beberapa ciri yaitu: memiliki kemampuan memahami visi atau tujuan dari KLK dan menyampaikannya kepada orang lain, melibatkan sumber daya yang ada untuk mencapai tujuan, totalitas dalam pekerjaan dan memberi teladan kepada staffnya, melakukan evaluasi dan analisis program serta menyelesaikan masalah yang ada (2) pengadaan guru pada KLK melalui proses seleksi dan pelatihan, selanjutnya para guru mendapatkan kompensasi baik berupa materi maupun non materi. (3) pola rekruitmen dalam pencarian peserta didik (siswa) adalah dengan cara menelusuri buku induk yang ada di sekolah dan selanjutnya dilakukan pengecekan di lapangan yang dibantu oleh tokoh agama dan tokoh masyarakat, a) kendala yang dihadapi oleh pengelola KLK adalah, masalah motivasi belajar siswa, adanya siswa yang menjadi tulang punggung keluarga dalam mencari nafkah, atau hidup sendiri serta menjadi kelompok-kelompok anak jalanan b) untuk mengatasi kendala tersebut pihak pengelola melakukan pendekatan informal dan personal kepada siswa dan orang tua serta melibatkan aparat keamanan ketika menyangkut permasalahan yang terkait dengan kelompok anak-anak jalanan, (4) adapun peran masyarakat dalam program KLK adalah mendukung keberadaan program, membantu mensosialisasikan dan merekrut calon peserta didik serta memberikan bantuan untuk ikut mengatasi permasalahan dalam pelaksanaan program KLK. Kesimpulan yang dapat diambil adalah pengelolaan pendidikan model Kelas Layanan Khusus di kedua situs melibatkan peran serta masyarakat dalam melakukan perekrutan siswa. Pendekatan personal dan informal dilakukan untuk mengatasi kendala yang ada seperti masalah motivasi siswa dan permasalahan ekonomi. Adapun untuk mengelola KLK dibutuhkan tenaga profesional yang dilakukan melalui perekruitan dan pelatihan serta diberikan kompensasi berupa materi dan non materi. Memperhatikan kesimpulan tersebut ada beberapa saran yang disampaikan yaitu: (1) Hendaknya Depdiknas Pusat khususnya PTKSD hendaknya menjalin kersama dan melibatkan institusi yang terkait ketika merumuskan perbaikan program KLK, misalnya: Departemen Sosial, karena permasalah peserta didik KLK tidak akan maksimal tanpa penanganan yang komprehensif dan menyeluruh yang melibatkan banyak pihak. (2) Keberhasilan program KLK sudah selayaknya mendapat dukungan Pemerintah Kota/Kabupaten, baik berupa dana maupun fasilitas yang mendukung serta kesejahteraan pengajar dan pengola KLK. Dinas Sosial hendaknya mendukung dengan melakukan pemberdayaan yang memandirikan orang tua siswa KLK secara ekonomi karena akan menjadi salah satu faktor yang sangat penting bagi keberhasilan program KLK. (3) Bagi Depdiknas Kota Mekar, keberhasilan kedua SDN tersebut bisa dijadikan percontohan untuk pengelolaan KLK di SD lainnya dan melakukan kajian khusus serta kerjasama dengan pihak lain, untuk membuka program sejenis yang bisa dilaksanakan oleh masyarakat – seperti diselenggarakan SD/MI swasta yang berminat, untuk itu diperlukan aturan, petunjuk teknis dan sosialisasi kepada institusi terkait seperti Pemerintah Kota dan parlemen daerah. (4) Kepala sekolah hendaknya melibatkan seluruh komponen yang ada agar bisa bekerja sama dengan baik dengan cara memahami visi dan misi dari program KLK, dengan melakukan pertemuan reguler dimana pada saat itu masing-masing pihak bisa memberikan perkembangan yang dicapai sehingga bisa dilakukan evaluasi dan diambil tindakan-tindakan yang dibutuhkan jika ada suatu permasalahan. (5) Keterilbatan Komite/Dewan Sekolah lebih ditingkatkan lagi terutama yang berhubungan dengan orang tua anak-anak yang belajar di KLK, karena idealnya kepala sekolah dan guru berfokus pada pengajaran peserta didik, sementara komite sekolah berfokus mencari dan menciptakan terobosan untuk pemberdayaan ekonomi orang tua peserta didik KLK. Dengan demikian dirapkan keberhasilan program KLK tidak bersifat temporer yaitu tidak hanya ketika peserta didik duduk di bangku SD tetapi juga ketika menginjak tingkatan pendidikan yang lebih tinggi. (6) Perlu adanya sosialiasi yang baik dari Dinas Pendidikan tentang program KLK sehingga diharapkan partisipasi masyarakat semakin besar dengan cara melibatkan dan mensinergikan program-program dari lembaga-lembaga swadaya masyarakat yang bergerak dalam pengentasan kemiskinan dan penanganan anak-anak jalanan.

Sifat organoleptik brownies kukus putih telur dengan menggunakan tiga margarin yang berbeda / Imroatul Amanah

 

Brownies kukus merupakan salah satu jenis cake, yang bersifat bantat dan berwarna coklat, lebih lembut dibanding dengan brownies panggang (oven). Penggunaan margarin pada brownies kukus putih telur berfungsi membentuk tekstur brownies lembut dan gurihnya lemak. Penggunaan margarin yang mempunyai ciri fisik dan kompisisi yang berbeda diduga dalam pembuatan brownies kukus putih telur menghasilkan rasa, tekstur, warna dan aroma brownies kukus putih telur dengan sifat organoleptik yang berbeda. Tujuan penelitian ini, untuk mempelajari penggunaan 3 margarin untuk menghasilkan brownies kukus putih telur yang disuka. Penelitian yang dilakukan adalah penelitian eksperimen, dengan menggunakan 3 margarin yang berbeda yang disimbulkan X, Ydan Z. Instrumen penelitian dalam uji organoleptik yaitu instrumen uji mutu hedonik dan instrumen uji hedonik yang berupa format uji penilaian terhadap rasa, warna, aroma dan tekstur brownies dengan penggunaan jenis margarin yang berbeda. Teknik pengumpulan data dengan mengisi format penilaian uji mutu hedonik dan uji hedonik yang masing-masing dilakukan oleh panelis. Panelis yang digunakan adalah panelis agak terlatih. Panelis yang digunakan mahasiswa D3 Tata Boga angkatan 2006 yang ditentukan secara acak sejumlah 20 orang. Teknis analisis data yang dilakukan adalah Analisis Sidik Ragam,jika pada hasil terdapat perbedaan yang sangat nyata yaitu jika Fhitung > Ftabel maka analisis data dilanjutkan dengan Duncan’s Multiple Test (DMRT). Hasil uji mutu hedonik rasa manis dan aroma harum margarin dicapai oleh brownies kukus putih telur yang menggunakan margarin Y, tekstur padat berongga kecil dicapai oleh brownies kukus putih telur yang menggunakan margarin Z, warna coklat dicapai oleh brownies kukus putih telur yang menggunakan margarin X. Hasil uji hedonik menunjukkan bahwa terdapat pebedaan yang sangat nyata terhadap tingkat kesukaan rasa, tekstur, warna dan aroma brownies kukus putih telur yang menggunakan 3 margarin yang disimbulkan dengan X, Y dan Z. Rasa dan aroama yang paling disuka pada brownies kukus putih telur yang menggunakan margarin Y, tekstur yang paling disuka pada brownies kukus putih telur yang menggunakan margarin Z dan warna yang paling disuka pada brownies kukus putih telur yang menggunakan margarin X. Kesimpulan dari penelitian ini adalah brownies kukus putih telur menggunakan margarin Y yang menghasilkan rasa manis dan aroma harum margarin yang disuka. Tetapi kelemahannaya ialah warnanya yang kurang coklat dan tekstur yang masih berongga besar. Saran yang diajukan untuk peneliti selanjutnya memperbaiki tekstur yang masih berongga besar dan jenis coklat yang baik dalam pembuatan brownies kukus putih telur.

Alat pendeteksi kebocoran gas LPG dengan informasi SMS / Sigit Hariadi Putra

 

Satunya faktor kegalan konversi minyak ke gas LPG adalah ketakutan akan bahaya gas LPG karena sifat gas LPG yang mudah terbakar. Kebanyakan kasus kebakaran akibat gas LPG selama ini, terjadi akibat kelalaian manusia itu sendiri dan kurangnya sosialisasi dari pemerintah mengenai tabung gas LPG menjadi faktor utama dari kelalaian manusia tersebut. Berdasarkan permasalahan bahaya gas LPG maka diperlukan alat yang bermanfaat bagi konsumen gas LPG tersebut. Alat ini berfungsi mendeteksi gas LPG pada regulator, selang, dan tabung gas LPG bila mengalami kebocoran dengan dilengkapi informasi SMS. Alat ini juga dilengkapi indikator bahaya (lampu dan alarm) yang berfungsi sebagai pengaman. Penggunaan informasi SMS ini diperuntukkan untuk konsumen gas LPG yang mempunyai banyak aktifitas di luar, yang senantiasa menggunakan atau membawa HP. Sehingga alat ini bersifat fleksibel dan mempunyai manfaat bagi konsumen yang mempunyai orientasi kegiatan di dalam atau di luar rumah. Prinsip kerja alat ini dimulai dari sensor gas yang mendeteksi adanya gas LPG pada selang, regulator, dan tabung. Bila terjadi kebocoran maka sensor gas akan mendeteksi adanya gas LPG dan mengeluarkan tegangan. Agar tegangan keluaran sensor gas yang bersifat analog dapat dibaca oleh mikrokontoler yang bersifat digital, maka tegangan tersebut dikuatkan oleh penguat pembanding (komparator). Komparator berfungsi membandingkan tegangan keluaran sensor gas dengan tegangan referensi dan mengubahnya menjadi logika digital pada pin keluaran komparator. Keluaran dari komparator lalu dimasukan ke mikrokontoler untuk di proses. Kemudian keluaran mikrokontroler mengirim data ke HP pengirim melalui antarmuka dan mengaktifkan indikator bahaya. Selanjutnya HP pengirim akan mengirim SMS ke HP penerima (konsumen LPG). Dari hasil pengujian dan pembahasan “Alat Pendeteksi Kebocoran Tabung Gas LPG Dengan Informasi SMS” dapat diambil kesimpulan bahwa, alat dapat berjalan sesuai dengan yang direncanakan yaitu dapat mendeteksi kebocoran gas LPG dan menginformasikan dalam bentuk SMS. Dalam pengembangan selanjutnya dapat dilakukan beberapa hal untuk kesempurnaan alat diantaranya sebagai berikut: Sebaiknya alat tidak hanya mengirim SMS saja melainkan juga menerima SMS, pengiriman SMS sebaiknya tidak hanya ke satu nomor saja melainkan ke banyak nomor, gunakan yang sensor yang lebih baik dari TGS 2610, gunakan kabel data asli dari HP pengirim, gas LPG tidak akan terbakar ataupun meledak asal tidak ada percikan api atau suhu panas yang mengenainya.

Sifat organoleptik hard candy jahe gajah (Zingiberis Rhizoma) dengan subtitusi jahe emprit (Zingiber majus Rumph.) / Linda Lestari

 

Hard candy adalah permen yang memiliki tekstur keras dan penampakan yang jernih. Bahan dasar penyusun hard candy meliputi gula (sukrosa), sirup glukosa, gula invert, flavor, pewarna, dan sebagainya. Jahe merupakan salah satu bahan yang dapat dimanfaatkan sebagai flavoring agents dalam pembuatan produk hard candy. Jahe gajah mempunyai rimpang besar, berwarna kuning atau kuning muda, seratnya sedikit dan lembut, aromanya kurang tajam, dan rasanya kurang pedas. Jahe emprit mempunyai rimpang yang agak pipih, berwarna putih, seratnya lembut, aromanya tidak tajam, dan rasanya pedas. Penggunaan jahe gajah saja dalam pembuatan hard candy dapat memberikan rasa yang tidak terlalu pedas dan flavor yang kurang kuat. Sedangkan penggunaan jahe emprit dalam pembuatan hard candy dapat memberikan rasa yang pedas dan flavor yang kuat, tetapi penggunaan jahe emprit saja dapat menghasilkan rasa hard candy yang sangat pedas. Jika jahe emprit ditambahkan dengan air, maka flavor yang dihasilkan tidak kuat. Penelitian ini bertujuan untuk mengetahui pengaruh substitusi jahe emprit terhadap jahe gajah dalam hard candy. Penelitian ini dilakukan di Laboratorium Tata Boga Gedung H4 Universitas Negeri Malang. Jenis penelitian ini adalah penelitian eksperimen dengan menggunakan pengulangan sebanyak 3 kali. Data hasil penelitian diperoleh dari hasil pengisian format penilaian uji organoleptik, yaitu meliputi uji mutu hedonik dan uji hedonik. Panelis yang digunakan adalah mahasiswa DIII Tata Boga Universitas Negeri Malang angkatan 2006 sebanyak 20 orang yang dipilih secara acak. Analisis hasil penelitian yang dipakai adalah analisis sidik ragam yang dilanjutkan dengan analisis Duncan Multiple Range Test (DMRT) 5% dan 1% apabila dari analisis sidik ragam terdapat perbedaan nyata (Fhitung > Ftabel). Substitusi jahe emprit yang digunakan dalam perlakuan adalah substitusi sebanyak 10%, 20%, 30%, dan 40%. Hasil uji mutu hedonik menunjukkan bahwa substitusi jahe emprit berpengaruh terhadap flavor, rasa, warna, dan kejernihan hard candy. Flavor hard candy jahe gajah substitusi jahe emprit, nilai rerata skor tertinggi (3,27) terdapat pada perlakuan D (hard candy jahe gajah substitusi jahe emprit 40%). Rasa hard candy jahe gajah substitusi jahe emprit, nilai rerata skor tertinggi (3,40) terdapat pada perlakuan D (hard candy jahe gajah substitusi jahe emprit 40%). Warna hard candy jahe gajah substitusi jahe emprit, nilai rerata skor tertinggi (3,28) terdapat pada perlakuan D (hard candy jahe gajah substitusi jahe emprit 40%). Kejernihan hard candy jahe gajah substitusi jahe emprit, nilai rerata skor tertinggi (3,07) terdapat pada perlakuan A (hard candy jahe gajah substitusi jahe emprit 10%). Hasil uji hedonik menunjukkan bahwa flavor hard candy jahe gajah substitusi jahe emprit yang disukai lebih dari setengah panelis (75%) adalah hard candy jahe gajah substitusi jahe emprit 30% (perlakuan C). Rasa hard candy jahe gajah substitusi jahe emprit yang disukai lebih dari setengah panelis (70%) adalah hard candy jahe gajah substitusi jahe emprit 30% (perlakuan C). Warna hard candy jahe gajah substitusi jahe emprit yang disukai lebih dari setengah panelis (73,33%) adalah hard candy jahe gajah substitusi jahe emprit 10% (perlakuan A). Kejernihan hard candy jahe gajah substitusi jahe emprit yang disukai sebagian besar panelis (81,67%) adalah hard candy jahe gajah substitusi jahe emprit 10% (perlakuan A).

Optimalisasi penjadwalan pada proyek pembangunan gudang dan DC Indomaret Jl. Mayjen Sungkono Buring Malang / Amelia Putri Purnamasari

 

ABSTRAK P. Putri, Amelia.2009. Optimalisasi Penjadwalan Pada Proyek Pembangunan Gudang dan DC Indomaret Jl. Mayjen Sungkono Kecamatan Buring Malang. Proyek Akhir, Program Studi Teknik Sipil dan Bangunan, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: Imam Alfianto, S.T., M.T. Kata kunci : penjadwalan, optimalisasi Penjadwalan merupakan alat mutlak yang diperlukan guna menyelesaikan suatu proyek. Untuk proyek berskala kecil, yang hanya memiliki beberapa kegiatan, umumnya penjadwalan hanyalah dibayangkan saja ( di dalam kepala atau pikiran) sehingga penjadwalan tidak begitu mutlak dilakukan. Akan tetapi berbeda masalahnya pada proyek berskala besar, di mana jumlah kegiatannya yang sangat besar serta rumitnya ketergantungan (keterkaitan) antar kegiatan sehingga tidak mungkin lagi bila hanya diolah di dalam pikiran. Penjadwalan dan kontrol menjadi rumit dan sangat penting supaya kegiatan dapat dilaksanakan dengan efisien. Data diperoleh dengan cara observasi dan wawancara, Pengumpulan data dilakukan dua tahap, tahap pertama data dikumpulkan dengan metode wawancara untuk memperoleh data tentang durasi pelaksanaan beserta efisiensi biaya yaitu data tentang kegiatan yang terjadi di lapangan setiap harinya serta tentang besarnya biaya pelaksanaan pekerjaan gudang dan kantor Indomaret yang sebenarnya di lapangan, yang meliputi volume pekerjaan, harga bahan, upah kerja dan harga satuan pekerjaan yang dilaksanakan di lapangan. Dari hasil penelitian yang telah dilakukan dapat diambil kesimpulan bahwa proyek dapat diselesaikan tepat waktu dengan optimalisasi penjadwalan yaitu dengan mereduksi waktu pelaksanaan yang ada dengan jumlah sumberdaya tetap antara kontraktor dan penulis. Dari perhitungan di dapat bahwa total biaya kontraktor Rp.377,130,000.00 dan penulis Rp. 355,658,333.33 dengan keuntungan 5,82% lebih besar dari kontraktor. Berdasarkan kesimpulan di atas penulis dapat memberikan saran kepada perencana bangunan adalah dalam merencanakan bangunan harus memperhatikan aspek-aspek seperti mobilisasi sumber daya (bahan, alat, tenaga kerja) yang sering terlambat, keahlian dan ketrampilan serta motivasi kerja para pekerja - pekerja ,jumlah pekerja yang kurang memadai atau sesuai dengan aktivitas pekerjaan yang ada, tersedianya bahan secara cukup pasti atau layak sesuai kebutuhan, tersedianya alat atau peralatan kerja yang cukup memadai atau sesuai kebutuhan, kelalaian atau keterlambatan oleh sub kontraktor pekerjaanharus dikendalikan, pendanaan kegiatan proyek yang tidak terencana dengan baik (kesulitan pendanaan di kontraktor) harus di antisipasi sebelumnya dan melakukan perhitungan dengan berdasarkan analisa Soedrajat sehingga menghasilkan perhitungan yang paling optimal.

Pemilihan lightning arrester sebagai pengaman surja petir pada GTT 20 KV / Ricky Vendi Sugiyono

 

ABSTRAK Sugiyono, Ricky. Vendi. 2009. Pemilihan Lightning Arrester Sebagai Pengaman Surja Petir Pada GTT 20 kV. Tugas Akhir. Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Drs. Sujono,M.T. ( II) Ahmad Fahmi,S.T.,M.T. Kata Kunci: Distribusi Listrik, Pemilihan, Lightning Arrester Keinginan untuk mewujudkan suatu kebutuhan dengan laju perkembangan teknologi dan kebutuhan itu sendiri adalah hal yang sangat mutlak di inginkan setiap suatu lembaga demi kemajuan lembaga tersebut. Hal tersebut yang mendasari suatu lembaga pendidikan membangun sarana demi kelangsungan kelancaran operasional pembelajarannya. Mengantisipasi ketidakstabilan dan kontinyuitas tenaga listrik, dituntut adanya peningkatan pelayanan sistem kelistrikan yang andal dan keamanan yang memadai. Gangguan akibat surja petir sangatlah bernahaya bagi alat – alat yang ada pada GTT maupun bagi kontinuitas sistem. Di Indonesia sendiri ganggua petir sangatlah besar intensitasnya. Sehingga Pengamanan terhadap petir itu sendiri haruslah sangat tepat dan efisien Pemilihan Ligthning Arrester pada GTT 20 kV di gedung G4 Fakultas Teknik Universitas Negeri Malang ini dimulai dari studi literatur, dengan baik dan benar serta memahami bagaimana pemilihan Lightning Arrester di pilih berdasarkan peraturan yang telah ditetapkan. Seperti karakterisrik gelombang petir di Indonesia, karakteritik pengamanan dari masing – masing jenis arrester, penentuan tegangan pengenal arrester, dan tipe arrester. Hasil pemilihan di peroleh 3 tahap, (1)karakteritik pengamanan arrester yang tepat untuk perlindugan trafo di GTT adalah karakteristik arester tipe katup dengan perlindungan margin 20% dibawah BIL, (2) tegangan pengenal arester didapatkan sebesar 25 kV dengan tegangan pelepasaan sebesar 116 kV, (3) untuk jenis arrester sendiri dipilih jenis arester tipe katup berdasarkan pertimbangan pertimbangan – pertimbangan yang telah dilakukan.

Peningkatan kemampuan menulis cerpen dengan memanfaatkan media komik siswa kelas III SDK Santo Fransiskus Lawang-Malang / Maria Margaretha Novi Kartikasari

 

ABSTRAK Kartikasari, Maria Margaretha Novi. 2009. Peningkatan Kemampuan Menulis Cerpen dengan Memanfaatkan Media Komik Siswa Kelas III SDK Santo Fransiskus Lawang-Malang. Skripsi Progam Studi Pendidikan Bahasa dan Sastra Indonesia & Daerah Jurusan Sastra Indonesia Fakultas Sastra Universitas Negeri Malang. Pembimbing: Dr. Hj. Yuni Pratiwi, M.Pd. Kata Kunci: menulis, cerpen, komik Bahasa Indonesia adalah mata pelajaran yang wajib dilaksanakan sejak siswa menempuh pendidikan dasar hingga ke jenjang sekolah lanjutan atas. Pengajaran Bahasa Indonesia perlu dilakukan sejak dini. Pengajaran Bahasa Indonesia diarahkan untuk meningkatkan kemampuan berkomunikasi secara lisan dan tulis dengan baik dan benar. Mata pelajaran Bahasa Indonesia dilaksanakan melalui pengembangan empat keterampilan berbahasa, yakni mendengar, menulis, berbicara, dan membaca. Masalah yang dikeluhkan oleh guru kelas III SDK Santo Fransiskus adalah rendahnya kemampuan siswa dalam menulis, terutama pembelajaran menulis cerpen. Masalah-masalah yang ditemukan antara lain, (1) siswa belum mampu mengembangkan tema ke dalam bentuk cerpen, (2) siswa belum mampu menggunakan kalimat langsung dan kalimat tidak langsung, (3) siswa belum mampu menggunakan ejaan, huruf kapital, dan (4) siswa belum mampu mengembangkan unsur pembangun cerpen. Rumusan masalah dalam penelitian ini adalah, (1) bagaimanakah tindakan dan hasil peningkatan kemampuan menulis cerpen dengan memanfaatkan media komik siswa kelas III SDK Santo Fransiskus Lawang-Malang pada tahap pramenulis, (2) bagaimanakah tindakan dan hasil peningkatan kemampuan menulis cerpen dengan memanfaatkan media komik siswa kelas III SDK Santo Fransiskus Lawang-Malang pada tahap menulis, dan (3) bagaimanakah tindakan dan hasil peningkatan kemampuan menulis cerpen dengan memanfaatkan media komik siswa kelas III SDK Santo Fransiskus Lawang-Malang pada tahap pascamenulis? Penelitian ini dilakukan di SDK Santo Fransiskus Lawang-Malang, difokuskan pada siswa kelas III sebagai subjek penelitian. Rancangan penelitian yang digunakan adalah Rancangan Penelitian Tindakan Kelas (PTK). Data yang digunakan berupa data verbal, data perilaku siswa dalam pembelajaran menulis, data numerik yang berupa skor hasil pada tahap pramenulis, menulis, dan pasca menulis, dan data nonverbal yang berupa dokumentasi foto siswa. Instrumen yang digunakan dalam penelitian ini, yakni lembar observasi dan angket. Penelitian ini dilakukan hingga dua siklus untuk mencapai tujuan penelitian, yaitu peningkatan kemampuan menulis cerpen dengan memanfaatkan media komik. Hasil penelitian ini menunjukkan bahwa media komik dapat meningkatkan kemampuan menulis cerpen. Pada siklus I tahap pramenulis dari 32 siswa yang mendapat tindakan 24 siswa dikatakan berhasil mencapai nilai diatas SKM (>70), dengan rincian 10 siswa mencapai kriteria sangat baik dengan rentangan nilai 100-86 dan 13 siswa mencapai kriteria baik dengan rentangan nilai 80-73. Dalam tahap pramenulis masih terdapat 9 siswa yang mendapat nilai dibawah SKM (<70), dengan rincian 8 siswa mencapai kriteria cukup dengan rentangan nilai 66-60, serta 1 siswa mencapai kriteria kurang dengan nilai 53. Pada tahap menulis didapatkan hasil dari 32 siswa yang mendapat tindakan hanya 15 siswa yang mendapat nilai diatas SKM (>70), dengan rincian 2 siswa mencapai kriteria sangat baik dengan rentangan nilai 100-90, dan 13 siswa mencapai kriteria baik dengan rentangan nilai 84-72. Dalam tahap ini ditemukan 17 siswa yang mencapai nilai dibawah SKM (<70), dengan rincian 16 siswa mencapai kriteria cukup dengan rentang nilai 64-60, serta 1 siswa yang mencapai kriteria kurang dengan nilai 44. Siklus II pada tahap pramenulis didapatkan hasil 23 siswa mencapai kriteria sangat baik dengan rentangan nilai 100-86, dan 9 siswa mencapai kriteria baik dengan rentangan nilai 86-73. Pada tahap menulis tidak ditemui siswa yang mencapai kriteria cukup dan kurang. Seluruh siswa memperoleh nilai diatas SKM (>70), dengan rincian 20 siswa mencapai kriteria sangat baik, dan 12 siswa mencapai kriteria baik. Pada siklus II didapatkan hasil semua siswa mengalami peningkatan nilai diatas SKM (>70). Berdasarkan data-data yang sudah dicapai pada siklus I dan siklus II, siswa sudah mampu menulis cerpen secara utuh dan padu dengan memanfaatkan media komik. Media komik dapat menjadi inspirasi bagi siswa, dengan bukti siswa menemukan judul, tema, tokoh, latar, dan alur dari media komik. Judul, tema, tokoh, latar, dan alur yang sudah ditemukan membantu siswa untuk berimajinasi dan menuliskan imajinasinya menjadi cerpen yang utuh dan padu. Berdasarkan hasil penelitian ini, disarankan untuk kepala sekolah dan guru agar memanfaatkan media komik sebagai salah satu media pembelajaran menulis cerpen, sebab komik merupakan bacaan yang digemari dan mudah dipahami siswa.

Pengembangan strategi domino dalam pembelajaran menulis cerpen siswa kelas X SMA Islam Malang tahun pelajaran 2008/2009 / Susi Budi Utami Yantias

 

ABSTRAK Yantias, Susi Budi Utami Yuli. 2009. Pengembangan Strategi Domino dalam Pembelajaran Menulis Cerpen Siswa Kelas X SMA Islam Malang Tahun Pelajaran 2008/2009. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: Prof. Dr. H. A. Syukur Ghazali, M.Pd Kata Kunci: pengembangan strategi Domino, pembelajaran menulis cerpen. Menulis cerpen adalah salah satu kompetensi dasar yang tertuang dalam Kurikulum Tingkat Satuan Pendidikan (KTSP) untuk bidang kesastraan khususnya pada pengajaran apresiasi prosa yang harus dikuasai siswa SMA kelas X. Dalam hal ini, siswa harus mampu menciptakan sendiri karya sastra melalui kegiatan menulis karangan berdasarkan pengalaman orang lain dalam bentuk cerpen. Bagi guru, pembelajaran menulis cerpen selama ini dianggap kurang berhasil karena butir-butir pembelajaran yang berkaitan dengan cerpen sulit untuk dikembangkan. Hal tersebut diakibatkan oleh pola pembelajaran yang digunakan oleh guru masih bersifat umum atau konvensional. Bagi siswa, pembelajaran menulis cerpen hanya untuk siswa yang menyenanginya saja sehingga yang lain merasa jenuh dan terbebani. Latar belakang inilah yang mendasari penelitian dengan judul Pengembangan Strategi Domino dalam Pembelajaran Menulis Cerpen Siswa Kelas X SMA Islam Malang Tahun Pelajaran 2008/2009. Penelitian ini dilakukan untuk (1) merancang produk awal pengembangan model strategi Domino dalam pembelajaran menulis cerpen, (2) menguji coba produk awal, dan (3) merevisi produk pengembangan model stategi Domino dalam pembelajaran menulis cerpen siswa SMA kelas X. Metode penelitian ini menggunakan rancangan pengembangan yaitu mengembangkan suatu model strategi pembelajaran dalam kegiatan menulis cerpen yang berwujud game atau permainan. Model strategi yang dikembangkan menggunakan permainan kartu domino. Pengembangan model strategi Domino dalam pembelajaran menulis cerpen diaplikasikan dalam rencana pelaksanaan pembelajaran (RPP), dan lembar kegiatan siswa (LKS). Untuk menghasilkan produk yang efektif dan efisien, maka produk tersebut diuji coba. Subjek uji coba dalam penelitian ini adalah uji ahli, uji praktisi, dan uji lapangan. Uji ahli melibatkan salah satu dosen ahli pembelajaran sastra. Uji praktisi melibatkan salah satu guru Bahasa dan Sastra Indonesia dari sekolah yang ditunjuk. Uji lapangan melibatkan siswa kelas X-E SMA Islam Malang sebanyak 35 orang. Hasil penelitian pengembangan model strategi Domino dalam pembelajaran menulis cerpen siswa SMA kelas X menunjukkan bahwa (1) strategi Domino dalam pembelajaran menulis cerpen terbagi menjadi tiga kegiatan yaitu kegiatan awal/pendahuluan, kegiatan inti, dan kegiatan akhir/penutup. Pada kegiatan awal guru melakukan kegiatan pemodelan dengan cara membaca model cerpen sehingga guru dapat melakukan proses interaktif antara guru-siswa, siswa dengan siswa. Pada kegiatan inti guru melakukan proses pembelajaran yang inspiratif dengan model strategi Domino yang berwujud game atau permainan yang memanfaatkan kartu domino, sehingga guru dapat memberikan kesempatan pada siswa untuk moncoba dan melakukan sesuatu. Permainan kartu domino ini digunakan untuk tahap penentuan tema, tokoh, latar, dan tahap pembuka cerpen. Dalam kegiatan inti, guru menekankan pada siswa untuk melakukan diskusi kelompok. Pada kegiatan akhir guru melakukan penilaian, pemublikasian hasil cerpen, dan refleksi, (2) strategi Domino sangat efektif untuk diterapkan dalam pembelajaran menulis cerpen, terbukti siswa mampu menulis cerpen dengan baik. Dalam hal ini, siswa mampu menulis cerpen dengan memilih dan mengembangkan tema berdasarkan ruang lingkup persoalan dalam kehidupan yang berbeda, sehingga hasil cerpen siswa sangat bervariasi, (3) strategi Domino sangat membantu siswa pada tahap pemilihan dan pengembangan tema, tokoh, alur, latar, dan sudut pandang, (4) dilihat dari pelaksanaannya, strategi Domino ini sangat praktis, dan (5) strategi Domino ini mampu menciptakan suasana yang menyenangkan bagi siswa dan dapat memotivasi siswa untuk belajar menulis cerpen. Kendala dari strategi Domino ini adalah pengalokasian waktu kurang teratur sehingga tugas-tugas harus diselesaikan sebagai tugas pekerjaan rumah (PR). Berdasarkan hasil penelitian ini, disarankan bagi guru pengajar Bahasa dan Sastra Indonesia yaitu (1) supaya guru dapat melaksanakan pembelajaran menulis kreatif khususnya pembelajaran menulis cerpen secara bervariasi dan terpadu serta memberi motivasi kepada siswa untuk berlatih menulis cerpen agar pembelajaran menulis cerpen tidak dianggap sulit dan menjemukan, sehingga mendapatkan hasil yang optimal, dan (2) berdasarkan hasil penelitian, guru disarankan dapat menggunakan model strategi Domino dalam pembelajaran menulis kreatif selain menulis cerpen, misalnya pada pembelajaran menulis dongeng, menulis naskah drama, dan menulis deskriptif.

Perancangan sistem pertanahan netral trafo pada gardu trafo tiang 20 KV dengan menggunakan tahanan tinggi / Didiet Wahyudianto

 

Hubungan supervisi pengajaran dan kompensasi kerja dengan kinerja guru Mts swasta di kota Malang / Nisfuana

 

ABSTRAK Nisfuana. 2009. Hubungan Supervisi Pengajaran dan Kompensasi Kerja dengan Kinerja Guru MTs Swasta di Kota Malang. Tesis, Program Studi Manajemen Pendidikan, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Hendyat Soetopo, M.Pd, (II) Prof. Dr. Willem Mantja, M.Pd. Kata kunci: supervisi, kompensasi, kinerja Guru adalah pengelola pembelajaran atau disebut pembelajar. Adapun faktor yang perlu diperhatikan oleh pembelajar adalah keterampilan mengajar, mengelola tahapan pembelajaran, dan memanfaatkan metode yang tersedia. Di dalam interaksi belajar mengajar, guru memegang kendali utama untuk keberhasilan tercapainya tujuan pembelajaran. Oleh sebab itu guru harus memiliki keterampilan mengajar, mengelola tahapan pembelajaran, memanfaatkan metode yang tersedia, menggunakan media dan mengalokasikan waktu. Kelima hal ini merupakan faktor pendekatan guru untuk mengkomunikasikan tindakan mengajarnya demi tercapainya tujuan pembelajaran. Keterampilan mengajar adalah sejumlah kompetensi guru yang menampilkan kinerjanya secara profesional. Kinerja merupakan prestasi yang dicapai oleh seseorang dalam melaksanakan tugasnya/pekerjaannya sesuai dengan standar dan kriteria yang yang telah ditentukan. Kinerja guru adalah unjuk kerja atau kegiatan yang dilakukan guru dalam rangka melaksanakan tugasnya sebagai guru. Adapun unsur kinerja yang baik bagi seorang guru pada dasarnya terlihat dari kemampuan dan keterampilannya dalam menyusun program pengajaran, melaksanakan pembelajaran, melaksanakan evaluasi, menganalisis hasil evaluasi, dan melaksanakan program perbaikan dan pengayaan. Pada pelaksanaannya kinerja akan sangat dipengaruhi oleh beberapa faktor baik yang bersumber dari pekerja sendiri maupun yang bersumber dari organisasi. Dari pekerja sangat dipengaruhi oleh kemampuan/ kompetensinya, sementara dari segi organisasi dipengaruhi oleh seberapa baik pemimpin memberdayakan pekerjanya, bagaimana mereka memberikan penghargaan pada pekerja, bagaimana mereka membantu meningkatkan kemampuan kinerja pekerja. Penelitian ini mengangkat supervisi pengajaran dan kompensasi kerja sebagai faktor yang mempengaruhi kinerja guru. Kedua hal tersebut telah dilaksanakan di lembaga MTs swasta di kota Malang, namun belum diyakini dapat mempengaruhi kinerja guru MTs swasta di kota Malang. Untuk dapat mengungkap keadaan tersebut, dalam penelitian ini dirumuskan permasalahan: (1) Bagaimanakah deskriptif supervisi pengajaran dan kompensasi kerja dengan kinerja guru MTs swasta di kota Malang?, (2) Apakah terdapat hubungan antara supervisi pengajaran dan kompensasi kerja dengan kinerja guru MTs swasta di kota Malang?, Selanjutnya ditentukan tujuan dari penelitian adalah untuk mendeskripsikan tentang hubungan supervisi pengajaran dan kompensasi kerja dengan kinerja guru MTs swasta di Kota Malang. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan penelitian survey jenis deskriptif korelasional untuk menggambarkan fenomena yang ada dan mengetahui hubungan variabel supervisi pengajaran (X1), kompensasi kerja (X2) dengan kinerja guru (Y) MTs swasta di Kota Malang. Ditentukan sejumlah 184 guru yang dijadikan sampel penelitian. Jumlah tersebut merupakan bagian dari populasi yang ditentukan dengan menggunakan tabel krejcie sejumlah 351 orang guru, yang tersebar di kota Malang. Pengolahan data dengan menggunakan tehnik korelasi untuk mengetahui koefisien korelasi dan signifikansi secara statistik. Hasil dari penelitian analisis deskripsi menunjukkan bahwa supervisi pengajaran dalam kategori tinggi 62,5% dan kategori sangat tinggi sebesar 30,4%, untuk kompensasi kerja pada kategori sedang sebesar 37,5%, kategori tinggi sebesar 37% dan kategori sangat tinggi sebesar 25,5% sedangkan untuk variabel kinerja guru pada kategori tinggi 57,6% dan sangat tinggi 42,4%. Selanjutnya dari hasil analisis inferensial menunjukkan bahwa variabel supervisi pengajaran (X1) berhubungan secara signifikan dengan variabel kinerja guru (Y) dengan p = 0,000, variabel kompensasi kerja (X2) berhubungan secara signifikan dengan variabel kinerja guru(Y) dengan p = 0,000. Artinya peningkatan variabel-variabel supervisi pengajaran, kompensasi kerja yang lebih baik, maka akan meningkatkan kinerja guru MTs swasta di kota Malang, karena koefisien korelasi bernilai positif. Bertitik tolak dari kenyataan hasil penelitian diatas menunjukkan bahwa supervisi pengajaran dan kompensasi kerja mempengaruhi kinerja guru MTs swasta di kota Malang. Namun begitu, beberapa hal masih dirasakan oleh peneliti terjadi di lembaga MTs swasta di kota Malang yaitu, pelaksanaan supervisi pengajaran belum bisa secara merata terhadap seluruh guru dan pemberian kompensasi kerja yang dirasakan belum bisa proporsional dan tepat waktu. Dengan demikian perlu kiranya mengatasi hal tersebut dan juga lebih meningkatkan prosentase serta kualitas pelaksanaannya, maka dapat disarankan: (1) Meningkatkan kegiatan pelaksanaan supervisi pengajaran dan melaksanakan seluruh teknik supervisi secara lebih merata terhadap seluruh guru, (2) Memberikan kompensasi kerja kepada guru secara proporsional dan tepat waktu, karena kedua langkah tersebut akan semakin meningkatkan kinerja guru MTs swasta di kota Malang.

Sifat organoleptik hard candy susu dengan jenis gula berbeda / Dian Prayogi

 

ABSTRAK Prayogi, Dian. 2009. Sifat Organoleptik Hard Candy Susu Dengan Jenis Gula Berbeda. Tugas Akhir. Program Studi Tata Boga Fakultas Teknik Universitas Negeri Malang. Pembimbing (1) Dra. Titi Mutiara Kiranawati, M.P. (2) Dra. Nunung Nurjanah, M.Kes. Kata Kunci : Hard Candy, Gula, Organoleptik Hard candy merupakan salah satu permen non kristalin yang dimasak dengan suhu tinggi (1500C). Sebagai produk confectionary, candy dibedakan menjadi dua golongan bedasarkan bahan bakunya diantaranya sugar confectionary yang berbahan dasar gula. Penelitian ini bertujuan untuk mengetahui mutu organoleptik hard candy susu. Jenis penelitian ini merupakan penelitian eksperimen dengan menggunakan gula yang berbeda yaitu gula aren, gula kelapa dan gula tebu. Pengamatan dilakukan terhadap sifat organoleptik yang meliputi rasa, warna, tekstur dan kebeningan dengan pengujian uji mutu hedonik dan uji hedonik oleh panelis. Panelis terdiri dari 20 orang agak terlatih dari mahasiswa D3 Tata Boga angkatan 2005-2006. Data dianalisis dengan menggunakan Analisis Sidik Ragam. Hasil analisis data yang berbeda nyata dilanjutkan dengan Duncan’s Multiple Range Test (DMRT) untuk mengetahui perbedaan masing-masing perlakuan. Hasil uji mutu hedonik menunjukkan bahwa terdapat perbedaan yang sangat nyata terhadap rasa, warna, tekstur dan kebeningan dengan jenis gula berbeda. Nilai rerata tertinggi untuk rasa 3,66 dengan jenis gula tebu yaitu manis. Nilai rerata tertinggi untuk warna 3,33 dengan jenis gula aren yaitu coklat cerah. Nilai rerata tertinggi untuk tekstur 3,76 dengan jenis gula tebu yaitu keras. Nilai rerata tertinggi untuk kebeningan 3,71 dengan jenis gula aren yaitu bening. Hasil uji hedonik terhadap hard candy susu menunjukkan bahwa rasa hard candy susu yang disukai panelis adalah hard candy susu dengan jenis gula tebu. Hasil uji hedonik terhadap hard candy susu menunjukkan bahwa warna yang disukai panelis adalah hard candy susu dengan jenis gula aren. Hasil uji hedonik terhadap hard candy susu menunjukkan bahwa tekstur yang disukai panelis adalah hard candy susu dengan jenis gula tebu. Hasil uji hedonik terhadap hard candy susu menunjukkan bahwa kebeningan yang disukai panelis adalah hard candy susu dengan jenis gula aren. Kesimpulan dari penelitian ini, yaitu : jenis gula yang berbeda akan menghasilkan hard candy susu dengan rasa, warna, tekstur, dan kebeningan yang berbeda sangat nyata. Hal tersebut dipengaruhi oleh adanya perbedaan jumlah kandungan sukrosa dan kadar abu pada setiap jenis gula.

Mutu organoleptik keripik telur ayam dengan penambahan bumbu soto instan kering / Ulfatur Rahmah Kurniawati

 

Bumbu soto merupakan bahan makanan yang dimanfaatkan masyarakat dalam memasak. Bumbu soto terbagi menjadi dua yaitu bumbu soto segar dan bumbu soto instan. Bumbu instan juga terbagi menjadi dua yaitu instan pasta dan instan kering atau bubuk. Bumbu soto memiliki kandungan oleoresin dan minyak atsiri yang menghasilkan aroma khas soto. Bumbu soto berfungsi memberikan flavour, warna dan tekstur pada keripik telur ayam. Bumbu soto segar dan bumbu soto instan kering memiliki keunggulan masing-masing. Penelitian ini merupakan penelitian eksperimen yang dilakukan terhadap keripik telur ayam dengan penambahan bumbu soto segar dan bumbu soto instan kering. Tujuan penelitian ini adalah untuk mengetahui mutu organoleptik (flavour, warna, tekstur) keripik telur ayam dengan penambahan bumbu soto segar dan bumbu soto instan kering. Panelis yang digunakan adalah panelis agak terlatih dari mahasiswa DIII Tata Boga sebanyak 30 orang. Analisis data yang digunakan adalah dengan uji t. Hasil penelitian pada uji mutu hedonik pada taraf signifikan 1% menunjukan adanya perbedaan pada flavour, warna dan tekstur antara keripik telur ayam bumbu segar dengan bumbu soto instan kering. Keripik telur ayam bumbu segar memiliki flavour soto kuat (skor rata-rata 3,2), warna coklat gelap (skor rata-rata 1,63), dan tekstur cukup renyah (skor rata-rata 2,67). Sedangkan keripik telur ayam bumbu soto instan kering memiliki flavour cukup kuat (skor rata-rata 2,47), warna coklat tidak gelap (skor rata-rata 3,57), dan tekstur renyah (skor rata-rata 3,53). Hasil penelitian uji hedonik menunjukan penambahan bumbu soto segar memberikan flavour dengan rata-rata tingkat panelis 3,4 (suka) dan 93,34% (sebagian besar) panelis menyukai, sementara penambahan bumbu soto instan memberikan warna dan tekstur yang disuka panelis. Sebanyak 100% (seluruhnya) panelis menyukai warna keripik telur ayam dengan rata-rata tingkat kesukaan panelis 3,6 (suka) dan sebanyak 90% (sebagian besar) panelis menyukai tekstur keripik telur ayam dengan rata-rata tingkat kesukaan panelis 3,47 (suka). Peneliti menyarankan kepada peneliti selanjutnya untuk melakukan penelitian pembuatan keripik telur ayam dengan penambahan bumbu soto instan kering guna menentukan flavour, warna, dan tekstur yang dikehendaki. Bagi masyarakat, produk keripik telur dapat dijadikan peluang usaha, dan bagi lembaga keripik telur ayam yang telah diteliti dapat dijadikan sebagai pengayaan materi matakuliah Teknologi Pengolahan Makanan Industri.

Using language games to improve the speaking ability of the second year students at SLTP Negeri 5 Manado (Classroom action research) / Anita Luisa Manoppo

 

Kontribusi penguasaan matakuliah prasyarat terhadap keberhasilan praktik industri mahasiswa DIII Tata Boga angkatan 2006 Universitas Negeri Malang / Merinda Kusmaningtyas

 

ABSTRAK Kusmaningtyas, Merinda. 2009. Kontribusi Penguasaan Matakuliah Prasyarat terhadap Keberhasilan Praktik Industri Mahasiswa DIII Tata Boga Angkatan 2006 Universitas Negeri Malang, Skripsi Jurusan Teknologi Industri Tata Boga, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Siswanto, M.A., (II) Dra. Teti Setiawati, M.Pd. Kata kunci : kontribusi, prasyarat, Praktik Industri Tenaga trampil siap pakai dapat terpenuhi apabila lembaga pendidikan khususnya perguruan tinggi, mampu menyiapkan lulusan yang menguasai bidangnya, baik ketrampilan maupun pengetahuan. Sebagai salah satu upaya yang ditempuh Perguruan Tinggi adalah dengan mewajibkan setiap mahasiswa untuk mengikuti matakuliah Praktik Industri. Agar tujuan tersebut dapat terlaksana maka, lembaga pendidikan khususnya perguruan tinggi perlu membekali peserta didik dengan pengetahuan dasar yang sesuai dengan yang dibutuhkan di dunia industri. Hal ini mendorong peneliti untuk meneliti tentang ”Kontribusi Penguasaan Matakuliah Prasyarat Terhadap Keberhasilan Praktik Industri Mahasiswa DIII Tata Boga Angkatan 2006 Universitas Negeri Malang”. Penelitian ini bertujuan untuk mengetahui kontribusi antara penguasaan matakuliah Prasyarat terhadap keberhasilan Praktik Industri pada mahasiswa DIII Tata Boga angkatan 2006 Universitas Negeri Malang. Adapun metode yang digunakan dalam penelitian adalah metode deskriptif kuantitatif dengan menggunakan analisis korelasional. Popolasi dalam penelitian ini adalah mahasiswa DIII Tata Boga angkatan 2006 yang sudah menempuh matakuliah Praktik Industri. Teknik pengumpulan data menggunakan teknik dokumentasi, kuesioner dan wawancara. Hasil penelitian menunjukan bahwa terdapat kontribusi secara simultan, antara penguasaan matakuliah prasyarat terhadap keberhasilan Praktik Industri sebesar 64,8%. Kontribusi secara parsial menunjukkan bahwa matakuliah yang paling dominan memberikan kontribusi adalah matakuliah Pastry sebesar 15,1%, selanjutnya matakuliah Bakery sebesar 14,5%, matakuliah Teknik Pengolahan Makanan Kontinental sebesar 12,8%, berikutnya matakuliah Teknik Pengolahan Makanan Indonesia sebesar 12,5% dan yang paling kecil memberikan kontribusi adalah matakuliah Teknik Pengolahan Makanan Oriental yaitu sebesar 9,9%. Ada beberapa saran yang diberikan bagi; (1) Dosen Tata Boga Universitas Negeri Malang, keberhasilan Praktik Industri akan lebih baik lagi, bila materi perkuliahan prasyarat Praktik Industri yang di ajarkan benar-benar disesuaikan dengan kebutuhan di tempat Praktik Industri, (2) Bagi Mahasiswa Tata Boga Jurusan Teknologi Industri Fakultas Teknik agar lebih termotivasi untuk mengikuti perkuliahan terutama matakuliah prasyarat Praktik Industri, karena matakuliah tersebut sangat penting, bermanfaat dan mempermudah mahasiswa dalam pelaksanaan matakuliah Praktik Industri, (3) Bagi Peneliti Lebih Lanjut sebagai bahan pembanding dan acuan bagi peneliti lain yang ingin meneliti hal yang serupa.

Penggunaan media majalah dinding dalam pembelajaran menulis siswa kelas V SDN Tlogowaru 2 Kecamatan Kedungkandang Kota Malang / Lestari Nuria Hati

 

Kemampuan berbahasa meliputi empat aspek, yakni menyimak, berbicara, membaca, dan menulis. Aspek keterampilan menulis sangat penting untuk dikuasai oleh siswa. Kemampuan menulis dibutuhkan dalam kehidupan sehari-hari untuk berkomunikasi dengan orang lain melalui bahasa tulis. Menulis bukan merupakan kemampuan yang instan, melainkan kemampuan yang tercermin dari pola pengajaran dan latihan yang dilakukan siswa. Oleh karena itu, pembelajaran menulis membutuhkan media yang mampu membantu siswa dalam proses menulis dan mencapai tujuan pembelajaran. Penelitian ini bermaksud untuk mendiskripsikan pembelajaran menulis menggunakan media majalah dinding. Secara rinci tujuan penelitian ini adalah untuk (1) mendeskripsikan strategi penggunaan media majalah dinding dalam pembelajaran menulis, (2) mendeskripsikan aktivitas siswa dalam pembelajaran menulis menggunakan media majalah dinding, dan (3) mendeskripsikan hasil pembelajaran menulis menggunakan media majalah dinding. Penelitian ini menggunakan metode deskriptif kualitatif. Subjek penelitian dalam penelitian ini adalah seluruh siswa kelas V SDN Tlogowaru 2 Kecamatan Kedung Kandang Kota Malang 2008-2009. Siswa berjumlah 8 orang. Data yang diperoleh peneliti berupa rekaman aktivitas penelitian. Rekaman aktivitas penelitian berupa tulisan dan gambar. Pengambilan data dilakukan dengan cara observasi, wawancara, pengisian angket. Instrumen penelitian yang digunakan dalam penelitian ini adalah lembar panduan observasi, panduan wawancara, angket, contoh-contoh materi menulis. Penelitian mencakup tiga kompetensi dasar yaitu, (1) menulis surat undangan (ulang tahun, acara agama, kegiatan sekolah, kenaikan kelas, dll) dengan kalimat yang efektif dan menggunakan ejaan, (2) menulis dialog sederhana antara dua atau tigatokoh dengan memperhatikan isi dan perannya, (3) menulis karangan berdasarkan pengalaman dengan memperhatikan pilihan kata dan penggunaan ejaan. Hasil penelitian menunjukkan siswa memperoleh hasil yang baik dalam pembelajaran menulis menggunakan media majalah dinding. Siswa menulis sesuai dengan tahapan menulis. Siswa mengikuti jalannya kegiatan pembelajaran dengan aktif. Siswa memiliki sumber inspirasi, referensi contoh karya tulis, dan wadah untuk memublikasikan karya. Siswa memiliki ketertarikan lebih dalam mengikuti tahapan menulis dengan menggunakan media majalah dinding. Pembelajaran menulis menggunakan media majalah dinding membutuhkan strategi yang tepat. Strategi digunakan agar tiap tahapan menulis dapat dilakukan dengan maksimal dan siswa mampu mencapai kompetensi dasar. Siswa aktif dalam mengikuti jalannya pembelajaran, sehingga siswa sungguh-sungguh dalam menulis dan mampu memperoleh nilai di atas SKM (60,1). Guru disarankan untuk menyiapkan strategi penggunaan majalah dinding dalam pembelajaran menulis agar mendapatkan hasil yang maksimal. Selain guru mata pelajaran bahasa dan sastra Indonesia, guru mata pelajaran lain juga disarankan untuk menggunakan majalah dinding sebagai media pembelajaran. Siswa disarankan untuk mengikuti kegiatan pembelajaran dengan sungguh, karena tidak semua sekolah memiliki atau memanfaatkan majalah dinding sebagi media pembelajaran.kepala sekolah disarankan menyediakan fasilitas berupa papan majalah dinding di dalam atau di luar kelas untuk membantu aktivitas belajar siswa. Peneliti lain disarankan untuk menggunakan hasil penelitian ini sebagai dasar, bahan pertimbangan, atau referensi dalam penelitian yang dilakukan tersebut.

Sifat organoleptik kerupuk rambak kelinci dengan lama perebusan yang berbeda / Ainiati Gamma Ridhi

 

Kerupuk rambak merupakan makanan ringan yang terbuat dari kulit hewan dan mempunyai sifat kering dan renyah. Penelitian ini merupakan penelitian eksperimen pembuatan kerupuk rambak kelinci dengan lama perubusan yang berbeda, yaitu 15 menit, 30 menit, 45 menit, dan 60 menit. Masing-masing perlakuan diulang sebanyak tiga kali. Tujuan penelitian ini adalah untuk mengetahui mutu organoleptik dan tingkat kesukaan terhadap kerupuk rambak kelinci yang meliputi tekstur, rasa, dan aroma. Eksperimen dilakukan pada bulan Juli 2009 di Laboratorium Tata Boga Gedung G3 lantai dua Universitas Negeri Malang. Data diperoleh dari panelis agak terlatih sebanyak 20 orang, yaitu mahasiswa D3 Tata Boga angkatan 2006 secara acak. Data dianalisis dengan analisis sidik ragam dan Duncan’s Multiple Range Test (DMRT). Hasil analisis menunjukkan terdapat perbedaan yang sangat nyata terhadap tekstur, rasa dan aroma kerupuk rambak kelinci dengan lama perebusan yang berbeda, yaitu 15 menit, 30 menit, 45 menit, dan 60 menit. Tekstur renyah dihasilkan dari perlakuan perebusan selama 60 menit. Rasa gurih dihasilkan dari perlakuan perebusan selama 45 menit. Aroma anyir kurang tajam dihasilkan dari perlakuan perebusan selama 60 menit. Hasil uji hedonik diketahui bahwa perlakuan perebusan selama 60 menit disukai panelis dari segi tekstur dan aroma, sedangkan rasa yang disukai panelis pada perlakuan perebusan selama 45 menit. Kesimpulan dari hasil penelitian ini adalah pada perebusan selama 60 menit menghasilkan tekstur renyah, rasa agak gurih, dan aroma anyir kurang tajam. Saran dari hasil penelitian ini adalah bagi lembaga, sebaiknya dilakukan penyuluhan dan pelatihan kerupuk rambak kelinci, kepada masyarakat luas terutama di daerah yang banyak beternak kelinci. Agar dapat memajukan perekonomian masyarakat sekitar dengan cara home industri. Bagi peneliti selanjutnya, disarankan agar dilaksanakan penelitian lanjutan terhadap lama perebusan kerupuk rambak kelinci dengan waktu 60 menit untuk mendapatkan rasa gurih, dan disarankan melakukan penelitian lanjutan tentang daya simpan produk kerupuk rambak kelinci, Bagi produsen yang ingin membuat kerupuk rambak kelinci disarankan untuk membuat kerupuk rambak kelinci dengan lama perebusan 60 menit, agar menghasilkan kerupuk rambak kelinci dengan tekstur yang renyah, rasa yang agak gurih, dan aroma anyir yang kurang tajam.

EFL teacher questions in reading comprehension courses at the language center of Muhammadiyah University of Malang: a case study / Masduki

 

ABSTRACT Masduki, 2009. EFL Teacher Questions in Reading Comprehension Courses at the Language Center, Muhammadiyah University of Malang: A Case Study. Dissertation. The English Language Education, Graduate Program, State University of Malang. Advisors: (I) Frof. E. Sadtono, Ph.D. (II) Prof. Moh. Adnan Latief, M.A., Ph.D. (III) Prof. Dr. Siusana Kweldju, M.Pd Key Words: Teacher Questions, Reading Comprehension The main purpose of the study is clarifying an issue on EFL teacher questions in Reading Comprehension (RC) courses. More specifically, the study was done to investigate: 1) the types of questions posed by EFL teacher in RC courses, and 2) the strategies employed by EFL teachers to make effective questions in RC courses. In order to effectively describe those two aspects of teacher questions, the researcher analyzes them by means of question classification. With respect to effective questioning, the obtained data were analyzed by relying on the concepts/criteria for effective questions. The research project was executed by employing the qualitative study as a classroom research, focusing on the observation of teacher question and the students’ responses as the interactive effects of the questions. The data in the forms of teaches’ and students’ utterances (questions) were obtained through non-participant observation. Two teachers teaching reading comprehension classes in the Language Center at Muhammadiyah University of Malang were selected as the research subjects to be observed. As the research also required the subjects’ opinion and understanding of certain phenomena, it needed the data that were elicited using interview. This means that the data to handle were subjectively produced by the research subjects and subjectively and qualitatively interpreted by the present researcher. Since the analysis resides within the camp of qualitative type of research, in general, the present study can be labeled into qualitative. The analysis reveals the obvious types of questions posed by EFL teachers in reading comprehension courses. The types include display and referential questions. Both display and referential questions that occurred in the classes were in the closed and open form. With the closed forms, the teachers required the students to provide only one correct answer. Meanwhile, with the open form, they wanted their students to give more than one right answer. The closed and open forms were found in interrogative with yes/no questions and wh-questions, commands, and statements. The statements consisted of a complete sentence and were added by raising intonation to show that the teacher asked a question. The forms of referential question was also found closed and open. The closed referential was found in interrogative with yes/no questions, wh-questions and statements. But, the teacher employed open referential questions in the forms of wh-questions, statements, and commands. In classroom practices, the teacher used display questions more frequently than referential questions. Then, as far as the strategies are concerned, three different strategies were used by the teachers in posing questions in RC courses: translation, repetition, and pausing. The first questioning strategy employed by teachers in EFL reading classes is translation. The translation is either from the target language (English) to the student native language (Indonesian) or vice versa. The use of translation strategy indicated that the teachers wanted to emphasize and to make clearer about things they explained and described. The interviews with some student subjects touched an important issue on the use of translation to pose questions. The students acknowledged that translation also turned out to be the students’ preference. This indicated that they wanted the L1 (Indonesian) equivalents on their teachers’ English speech whenever they found it incomprehensible. This might also indicate that the students (mostly freshmen) had low proficiency in English. This finding supported the view that students’ preference for L1 and the language dominance in the setting may influence teachers’ preference for the communication strategies and the language used in the classrooms. The second strategy employed by teachers in EFL reading classes is repetition. The teacher repeated the question to ask whether the student understand about the questions posed. The repetition strategy was intended not only to increase comprehensibility but also to maximize the opportunities for students to answer. The present study also documented a point worth highlighting pertaining to the repetition. That is, despite the existing debate among scholars on the use of repetition, repetition strategy was capable of ensuring and improving EFL students’ engagement in a learning process. In the observed classes, there was sufficient evidence supporting this assertion. The findings attested some previous related studies which revealed that teacher’s repetition strategy was effective for improving learners’ engagement to find the intended response. The third questioning strategy employed by the teacher is the employment of wait-time or pausing. The present study reveals that teachers employed relatively moderate period of pause. The observed teachers posed questions with the mean of wait-time of 3:69 seconds. With this in mind, in this research, many students volunteered to answer each question. With regard to the wait-time, the study also reveals that the wait-time pauses were very similar among question types. Regarding the ways to pose effective questions, a number of modifications in the strategy of questioning were employed by the observed EFL teachers. For the purposes, the teachers employed probing and rephrasing modifications. Each has its own pattern. For the probing there were two types of modification employed by the teachers. Those are sequencing the questions by: 1) focusing on subordinate category, and 2) focusing on an exemplification. In addition to probing, the other modification of the question is rephrasing. In the present study, rephrasing was found to have more than one modification, namely the modification of rephrased questions by: 1) using a clue that describes the attribute of the expected answer, 2) comparing or contrasting of the expected answer to something, and 3) rephrasing with alternative or choice questions. Finally, as observed, there appears to be a direct relationship between the question modification made by teachers with the quantity and quality of the student’s responses. With the question modifications, the study found relatively ample evidence that the students could be helped to elicit the intended responses in the process of comprehending a reading text. Thus, it is recommended that teachers achieve a high degree of sensitivity and awareness to use questions in the most effective manner.

Identifikasi kerak evaporator di beberapa pabrik gula / Septika Sandra Kusuma Dewi

 

Evaporator merupakan salah satu dari satuan operasi teknik kimia yang diaplikasikan di industri gula, yang berfungsi untuk memisahkan air dari nira encer melalui peristiwa perpindahan panas. Dalam industri gula larutan tersebut berupa nira encer yang diperoleh dari nira mentah yang telah mengalami proses klarifikasi dari salah satu badan yang dikenal dengan badan pemurnian. Peristiwa perpindahan panas dapat terjadi karena mekanisme konduksi, konveksi, dan radiasi. Perhitungan panas dalam ilmu perpindahan panas (U) dapat dihitung dari jumlah tahanan panas secara keseluruhan. Selama operasional, koefisien perpindahan panas pada evaporator biasanya mengalami perubahan. Perubahan tersebut mengakibatkan terbentuknya kerak pada evaporator. Kerak yang terbentuk walaupun tipis akan merupakan tambahan tahanan terhadap perpindahan panas. Lapisan kerak ini timbul terutama pada permukaan yang selaluberhubungan dengan larutan atau cairan. Oleh karena kerak dapat mengakibatkan suatu kerugian terhadap laju perpindahan panas, para pelaku industri gula khususnya bidang proses produksi selalu berupaya untuk menekan atau mengurangi terbentuknya kerak dalam evaporator baik sisi nira maupin sisi uap. Penelitian ini bersifat eksperimen menggunakan sarana di Laboratorium Analitik Pusat Penelitian Perkebunan Gula Indonesia (P3GI) Pasuruan. Objek penelitian adalah kerak evaporator dari badan penguapan (BP) I s.d BP IV serta kerak evaporator dari daerah Pantura dan Pedalaman badan penguapan (BP) IV. Penentuan identifikasi kerak evaporator pada pabrik gula ini ditentukan dengan menggunakan analisis kadar air, kadar yang hilang karena pemijaran (kadar abu), kadar yang tidak larut dalam HCL, asam silikat, besi oksida dan aluminium, analisis CaO, analisis MgO, analisis sulfat, analisis fosfat dan karbon dioksida. Hasil penelitian menunjukkan bahwa kerak pada badan penguapan I lebih banyak mengandung bahan organik dan garam-garam fosfat dari Ca, Fe dan MgO; kerak pada badan penguapan II sebagian besar mengandung bahan organik yaitu silikat (terlarut dan tak terlarut) dan garam fosfat dari Ca; kerak badan penguapan III banyak dijumpai bahan organik dan silikat (terlarut dan tak terlarut) kemudian garam fosfat dari Ca; Pada badan penguapan IV (BP akhir) banyak dijumpai silikat (terlarut dan tak terlarut) bahan organik dan garam silikat dari Ca.

Pengaruh kinerja keuangan perbankan berdasarkan model Camels dan Eagles terhadap saham (studi kasus pada perusahaan perbankan yang listing di BEI periode 2007-2009) / Arif Yudhistira Raj Suweda

 

Kata kunci : CAMELS, EAGLES, Harga Saham Pentingnya menilai tingkat kesehatan bank adalah untuk mengetahui kondisi sesungguhnya bank tersebut. Kondisi perekonomian yang berubah-ubah akan memperlihatkan ketahanan suatu bank dalam menghadapi naik turunnya perekonomian. Model yang dapat digunakan adalah model CAMELS dan EAGLES. Permasalahan dalam penelitian ini adalah bagaimana pengaruh model CAMELS dan EAGLES terhadap harga saham baik secara parsial maupun secara simultan dan seberapa besar kontribusinya. Populasi dalam penelitian ini adalah sektor perbankan yang listing di BEI sebanyak 29 bank. Sampel ditentukan dengan teknik purposive sampling dengan tujuan untuk mendapatkan sampel yang representatif sesuai dengan kriteria yang ditentukan. Adapun sampel dalam penelitian ini ada 10 perusahaan perbankan. Variabel dalam penelitian ini ada dua yaitu; variabel bebas meliputi CAR, KAP, NPM, ROA, ROE, LDR, IGR, DGR, LGR dan SRQ. Sedangkan untuk variabel terikatnya adalah harga saham pada perusahaan perbankan di BEI. Metode yang digunakan adalah Uji Asumsi Klasik yang terdiri atas Uji Normalitas, Uji Multikolinieritas, Uji Heteroskedastisitas. Analisis Regresi dan Uji Hipotesis yang terdiri dari Uji t dan Uji F. Berdasarkan hasil uji t diketahui bahwa ada pengaruh yang signifikan antara ROA, ROE dan LDR, terhadap harga saham secara parsial, artinya Ha diterima. Sedangkan untuk KAP, NPM, IGR, DGR, CAR, LGR dan SRQ tidak berpengaruh secara signifikan, artinya Ha ditolak. Untuk uji F model CAMELS memperoleh Nilai R Square sebesar 0,572 atau 57.2%. Artinya bahwa variabel Y dipengaruh sebesar 57.2%. Untuk uji F model EAGLES memperoleh Nilai R Square sebesar 0,624 atau 62.4%. Artinya bahwa variabel Y dipengaruh sebesar 62.4%. Dengan melihat kontribusi yang paling besar yaitu EAGLES sebesar 62,4%, maka analisis ini dapat disarankan untuk menilai kinerja keuangan suatu bank.

Meingkatkan kemampuan pemahaman konsep pecahan desimal melalui penggunaan blok desimal siswa kelas V SDN Winongan Lor II / Sri Muji Mistutik

 

ABSTRAK Mistutik, S. M, 2009. Meningkatkan Kemampuan Pemahaman Konsep Pecahan Desimal Melalui Penggunaan Blok Desimal Siswa Kelas V SDN Winongan Lor II. Skripsi, Jurusan KSDP Program Studi S1 PGSD FIP Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Moh. Sochib, M.Pd, (II) Dra. Sri Harmini, S. Pd, M. Pd. Kata Kunci : Pemahaman Konsep, Pecahan Desimal, Penggunaan Blok Desimal, SD Berdasarkan observasi awal ditemukan permasalahan bahwa dari 28 siswa kelas V SDN Winongan Lor II, ada 25 siswa yang belum menguasai teknik menyimpan dan meminjam pada penjumlahan dan pengurangan pecahan desimal. Di samping itu berdasarkan pre tes yang telah dilakukan peneliti tentang mengubah pecahan biasa menjadi pecahan desimal ditemukan bahwa dari 28 siswa hanya 3 siswa yang mampu mengerjakan 2 soal dengan benar, 10 siswa mampu mengerjakan 1 soal dengan benar dan 15 siswa lainnya salah dalam mengerjakan soal tersebut. Untuk mengatasi hal itu, maka diadakan penelitian dengan tujuan mendiskripsikan peningkatan kemampuan pemahaman konsep pecahan desimal siswa kelas V dengan menggunakan blok desimal. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK), dengan rincian pelaksanaan : pre tes 1 kali pertemuan, siklus I dua kali pertemuan, siklus II satu kali pertemuan. Pelaksanaan kegiatan pembelajaran dibagi dalam dua siklus, masing-masing siklus terdiri dari (1) perencanaan, (2) pelaksanaan, (3) obsevasi, dan (4) refleksi. Subyek penelitian adalah 28 siswa kelas V SDN Winongan Lor II semester II tahun pelajaran 2008/2009. Penelitian ini dilakukan mulai tanggal 25 Mei 2009 sampai dengan 16 Juli 2009. Instrumen penelitian ini meliputi : pedoman observasi untuk guru dan siswa, lembar evaluasi (tes), dan pedoman wawancara. Pedoman observasi guru dan siswa berguna untuk memberikan informasi tentang perilaku siswa dan memberikan masukan bagi guru tentang cara mengajar. Lembar evaluasi (tes) diberikan untuk mengetahui sejauh mana dalam pembelajaran yang diberikan dapat diserap siswa. Pedoman wawancara untuk mengetahui pemahaman dan perasaan siswa terhadap pembelajaran. Data yang diperoleh dalam penelitian dianalisa secara kuantitatif dan kualitatif, dan indikator keberhasilan dalam PTK ini adalah bila ketuntasan perorangan sebesar 65% dan ketuntasan klasikal sebesar 75% berdasarkan petunjuk belajar mengajar dalam KTSP. Hasil yang diperoleh dalam penelitian ini terjadi peningkatan hasil belajar yaitu pada siklus I nilai rata-rata kelas sebesar 60 meningkat 90,7 pada siklus II. Berdasarkan hasil penelitian ini, dapat disarankan dalam PBM guru menggunakan alat peraga/media yang menarik dan bervariasi misalnya penggunaan blok desimal supaya pembelajaran berlangsung menyenangkan dan guru harus kreatif menemukan cara-cara yang mudah dan cepat dipahami siswa dalam pembelajaran matematika.

Penerapan model pembelajaran problem posing untuk meningkatkan kecakapan berpikir (thinking skill) dan hasil belajar biologi siswa klelas XI-IPA SMA Negeri 1 Malang / Alhidayat

 

ABSTRAK Alhidayat. 2009. Penerapan Model Pembelajaran Problem Posing untuk Meningkatkan Kecakapan Berpikir (Thinking Skill) dan Hasil belajar Biologi Siswa Kelas XI-IPA SMA Negeri I Malang. Skripsi Program Studi Pendidikan Biologi, Jurusan Biologi FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Fatchur Rohman, M.Si, (II) Drs. Triastono Imam Prasetyo, M.Pd Kata kunci: Model Pembelajaran Problem Posing, kecakapan berpikir, hasil belajar Berdasarkan hasil observasi peneliti sebanyak 2 kali pada bulan Januari- Februari 2009, diketahui bahwa selama proses pembelajaran biologi di kelas XI IPA SMA Negeri I Malang, guru berperan aktif dalam menyampaikan materi pelajaran, sedangkan siswa pasif dalam menerima pelajaran. Kemampuan siswa dalam menanggapi atau menjawab pertanyaan dari guru masih rendah. Kondisi tersebut menunjukkan bahwa kecakapan berpikir siswa masih rendah. Problem posing merupakan salah satu model pembelajaran yang dapat digunakan untuk mengembangkan kecakapan berpikir siswa karena dalam pembelajaran ini, siswa dikondisikan untuk menggali informasi sebanyak-banyaknya dari berbagai literatur, merumuskan soal atau pertanyaan dari situasi yang ada, menentukan jawaban atau pemecahan dari permasalahan yang mereka buat serta mencari alternatif pemecahannya. Berdasarkan uraian tersebut maka dilakukan penelitian yang berjudul “Penerapan Model Pembelajaran Problem Posing untuk Meningkatkan Kecakapan Berpikir (Thinking Skill) dan Hasil Belajar Biologi Siswa Kelas XI-IPA SMA Negeri I Malang”. Tujuan penelitian ini adalah meningkatkan kecakapan berpikir (Thinking Skill) dan hasil belajar biologi siswa kelas XI SMA Negeri I Malang melalui penerapan model pembelajaran problem posing. Penelitian ini merupakan penelitian tindakan kelas (PTK) dengan model pembelajaran problem posing yang dilaksanakan dalam dua siklus. Masing- masing siklus terdiri dari 3 pertemuan. Subyek penelitian ini adalah siswa kelas XI-IPA2 SMA Negeri 1 Malang, semester genap tahun ajaran 2008-2009 sebanyak 38 orang, yang terdiri dari 23 orang siswa perempuan dan 15 orang siswa laki-laki. Data dalam penelitian ini berupa kecakapan berpikir dan hasil belajar biologi siswa kelas XI-IPA2 SMA Negeri I Malang. Kecakapan berpikir siswa diukur berdasarkan peningkatan persentase kualitas kecakapan berpikir siswa secara klasikal, sedangkan hasil belajar siswa diukur berdasarkan peningkatan ketuntasan belajar siswa secara klasikal. Instrumen yang digunakan dalam penelitian ini yaitu soal tes, lembar observasi, dan catatan lapangan. Hasil penelitian menunjukkan bahwa penerapan model pembelajaran problem posing yang dapat meningkatkan kecakapan berpikir (Thinking Skill) siswa kelas XI-IPA2 SMA Negeri I Malang, terdiri dari 5 tahapan yaitu tahap mendeskripsikan situasi/ informasi, mendefinisikan masalah, menampilkan permasalahan, mendiskusikan masalah, dan mendiskusikan alternatif pemecahan masalah. Kecakapan berpikir dan hasil belajar biologi siswa mengalami peningkatan dari siklus I ke siklus II. Kecakapan membuat pertanyaan kognitif i tingkat tinggi meningkat 22%, sedangkan kecakapan menjawab pertanyaan kognitif tingkat tinggi meningkat 89%. Peningkatan hasil belajar biologi dari siklus I ke siklus II adalah 50% untuk kemampuan kognitif dan 19% untuk kemampuan afektif siswa. Berdasarkan hasil penelitian dapat diambil kesimpulan bahwa kecakapan berpikir dan hasil belajar biologi siswa mengalami peningkatan melalui penerapan pembelajaran model Problem posing.

Kebijakan sekolah terhadap pelaksanaan pembelajaran mata pelajaran seni budaya dan keterampilan pada siswa kelas VI tahun pelajaran 2008/2009 di SD Negeri Bareng 3 Malang / Vika Miranti

 

ABSTRAK Miranti, Vika. 2009. Kebijakan Sekolah Terhadap Pelaksanaan Pembelajaran Mata Pelajaran Seni Budaya dan Keterampilan Pada Siswa Kelas VI SD Negeri Bareng 3 Malang. Skripsi, Program Studi Pendidikan Seni Tari, Jurusan Seni Dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Drs. Soerjo Wido Minarto M. Pd, (II) Dra. Ninik Harini. Kata kunci: Kebijakan, Sekolah, Pembelajaran Seni Budaya, SDN Bareng 3 SD Negeri Bareng 3 Malang adalah salah satu sekolah dasar negeri yang merupakan sekolah inti yang berada di wilayah gugus 4 Bareng. Sebelum menjadi SD Negeri Bareng 3, sekolah ini adalah gabungan dari tiga sekolah dalam satu lingkungan, terdiri dari SD Negeri Bareng 6, SD Negeri Bareng 7, dan SD Negeri Bareng 8. Kemudian Dinas Pendidikan Kota Malang melakukan peregroupan pada sekolah – sekolah yang dalam satu lingkungan terdapat sekolah lebih dari satu. Dengan alasan, supaya mutu pendidikan khususnya pada sekolah dasar di Kota Malang lebih meningkat. Sekolah ini merupakan salah satu sekolah yang melaksanakan pembelajaran Mata Pelajaran Seni Budaya dan Keterampilan yang pelaksanaannya telah dimulai pada tahun ajaran 2006/2007. Hal tersebut sesuai dengan perubahan kurikulum yang berlaku sekarang yaitu Kurikulum Tingkat Satuan Pendidikan (KTSP). Kebijakan adalah suatu usaha dalam mengendalikan keadaan agar dapat berjalan sesuai dengan yang diinginkan melalui suatu pengaturan. Kebijakan sekolah merupakan kebijakan suatu lembaga sekolah untuk mengembangkan pendidikan dalam sekolah tersebut. Kebijakan meliputi apapun pilihan sekolah untuk melakukan atau tidak melakukan sesuatu. Permasalahan yang akan di bahas dalam penelitian ini adalah langkah kebijakan strategis dan operasional dalam kurikulum Seni Budaya dan Keterampilan pada kelas VI dan strategi pembelajaran, proses belajar mengajar dan penilaiannya pada siswa kelas VI di SD Negeri Bareng 3 Malang. Tujuan dari penelitian ini adalah untuk langkah kebijakan strategis dan operasional dalam kurikulum Seni Budaya dan Keterampilan pada kelas VI dan strategi pembelajaran, proses belajar mengajar dan penilaiannya pada siswa kelas VI di SD Negeri Bareng 3 Malang. Penelitian ini termasuk dalam penelitian deskriptif kualitatif, teknik analisa datanya menggunakan tiga langkah yaitu mereduksi data, penyajian data, dan verifikation.Penelitian ini dilakukan untuk mengetahui bagaimana Penelitian ini dilakukan pada bulan Maret sampai dengan bulan Juni 2009 menggunakan pendekatan kualitatif dengan metode pengumpulan data berupa observasi, wawancara, dan pengumpulan dokumen dengan Guru Seni Budaya dan Keterampilan dan Kepala Sekolah sebagai responden. Hasil dari penelitian ini adalah (1) Kebijakan sekolah yang menyatakan bahwa sesuai hasil musyawarah Kepala Sekolah dengan dewan Guru SD Negeri Bareng 3 Malang menetapkan pada tahun ajaran 2008/2009 pembelajaran Seni Budaya dan Keterampilan diberlakukan sampai tanggal 30 April 2009, sedangkan tanggal 1 sampai dengan 8 Mei dikhususkan untuk mata pelajaran UASBN saja; (2) Sekolah juga mempunyai kebijakan dengan memberikan guru sendiri untuk mata pelajaran Seni Budaya dan Keterampilan bagi siswa kelas VI dan (3) Pelaksanaan pembelajaran di kelas, guru menggunakan tiga bagian dalam kegiatan belajar. Kesimpulan dari penelitian ini adalah, bahwa Sekolah tetap memberikan pembelajaran Seni Budaya dan Keterampilan pada siswa kelas VI tahun pelajaran 2008/2009 pembelajaran Seni Budaya dan Keterampilan diberlakukan sampai tanggal 30 April 2009, sedangkan tanggal 1 sampai dengan 8 Mei dikhususkan untuk mata pelajaran UASBN saja. Kemudian sekolah juga mempunyai kebijakan dengan memberikan guru sendiri untuk mata pelajaran Seni Budaya dan Keterampilan bagi siswa kelas VI. Dalam pelaksanaan pembelajaran mata pelajaran Seni Budaya dan Keterampilan guru menggunakan tiga bagian dalam kegiatan belajar. Disarankan kepada SD Negeri Bareng 3 Malang untuk pemberian materi Seni Budaya dan Keterampilan pada siswa kelas VI lebih maksimal karena mengingat adanya pemberian batasan jangka waktu dalam memberikan materi. dan dapat menambah guru yang lebih berkompeten di bidang seni supaya pemberian materi lebih maksimal lagi.

Penerapan pembelajaran trigonometri dengan metode silih tanya untuk meningkatkan prestasi belajar siswa SMA kelas X / Elly Rahmawati

 

ABSTRAK Rahmawati, Elly. 2009. Penerapan Pembelajaran Trigonometri Dengan Metode Silih Tanya Untuk Meningkatkan Prestasi Belajar Siswa SMA Kelas X. Skripsi, Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Askury, M.Pd dan (II) Drs. H. Abdurrahman As’ari, M.Pd, M.A Kata kunci: pembelajaran matematika, metode silih tanya, prestasi belajar siswa Berdasarkan pengalaman peneliti selama menjalankan praktik mengajar di SMAN 8 Malang, hanya sebagian kecil siswa yang tuntas belajarnya. Kebanyakan mereka ribut sendiri ketika proses belajar mengajar berlangsung, dan sangat jarang dari mereka yang mempertanyaan penjelasan guru. Kondisi ini memotivasi peneliti untuk menjalankan penelitian tindakan kelas untuk mengatasinya. Berdasarkan kajian kepustakaan, jika dilaksanakan secara sempurna, Metode Silih Tanya memiliki potensi untuk mengatasi masalah ini. Oleh karena itu, peneliti tertantang untuk menyelidiki bagaimana melaksanakan metode Silih Tanya yang mampu membantu siswa meningkatkan prestasinya. Pada saat yang sama, penelitian ini juga dimaksudkan untuk menggambarkan respons siswa terhadap pelaksanakan metode Silih Tanya. Temuan penelitian menunjukkan bahwa guru harus memberikan perhatian kepada bagaimana para siswanya dikelompokkan selama proses penerapan metode Silih Tanya tersebut. Guru harus menghidarkan terjadinya pengelompokan yang didasarkan atas teman kesukaan siswa. Kalau hal ini dibiarkan, turnamen yang merupakan bagian dari pelaksanaan Metode Silih Tanya akan berlangsung secara tidak adil. Penelitian ini juga menampilkan kenyataan bahwa respons siswa terhadap pelaksanaan metode Silih Tanya ini bisa dikategorikan bagus.

Penggunaan lagu-lagu untuk meningkatkan keterampilan berbicara bahasa Inggris kelas IV di SDN Sumberjo I Kandat Kediri / Valentina Retna Rahayu

 

ABSTRAK Rahayu, Valentina R. 2009. Penggunaan Lagu-lagu untuk Meningkatkan Keterampilan Berbicara Bahasa Inggris Kelas IV SDN Sumberjo I Kandat Kediri. Skripsi, Jurusan KSDP, Program studi SI PGSD, FIP Universitas Negeri Malang. Pembimbing (1) Dra. Ratna Trieka Agustina, M.Pd, (2) Drs. I Wayan Sutama, M.Pd. Kata kunci: Keterampilan berbicara, Media, Lagu-lagu. Pembelajaran berbicara Bahasa Inggris siswa kelas IV SDN Sumberjo I yang diselenggarakan selama ini tidak melalui latihan (praktik) berbicara melainkan sekedar teori berbicara, siswa tidak dilibatkan dalam pembelajaran dan tidak diberi kesempatan untuk berlatih berbicara untuk mengungkapkan pendapat. Saat pembelajaran berlangsung siswa terlihat kurang tertarik, bosan dan mengantuk sehingga keterampilan berbicara kurang dan hasil belajar sangat rendah. Hal ini dapat dilihat dari rata-rata hasil belajar siswa pada pra tindakan yaitu 57,83 dan hanya 8 siswa (34,78%) dari 23 siswa yang mencapai Kriteria Ketuntasan Minimal (KKM) 65. Berdasarkan hal tersebut maka dilaksanakan pembelajaran Bahasa Inggris dengan menggunakan lagu-lagu melalui Penelitian Tindakan Kelas (PTK). Penelitian ini bertujuan untuk (1) untuk mendeskripsikan kegiatan penyajian teks lagu dengan menggunakan media Flash Card Animal bisa meningkatkan keterampilam berbicara Bahasa Inggris kelas IV, (2) untuk mendeskripsikan kegiatan mendramakan teks lagu bisa meningkatkan keterampilan berbicara Bahasa Inggris kelas IV. (3) untuk mendeskripsikan kegiatan bercerita binatang kesukaan sesuai dengan teks lagu bisa meningkatkan keterampilan berbicara Bahasa Inggris kelas IV. Model penilaian yang digunakan pada penelitian ini terdiri dari tujuh aspek antara lain yaitu gagasan, pelafalan, intonasi, kelancaran, volume suara, alamiah, dan penguasaan kosakata. Berdasarkan hasil penelitian, menunjukkan bahwa penggunaan lagu-lagu dalam pembelajaran terdiri dari tiga tahapan kegiatan yaitu (1) kegiatan penyajian teks lagu menggunakan media flash card animal, (2) kegiatan mendramakan teks lagu, (3) kegiatan bercerita binatang kesukaan sesuai teks lagu, kegiatan-kegiatan tersebut terbukti dapat meningkatkan keterampilan berbicara Bahasa Inggris pada semua kelompok belajar. Siswa kelompok tinggi mengalami kenaikan sebesar 10,44 (13,60%), siswa kelompok sedang mengalami kenaikan sebesar 16,27 (24,59%), sedangkan siswa kelompok rendah mengalami kenaikan yang cukup signifikan yaitu 17,26 (27,16%). Dari penelitian ini dapat disimpulkan bahwa penggunaan lagu-lagu dalam pembelajaran untuk meningkatkan keterampilan berbicara Bahasa Inggris Kelas IV sangat tepat dan efektif diterapkan pada siswa yang mempunyai kemampuan rendah dan kemampuan sedang di SDN Sumberjo I Kandat Kediri Saran yang dapat disampaikan dari penelitian adalah bahwa pada setiap kesempatan guru sebagai pembelajar hendaknya menyajikan materi yang lebih variatif lagi, agar siswa tidak cepat merasa bosan, Dengan demikian, kompetensi siswa dapat meningkat secara optimal. Keterampilan berbicara bahasa Inggris siswa dan hasil belajar bahasa Inggris siswa masih perlu ditingkatkan lagi melalui upaya yang terencana dan berkesinambungan dengan menerapkan penggunaan lagu-lagu dalam pembelajaran.

Implementasi pembelajaran matematika realistik untuk meningkatkan penguasaan konsep perkalian dan keaktifan siswa kelas II SDN Pateguhan Pasuruan / Nisa'ul Khurin Khasanah

 

ABSTRAK Khasanah, N.K. 2009 Implementasi Pembelajaran Matematika Realistik Untuk Meningkatkan Penguasaan Konsep Perkalian Dan Keaktifan Siswa Kelas II SDN Pateguhan Pasuruan. Skripsi Jurusan KSDP Program Studi S1 PGSD FIP Universitas Negeri Malang. Pembimbing (1) Dra. Endang Setyo Winarni, M.Pd. (II) Dra. Sri Harmini, S.Pd. M.Pd Kata Kunci : Pembelajaran matematika realistik, meningkatkan, penguasaan, keaktifan, konsep perkalian, Sekolah Dasar Matematika memiliki peranan penting dalam memajukan kemampuan berpikir siswa. Belajar matematika memerlukan pemahaman konsep yang baik karena pemahaman konsep sebelumnya merupakan prasyarat untuk memahami konsep yang baru. Oleh karena itu penguasaan terhadap konsep dalam matematika mutlak diperlukan. Observasi awal yang dilakukan di kelas II SDN Pateguhan menunjukkan bahwa pembelajaran yang digunakan adalah ceramah sehingga pembelajaran hanya terpusat pada guru. Siswa cenderung pasif dalam pembelajaran dan hanya menerima bentuk jadi dari guru. Penekanan calistung atau baca tulis hitung pada kelas rendah di SD menjadi berkurang karena untuk perkalian 6 sampai 9 anak-anak diajari dengan menekuk jari. Hal ini menyebabkan penguasaan anak terhadap konsep perkalian bilangan cacah kurang. Upaya yang dilakukan untuk meningkatkan penguasaan siswa terhadap konsep perkalian dan keaktifan siswa dengan mengimplementasikan pembelajaran matematika realistik. Penelitian ini bertujuan untuk mendeskripsikan langkah-langkah dalam proses implementasi pembelajaran matematika realistik, peningkatan penguasaan konsep perkalian dan keaktifan siswa kelas II. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) yang dilakukan dalam dua siklus. Subyek penelitian adalah 36 siswa kelas II SDN Pateguhan Semester II Tahun Pelajaran 2008/2009. Penelitian ini dilakukan mulai tanggal 1 juni 2009 sampai 3 Juli 2009. Pembelajaran matematika realistik yang diimplementasikan diawali dengan pemberian masalah-masalah kontekstual yang dilengkapi dengan alat-alat peraga. Masalah kemudian didiskusikan secara berkelompok. Hasil diskusi kelompok disajikan dalam diskusi kelas dengan tujuan untuk mendapatkan kesimpulan dari masalah yang diberikan. Hasil penelitian menunjukkan bahwa pembelajaran matematika realistik meningkatkan penguasaan konsep perkalian dan keaktifan siswa kelas II SDN Pateguhan. Untuk penelitian selanjutnya disarankan untuk mengimplementasikan pembelajaran matematika realistik dalam menanamkan konsep perkalian di kelas II. Selain itu dikembangkan juga pada materi matematika yang lainnya pada kelas yang lain dengan lebih menarik dengan mengembangkan masalah-masalah yang lebih kontekstual.

Penerapan pembelajaran melalui pemecahan masalah bersetting kooperatif tipe STAD untuk meningkatkan kemampuan pemecahan masalah program linear di kelas X SMK Negeri 8 Malang / Arlina Yuni Astutiek

 

ABSTRAK Yuni Astutiek, Arlina. 2009. Penerapan Pembelajaran Melalui Pemecahan Masalah Bersetting Kooperatif Tipe STAD untuk Meningkatkan Kemampuan Pemecahan Masalah Program Linear di Kelas X SMK Negeri 8 Malang. Tesis. Program Studi Pendidikan Matematika, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Hj. Cholis Sa’dijah, M.Pd, M.A. (II) Drs. H.M.Shohibul Kahfi, M.Pd Kata kunci: Masalah,Pemecahan masalah, kemampuan pemecahan masalah, Program linear Penelitian ini diawali dengan adanya kenyataan rendahnya kemampuan siswa SMK Negeri 8 Malang dalam memecahkan masalah pada materi program linear. Hal ini disebabkan karena selama ini pembelajaran mayoritas masih berpusat pada guru, guru masih mendominasi siswa. Oleh karena itu perlu adanya upaya untuk menerapkan suatu model pembelajaran yang memungkinkan siswa mengembangkan kemampuan pemecahan masalahnya. Salah satunya melalui:” Penerapan Pembelajaran Melalui Pemecahan Masalah Bersetting Kooperatif Tipe STAD”. Penerapannya ,mengikuti prosedur yang ada di STAD, tetapi dalam menyelesaikan masalah menggunakan empat langkah penyelesaian masalah menurut Polya. Dalam penerapannya siswa dibagi dalam 6 kelompok masing-masing beranggotakan 4 orang, siswa belajar dengan bantuan LKS secara berkelompok, berdiskusi untuk menemukan, memahami konsep serta memecahkan masalah. Dalam proses pemecahan masalah ini digunakan empat langkah menurut Polya. Dalam penelitian ini pemecahan masalah didefinisikan sebagai usaha mencari jalan keluar dari suatu kesulitan, mancapai suatu tujuan yang tidak dengan segera dapat dicapai. Dari pengertian yang dikemukakan di atas, dapat disimpulkan bahwa pemecahan masalah dalam matematika adalah suatu aktivitas psikologis (khususnya intelektual) untuk mencari solusi dari permasalahan yang dihadapi dengan menggunakan secara integratif semua bekal pengetahuan matematika yang telah dimiliki. Sedangkan kemampuan pemecahan masalah matematika merupakan kemampuan untuk menyelesaikan pertanyaan matematika yang tidak bersifat rutin, artinya pertanyaan tersebut tidak dapat dijawab dengan prosedur rutin. Dengan kata lain, siswa tidak mempunyai strategi tertentu yang segera dapat digunakan untuk menjawab pertanyaan tersebut. Tujuan penelitian ini adalah untuk mendeskripsikan penerapan pembelajaran melalui pemecahan masalah bersetting kooperatif tipe STAD yang dapat meningkatkan kemampuan pemecahan masalah program linear di kelas X SMK Negeri 8 Malang. Penelitian ini menggunakan penelitian kualitatif dengan jenis penelitian tindakan kelas. Penelitian ini dilaksanakan pada siswa kelas X METRO A yang berjumlah 24 orang, sedangkan subjek wawancaranya adalah 3 orang. yaitu siswa yang nilainya terendah saat itu/perolehan nilainya menurun dibandingkan dengan tes sebelumnya/yang nilainya tetap, tidak ada peningkatan dan pelaksanaannya setelah pembelajaran satu tindakan berlangsung. Hasil penelitian menunjukkan bahwa kemampuan pemecahan masalah tentang program linear siswa meningkat dibandingkan dengan sebelum diterapkannya model pembelajaran ini. Hal ini terjadi karena siswa diberi kesempatan untuk mencari, dan mengkonstruk pengetahuan melalui pemecahan masalah. Siswa menjadi lebih mudah menemukan dan memahami konsep-konsep yang sulit jika mereka saling mendiskusikan masalah tersebut dengan temannya. Berdasarkan penelitian ini, maka bagi penulis lain yang berminat mengadakan penelitian serupa hendaknya melakukan pada sekolah yang lain sehingga akan diperoleh gambaran lebih lanjut mengenai efektifitas pembelajaran melalui pemecahan masalah bersetting kooperatif tipe STAD pada materi program linear.

Sifat organoleptik cookies dengan penggunaan tepung telur ayam ras dalam jumlah yang berbeda / Anista Filla Sari

 

ABSTRAK Sari, Anista Filla. 2009. Sifat Organoleptik Cookies dengan Penggunaan Tepung Telur Ayam Ras dalam Jumlah yang Berbeda. Tugas Akhir. Program Studi Tata Boga. Jurusan Teknologi Industri. Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dra. Nunung Nurjanah, M.Kes, (2) Dra. Teti Setiawati, M. Pd. Kata kunci: Cookies, tepung telur, air, dan organoleptik Cookies adalah adonan pasir yang berbentuk pipih dengan rasa manis (sweet) atau gurih (savoury). Bahan pembuatan cookies pada umumnya adalah tepung, gula, sorthening, bahan pengembang dengan tambahan cairan atau flavor dan telur. Tepung telur merupakan produk awetan telur mentah yang dibuat untuk menyelamatkan masa simpan telur sehingga tahan lama, dibuat dari telur segar yang masih mentah, namun sudah dihilangkan sebagian besar kandungan airnya, hingga hanya tersisa 10%. Tepung telur mempunyai sifat rapuh, tekstur rapuh ini sangat baik untuk digunakan dalam pembuatan cookies yang renyah. Penelitian ini merupakan penelitian eksperimen pembuatan cookies dengan penggunaan tepung telur ayam ras dalam jumlah yang berbeda. Tujuan penelitian ini adalah untuk mengetahui perbedaan sifat organoleptik meliputi warna, flavour, dan tekstur cookies tepung telur. Data hasil penelitian diperoleh dari hasil pengisian format penilaian uji mutu hedonik dan uji hedonik yang menggunakan panelis agak terlatih sebanyak 20 orang dengan pengulangan sebanyak tiga kali. Data akan dianalisis menggunakan analisis sidik ragam dan jika terdapat perbedaan maka akan dilanjutkan dengan Duncan’s Mutiple Range Test (DMRT). Hasil penelitian yang didapat menunjukkan bahwa untuk uji mutu hedonik terdapat perbedaan terhadap warna, flavour, dan tekstur cookies dengan penggunaan tepung telur ayam ras. Warna cookies dengan penggunaan tepung telur 30% memiliki skor rerata (3,53) yaitu coklat keemasan. Flavour cookies dengan penggunaan tepung telur 40% memiliki skor rerata (3,58) yaitu flavour kuat. Tekstur cookies dengan penggunaan tepung telur 40% memiliki skor rerata (3,52) yaitu tekstur renyah. Adapun hasil penelitian uji hedonik menunjukkan bahwa, warna cookies dengan penggunaan tepung telur 30% disukai oleh setengah dari panelis (46,67%). Flavour cookies dengan penggunaan tepung telur 40% disukai oleh setengah dari panelis (50%). Tekstur cookies dengan penggunaan tepung telur 40% disukai oleh setengah dari panelis (48,87%). Kesimpulan dari penelitian ini adalah cookies tepung telur ayam ras yang memiliki warna coklat keemasan diperoleh dari perlakuan C dengan menggunakan tepung telur 30%. Dan untuk menghasilkan cookies tepung telur ayam ras yang memiliki flavour telur yang kuat dan tekstur yang renyah diperoleh dari perlakuan D dengan menggunakan tepung telur 40%. Disarankan dilakukan penelitin lebih lanjut tentang berbagai perlakuan pada tepung telur ayam ras agar diperoleh flavour, warna, tekstur tetap baik, seperti kecepatan pengocokan atau penggantian bahan.

Sifat organoleptik dendeng ikan lele dumbo (Clarias Gariepinus) dengan perbedaan lama curing / Agustina Dwi Jayanti

 

Dendeng yang dikenal oleh masyarakat pada umumnya adalah dendeng yang berbahan daging. Pada penelitian kali ini bahan yang digunakan dalam pembuatan dendeng adalah ikan lele dumbo. Dendeng ikan lele dumbo adalah dendeng yang terbuat dari daging ikan lele dumbo yang mengalami proses fillet, skinning, dan curing. Proses curing yang digunakan adalah curing kering dengan kulit ikan lele dumbo yang dibuang (skinning). Curing kering adalah proses membalur bahan dendeng dengan bahan- bahan curing yang sudah dihaluskan. Penelitian ini merupakan penelitian eksperimen pembuatan dendeng ikan lele dumbo (Clarias Gariepinus) dengan perbedaan lama curing yaitu 3 jam, 6 jam, 9 jam, dan 12 jam. Tujuan penelitian ini adalah untuk mengetahui sifat organoleptik yang meliputi warna, tekstur, dan rasa melalui uji mutu hedonik dan uji hedonik. Data dianalisis dengan menggunakan analisis sidik ragam dan dilanjutkan dengan Duncan’s Multiple Range Test (DMRT). Hasil uji mutu hedonik dendeng ikan lele dumbo (Clarias Gariepinus) dengan perbedaan lama curing yaitu 3 jam, 6 jam, 9 jam, dan 12 jam menunjukkan berbeda sangat nyata terhadap warna, tekstur, dan rasa. Dendeng ikan lele dumbo (Clarias Gariepinus) yang menghasilkan warna coklat gelap dengan skor (3,68), tekstur kering tidak alot (liat) dengan skor (3,73) dan rasa manis gurih dengan skor (3,57) diperoleh dari lama curing 12 jam. Hasil uji hedonik menunjukkan bahwa panelis menyukai warna sebanyak (45%), tekstur (43,33%) dan rasa (45%) adalah dendeng lele ikan dumbo dengan lama curing 12 jam. Kesimpulan dari hasil penelitian ini adalah dendeng ikan lele dumbo yang mempunyai warna coklat gelap, tekstur kering tidak alot (liat) dan rasa manis gurih diperoleh dari proses curing kering selama 12 jam. Disarankan dilakukan penelitian lebih lanjut tentang pemasaran dendeng ikan lele dumbo yang belum ada dipasaran.

Implementasi pembelajaran kooperatif model PBL (problem based learning) dan konvensional untuk meningkatkan hasil belajar mata pelajaran mengikuti prosedur keamanan, keselamatan dan kesehatan kerja (studi pada siswa kelas X APK SMK Negeri 1 Turen) / Sri Handayani

 

Acceleration of information stream in the globalization era this time demand all field of life to accommodate vision, mission, purpose and strategy in order to suitable with requisities and un up to date. Not except in education world, national education system must be developed suitable with requisities and development that occur not only in local, national but also in global. One of the other government ways to increase quality of education is by establishing new curriculum it is education unity level curriculum which more famous called KTSP. KTSP is the the way to complete curriculum in order to be familiar with teachers, because the teachers are more be involved so they are hope to have much responsibility. Completion curriculum which continued is necessity in order to be national education system always relevant and competitive. Right now, there are still many teachers who use conventional learning. It is because of the teachers still regard that conventional is the most effective learning which used in the learning process. Eventhough, side by side of development era include in education word fineableone of the other learning approximation which is suitable with curriculum that is completed is cooperative learning. One of the other learning models that associated with cooperative learning approximation is Problem Based Learning. Problem Based Learning is a learning approximation that use real world problem as a context for students to study about way to think accurately and skill to solve problem, and also to get knowledge and concept that essentral with material of lesson. This examination is Classroom Action Research with two sicluses and use quality approximation. Technics of data collecting that used in this examination involve observation, interview, field note, documentary study and test. The subject that used in this examination is students of Apk class X State Vocational High School I (SMK N I) Turen that consist of 40 students. From 40 students are divided by two groups that each of group consist of 20 students. The first group use conventional learning and the second group use PBL model learning. Based on this examination result, it showed that use PBL model learning can increase study result of Apk students class X SMK N I Turen. In this case, it can be seen from average of the first ciclus pre test to reach for 58,90 and increase become 71,20 in the post test. Examination result on the second ciclus average pre test to reach for 64,85 and increase become 79,30 on the post test. In the same case occur on the examination result for students who use conventional learning. Based on the first ciclus examination average pre test to reach for 62,35 and increase become 71,05 on the post test. On the second ciclus average pre test is 62,85 and increase become 73,65 on the post test. So it can be said that between PBl model learning and conventional can increase study result of students lesson following safety procedure, salvation and healthy of work. But that make different is which PBL model learning raising level study result of students is higher than conventional learning. Based on examination result the suggestion that proposed are: (1) PBL model learning has been proved can increase study result of students so for the teachers of lesson following safety procedure, salvation and healthy of work and the teachers of the other lesson can use PBL learning, (2) for following researcher can be developed to material beside work procedure, lesson beside following safety procedure, salvation and healthy of work and can be developed for the other school.

Hubungan kebiasaan belajar dengan prestasi belajar siswa pada kelompok mata diklat produktif siswa kelas X di SMK Negeri 2 Malang / Mariana Djo Behi

 

ABSTRAK Djo Behi, Mariana. 2009. Hubungan Kebiasaan Belajar dengan Prestasi Belajar Siswa pada Kelompok Mata Diklat Produktif Siswa Kelas X di SMK Negeri 2 Malang. Skripsi, Program Studi Tata Boga, Bidang Keahlian Usaha Jasa Restoran, Jurusan Teknologi Industri; Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Dr. H. Dwi Agus Sudjimat, ST., M.Pd, (II) Dra. Agus Hery Supadmi I., M.Pd. Kata Kunci: kebiasaan belajar, prestasi belajar. Penelitian ini bertujuan untuk (1) mendeskripsikan kualifikasi kebiasaan belajar siswa di rumah; (2) mendeskripsikan kualifikasi kebiasaan belajar siswa di sekolah; (3) mendeskripsikan kualifikasi prestasi belajar siswa; (4) menganalisis hubungan antara kebiasaan belajar di rumah dengan prestasi belajar; (5) menganalisis hubungan antara kebiasaan belajar di sekolah dengan prestasi belajar; (6) menganalisis hubungan antara kebiasaan belajar di rumah dan di sekolah dengan prestasi belajar. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Teknik penarikan sampel menggunakan total sampling, dengan sampel yang berjumlah sebanyak 68 siswa. Data yang dikumpulkan dengan menggunakan angket dan dokumentasi. Teknik analisis data yang digunakan dalam penelitian ini adalah analisis regresi berganda. Berdasarkan hasil analisis data; (1) Kebiasaan belajar di rumah pada kualifikasi baik, terbukti dengan perolehan persentase sebesar 52,9%; (2) Kebiasaan belajar di sekolah pada kualifikasi baik, terbukti dengan perolehan persentase sebesar 51,5%; (3) Prestasi belajar pada kualifikasi baik, terbukti dengan perolehan persentase 79,41%; (4) Ada hubungan yang signifikan antara kebiasaan belajar di rumah dengan prestasi belajar siswa yaitu sebesar 0,423; (5) Ada hubungan yang signifikan antara kebiasaan belajar di sekolah dengan prestasi siswa yaitu sebesar 0,465; (6) Secara simultan ada hubungan yang signifikan antara kebiasaan belajar di rumah dan kebiasaan belajar di sekolah dengan prestasi belajar. Kesimpulan penelitian ini adalah:(1) Kualifikasi kebiasaan belajar di rumah dengan prestasi belajar pada tingkat baik; (2) Kualifikasi kebiasaan belajar di sekolah pada tingkat baik; (3) Kualifikasi prestasi belajar pada tingkat baik; (4) Ada hubungan kebiasaan belajar di rumah dengan prestasi belajar; (5) Ada hubungan kebiasaan belajar di sekolah dengan prestasi belajar; (6) Secara parsial maupun simultan ada hubungan anatara kebiasaan belajar di rumah dan di sekolah dengan prestasi prestasi belajar. Saran dari penelitian ini adalah (1) Siswa hendaknya tetap mempertahankan kebiasaan belajar di rumah maupun di sekolah agar siswa dapat berprestasi lebih baik lagi; (2) Guru mata diklat hendaknya menciptakan suasana belajar mengajar yang mampu menumbuhkembangkan kegairahan belajar siswa ; (3) Bagi orangtua hendaknya memperhatikan dan mendampingi anak dalam kegiatan belajarnya di rumah sehingga anak termotivasi untuk belajar lebih giat lagi; (4) Peneliti yang akan datang diharapkan penelitian ini untuk ditindaklanjuti dengan variabel yang berbeda dan sampel yang lebih luas.

Studi tentang aspek-aspek yang dipertimbangkan guru dalam penilaian ranah psikomotorik, kognitif, afektif pada pembelajaran pendidikan jasmani, olahraga dan kesehatan di SMP se-kecamatan Kesamben Kabupaten Blitar / Mohamad Ryan Dzul Fahmi

 

ABSTRAK Fahmi, Mohamad Ryan Dzul. 2009. Studi tentang Aspek-aspek yang Dipertimbangkan Guru dalam Penilaian Ranah Psikomotorik, Kognitif, Afektif pada Pembelajaran Pendidikan Jasmani, Olahraga dan Kesehatan di SMP se-Kecamatan Kesamben Kabupaten Blitar. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing (I) Dra. Siti Nurrochmah, M.Kes, (II) Drs. Mulyani Surendra, M.S. Kata kunci : penilaian, ranah psikomotorik, kognitif, afektif. Untuk mengetahui ketercapaian tujuan pendidikan, terutama untuk mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan maka dapat dilakukan dengan cara melaksanakan penilaian. Dimana tujuan dilakukannya penilaian adalah untuk mengetahui seberapa jauh kemampuan siswa dan berhasil tidaknya proses pembelajaran yang dilakukan oleh para pengajar dan siswa. Terutama untuk perubahan-perubahan perilaku siswa yang diharapkan melalui proses belajar. Secara umum, dalam pembelajaran Pendidikan Jasmani, Olahraga dan Kesehatan terdapat 3 ranah yang diharapkan mampu dikuasai oleh siswa sebagai hasil belajar. Ketiga ranah tersebut adalah ranah kognitif, afektif, dan psikomotorik. Dalam penilaian ketiga ranah tersebut, aspek-aspek yang terdapat dalam masing-masing ranah penilaian tentu berbeda-beda. Berdasarkan pengamatan awal yang dilakukan peneliti di Kecamatan Kesamben diperoleh hasil bahwa dalam melaksanaan penilaian guru Pendidikan Jasmani, Olahraga dan Kesehatan di SMP se-Kecamatan Kesamben belum mengetahui aspek-aspek yang seharusnya dipertimbangkan dalam penilaian ranah kognitif, afektif, dan psikomotorik pada pembelajaran Pendidikan Jasmani, Olahraga dan Kesehatan berdasarkan kurikulum tingkat satuan pendidikan (KTSP). Belum sepenuhnya menggunakan sistem penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan yang sesuai dengan kurikulum tingkat satuan pendidikan (KTSP), dan masih ada beberapa aspek yang sebenarnya tidak termasuk dalam kurikulum tingkat satuan pendidikan (KTSP) untuk aspek penilaian ranah kognitif, afektif, psikomotorik digunakan untuk menilai siswa pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan. Oleh karena itu peneliti tertarik untuk mengetahui aspek-aspek apa saja yang dipertimbangkan guru dalam memberikan nilai mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan pada ranah psikomotorik, kognitif, afektif. Rumusan masalah dalam penelitian ini yaitu aspek-aspek apa saja yang dipertimbangkan guru dalam memberikan nilai pada ranah psikomotorik, kognitif, afektif. Penelitian ini bertujuan untuk mengetahui dan mengkaji aspek-aspek yang dipertimbangkan guru dalam memberikan penilaian pada ranah psikomotorik, kognitif, afektif. Penelitian ini dilakukan di seluruh SMP se-Kecamatan Kesamben yang berjumlah 6 SMP. Yang menjadi subyek penelitian adalah guru mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan di SMP se-Kecamatan Kesamben yang berjumlah 9 orang guru. Jenis penelitian ini termasuk penelitian deskriptif, instrumen yang digunakan dalam penelitian ini berupa instrumen angket dan analisis data yang digunakan adalah teknik analisis persentase. Hasil penelitian yang telah dilakukan menunjukkan bahwa aspek-aspek yang dipertimbangkan oleh guru dalam penilaian ranah psikomotorik pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan menurut penelitian ini adalah aspek keterampilan olahraga 100%, kebugaran jasmani 88,9%, dan kelincahan 77,8%. Hasil penelitian yang selanjutnya yaitu aspek-aspek yang dipertimbangkan oleh guru dalam penilaian ranah kognitif pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan menurut penelitian ini adalah aspek pengetahuan pendidikan jasmani dan olahraga 100%, aplikasi teknik 77,8%, dan pengetahuan perilaku hidup sehat 66,7%. Sedangkan hasil penelitian tentang aspek-aspek yang dipertimbangkan oleh guru dalam penilaian ranah afektif pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan menurut penelitian ini adalah aspek sikap disiplin dan kerjasama 100%, sportif dan motivasi 88,9%, tanggungjawab dan percaya diri 77,8%, dan kejujuran 55,5%. Berdasarkan penelitian ini dapat diberikan saran kepada guru Pendidikan Jasmani, Olahraga dan Kesehatan dalam melakukan penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan hendaknya berpedoman pada buku panduan penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan pada kurikulum tingkat satuan pendidikan (KTSP), sehingga mengetahui aspek-aspek yang seharusnya dipertimbangkan dalam melakukan penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan serta tidak terkesan seenaknya dalam melakukan penilaian.

Penerapan pendekatan pembelajaran matematika realistik Indonesia (PMRI) untuk meningkatkan prestasi belajar siswa pada materi bangun ruang di kelas VIII SMP Negeri 5 Malang / Hustiawan Adha Cahyono

 

ABSTRAK Cahyono, Hustiawan Adha. 2009. Penerapan Pendekatan Pembelajaran Matematika Realistik Indonesia (PMRI) untuk Meningkatkan Prestasi Belajar Siswa Pada Materi Bangun Ruang di Kelas VIII D SMP Negeri 5 Malang. Skripsi, Program Studi Pendidikan Matematika Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dra. Santi Irawati, M.Si, Ph.D (II) Drs. Rustanto Rahardi, M.Si. Kata Kunci: PMRI, prestasi siswa dan penelitian tindakan kelas Penelitian ini berawal dari keadaan kelas VIII D yang tidak menyukai matematika. Berdasarkan pengamatan langsung yang dilakukan pada waktu PPL (praktek pengalaman lapangan) terlihat bahwa siswa tidak berani bertanya dan kurang motivasi dalam belajar matematika. Hal ini menyebabkan perolehan nilai siswa tidak mencapai KKM (Kriteria Ketuntasan Minimum). Demikian juga berdasarkan hasil wawancara dengan guru mata pelajaran matematika, didapat bahwa banyak siswa yang tidak mencapai KKM pada materi kubus dan balok. Bangun kubus dan balok ini sering dijumpai pada kehidupan sehari-hari sehingga diperlukan pembelajaran yang khusus yaitu PMRI (Pembelajaran Matematika Realistik Indonesia). Berdasarkan pengamatan tersebut perlu dilakukan penelitian untuk meningkatkan prestasi belajar siswa pada materi bangun ruang kelas VIII D dengan menggunakan PMRI. Penelitian merupakan penelitian tindakan kelas yang menggunakan 4 tahap yaitu perencanaan, tindakan, pengamatan dan refleksi. Dalam pelaksanaannya, penelitian ini dilaksanakan menggunakan dua siklus. Pada siklus I dilakukan 5 kali tindakan sedangkan pada siklus II hanya 1 kali tindakan. Sebelum pelaksanaan siklus I diberikan pretes untuk mengetahui kemampuan awal siswa, kemudian diberikan postes setelah akhir siklus I dan siklus II. Postes ini untuk mengetahui ada tidaknya peningkatan prestasi belajar siswa pada bangun ruang kelas VIII D di SMP Negeri 5 Malang. Berdasarkan hasil penelitian diperoleh bahwa prestasi belajar pada materi bangun ruang siswa kelas VIII D SMP Negeri 5 Malang meningkat. Hal ini ditunjukkan oleh nilai rata-rata pretes yaitu 62,74 yang meningkat pada nilai rata-rata postes siklus I yaitu 76,18 menjadi 88,1 pada nilai rata-rata siklus II. Di samping itu juga dilihat dari banyaknya siswa yang tuntas belajar mengalami peningkatan yaitu dari nilai pretes siklus I diketahui 29% siswa tuntas belajar kemudian untuk nilai postes siklus I siswa yang tuntas belajar naik menjadi 74%. Pada siklus II banyak siswa yang tuntas belajar naik lagi menjadi 97%. ABSTRACT Cahyono, Hustiawan Adha. 2009. Application of Indonesia Realistic Mathematics Learning (PMRI) Approach to Increase Students'Learning Achievement on 3D Concept in Class VIII D SMP Negeri 5 Malang. Thesis, Departement of Mathematics Faculty of Mathematics and Sciences State University of Malang. Advisors: (I) Dra. Santi Irawati, M.Si. Ph.D (II) Drs. Rustanto Rahardi, M.Si Key words: PMRI, student achievement and research of class measure This research is started from the students' of VIII D classroom that dislike mathematic lesson. Based on the direct observation that was doing when PPL (Praktek Pengalaman Lapangan), it is shown that the student did not brave to ask and did not have quite motivation in mathematic learning. It could cause that students' achievement can not reach the KKM (Kriteria Ketuntasan Minimum). Moreover, based on the result of interview with mathematic teacher, it is concluded that many students can not reach the KKM on cube and cuboid topics. These cube and cuboid concept are often encountered in daily life so that it is needed a special learning such as Pembelajaran Matematika Realistik Indonesia (PMRI). Based on that observation, it is needed to have a research to increase students' learning achievement on 3D concept for grade VIII D at SMPN 5 Malang by using PMRI. The research is a classroom action research using 4 stages of planning, action, observation and reflection. In implementation, this research is carried out using two cycles. There are performed five actions in cycle I and only one action in cycle II. Before the implementation it was given to determine the students' prior know ledge a pretest prior knowledge, and then a post test in the end of cycle I and cycle II. These post test is given to know the improvementof students' learning achievement in 3D concept in grade VIII D SMP Negeri 5 Malang. Based on research results, it is obtained that the students' learning achievement in 3D concept grade VIII D at SMP Negeri 5 Malang is increased. This is indicated by the average value of pretest 62.74 which is increased at an average value of post test in the cycle I that is 76.18 into 88.1 in cycle II. Beside, the number of students who reached the KKM is increased from 29% (pre test I) into cycle I into 74% (pos test I). In cycle II the number of students who reached the KKM is 97% (post test II).

Pengaruh stress kerja terhadap motivasi kerja dan dampaknya pada kinerja karyawan (studi pada karyawan Bumiputera 1912 Kantor Cabang Tulungagung) / Derrytyas Ferryna F.

 

Karyawan sebagai sumber daya yang dimiliki oleh perusahaan yang merupakan faktor penting dalam menentukan berhasil tidaknya suatu perusahaan,sehingga pelaksanaan kerja karyawan sangat mempengaruhi tujuan organisasisecara keseluruhan. Betapapun baiknya sumber daya lain yang dimiliki oleh perusahaan jika tidak didukung oleh karyawan yang bekerja secara efektif dan efisien maka tetap saja tidak dapat mencapai tujuan organisasi yang memuaskan bahkan bisa saja menemui kegagalan. Motivasi merupakan suatu dorongan agar para karyawan dapat bekerja sesuai dengan apa yang diharapkan perusahaan.pemberian motivasi kepada karyawan dapat mempengaruhi aktivitas bagi perusahaan dalam meningkatkan produktivitas kerja. Tumbuhnya motivasi yang terjadi pada diri karyawan menjadi suatu proses kearah pencapaian tujuan pengelolaan sumber daya manusia. Untuk keberhasilan pengelolaan, perlu pemahaman terhadap keinginan karyawan sebagai manusia yang memiliki harapan dan perlu pemahaman terhadap kebutuhan dari setiap individu yang terlibat didalamnya yang dapat mendorong atau memotivasi kegiatan kerja mereka. Dengan adanya pemahaman terhadap harapan dan kebutuhan dari setiapindividu yang terlibat didalamnya, akan dimungkinkan terciptanya motivasi yang tinggi pada diri individu yang bersangkutan untuk melakukan suatu kegiatan sesuai dengan kewajibannya. Penelitian ini bertujuan untuk mengetahui pengaruh stress kerja yang ada di BUMIPUTERA 1912 Kantor Cabang Tulungagung terhadap kinerja dengan di mediasi oleh motivasi kerja. Penelitian ini dilaksanakan di BUMIPUTERA 1912 Kantor Cabang Tulungagung pada awal bulan Mei sampai dengan akhir bulan Mei 2009. Subjek dalam penelitian ini adalah karyawan BUMIPUTERA 1912 Kantor Cabang Tulungagung yang berjumlah 101 orang. Sedangkan sampelnya diambil sebanyak 80 orang dan teknik pengambilan sampel menggunakan simple random sampling. Analisis data yang dipakai analisis jalur (path analysis) yang merupakan suatu bentuk terapan dari analisis regresi berganda (multiple regression analysis).Tujuan dari analisis jalur adalah untuk mengetahui pengaruh langsung dan tidak langsung. Dalam tujuan penelitian ini untuk mengetahui pengaruh langsung stress kerja terhadap motivasi kerja, stress kerja terhadap kinerja dan motivasi kerja terhadap kinerja karyawan.sedangkan untuk pengaruh tidak langsung stress kerja terhadap kinerja karyawan yang dimediasi oleh motivasi kerja. iv Dalam penelitian ini mempunyai variabel bebas yaitu Stress Kerja (X), variabel antara yaitu Motivasi Kerja (Z) dan variabel terikat yaitu Kinerja (Y). Pengujian hipotesis dilakukan dengan menggunakan SPSS for windows 10.0.Hasil penelitian ini menunjukkan bahwa keempat hipotesis alternatif yang diajukan adalah diterima. Hasil pengaruh langsung diperoleh beta (β) sebesar - 0,444 dengan Signifikansi (Sign) 0,000 untuk stress kerja terhadap motivasi kerja, beta (β) sebesar -0,238 dengan Sign 0,031 untuk stress kerja terhadap kinerja, beta 􁈺β􁈻 sebesar 0,376 dengan Sign 0,001 untuk motivasi kerja terhadap kinerja. Sedangkan untuk pengaruh tidak langsung dihasilkan sebesar -0,167 yaitu hasil dari pengaruh tidak langsung stress kerja terhadap kinerja melalui mediasi motivasi kerja. Sedangkan koefisien detreminasi total yang diperoleh sebesar 0,419. Berdasarkan hasil penelitian ini disarankan agar BUMIPUTERA 1912 Kantor Cabang Tulungagung lebih memperhatikan faktor apa saja yang dapat mempengaruhi motivasi, seperti penghargaan atas kerja, ketentuan gaji yang layak, dan lain-lain, yang membuat karyawan lebih bersemangat dalam bekerja.stress kerja yang dirasakan oleh karyawan rendah, berarti karyawan tidak menganggap pekerjaannya adalah suatu keterpaksaan. Hal ini harus tetap dijaga oleh Kepala Cabang BUMIPUTERA 1912 cabang Tulungagung dengan tetap memperhatikan faktor-faktor yang dapat megakibatkan stress menjadi tinggi. Dalam penelitian selanjutnya agar objek penelitian yang diambil mempunyai kuantitas responden yang lebih besar dan berada di kota-kota besar. Dengan mengambil sampel pada organisasi yang berskala lebih besar maka akan memiliki keragaman yang lebih tinggi karakter baik demografi pada karyawannya. Peneliti juga menyarankan untuk penelitian selanjutnya agar menambah hipotesis penelitian dengan variabel-variabel kepuasan kerja,komitmen, niatan untuk keluar, dan lain-lain. Sehingga nantinya dapat diperoleh perkembangan dari penelitian-penelitian yang sudah ada. Dalam kegiatan penelitian, penulis menemui berbagai kendala salah satunya mengenai jauhnya jarak lokasi penelitian yang mengakibatkan kurangnya intensitas observasi sehingga kurang begitu mendalam dalam menjabarkan fenomena yang terjadi di perusahaan. Untuk penelitian selanjutnya agar objek penelitian dekat dengan lokasi tempat tinggal penulis dan dilakukan komunikasi tidak hanya melihat langsung objek penelitian tetapi juga dengan media komunikasi berupa telepon.

Pengaruh model pembelajaran TGT (Teams Games Tournament) terhadap hasil belajar geografi di MTs Negeri Pulosari, Ngunut Kabupaten Tulungagung / Titis Nurhayati

 

Pembelajaran merupakan proses interaksi yang terjadi antara guru dengan siswa agar siswa mendapatkan pengalaman belajar dari kegiatan tersebut. Dalam proses pembelajaran, pemilihan suatu metode sangat menentukan kualitas pembelajaran. Seiring dengan proses peningkatan kualitas pembelajaran, maka dalam kurikulum KTSP dianjurkan adanya variasi metode dalam kegiatan pembelajaran agar siswa dapat terlibat aktif di dalamnya. Variasi metode dapat ditunjukkan jika guru menerapkan berbagai model pembelajaran untuk menyampaikan materi, karena di dalam model pembelajaran terdapat beberapa metode yang dapat diterapkan sehingga melibatkan siswa aktif. Salah satu pendekatan pembelajaran yang melibatkan siswa aktif adalah pembelajaran yang bersifat konstruktivis. Dalam pembelajaran konstruktivis ada beberapa model yang dapat diterapkan, salah satunya adalah model pembelajaran TGT (Teams Games Tournament). Dalam model pembelajaran ini pengelompokan siswa berdasarkan prinsip heterogenitas baik dari segi kemampuan akademik, jenis kelamin, maupun ras. Penelitian ini bertujuan untuk mengetahui pengaruh model pembelajaran TGT (Teams Games Tournament) terhadap hasil belajar Geografi siswa kelas VII MTs Negeri Pulosari pada topik Hidrosfer. Penelitian ini termasuk jenis penelitian eksperimen semu (Quasi Eksperiment) dengan mengambil subjek penelitian dua kelas yaitu kelas VII C sebagai kelas eksperimen dan kelas VII A sebagai kelas kontrol. Instrumen penelitian berupa tes untuk prates dan pascates. Teknik analisis yang digunakan adalah uji t tidak berpasangan (Independent Samples Test) yang dapat diselesaikan dengan bantuan SPSS 13.00 for Windows. Hasil penelitian menunjukkan bahwa terdapat perbedaan yang signifikan antara nilai rata-rata kelas eksperimen dankelas kntrol. Dari hasil analisis data diketahui bahwa hasil belajar siswa pada kelas eksperimen memiliki rata-rata sebesar 27,50 sedangkan pada kelas kontrol memiliki rata-rata 23,29 dengan nilai probabilitas (p) 0,009, sehingga ada pengaruh penerapan model pembelajaran TGT terhadap hasil belajar Geografi siswa pada topik Hidrosfer. Disarankan bagi guru Geografi untuk menggunakan model pembelajaran TGT sebagai variasi model pembelajaran karena dapat meningkatkan hasil belajar siswa. Bagi peneliti selanjutnya disarankan untuk menggunakan model ini untuk materi selain topik Hidrosfer.

Implikasi realistic mathematic education (RME) terhadap tingkat pemahaman siswa kelas II sekolah dasar pada materi pembagian / Otik Mulyantiningsih

 

ABSTRAK Mulyantiningsih, Otik. 2009. Implikasi Realistic Mathematics Education (RME) terhadap Tingkat Pemahaman Siswa Kelas II Sekolah Dasar pada Materi Pembagian. Skripsi, Jurusan Matematika, FMIPA, Universitas Negeri Malang. Pembimbing: (I) Dra. Etty Tedjo Dwi C., M.Pd, (II) Drs. H. Imam Supeno, M.S. Kata Kunci: realistic mathematics education, tahapan pemahaman konsep, tes pemahaman konsep. Matematika merupakan salah satu alat untuk menyusun pemikiran yang jelas, tepat, dan taat azas. Dalam pembelajaran matematika perlu dikembangkan materi dan proses pembelajaran matematika yang sesuai dengan kebutuhan, perkembangan kognitif dan keterampilan intelektual siswa sehingga konsep matematika yang bersifat abstrak dapat dipahami dengan mudah dan bermakna. Observasi awal yang dilakukan di SDN Saptorenggo I Pakis Malang pada kelas II menunjukkan bahwa pembelajaran dilakukan dengan cara tradisional, pemahaman konsep siswa masih kurang sehingga sulit memahami materi perkalian, soal latihan yang digunakan adalah soal hitung murni, dan pembelajaran kurang bermakna. Oleh karena itu perlu adanya pembelajaran yang dapat mengaitkan konsep matematika dengan pengalaman anak sehari-hari yaitu dengan menerapkan Realistic Mathematics Education (RME). Dalam penelitian ini, jenis penelitian yang digunakan adalah Deskriptif Kualitatif. Penelitian dilaksanakan pada tanggal 3-21 Maret 2009 dengan banyaknya siswa 43 orang. Hasil penelitian disajikan secara deskriptif. Pembelajaran Matematika Realistik yang diterapkan diawali dengan pemberian masalah kontekstual dengan menggunakan alat peraga. Masalah didiskusikan secara kelompok dan hasil diskusi kelompok disajikan dalam diskusi kelas yang bertujuan untuk mendapatkan kesimpulan dari masalah yang diberikan. Hasil penelitian menunjukkan bahwa Pembelajaran Matematika Realistik meningkatkan kemampuan pemahaman konsep siswa kelas II SDN Saptorenggo I Pakis Malang pada materi pembagian. Untuk penelitian selanjutnya disarankan untuk menerapkan Realistic Mathematics Education (RME) dengan memberikan soal-soal yang mempunyai jawaban terbuka dan pembelajaran kooperatif agar siswa terbiasa bekerja dalam kelompok.

Penerapan model pembelajaran Talking Stick untuk meningkatkan kemampuan membaca pemahaman siswa kelas V SDN Jetis 1 Kabupaten Nganjuk / Zenny Dwi Lutfita

 

Kata Kunci:Model PembelajaranTalking Stick, Membaca Pemahaman, Sekolah Dasar Hasilobservasi yang dilakukanpeneliti di kelas V SDNJetis 1KabupatenNganjukpadapembelajaranBahasa Indonesia materimembacapemahamandidapatkanfaktasebagaiberikut. (1) Siswamasihmengalamikesulitandalammemahamiisibacaan; (2) Saat guru menanyakantentangisibacaan, siswacenderungmenanyakanjawabanpadatemanatau guru tanpamaumembacakembaliteksbacaan; (3) Rata-rata hasilbelajarsiswahanyamencapai 66,7 denganketuntasankelas 45,8%, sedangkanKKM yang ditentukanadalah 70,00 untukhasilbelajardan 75% untukketuntasan belajar klasikal. Untukmeningkatkankemampuanmembacapemahamansiswa kelas V SDN Jetis 1, perludiadakanperbaikanpembelajaran salah satu alternatifnya menerapkan model Talking Stick. Penelitianinibertujuanuntukmendeskripsikanpenerapan model Talking StickpadapembelajaranBahasa Indonesia. Mendeskripsikankemampuanmembacapemahamansiswasetelahmenerapkan model Talking Stickpadakelas V SDN Jetis 1. Penelitianinimenggunakanjenispenelitiantindakankelasdenganpendekatandeskriptifkualitatif model kolaboratif. Subyekpenelitianadalahsiswakelas V SDNJetis 1 KabupatenNganjuk yang berjumlah 24 siswa. Data yang diambil yaitu pelaksanaan pembelajaran menerapkan model Talking Stick dan hasil belajar siswa. Data diperoleh melalui observasi, wawancara, tesdandokumentasi. Hasilpenelitianmenunjukkanbahwapenerapan model Talking Stick yang berlangsungsecaraefektifdanseksamadapatmeningkatkankemampuanmembacapemahamansiswa kelas V SDN Jetis 1. Hal tersebutterbuktidarinilai rata-rata hasilbelajarsiswapadapratindakan 66,7, siklusI 71, sedangkanpadasiklus II meningkatmenjadi85. Ketuntasanbelajarpadapratindakan45,8%, siklus I 66,7%, danpadasiklusII meningkatmenjadi 83,3%. Saran yang dapatdiberikanberdasarkanhasilpenelitianiniantar lain: (1) untukkesempurnaanpenerapan model pembelajaran Talking Stickharusdisediakanalokasiwaktu yang cukup agar tidakmengurangitahapberpikirdanmenjawabsiswa; (2) guru hendaknyamembuatvariasi model pembelajaranmemadukan model pembelajaran Talking Stick denganmetode yang lain; (3) dalampenilaian guru hendaknyamenekankanpemahamansiswapadaaspekkemampuanmembaca yang ditentukan.

The implementation of bilingual education at Klabat University and its outcomes in terms of students' English proficiency and their achievement in subject-matter / Adele Micheline Pattiradjawane

 

ABSTRACT Pattiradjawane, Micheline Adele. 2009. The Implementation of Bilingual Education at Klabat University and Its Outcomes as Seen in Students’ English Proficiency and their Achievement in Subject-matter. Dissertation, English Education Program, Post Graduate Program, State University of Malang. Advisors: (I) Prof. Dr.H. M. F. Baradja, M.A., (II) Prof. Drs. Bambang Yudi Cahyono, M.Pd, M.A., Ph.D., and (III) Prof. Dr. Siusana Kweldju, M.Pd Key words : implementation, bilingual education, English proficiency, achievement in bilingual subject-matter An important change taking place in the educational system of Indonesia is the use of English as medium of instruction for a number of content courses, while Bahasa Indonesia is still maintained as medium of instruction. This phenomenon has aroused attention of educational authorities. The two foci of the study are the implementation of the bilingual program and its outcomes as seen in students’ English proficiency and their achievement in subject-matter. With reference to the first focus, the objective of this study is to describe the implementation of bilingual education at Klabat University (KU). The second objective is to describe the outcomes of bilingual education in terms of students’ English proficiency and their achievement in subject-matter. The investigation into the implementation of bilingual education focused on practices that promoted and impeded the implementation, how English was cultivated in the bilingual program and how bilingual courses were conducted. The investigation on students’ outcomes focused on their English proficiency, their achievement in three bilingual courses, and the relationships between English proficiency and achievement in subject-matter. In order to achieve the objectives above, the research methods were qualitative and quantitative. Being dominantly a qualitative study the design adopted in this study was an emergent design. In order to describe the implementation of the bilingual program, the qualitative method was used. In order to describe the outcomes of bilingual education, the quantitative method was used. In order to describe the relationships between students’ English proficiency and their achievement in subject-matter, the qualitative method was employed. Three sampling procedures were used in the study: (1) snowballing sampling for respondents for the interview on the policies in implementation of bilingual education, (2) purposive sampling for six respondents to the questionnaire on policies and cultivation of English, and (3) proportional purposive sampling for subjects on their English proficiency and achievement in subject-matter. The subjects were students attending bilingual courses at KU. Each subject represented a level of proficiency. Their levels of proficiency were based on their scores on the placement test administered by the KU when they were accepted into the university. The four different levels of proficiencies were beginning English level, lower elementary level, upper elementary level, and intermediate level. Three methods were used to obtain data on the implementation of bilingual education: (1) interviewing respondents who were involved in the implementation of bilingual education, (2) distributing a questionnaire on the implementation of bilingual education to six lecturers from the School of Economics, and (3) observing the implementation of three bilingual courses: Intermediate Accounting II, Business Finance II, and Controllership. Data collection on the outcomes of bilingual education used five methods: administering the English Placement Test to the sample (N=44), administering the Test of English as a Foreign Language to the sample (N=32), obtaining the list of test scores on achievement in subject-matter from the lecturers who conducted the bilingual courses, distributing a questionnaire on students’ self perception of their achievement, and interviewing lecturers on their perception of students’ achievement. Data on the implementation of bilingual education were analyzed by crafting a profile. The quantitative data on students’ scores were analyzed by using descriptive statistics with using the t-test. The perception questionnaire was analyzed by data reduction, coding and categorizing. The findings show that the implementation of bilingual education at KU followed a natural course of events and was dominated by good practices such as complying with the procedures outlined in the university’s constitution, taking creative actions with no dependency on government’s fundings, imposing no pressure on students and teachers to use English thus allowing a comfortable sociolinguistic situation to emerge in which three languages coexists. The cultivation of English was extensive: English was used in academic and non-academic activities. However, the conducting of bilingual courses lacked in aspects of technology. Findings on the outcomes of bilingual education show that, in terms of English proficiency there was no significant difference between students’ scores on entry in the university and students’ second scores on the placement test. However, on analyzes by each level of proficiency, beginning English and lower elementary level students made significant gain in their English proficiency. Students at the upper elementary level gained in proficiency but not significantly, but intermediate students showed no gain in proficiency. It is concluded that students’ English proficiency is adequate for studies at KU. Findings on achievement in subject-matter are students’ achievement was satisfactory. Students’ achievement in subject-matter indicate students employ language knowledge and pragmatic strategies to work on the test tasks in the TLU domain. Achievement in IA II showed that the class is heterogeneous with σ 22.36 and variance of 499.99. Achievement in BF II showed that the class was homogenous with σ 4.42 and variance 19.5. Achievement in the CTR class showed a heterogeneous class with σ 9.37 and variance 87.97. It is concluded that students’ achievement is satisfactory due to an interplay of students’ computation skills, students’ strategies, students’ reading proficiency and students’ academic performance as attributed to having high GPA’s. In addition, there is no relationship between students’ English proficiency and their achievement. The conclusions drawn are that the implementation of bilingual education had practices that promoted the program. This study recommends the continuation of the bilingual education program at KU while working toward students’ graduating with dual certificates.

Studi tentang waktu pembelajaran pendidikan jasmani olahraga dan kesehatan di SMP negeri 19 Malang / Khoirul Insani

 

Insani, Khoirul. 2009. Studi Tentang Waktu Pembelajaran Pendidikan Jasmani Olahraga dan Kesehatan di SMP Negeri 19 Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. M. E. Winarno, M. Pd., (2) Dra. Desiana Merawati, M. S. Kata kunci: Pembelajaran, Pelaksanaan Waktu Belajar, Pendidikan Jasmani. Waktu belajar merupakan bagian yang tak terpisahkan dari tingkat keberhasilan proses belajar mengajar (PBM) suatu mata pelajaran. Pelaksanaan waktu belajar pendidikan jasmani dilakukan untuk mengetahui seberapa besar tingkat keberhasilan pengajaran dilihat dari waktu belajar akademis pendidikan jasmani. Dalam kegiatan pengajaran pendidikan jasmani, penilaian dilakukan terhadap beberapa variabel yaitu: kegiatan awal sebelum pembelajaran, pendahuluan, latihan inti, dan penutup. Tujuan dari penelitian ini adalah untuk mengetahui pelaksanaan waktu belajar pendidikan jasmani dilihat dari kegiatan awal sebelum pembelajaran, pendahuluan, latian inti dan penutup. Permasalahan dari penelitian ini adalah apakah guru sudah melaksanakan waktu belajar pendidikan jasmani yang sudah direncanakan. Rancangan yang digunakan dalam penelitian ini adalah penelitian deskriptif kuantitatif dengan variabel kriteria berdasarkan waktu belajar akademis pendidikan jasmani. Alat ukur yang digunakan dalam pengambilan data berupa panduan observasi. Subyek dalam penelitian ini adalah guru pendidikan jasmani yang ada di SMP Negeri 19 Malang yang berjumlah 2 guru pendidikan jasmani. Diperoleh reliabilitas adalah 0,986 dan objektivitas adalah 0,999. Hasil penelitian menunjukkan bahwa pelaksanaan waktu belajar pendidikan jasmani oleh guru pendidikan jasmani di SMP Negeri 19 Malang tergolong masih kurang maksimal, kegiatan awal pembelajaran 58,3% guru yang menyiapkan perangkat pembelajaran, pada pelaksanaan kegiatan, pada tahap pendahuluan 22,67 menit (283,37%), tahap latihan inti 28,33 menit (42,92%) dan tahap penutup 4,85 menit (80,83%). Secara keseluruhan pelaksanaan waktu pembelajaran pendidikan jasmani 56,43 menit atau 70,53%. Saran-saran dari hasil penelitian adalah sebagai berikut: ditinjau dari setiap variabel, pembelajaran pendidikan jasmani yang dilakukan oleh guru di SMP Negeri 19 Malang kurang efektif. Diharapkan semua guru menyusun perangkat pembelajaran, pendahuluan yang dilakukan masih terlalu lama, sebaiknya dipersingkat agar waktu dapat difokuskan pada tahap inti. Guru diharapkan melibatkan siswa dalam memilih materi yang akan diajarkan dalam satu semester atau satu tahun.

Legenda watugunung sebagai sumber koreografi yang menggali nilai budaya pernikahan sedarah dalam pendidikan moral Jawa / Eko Purwaningsih

 

ABSTRAK Purwaningsih, Eko. 2009. Legenda "Watugunung" sebagai Sumber Koreografi yang Menggali Nilai Budaya Pernikahan Sedarah dalam Pendidikan Moral Jawa. Skripsi Penciptaan Karya Seni, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Drs. Soerjo Wido Minarto, M.Pd, (II) Drs. Supriyono. Kata kunci : Pendidikan Moral, Pernikahan Sedarah, Pembuatan koreografi Legenda "Watugunung". Pendidikan moral merupakan sebuah cara membimbing seseorang yang dilakukan dengan sengaja oleh orang dewasa kepada anak-anak untuk memberikan suatu pelajaran nilai atau norma, baik buruknya suatu perbuatan. Pendidikan moral dapat dilakukan lewat berbagai media, hal ini memberikan kesempatan luas kepada pihak untuk berperan aktif dalam memajukan pendidikan kita. Perkawinan Sedarah atau Incest adalah hubungan badan atau hubungan seksual yang terjadi antara dua orang yang mempunyai ikatan pertalian darah. Dalam hal ini hubungan seksual sendiri ada yang bersifat sukarela dan ada yang bersifat paksaan. Paksaan itulah yang dinamakan perkosaan. Jika itu terjadi antara dua orang yang bertalian darah itulah yang dinamakan Incest. Dan kasus Incest yang lebih banyak diketahui masyarakat adalah perkosaan Incest. Penciptan karya tari dramatik "Watugunung" bertujuan untuk mengetahui proses penciptaan karya sebagai sarana pengenalan budaya pernikahan sedarah dan pendidikan moral. Sebuah koreografi ini ditujukan tidak hanya untuk pelajar tetapi juga masyarakat umum, karena dalam tari ini memberikan sebuah pendidikan moral tentang pernikahan sedarah yang berdampak negatif, dan perlu diperhatikan baik dari masyarakat maupun para pelajar khususnya, sebagai media pendidikan. Semakin berkurangnya nilai-nilai moral dalam era modernitas ini mendorong koreografer untuk melakukan upaya mengembangkan legenda Watugunung sebagai salah satu legenda perkawinan sedarah di Indonesia ke dalam bentuk karya tari, yang membawa pesan dan nilai moral bagi masyarakat luas. Dalam koreografi berjudul Watugunung (dalam wacana Incest) penggarapan koreografi legenda Watugunung sebagai pengenalan budaya dan pendidikan moral, koreografer mencoba untuk bisa menawarkan suatu hal baru dalam sebuah karya tari, baik saat berproses latihan atau pada saat pementasan. Pembawaan gerak tari yang bernuansa baru dikemas dengan teatrikal, dan duet, kemudian lighting, musik, coba di optimalkan pada saat pementasan. Selama proses pembuatan koreografi legenda Watugunung ini banyak sekali bantuan yang diberikan dari tim kreatif dan para penari, berupa dorongan kreatifitas, semangat dan juga data yang menunjang riset, sehingga pelaksanaan pembuatan dan penyusunan koreografi ini berjalan dengan baik. Dari hasil penyusunan koreografi ini, terbagi atas empat adegan. Dengan mengambil tema perkawinan sedarah atau Incest. Judul tari Watugunung berasal dari sebuah legenda yang hidup pada masyarakat Jawa dan Bali, dimana legenda ini menceritakan seorang anak yang menikahi ibunya sendiri dan legenda ini adalah sebagai dasar munculnya hitungan waktu atau wuku pada masyarakat Jawa dan Bali.

Translation analysis in menu of mobile phone: the Indonesian language used in Nokia 3530 / Halim Rosyid

 

This study aimed at analysing the Indonesian translation in the menu of Nokia 3530. In addition, this study focused on examining the translation procedures used to translate menu items in mobile phone Nokia 3530, identifying the degree of message conservation and also suggesting some improvements for the translations. The results of this study showed that the most dominant translation procedure used to translate words was literal translation, used to translate phrases was transposition, used to translate sentences is literal translation. Another result was about the degree of message conservation. Most translations of word, phrase and sentence in menu items of Nokia 3530 were considered as faithful translation. Key words: translation, translation analysis, menu, mobile phone.

Pengembangan media VCD pembelajaran metode permainan (baris bilangan) pada mata pelajaran matematika pokok bahasan operasi bilangan bulat untuk SD kelas IV semester II / Nur Rohmad

 

ABSTRAK Rohmad, Nur. 2009. Pengembangan Media VCD Pembelajaran Metode Permainan ‘Baris Bilangan’ Pada Mata Pelajaran Matematika Pokok Bahasan Operasi Bilangan Bulat Untuk SD Kelas IV Semester II. Skripsi. Jurusan Teknologi Pendidikan FIP Universitas Negeri Malang. Pembimbing : (I) Dr. Imanuel Hitipeuw, MA, (II) Eka Pramono Adi, M.Si. Kata kunci: Pengembangan, Media VCD Pembelajaran, Permaianan Baris Bilangan, Matematika. Media VCD pembelajaran adalah media pembelajaran yang penyampaiannya memadukan unsur audio, visual dalam waktu yang bersamaan sehingga dapat menarik minat pengguna. Matematika merupakan mata pelajaran yang bersifat abstrak, sehingga dituntut kemampuan guru untuk dapat mengupayakan metode yang tepat sesuai dengan tingkat perkembangan mental siswa. Untuk itu diperlukan model dan media pembelajaran yang dapat membantu siswa untuk mencapai kompetensi dasar dan indikator pembelajaran. Salah satu media yang sesuai dengan perkembangan teknologi saat ini adalah media VCD pembelajaran. Tujuan pengembangan VCD pembelajaran ini adalah untuk membuat media VCD pembelajaran metode permainan “Baris Bilangan” pada mata pelajaran Matematika pokok bahasan Operasi Bilangan Bulat untuk Sekolah Dasar kelas IV semester II yang efektif dan dapat membantu proses pembelajaran. Subyek ujicoba dalam pengembangan media CD pembelajaran ini adalah siswa kelas IV SD Laboratorium UM. Jenis data pengembangan ini adalah kualitatif deskriptif. Sedangkan pengumpulan data dilakukan melalui observasi, serta menggunakan instrumen berbentuk angket yang diberikan kepada ahli media, ahli materi, dan siswa. Untuk hasil belajar siswa digunakan evaluasi dalam bentuk pre test dan post test. Analisis data yang digunakan untuk mengolah data hasil validasi ahli media, ahli materi, dan audiens adalah prosentase, sedangkan untuk mengolah hasil belajar siswa digunakan diagram perbandingan. Hasil pengembangan media VCD pembelajaran ini berdasarkan analisis data dari 2 ahli media, 1 ahli materi, dan siswa, kemudian dianalisia berdasarkan atas tabel spesifikasi Sudjana, memenuhi kriteria valid, atau dapat dikatakan ahli media setuju bahwa VCD pembelajaran ini sudah layak untuk diterapkan, dengan hasil yakni ahli media 95 %, ahli materi 92,5 %, audiens 87,89 %. Sedangkan untuk tes hasil belajar menunjukkan media VCD pembelajaran ini memberikan efek positif terhadap hasil belajar siswa, itu dapat membuktikan bahwa meskipun materi sudah pernah diajarkan ternyata media ini efektif. Saran yang diajukan, hendaknya hasil produk media VCD pembelajaran ini dipergunakan dengan sebaik-baiknya dan ditindak lanjuti sehingga dapat memberikan kontribusi yang berarti terhadap pembelajaran di Sekolah Dasar (SD), khususya untuk mata pelajaran matematika.

Pengembangan media compact disc (CD) interaktif pembelajaran bahasa Jerman untuk keterampilan mendengar dan menulis di SMA Negeri I Tumpang / Nina Izati

 

ABSTRAK Izati, Nina. 2009. Pengembangan Media Compact Disc (CD) Interaktif untuk Keterampilan Mendengar dan Menulis di SMA Negeri I Tumpang. Skripsi, Jurusan Pendidikan Bahasa Jerman Fakultas Sastra Universitas Negeri Malang. Pembimbing: (1) Dra. Sawitri Retnantiti, M.Pd, (II)Edy Hidayat, S.Pd, M.Hum,. Kata kunci: pengembangan, media CD interaktif, pembelajaran bahasa Jerman. Media CD interaktif adalah salah satu media yang bisa digunakan dalam pembelajaran bahasa Jerman yang mampu menggabungkan teks, grafis, gambar, foto, audio, video, dan animasi secara terintegrasi. Berdasarkan hasil wawancara dengan guru matapelajaran bahasa Jerman SMA Negeri I Tumpang dan hasil dari angket analisis kebutuhan, diketahui bahwa 1) prestasi belajar bahasa Jerman siswa kelas XI program Bahasa menurun, 2) siswa tidak begitu antusias dalam mengikuti kegiatan pembelajaran bahasa Jerman, 3) siswa mengalami banyak kesulitan dalam mempelajari Grammatik bahasa Jerman, 4) siswa mengalami banyak kesulitan dalam pembelajaran bahasa Jerman keterampilan menulis dan belum pernah mendapatkan kegiatan pembelajaran untuk keterampilan mendengar, dan 5) media CD interaktif belum pernah digunakan dalam kegiatan pembelajaran bahasa Jerman. Pengembangan media yang mampu mengkombinasikan keterampilan mendengar dan keterampilan menulis dianggap efektif untuk mengatasi permasalahan tersebut. Oleh sebab itu, pengembang memilih mengembangkan media CD interaktif, yang dengan kelebihannya mampu mengintegrasikan pembelajaran untuk keterampilan mendengar dan menulis. Tujuan dari penelitian pengembangan ini adalah mengembangkan media CD interaktif pembelajaran bahasa Jerman keterampilan mendengar dan menulis guna memenuhi kebutuhan sekolah akan media. Untuk tujuan penelitian pengembangan ini, pengembang menggunakan pendekatan deskriptif kualitatif. Data kualitatif berasal dari hasil wawancara, angket, observasi, dan hasil tes mendengar dan menulis siswa. Sebelum diujikan di lapangan, produk media ini divalidasi oleh dua ahli, yaitu ahli media dan ahli materi untuk menilai kelayakan media. Subjek uji coba pada penelitian pengembangan ini adalah guru bahasa Jerman dan 29 siswa kelas XI program bahasa SMA Negeri I Tumpang. Angket pada tahap validasi dan uji coba dianalisis dengan menggunakan persentase. Hasil wawancara dan hasil observasi dianalisis secara deskriptif. Adapun nilai siswa dijadikan sebagai data pendukung angket uji coba siswa. Hasil dari penelitian pengembangan ini adalah media CD interaktif dapat digunakan dalam proses pembelajaran dengan sedikit revisi. Menurut pendapat ahli media, dikatakan bahwa media sangat valid dengan persentase sebesar 85%. Pendapat ini didukung oleh ahli materi yang menyebutkan, bahwa media sangat valid dengan persentase sebesar 85%. Adapun menurut guru, media sangat valid dengan persentase sebesar 84%. Dari angket siswa diperoleh hasil, bahwa media cukup valid dengan sedikit revisi, dengan persentase 76.52%. iv AUSZUG Izati, Nina. 2009. Das Entwickeln der Compact Disc (CD) Interaktiv des Deutschunterrichtmediums für die Hör- und Schreibfertigkeit in der SMAN I Tumpang. Diplomarbeit. Deutschabteilung der Literaturwissenschaftlichen Fakultät der Staatlichen Universität Malang. Beraterin (I) Dra. Sawitri Retnantiti, M.Pd,. Berater (II) Edy Hidayat, S.Pd, M.Hum,. Schlüsselwörte: Entwicklung, CD-Interaktiv, Deutschunterricht. CD-Interaktiv ist eines der Medien im Deutschunterricht, das Texte, Grafik, Bild, Fotos, Audio, und eine Animation einbinden kann. Aufgrund des Interviews mit der Deutschlehrerin an der SMAN I Tumpang und der Umfrage der Bedarfanalyse, kann gewusst werden, dass 1) die Lernsergebnises der Schüler von Klasse XI Sprachabteilung im Deutschunterricht abfallen sind, 2) die Schüler wenige Begeisterung um Deutsch zu lernen haben, 3) die Schüler beim Deutschunterricht Probleme um Grammatik zu lernen haben, 4) die Schüler beim Deutschunterricht Probleme in der Schreibfertigkeit haben und noch nie Hörfertigkeit im Deutschunterricht gelernt haben, und 5) CD-Interaktif noch nie im Deutschunterricht benutzt wird. Dann braucht ein Lehrer ein Lehrmedium, das die Hör- und Schreibfertigkeit kombinieren kann. Aus diesem Grund möchte die Verfasserin eine CD Interaktiv entwickeln, denn es ist nützlich für die Hör- und Schreibfertigkeit. Diese Untersuchung hatte das Ziel, interaktive CD des Deutschunterrichtmediums für Hör- und Schreibfertigkeit zu entwickeln, um den Bedarf der Schule von Lehrmedium zu decken. Um die Frage der Untersuchung zu beantworten, wird der qualitative deskriptive Ansatz gebraucht. Die qualitativen Daten wurden aus dem Interviewsergebnis, der Umfrage, der Observation, und den Noten der Schüler genommen. Vor dem Feldversuch, wurde das Lehrmedium vom Mediumexpert und Materialenexpertin validiert, um die Zweckmäßigkeit des Lehrmediums zu bewerten. Das Feldversuchsubjekt dieser Untersuchung sind 29 SchülerInnen von Klasse XI Sprachabteilung und eine Deutschlehrerin in der SMAN I Tumpang. Die Umfrage der Gültigkeit und Die Umfrage der Mediumsprobe werden in Prozentzahl ausgedruckt. Das Interviewergebnis und die Observationsergebnis werden deskriptiv analysiert. Die Noten der Schüler gilt als Unterstützungsdaten des Umfragesergebnises der Schüler. Aus der Untersuchung ergibt sich, dass dieses Medium benutzt werden kann, unter der Voraussetzung, dass es noch mal redigiert werden muss. Nach der Meinung des Mediumexperten, dieses Medium sehr gut ist, mit dem Gültigkeitsgrad 85%. Die Materialenexpertin meint, dass dieses Medium auch sehr gültig ist, nämlich 85%. Die Deutschlehrerin hat auch gleiche Meinung, nämlich dieses Medium ist sehr gültig mit 84%. Die Schüler haben andere Meinung. Sie meinen, dieses Medium ist noch gültig genug, aber die Gültigkeitsgrad ist nicht so hoch, nämlich 76,52%. Deshalb muss es noch mal redigiert werden.

Penyusunan tata ruang kantor sebagai upaya untuk meningkatkan kinerja karyawan (studi pada Kantor Pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang) / Sulaili

 

ABSTRAK SULAILI. 2009. Penyusunan Tata Ruang Kantor Sebagai Upaya Untuk Meningkatkan Kinerja Karyawan (Studi Pada Kantor Pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang). Skripsi, Jurusan Manajemen Program Studi S-1 Pendidikan Administrasi Perkantoran Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Drs. I Nyoman Saputra, M. Si. (II) Dr. Heny Kusdiyanti, S.Pd. M.M Kata Kunci: Tata Ruang Kantor, Kinerja Karyawan Sumber daya manusia adalah aset yang paling vital yang harus dimiliki oleh sebuah organisasi. Unsur manusia dalam keberadaan suatu organisasi sangatlah penting karena dapat menentukan baik atau buruknya, maju atau mundurnya suatu organisasi, disamping peralatan dan perlengkapan atau aset-aset vital lainnya. Salah satu tempat terciptanya suatu kerja sama dalam suatu organisasi adalah kantor. Dewasa ini, kedudukan dan peranan kantor berkembang dengan pesat dan sangat menentukan keberhasilan suatu organisasi dalam rangka mencapai tujuannya. Kantor adalah tempat dilaksanakannya semua kegiatan tata usaha, di sana terdapat pegawai, perabot kantor, peralatan kantor, mesin-mesin kantor dan lain sebagainya yang dapat membantu proses pekerjaan kantor. Setiap pekerjaan memerlukan kondisi tata ruang kantor yang baik dan memadai. Pengaturan tempat kerja atau ruangan, diperhitungkan dengan suasana kerja pengawasan (Human relations) antar pegawai maupun pengunjung kantor. Pengaturan suasana maupun faktor lain yang berhubungan dengan pekerjaan tata usaha hendaknya memadai. Seperti cahaya, udara, suara, dan warna Bilamana pengaturan tersebut tepat akan menimbulkan ketenangan, kepuasan dan gairah kerja. Kesemuanya ini berpengaruh langsung terhadap produksi kantor, baik secara kualitatif dan kuantitatif. Penelitian yang dilakukan merupakan penelitian penjelasan (a explenatory research). Pengambilan data primer menggunakan instrumen angket dengan skala likert, 5 alternatif jawaban, pernyataan dan pertanyaan dijabarkan dalam angket sebanyak 33 item kemudian disebarkan kepada 95 karyawan kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang. Agar data yang diperoleh dari instrumen penelitian sakhih, maka dilakukan uji validitas dan reliabilitas dengan menggunakan bantuan SPSS 16.00 for windows. Karena penelitian ini menjelaskan pengaruh variabel bebas terhadap variabel terikat, maka termasuk penelitian jenis kuantitatif. Teknik pengumpulan data selain menggunakan angket juga observasi, dokumen dan interview atau wawancara. Penelitian ini merupakan teknik analisis deskriptif dan analisis regresi berganda. Teknik analisis deskriptif digunakan untuk mendeskripsikan variabel tata ruang kantor yang meliputi perencanaan tata ruang kantor, pengaturan ruang kantor serta lingkungan dan kondisi fisik tata ruang kantor dan kinerja karyawan pada kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang. Sedangkan analisis regresi berganda digunakan untuk mengetahui pengaruh variabel bebas terhadap terikat, yaitu tata ruang kantor yang meliputi perencanaan tata ruang kantor, pengaturan ruang kantor serta lingkungan dan kondisi fisik tata ruang kantor terhadap kinerja karyawan pada kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang, baik secara parsial maupun simultan. Hasil penelitian ini adalah sebagai berikut: berdasarkan analisis distribusi frekuensi sebagian besar responden mengatakan bahwa perencanaan tata ruang kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang dalam kondisi baik atau sudah sesuai dengan keinginan karyawannya dengan persentase 55,79%, sedangkan pengaturan ruang kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang dalam kondisi baik atau sudah sesuai dengan keinginan karyawannya dengan persentase 63,16%. Lingkungan dan kondisi fisik tata ruang kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang sudah baik atau sudah sesuai dengan keinginan karyawannya dengan persentase 75,79%. Sedangkan untuk kinerja karyawan kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang adalah baik atau tinggi, dengan persentase sebesar 67,37%. Dari analisis analisis regresi berganda dengan menggunakan taraf kesalahan 5%. Secara parsial dapat diketahui variabel perencanaan tata ruang kantor (X1) mempunyai Sigt 0,000 < 0,05. thitung (3,684) > ttabel (1,986) Nilai β = 0,225 sehingga dapat dikatakan secara parsial perencanaan tata ruang kantor (X1) mempunyai pengaruh yang signifikan terhadap kinerja karyawan (Y). Untuk variabel pengaturan ruang kantor (X2) mempunyai Sigt 0,001 < 0,05. thitung (3,382) > ttabel (1,986). Nilai β = 0,366 sehingga dapat dikatakan secara parsial pengaturan ruang kantor (X2) mempunyai pengaruh yang signifikan terhadap kinerja karyawan (Y). Untuk variabel lingkungan dan kondisi fisik tata ruang kantor (X3) mempunyai Sigt 0,000 < 0,05. thitung (4,160) > ttabel (1,986). Nilai β = 0,295 sehingga dapat dikatakan secara parsial lingkungan dan kondisi fisik tata ruang kantor (X3) mempunyai pengaruh yang signifikan terhadap kinerja karyawan (Y) kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang. Secara simultan variabel tata ruang kantor mempunyai sigF = 0,000 < 0,05. Nilai Fhitung = 33,884 > Ftabel = 2,705 dan β 1= 0,225; β 2= 0,366; β 3=0,295. sehingga dapat dikatakan secara simultan tata ruang kantor (X) mempunyai pengaruh yang signifikan terhadap kinerja karyawan (Y). Nilai Angka Adjusted R square menunjukkan koefisien determinasi sebesar 51,2 % yang berarti perubahan variabel kinerja karyawan (Y) disebabkan oleh perubahan variabel perencanaan tata ruang kantor (X1), pengaturan ruang kantor (X2), serta lingkungan dan kondisi fisik tata ruang kantor (X3), sedangkan sisanya 48,8 % disebabkan oleh faktor di luar variabel yang ada dalam penelitian ini. Kemudian penghitungan Sumbangan Efektif secara simultan adalah 52,8%. Secara parsial variabel perencanaan tata ruang kantor (X1) adalah sebesar 16,8%, Sumbangan Efektif variabel pengaturan ruang kantor (X2) adalah sebesar 15,3%, serta Sumbangan Efektif variabel lingkungan dan kondisi fisik tata ruang kantor (X3) adalah sebesar 20,7%. Dengan demikian dapat disimpulkan bahwa variabel lingkungan dan kondisi fisik tata ruang kantor (X3) lebih dominan berpengaruh terhadap variabel kinerja karyawan (Y) Dari paparan data di atas dapat disimpulkan bahwa variabel tata ruang berpengaruh signifikan terhadap kinerja karyawan kantor pusat PT PG Rajawali I Unit PG Krebet Baru Bululawang Malang. Dari kesimpulan di atas diharapkan di masa akan datang untuk meningkatkan kondisi tata ruang kantor sehingga kinerja karyawan dapat ditingkatkan.

Hubungan antara persepsi terhadap karakteristik pekerjaan dengan stres kerja pada perawat di Rumah Sakit JIwa Sambang Lihum Kalimantan Selatan / Fitriyani

 

ABSTRAK Fitriyani. 2009. Hubungan Antara Persepsi terhadap Karakteristik Pekerjaan dengan Stres Kerja Pada Perawat Di Rumah Sakit Jiwa Sambang Lihum Kalimantan Selatan. Skripsi, Jurusan Bimbingan Konseling dan Psikologi, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Sri Weni Utami, M.Si, (II) Fattah Hidayat, M.Si. Kata Kunci : Persepsi, Karakteristik Pekerjaan, Stres Kerja Dalam menjalankan tugasnya seorang perawat tidak dapat terlepas dari stres, karena masalah stres tidak dapat dilepaskan dari dunia kerja. Dengan semakin bertambahnya tuntutan dalam pekerjaan maka semakin besar kemungkinan seorang perawat mengalami stres kerja, setiap jenis pekerjaan tidak terlepas dari tekanan-tekanan baik dari dalam maupun dari luar yang dapat menimbulkan stres bagi para pekerjanya. Dalam proses bekerja hasil atau akibatnya perawat dapat mengalami stres, yang dapat berkembang menjadikan perawat sakit fisik dan mental, sehingga tidak dapat bekerja secara optimal. Menurut hasil survei dari PPNI tahun 2006, sekitar 50,9 persen perawat yang bekerja di empat provinsi di Indonesia mengalami stres kerja, sering pusing, lelah, tidak bisa beristirahat karena beban kerja terlalu tinggi dan menyita waktu. Tujuan utama penelitian ini adalah untuk mengetahui: (1) persepsi terhadap karakteristik pekerjaan perawat di RSJ Sambang Lihum, (2) stres kerja perawat di RSJ Sambang Lihum, dan (3) hubungan antara persepsi terhadap karakteristik pekerjaan dengan stres kerja perawat di RSJ Sambang Lihum. Desain yang digunakan adalah deskriptif dan korelasional dengan teknik pengambilan sampel purposive sample. Persepsi terhadap karakteristik pekerjaan diukur dengan skala persepsi terhadap karakteristik pekerjaan sebanyak 40 item dengan validitas item antara 0,314-0,695 dan reliabilitas 0,919. Stres kerja diukur dengan skala stres kerja sebanyak 41 item dengan validitas item antara 0,321- 0,705 dan reliabilitas 0,928. Subyek penelitian adalah 60 orang perawat di RSJ Sambang Lihum. Data yang terkumpul dianalisa dengan teknik korelasi Pearson. Hasil penelitian menunjukkan bahwa: (1) persepsi terhadap karakteristik pekerjaan perawat di RSJ Sambang Lihum berada pada tingkat netral, (2) stres kerja perawat di RSJ Sambang Lihum berada pada tingkat sedang, dan (3) terdapat korelasi negatif antara persepsi terhadap karakteristik pekerjaan dengan stres kerja perawat di RSJ Sambang Lihum. Berdasarkan hasil penelitian ini dapat disarankan: 1) Perawat hendaknya lebih mengembangkan persepsi yang positif terhadap karakteristik pekerjaannya sehingga dapat mengurangi kemungkinan untuk terjadinya stres kerja, 2) Pihak RSJ dapat mengendalikan kemungkinan terjadinya stres kerja dengan mengetahui faktor-faktor penyebab agar dapat meminimalisir dampak negatif dan dapat mengambil tindakan pencegahan sehingga dapat mengurangi dan menekan faktor- faktor penyebab terjadinya stres kerja pada perawat, 3) Bagi peneliti berikutnya sebaiknya melakukan penelitian secara berkesinambungan tentang berbagai aspek yang berkaitan dengan persepsi terhadap karakteristik pekerjaan dengan stres kerja perawat di RSJ, menambahkan penggunaan observasi dan wawancara serta menambah populasi dan mengembangkan wilayah penelitian.

Penerapan pembelajaran berbasis masalah (PBM) untuk meningkatkan kemampuan berpikir kritis dan hasil belajar biologi siswa kelas X SMA Negeri 5 Malang / Mariya Ulfah

 

ABSTRAK Ulfah, Mariya. 2009. Penerapan Pembelajaran Berbasis Masalah (PBM) Untuk Meningkatkan Kemampuan Berpikir Kritis dan Hasil Belajar siswa Kelas X SMA Negeri Malang. Skripsi, Jurusan Biologi, Program Studi Pendidikan Biologi, FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Hadi Suwono, M.Si (II) Dr. Fatchur Rohman, M.Si. Kata kunci: pembelajaran berbasis masalah (PBM), berpikir kritis, hasil belajar. Penelitian ini bertolak dari hasil observasi dan wawancara yang telah dilakukan peneliti sehingga ditemukan adanya permasalahan mengenai rendahnya kemampuan berpikir kritis dan hasil belajar dalam mata pelajaran biologi di SMA Negeri 5 Malang khususnya Kelas X-3. Salah satun permasalahan tersebut dapat dilihat dari LKS (Lembar Kerja Siswa) yang biasa digunakan siswa sebagai penuntun kegiatan untuk menguji konsep dalam buku atau informasi yang disampaikan oleh guru. Penelitian ini bertujuan untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas X-3 dengan menerapkan Pembelajaran Berbasis Masalah (PBM) dalam mata pelajaran biologi di SMA Negeri 5 Malang. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang dilaksanakan dengan 2 siklus. Subjek penelitian ini adalah kelas X-3 di SMAN 5 Malang dengan jumlah 32 siswa. Setiap siklus PTK terdiri atas perencanaan tindakan, pelaksanaan, observasi, dan refleksi. Instrumen penelitian yang digunakan adalah lembar wawancara, lembar laporan, catatan lapangan, soal tes, angket dan dokumentasi. Teknik analisis data yang digunakan adalah persentase ketercapaian PBM dan kemampuan berpikir kritis serta hasil belajar siswa (ranah kognitif). Hasil penelitian menunjukkan adanya peningkatan persentase pada kemampuan berpikir kritis setelah tindakan PBM dilakukan dari siklus I sampai siklus II. Persentase kemampuan berpikir kritis pada hasil karya siswa (laporan) mengalami peningkatan sebesar 15% dari siklus I sebesar 49% ke siklus II sebesar 64%. Hasil belajar siswa untuk ranah kognitif juga mengalami peningkatan sebesar 13%. Persentase hasil belajar pada siklus I sebesar 70% dan pada siklus II sebesar 83%. Daya serap klasikal siswa juga mengalami peningkatan sebesar 25%. Pada siklus I daya serap klasikal sebesar 63% dan siklus II sebesar 88%. Berdasarkan hasil penelitian maka dapat dikatakan bahwa Penerapan Pembelajaran Berbasis Masalah (PBM) dapat meningkatkan kemampuan berpikir kritis dan hasil belajar biologi siswa Kelas X SMA Negeri 5 Malang.

Evaluasi kompetensi pedagogik dan profesional guru ekonomi SMA yang telah lulus program sertifikasi di Kabupaten Sumenep / Dewi Sofiatika

 

ABSTRAK Sofiatika, Dewi. 2009. Evaluasi Kompetensi Pedagogik Dan Profesional Guru Ekonomi Sekolah Menengah Atas Yang Telah Lulus Program Sertifikasi Di Kabupaten Sumenep, Skripsi. Program Studi Pendidikan Ekonomi Pembangunan, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Hari Wahyono, M.Pd Pembimbing (II) Imam Mukhlis, SE, MSi Kata kunci: Evaluasi Pembelajaran, Sertifikasi Upaya untuk memperbaiki kualitas pendidikan di Indonesia sangat ditentukan oleh faktor pendidikan. Dimana dalam dunia pendidikan banyak faktor yang mempengaruhinya, tetapi yang paling besar mempengaruhinya adalah keberadaan peran dan fungsi guru. Guru memiliki peran yang penting dalam dunia pendidikan. Untuk meningkatkan mutu pendidikan sangat membutuhkan guru yang berkompetensi dalam bidangnya. Misi pendidikan akan berhasil apabila dilaksanakan oleh guru yang baik atau berprofesional. Tujuan penelitian ini adalah untuk mengetahui kualitas guru mata pelajaran ekonomi SMA yang telah lulus sertifikasi se-Kabupaten Sumenep dalam: (1) penyusunan RPP, (2) pelaksanaan pembelajaran di kelas, dan (3) evaluasi hasil pembelajaran Penelitian ini merupakan penelitian deskriptif kuantitatif. Subjek penelitian dalam penelitian ini adalah guru mata pelajaran ekonomi SMA yang telah lulus program sertifikasi se-Kabupaten Sumenep , yang meliputi enam guru mata pelajaran ekonomi dari Sekolah Menengah Atas Negeri yang meliputi empat sekolah yang ada di Kabupaten Sumenep. Penelitian ini menggunakan instrumen pedoman observasi, wawancara, dan dokumentasi. Data penelitian dianalisis secara deskriptif dengan tabel persentase. Hasil penelitian menunjukkan bahwa (1) kualitas guru mata pelajaran ekonomi SMAyang telah lulus program sertifikasi dalam penyusunan RPP yaitu dari 6 orang guru yaitu 2 orang atau 33,3 persen memiliki tingkat kualitas sangat tinggiatau sangat profesional, dan 4 orang atau 66,7 persen memiliki tingkat kualitas tinggi atau profesional. Maka kualitas guru ekonomi yang telah lulus sertifikasi dalam penyusunan RPP mempunyai kualitas yang tinggi dan merupakan guru yang profesional, (2) kualitas guru mata pelajaran ekonomi SMAyang telah lulus sertifikasi dalam pelaksanaan pembelajaran yaitu dari 6 orang guru yaitu 1 orang atau 16.7 persen memiliki tingkat kualitas sangat tinggi atau sangat profesional, 4 orang atau 66,7 persen memiliki tingkat kualitas tinggi atau profesional, dan 1 orang atau 16,7 memilii tingkat kualitas yang cukup tinggi atau cukup profesional. Maka guru ekonomi SMA yang telah lulus program sertifikasi se-Kabupaten Sumenep merupakan guru yang berkualitas atau profesional dalam melaksanakan pembelajaran dikelas dan (3) kualitas guru mata pelajaran ekonomi SMA yang telah lulus sertifikasi dalam evaluasi hasil belajar yaitu Sth mendapat Skor 35, Bdn mendapat skor 25, Btn mendapat skor 34, Frd mendapat skor 27, Msk mendapat skor 25, dan Amb mendapat skor 32.

Analisis kesalahan dan perbaikan konsep pada buku teks matematika SMA kelas X / Hani' Maria

 

ABSTRAK Maria, Hani’. 2009. Analisis Kesalahan dan Perbaikan Konsep pada Buku Teks Matematika SMA Kelas X. Skripsi, Jurusan Matematika Fakultas matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing: (I) Drs. H. Muchtar Abdul Karim, M. A., (II) Dr. Subanji, S. Pd, M. Si. Kata kunci: kesalahan konsep, buku teks. Matematika memiliki objek kajian yang bersifat abstrak, maka buku teks memiliki peran penting dalam pembelajaran matematika di sekolah. Kualitas buku teks matematika akan mempengaruhi keberhasilan pembelajaran. Adanya kesalahan konsep dalam buku teks mengakibatkan siswa mempunyai pemahaman konsep yang salah dan akan mengalami kesulitan dalam mengembangkan maupun memahami konsep yang lebih luas. Kegiatan utama penelitian ini adalah menganalisis isi buku teks matematika SMA kelas X yaitu dalam hal kesalahan dan perbaikan konsep. Analisis yang dilakukan bertujuan untuk mendeskripsikan dan memperbaiki kesalahan konsep. Buku teks yang digunakan sebagai bahan analisis adalah ERW, ERN, ERS1, ERS2, dan ERT. Kesalahan pengungkapan konsep matematika dalam hal ini adalah ketidaktepatan konsep pada buku teks dengan konsep yang sebenarnya. Hasil analisis ditemukan kesalahan konsep pada masing-masing buku teks, yaitu: ERW sebanyak 10 kesalahan, ERN sebanyak 10 kesalahan, ERS1 sebanyak 3 kesalahan, ERS2 sebanyak 2 kesalahan, dan ERT sebanyak 5 kesalahan. Berdasarkan hasil analisis, ditemukan kesalahan konsep pada buku teks matematika SMA kelas X. Saran-saran yang dapat diberikan sebagai berikut. (1) Guru hendaknya tidak mengikuti sepenuhnya konsep yang disajikan dalam buku teks dan tidak hanya menggunakan satu buku sebagai bahan rujukan dalam membimbing siswa. (2) Siswa hendaknya tidak menggunakan satu buku sebagai acuan dalam belajar dan memilih buku yang berkualitas agar memperoleh konsep materi yang benar. (3) Sekolah hendaknya lebih teliti dalam memilih buku teks matematika yang akan digunakan. (4) Penulis buku teks hendaknya meneliti kembali konsep-konsep yang disajikan pada buku teks dan memperbaiki kesalahan konsep yang ada agar pembaca lebih memahami apa yang mereka pelajari. (5) Penerbit hendaknya merevisi kesalahan konsep yang ada pada buku teks dan agar lebih teliti sebelum menerbitkan buku. (6) Penelitian hendaknya ditingkatkan pada ruang lingkup yang lebih luas. Analisis tidak hanya ditinjau dari aspek konsep materi tetapi diharapkan analisis dikembangkan pada aspek yang lain. ABSTRACT Maria, Hani'. 2009. Analysis Errors in Concept and Correction in Mathematics Text Books for Ten Grade Senior High School. Thesis, Mathematics Department, Faculty of Mathematics and Natural Science. Advisor: (I) Drs. H. Muchtar Abdul Karim, M. A., (II) Dr. Subanji, S. Pd, M. Si. Key Words: errors in concept, textbooks. Mathematics has abstract object of study, and thus textbooks bring an important role in mathematics pedagogical process at school. Quality of mathematics textbooks will certainly influence the success of the learning process. Where there is errors in concept within textbooks, students will obtain misconcepts and eventually experience difficulties in understanding or even applying to broader concepts. This study analyzes the contents of mathematics textbooks for tenth grader in terms of errors in concept and correction. The aims of this analysis are describing and correcting the errors. Textbooks used as the material are ERW, ERN, ERS1, ERS2, and ERT. Errors in mathematics concept explanation analyzed in the current study is misconcepts in the textbooks which are different from the real concepts. The analysis finds errors in each of the textbooks in this following amounts: ERW has 10 mistakes, ERN has 10 mistakes, ERS1 has 3 mistakes, ERS2 has 2 mistakes, and ERT has 5 mistakes. Based on the analysis, mathematics textbooks for ten grade of senior high school contains some mistakes. To cope with that, these following suggestions can be considered. (1) Teachers should not thoroughly follow the concepts available in textbooks and should use more than one textbooks as reference in teaching students. (2) Students should use more than one different textbooks and choose textbooks whose quality is good in order to obtain correct concepts. (3) Schools should be critical in choosing mathematics textbooks used. (4) Textbook writers should re-examine the concepts given in textbooks and correct the mistakes so that readers understand the concepts deeper. (5) Publishers should revise misconcepts in textbooks and to be more accurate before publishing the books. (6) Future researchers should be improved and applied in a broader scope. Not only does analysis observe material concept, it may also observe other aspects of textbooks.

Perancangan bahan ajar CAD 2 dimensi pada mata kuliah CAD/CAM berbasis multimedia di Jurusan Teknik Mesin Universitas Negeri Malang / Anang Wicaksono

 

Abstrak ABSTRAK Wicaksono, Anang. 2008. Perancangan Bahan Ajar Cad 2 Dimensi Pada Mata Kuliah CAD/CAM Berbasis Multimedia di Jurusan Teknik Mesin Universitas Negeri Malang. Pembimbing (1) Dra. Widiyanti, M.Pd., (2) Suprayitno, S.T., M.T Kata kunci: media pembelajaran, multimedia interaktif, cad 2 dimensi. Universitas Negeri Malang adalah sebuah lembaga pendidikan yang bertujuan mencetak tenaga pendidik yang kompeten. Fakultas Teknik UM adalah salah satu fakultas yang ada di Universitas Negeri Malang, memiliki program studi keguruan bertujuan untuk mencetak tenaga pengajar dibidang teknik. Terdapat beberapa jurusan yang dikembangkan yaitu; Teknik Mesin, Teknik Elektro, Teknik Sipil, dan Teknologi Industri. Mata kuliah CAD/CAM merupakan salah satu mata kuliah yang wajib dikuasai dan ditempuh oleh mahasiswa teknik, terutama mahasiswa teknik mesin, baik itu mahasiswa Program Studi Pendidikan Teknik Mesin maupun Diploma 3 Teknik Mesin. Dalam praktikum matakuliah CAD/CAM, peserta didik pada Jurusan Teknik Mesin Fakultas Teknik Universitas Negeri Malang hanya mempunyai waktu yang singkat yaitu 2 minggu untuk menempuh matakuliah CAD/CAM ini, itupun dilakukan dengan sistim blok, jadi setiap hari mereka selalu mendapatkan materi baru untuk mengejar penyampaian materi sampai memenuhi kompetensi. Padahal penguasaan dan pemahanman materi tidak cukup dengan waktu 2 minggu. Jadi waktu mereka untuk benar-benar menguasai materi-materi CAD sangat kurang, akibatnya pada pertemuan selanjutnya masih banyak yang bertanya pada pembimbing tentang materi yang sebelumnya, akhirnya pembimbing mengulang kembali materinya, hal inilah yang menghambat penyampaian materi pada matakuliah CAD/CAM dan akhirnya banyak materi yang dipersingkat supaya memenuhi kompetensi yang menyebabkan peserta didik tidak dapat benar-benar menguasai matakuliah ini dan mendapatkan nilai rata-rata, sehingga diharapkan hasil software ini dapat dipelajari sendiri tanpa memerlukan bantuan orang lain di luar perkuliahan, maka mahasiswa berpeluang besar untuk meningkatkan kemampuan yang berindikasi pada ketrampilan dalam CAD/CAM yang imbasnya pada nilai Model pengembangan yang digunakan dalam proyek ini mengacu pada sistematika metode pengajaran CAD/CAM secara umum dan dipadukan dengan sistematika pengembangan produk multimedia, selain itu perancang produk multimedia interaktif ini menggunakan model pengembangan Dick & Carey yang menggariskan langkah-langkah pengembangan produk secara sistematik. Produk multimedia interaktif ini perlu diuji coba kelayakannya sebagai salah satu bahan ajar yang sesuai dengan kebutuhan Teknik Mesin dalam proses pengajaran matakuliah menggambar komputer. Uji coba dilakukan dengan meminta masukan dari (1) ahli materi, (2) ahli media pembelajaran, (3) dan uji coba kelompok kecil. Kegiatan uji coba telah mendapatkan hasil yang menunjukkan bahwa secara umum produk dapat dikatakan sudah memenuhi kebutuhan pengguna. Pada uji isi materi didapat nilai kelayakan produk BAIK, untuk uji tampilan multimedia dan desain pembelajaran oleh ahli media pembelajaran nilai kelayakan CUKUP BAIK, sedangkan untuk uji coba media pada kelompok kecil mendapatkan nilai kelayakan BAIK. Produk multimedia pembelajaran yang dihasilkan dibuat untuk kebutuhan pengguna saat ini, dalam pemanfaatannya lebih lanjut perlu diadakan revisi berupa penyesuaian kebutuhan pengguna dimasa yang akan datang. Saran dalam pengembangan produk lebih lanjut dapat dilengkapi dengan bahan-bahan yang dianggap dapat memberikan wawasan lebih kepada pengguna dan lebih mengaktifkan peran pebelajar (mahasiswa).

Perbedaan kecerdasan emosional antara mahasiswa bekerja dan tidak bekerja di Fakultas Bahasa Inggris STKIP PGRI Pasuruan / Ayu Dian Pratiwi

 

Mahasiswa sebagai remaja akhir berada dalam satu masa transisi dimana semakin tampak sifat orang dewasa yang diperlihatkan pada keputusan untuk bekerja sambil kuliah. Mahasiswa yang bekerja tentunya berbeda dengan mahasiswa yang rutinitasnya kuliah. Rutinitas sebagai mahasiswa membutuhkan kecerdasan baik intelektual maupun emosi. Alangkah baiknya apabila mahasiswa yang kuliah sambil bekerja ini juga memiliki kecerdasan emosi yang lebih tinggi untuk menyokong prestasi mahasiswa tersebut dalam dunia pendidikan maupun kerja. Kecerdasan emosi itu dapat dilihat dalam kemampuan mengenali emosi diri, mengelola emosi diri, memotivasi diri sendiri, empati, serta kemampuan dalam menjalin suatu hubungan dengan orang lain. Kecerdasan emosi dipengaruhi oleh faktor internal dan eksternal. Penelitian dilaksanakan dengan rancangan deskriptif komparatif pada 68 responden (34 mahasiswa bekerja dan 34 mahasiswa tidak bekerja) yang diambil dengan teknik Purposive Sampling di STKIP PGRI Pasuruan. Data dikumpulkan dengan menggunakan skala kecerdasan emosional dengan validitas ≥ 30 dan α 0,914; kemudian dianalisis dengan teknik analisis deskriptif dan analisis uji Chi Square. Hasil penelitian menunjukkan bahwa dari 34 mahasiswa bekerja rata-rata memiliki kecerdasan emosi yang tinggi yaitu sebanyak 15 orang (44,12%) sedangkan dari 34 mahasiswa tidak bekerja rata-rata memiliki kecerdasan emosi yang sedang yaitu sebanyak 16 orang (47,06%), Ada perbedaan kecerdasan emosional mahasiswa bekerja dan tidak bekerja (chi square = 47,000, sig = 0,042 p < 0,05). Berdasar hasil penelitian disarankan (1) mahasiswa dapat menambah aktivitasnya ketika berada di kampus, seperti mengikuti kegiatan-kegiatan ekstrakurikuler yang telah disediakan oleh pihak perguruan tinggi. Mengikuti kegiatan organisasi dapat membantu mahasiswa untuk mempelajari dinamika kelompok, berkomunikasi dengan baik, dan bertanggung jawab (2) Pihak kemahasiswaan seperti layanan konseling pendidikan pada mahasiswa mampu memberikan materi tentang meningkatkan kecerdasan emosi pada mahasiswa. Selain itu, pihak perguruan tinggi dapat memberikan seminar-seminar khususnya tentang kecerdasan emosi guna membantu menumbuhkembangkan kecerdasan emosi yang dimiliki oleh mahasiswa. (3) Hendaknya peneliti selanjutnya juga mengkaji lebih dalam perbedaan tersebut dengan melihat faktor-faktor yang melatarbelakanginya, mampu menjabarkan perbedaan tersebut, dan hendaknya memasukkan variabel lain seperti problem solving, mengatasi stress, dan lain-lain sehingga hasil penelitian yang diperoleh menjadi semakin detail dan akurat.

Pengaruh pemberian reward dan punishment untuk mengurangi perilaku attenrion deficit hyperactivity disorder / Siti Hartinah

 

ABSTRAK Hartinah, Siti. 2009. Pengaruh Pemberian Reward Dan Punishment Untuk Mengurangi Perilaku Attention Deficit Hyperactivity Disorder (ADHD). Skripsi, Jurusan Bimbingan Konseling dan Psikologi Program Studi Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dra. Endang Prastuti, M.Si., (II) Anies Syafitri, S.Psi, M.Psi, Psikolog. Kata kunci: modifikasi perilaku, ADHD Anak yang memiliki keadaan khusus sehingga membutuhkan penanganan yang khusus pula disebut Anak Berkebutuhan Khusus (ABK). Salah satu jenis anak berkebutuhan khusus (ABK) adalah anak dengan Attention Deficit Hyperactivity Disorder (ADHD). Attention Deficit Hyperactivity Disorder merupakan suatu gangguan yang terdapat pada anak-anak dimana anak memperlihatkan impulsivitas, tidak adanya perhatian dan hiperaktivitas (hyperactivity) yang dianggap tidak sesuai dengan tingkat perkembangan mereka. Anak-anak yang menderita ADHD sering kali menunjukkan gejala tidak adanya konsentrasi, hiperaktif, dan impulsif. ADHD adalah gangguan perkembangan yang mempunyai onset gejala sebelum usia 7 tahun. Reward merupakan hadiah yang diberikan kepada anak ADHD apabila anak tersebut telah melakukan perilaku yang diharapkan dan dapat berupa konsekuensi yang menyenangkan. Sedangkan punishment adalah hukuman yang diberikan ketika anak tidak memunculkan perilaku yang diharapkan. Penelitian ini menggunakan rancangan penelitian eksperimental. Desain penelitian yang digunakan adalah ekaperimental Single-Subject Design atau bisa juga disebut Single Case Experimental Design. Sampel yang digunakan sejumlah dua orang (N=2). Analisis yang digunakan dalam penelitian ini adalah dengan uji t. Uji t memperlihatkan bahwa ada perbedaan frekuensi pada tahap Baseline I (A1) dan Baseline II (A2) maupun pada tahap Baseline II (A2) dan treatment II (B2) pada tingkat signifikansi 0.05 pada masing-masing subyek. Pada subyek 1, perbandingan Baseline I (A1) dan Baseline II (A2) menggunakan uji t sebesar 5,835 dan hasil perbandingan Baseline II (A2) dan treatment II (B2) sebesar 4,754. Pada subyek 2, perbandingan Baseline I (A1) dan Baseline II (A2) sebesar 6,013 dan hasil perbandingan Baseline II (A2) dan treatment II (B2) sebesar 7,425. Hasil perhitungan mean (rata-rata) memperlihatkan bahwa semua subyek mengalami penurunan pemunculan target perilaku pada masing-masing tahap. Berdasarkan perhitungan Mean, subyek 1 rata-rata kemunculan perilaku tahap Baseline I sebesar 8,208, tahap Treatment I sebesar 7,521. Tahap selanjutnya yaitu tahap Baseline II, sebesar 6,830. Tahap Treatment II, sebesar 6,250. Hal serupa juga terjadi kepada Subyek 2 yang mengalami penurunan kemunculan perilaku pada setiap tahap penelitiannya. Tahap Baseline I, rata-rata kemunculan target perilaku sebesar 9,542, tahap Treatment I sebesar 9,291. Tahap Baseline II, sebesar 9,00. Tahap Treatment II, sebesar 8,092. Berdasarkan hasil penelitian, maka dapat diberikan saran kepada beberapa pihak diantaranya: (1) para peneliti selanjutnya, diharapkan penelitian yang akan dilakukan selanjutnya lebih dipersiapkan baik dalam jumlah sampel, program modifikasi perilaku, maupun kontrol lingkungan serta memiliki kepekaan yang tinggi terhadap fenomena yang terjadi di masyarakat. (2) orang tua ABK, diharapkan dapat menerapkan metode modifikasi perilaku dalam pola pengasuhan di rumah. Serta, (3) lembaga terapi, diharapkan dengan pemberian reward dan punishment sebagai salah satu sarana terapi bagi anak ADHD.

Pengaruh identitas visual (Aspek seni arsitektural, kemahasiswaan, dan logo) terhadap reputasi yang terbentuk di kalangan mahasiswa Universitas Negeri Malang (Studi pada Mahasiswa Fakultas ekonomi jurusan Manajemen Angkatan 2006 reguler) / Santi

 

Identitas visual adalah identitas yang berkaitan dengan citra atau image yang dipertahankan oleh organisasi sebagai jembatan untuk menyatukan berbagai konteks, audience, dan bagi organisasi ini. Reputasi Universitas adalah representasi kolektif yang dipegang teguh oleh berbagai stake holder (pemangku kepentingan) universitas tersebut (termasuk media) dari waktu ke waktu. Penelitian ini ditujukan untukmenganalisis : (1) pengaruh signifikan secara simultan antara Aspek Seni Arsitektural, Aspek Kemahasiswaan, Aspek Logo terhadap reputasi, (2) pengaruhsignifikan antara Aspek Seni Arsitektural terhadap reputasi, (3) pengaruh signifikan antara Aspek Kemahasiswaan terhadap reputasi, (4) pengaruh signifikan antara Aspek logo terhadap reputasi yang terbangun di kalangan mahasiswa Fakultas Ekonomi Universitas Negeri Malang. Penelitian dirancang sebagai penelitian deskriptif dengan menggunakananalisis regresi yang dilakukan terhadap 57 mahasiswa Jurusan ManajemenUniversitas Negeri Malang. Instrumen yang digunakan adalah kuesioner denganskala likert untuk mengukur variabel identitas visual terbagi dalam aspek seni arsitektural (X1), aspek kemahasiswaan (X2), aspek logo (X3), dan variabel reputasi (Y). Masing-masing skala variabel identitas visual (aspek seni dan bangunan, aspekkemahasiswaan, serta aspek logo) diwakili dengan 9 foto, sementara variabel reputasi diwakili 12 item pernyataan. Berdasarkan uji validitas dan reliabilitas instrumen, aspek seni dan arsitektural dinyatakan valid dengan koefisien reliabilitas sebesar 0,7173, aspek kemahasiswaan dinyatakan valid dengan koefisien reliabilitas sebesar 0,7368, aspek logo dinyatakan valid dengan koefisien reliabilitas sebesar 0,6195, dan variabel reputasi dinyatakan valid dengan koefisien reliabilitas sebesar 0,7313. Hasil analisis regresi menunjukkan adanya pengaruh searah yang signifikan dari aspek seni arsitektural (b1 = 0, 809; t hit > t tab pada <0,05), aspekkemahasiswaan (b2 = 0, 968; t hit > t tab pada <0,05), dan aspek logo (b3 = 0, 633; t hit > t tab pada <0,05) terhadap reputasi Universitas Negeri Malang. Sedangkansecara simultan aspek seni arsitektural, kemahasiswaan, dan logo berpengaruh searahterhadap reputasi yang terbentuk di kalangan mahasiswa (F hit > F tab pada <0,05) Berdasarkan hasil penelitian hingga tahap penyimpulan, saran yang dapat penulis ajukan adalah sebagai berikut (1) Bagi Universitas Negeri Malang,dibutuhkan strategi komunikasi pemasaran yang terintegrasi (2) Bagi peneliti selanjutnya, penelitian ini menjadi dasar untuk dikembangkan dengan melibatkanberbagai khalayak internal maupun eksternal (3) Bagi mahasiswa, diharapkan turut ambil bagian dalam strategi komunikasi pemasaran yang dilaksakan Universitas Negeri Malang.

Komparasi minat rekreatif dan minat belajar antara siswa laki-laki dan prempuan di SMA Negeri 2 Malang / Riska Febriyanti

 

ABSTRAK Febriyanti, Riska. 2009. Komparasi Minat Rekreatif dan Minat Belajar Antara Siswa Laki-laki dan Perempuan di SMA Negeri 2 Malang. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Drs. H. Widada, M. Si, (2) Dr. Andi Mappiare A.T, M. Pd. Kata kunci: Minat rekreatif, minat belajar, laki-laki, perempuan. Adanya perbedaan tingkah laku antara laki-laki dan perempuan bukanlah semata-mata karena perbedaan jenis kelamin. Mungkin yang dapat membedakan antara laki-laki dan perempuan adalah dalam hal peranan dan perhatiannya terhadap sesuatu pekerjaan, hal ini merupakan akibat pengaruh kultural. Adanya konsep tentang gender yang kadang disamakan dengan konsep jenis kelamin seringkali menimbulkan dampak tertentu bagi kedua jenis kelamin tersebut yang pada akhirnya juga dapat mempengaruhi adanya perbedaan minat antara laki-laki dan perempuan. Tujuan penelitian adalah untuk: (1) memperoleh gambaran mengenai sebaran minat rekreatif siswa laki-laki dan perempuan di SMA Negeri 2 Malang, (2) memperoleh gambaran mengenai sebaran minat belajar siswa laki-laki dan perempuan di SMA Negeri 2 Malang, (3) memperoleh gambaran mengenai perbedaan minat rekreatif antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang dan (4) memperoleh gambaran mengenai perbedaan minat belajar antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang. Rancangan penelitian yang digunakan adalah deskriptif komparatif. Populasi penelitian adalah siswa SMA Negeri 2 Malang kelas X dan XI. Teknik pengambilan sampel menggunakan sampling nonprobabilitas, yaitu sampling kebetulan atau sampling seadanya. Pengumpulan data menggunakan alat ukur angket tertutup dengan klasifikasi untuk angket minat rekreatif berupa option a, b, c, dan d, sedangkan untuk minat belajar dengan klasifikasi selalu, sering, kadang, dan tidak pernah. Teknik analisis data yang digunakan adalah analisis persentase dan Uji-t. Dari hasil penelitian di SMA Negeri 2 Malang menunjukkan bahwa (1) siswa laki-laki memiliki minat rekreatif relatif lebih tinggi dibandingkan dengan siswa perempuan, (2) untuk minat belajar, siswa laki-laki dan perempuan relatif memiliki minat belajar yang hampir sama, (3) hasil analisis Uji-t untuk minat rekreatif diperoleh nilai t-hitung sebesar 3, 184 dengan koefisien probabilitas error (p) 0,000. Dengan nilai p < 0,05 maka Ho ditolak dan H1 diterima yang dapat disimpulkan bahwa ada perbedaan minat rekreatif antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang, dan (4) untuk minat belajar diperoleh nilai t 1,936 dengan koefisien probabilitas error (p) 0,056. Dengan nilai p > 0,05 maka dalam hal ini Ho diterima dan H1 ditolak, yang berarti tidak ada perbedaan minat belajar antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang. Sehubungan dengan hasil penelitian yang telah dilakukan, maka saran yang ingin penulis sampaikan, kepada 1) Konselor, sebagai bahan informasi bagi siswa baik dalam bidang pribadi, sosial, belajar, dan karir, dapat memberikan pengetahuannya dalam hal peningkatan minat belajar sehingga siswa yang memiliki minat belajar rendah dapat termotivasi untuk meningkatkan minat belajarnya, karena pada dasarnya baik siswa laki-laki maupun perempuan memiliki minat belajar yang sama. Selain itu konselor juga dapat memberikan informasi mengenai penyaluran yang tepat sehubungan dengan minat rekreatif yang dimiliki siswa, 2) Guru, selain berusaha untuk menciptakan suasana yang mendukung minat belajar siswa juga perlu memperhatikan minat rekreatif yang mungkin juga dimiliki oleh siswanya sehingga dapat mengerti keadaan siswa dan dapat memberikan pengarahan yang tepat serta metode pembelajaran yang efektif, 3) Siswa, dengan minat rekreatif yang dimilikinya agar berusaha menyalurkannya dengan baik sehingga tidak mengganggu kegiatan belajarnya. Selain itu siswa juga perlu untuk selalu meningkatkan dan mempertahankan minat belajarnya sehingga mampu bersaing untuk memperoleh prestasi yang terbaik, 4) Peneliti lain, yang tertarik untuk melakukan penelitian lanjutan hendaknya memperluas ruang lingkup penelitian yang memiliki latar belakang sekolah yang berbeda seperti SMA, MAN atau SMK.

Pemanfaatan sumber belajar oleh guru dalam hubungannya dengan keefektifan proses belajar-mengajar di Sekolah Dasar Negeri se-Kecamatan Nganjuk Kabupaten Nganjuk / Riza Fauzi Tri Rahayu

 

ABSTRACT Rahayu, Riza Fauzi Tri. 2009. Pemanfaatan Sumber Belajar oleh Guru dalam Hubungannya dengan Keefektifan Proses Belajar-Mengajar di Sekolah Dasar Negeri se-Kecamatan Nganjuk Kabupaten Nganjuk. Thesis, Majors of Education Administration, Faculty of Education,State University of Malang. Tutor: (1) Dra. Mustiningsih, M.Pd, (2) Dr. H. Ali Imron, M.Pd, M.Si. Keyword: exploiting of source learn, effectiveness of teaching and learning process In general, every instructor teacher requiring source learn as supporter process teaching and learning in school. Process teaching and learning in this case representing a process which contains with refer to deed of student and teacher of interrelationship that goes on in educative situation. Problem of which studied in this research is: (1) how exploiting of source learn by teacher in the state elementary school of Nganjuk District in Nganjuk Regency?, (2) how effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency?, (3) there any relation between exploiting of source learn by teacher with effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency?. This research purpose to know: (1) exploiting of source learn by teacher in the state elementary school of Nganjuk District in Nganjuk Regency, (2) effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency, (3) relation between exploiting of source learn by teacher with effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency. This research use descriptive correlational plan. The population is teachers in the state elementary school of Nganjuk District in Nganjuk Regency amounting to 293 teachers from 37 state elementary schools, while sampel the taken is 165 teachers. Intake of sampel in this research use random sampling technique. Gathering instrument the used is enquette. Gathered to be data to be analysed with descriptive technique and product moment correlation. The result of this research indicate that: (1) exploiting of source learn by teacher is included in good category, (2) effectiveness of teaching and learning process is included in very good category, (3) have relation which is significant between exploiting of source learn with effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency. Pursuant to result of this research, writer raise suggestion: shall in course of teaching and learning use source learn by teacher exist in around and according to given Iesson. This matter is done to effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency. If have been executed better, headmaster shall can urge instructor teacher to be maintaining it so that reached the target of national education.

Hubungan antara self esteem dengan perilaku asertif siswa kelas X di SMAN 3 Malang / Faolia Arina Hidayati

 

Self esteem merupakan penilaian seorang individu terhadap dirinya sendiri. Penilaian ini meliputi penilaian positif atau negatif. Individu yang memiliki penilaian yang positif terhadap dirinya atau memiliki tingkat self esteem yang tinggi akan mampu memilih dan memilah perilaku mana yang pantas dan perilaku mana yang tidak pantas dilakukan. Mereka lebih percaya diri dalam menentukan sikap apa yang harus dilakukan. Mereka tidak akan mudah terpengaruh oleh lingkungan yang buruk, karena mereka dapat bersikap tegas dan tidak takut mengungkapkan pendapatnya. Dengan bersikap tegas atau asertif seseorang dapat mengekspresikan pikiran, perasaan, dan hak-hak pribadinya tanpa melanggar hak atau merugikan orang lain. Penelitian ini bertujuan untuk: (1) mengetahui tingkat self esteem siswa, (2) mengetahui tingkat perilaku asertif siswa, dan (3) mengetahui hubungan antara self esteem dengan perilaku asertif siswa. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Populasi dalam penelitian ini adalah siswa kelas X SMAN 3 Malang tahun ajaran 2008-2009 yang terdiri dari 8 kelas. Pengambilan sampel dalam penelitian ini dengan menggunakan teknik random sampling. Sampel yang diambil dalam penelitian ini adalah 2 kelas. Penelitian ini menggunakan dua instrumen, yaitu inventori self esteem yang dikembangkan dari teori Coopersmith yang telah diadaptasi oleh Hunty Ilmawati (2008) dan inventori perilaku asertif yang telah dikembangkan oleh Lailina Atiqoh (2008). Analisis data dalam penelitian ini dengan menggunakan teknik persentase dan teknik korelasi product moment. Hasil penelitian menunjukkan bahwa siswa yang memiliki self esteem yang sangat tinggi sebanyak 10 siswa atau sebesar 15,6%, yang memiliki self esteem tinggi yaitu sebanyak 54 siswa atau sebesar 84,4%. Pada perilaku asertif, siswa yang memiliki perilaku asertif yang sangat tinggi sebanyak 9 siswa atau sebesar 14,1%, yang memiliki perilaku asertif tinggi sebanyak 53 siswa atau sebesar 52,8%, yang memiliki perilaku asertif sedang sebanyak 2 siswa atau sebesar 3,1%. Hasil analisis korelasional menunjukkan korelasi sebesar 0,94. Hal ini berarti self esteem siswa mempunyai korelasi positif dengan perilaku asertif siswa. Ini berarti semakin tinggi self esteem siswa, maka semakin tinggi pula perilaku asertifnya. Berdasarkan hasil penelitian, dapat diketahui bahwa tingkat self esteem dan perilaku asertif siswa sudah cukup tinggi. Maka disarankan pada konselor untuk mengembangkannya lagi dengan pemberian motivasi melalui bimbingan kelompok yang dapat dilakukan dengan menggunakan teknik permainan atau pelatihan-pelatihan pemahaman diri. Untuk guru kelas disarankan dapat memotivasi siswa, agar dapat meningkatkan self esteem dan perilaku asertifnya. Hal ini dapat dilakukan dengan menggunakan metode pembelajaran yang mendukung siswa menjadi individu yang memiliki self esteem dan perilaku asertif yang tinggi. Misalnya dengan memberikan reward pada siswa yang memperoleh nilai terbaik waktu ulangan, dan memberikan kesempatan untuk mengungkapkan pendapatnya dalam proses belajar mengajar.

Pembuatan busana pesta wanita dengan menerapkan aplikasi geometris pada bustier / Selfi Triana

 

Manusia memerlukan berbagai macam kebutuhan, baik yang berupa material maupun non material dalam memenuhi keperluan hidupnya. Salah satu kebutuhan material yang harus terpenuhi dalam kehidupan manusia tersebut adalah busana. Busana merupakan kebutuhan pokok manusia di samping makan (pangan) dan perumahan (papan). Seperti yang dikatakan Petra (2007 :1) bahwa: Setiap orang memiliki tingkat dan jenis kebutuhan yang saling berbeda dalam berbusana. Hal ini dapat dipengaruhi oleh pekerjaan, kondisi geografis tempat tinggal, tingkat social masyarakat, dan kondisi ekonomi. Perubahan status juga mempengaruhi cara berpakaian seseorang. Pada wanita misalnya, wanita masa kini cenderung memiliki latar pendidikan yang lebih tinggi dan terbuka pada ide baru, maka wanita menginginkan pilihan yang lebih banyak dalam mode. Priowirjanto (2001) menyebutkan bahwa busana terdiri dari beberapa macam, di antaranya busana kasual, busana kerja, busana pesta, busana dalam dan busana anak. Perkembangan model busana semakin beragam seiring perkembangan zaman. Wanita menginginkan lebih banyak pilihan dalam berbusana. Hal ini dikarenakan perubahan status wanita menjadi lebih modern, sehingga wanita ingin terlihat lebih modis dan anggun. Mereka juga cenderung memilih busana dengan desain berbeda dengan yang dikenakan orang lain. Busana pesta menurut waktu terbagi menjadi tiga yaitu pesta pagi, pesta siang, dan pesta malam. Busana pesta pagi biasanya menggunakan busana dengan warna-warna yang lembut misalnya warna cream, merah muda dan sebagainya, untuk pesta siang menggunakan busana dengan warna-warna cerah misalnya warna merah, hijau muda dan sebagainya, sedangkan untuk pesta malam busana yang sering dikenakan berupa gaun panjang dengan warna gelap

Peningkatan kemampuan representasi matematis siswa kelas VI MI Mambaul Ulum dengan menggunakan pendekatan realistic mathematics education (RME) / Khanifah Nur Rofiqoh

 

ABSTRAK Rofiqoh, Khanifah Nur. 2009. Peningkatan Kemampuan Representasi Matematis Siswa Kelas VI MI Mambaul Ulum dengan Menggunakan Pendekatan Realistic Mathematics Education (RME). Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Ipung Yuwono, M.S., M.Sc.dan (II) Drs. Tjang Daniel Chandra, M.Si, Ph.D. Kata kunci: Peningkatan, Kemampuan Representasi Matematis, RME Siswa kelas VI MI Mambaul Ulum masih mengalami kesulitan dalam menyelesaikan masalah matematika yang kontekstual. Hal diakibatkan siswa tidak biasa menyelesaikan soal dengan menggunakan representasi matematis yang beragam. Representasi bertujuan mempermudah siswa dalam menyelesaiakan masalah matematika yang sifatnya abstrak menjadi lebih nyata bagi siswa. Salah satu alternatif pembelajaran yang memanfaatkan lingkungan nyata siswa adalah Realistic Mathematics Education (RME). Karena itu, dalam penelitian ini akan dikaji pembelajaran dengan pendekatan Realistic Mathematics Education (RME). Penelitian ini bertujuan untuk mendeskripsikanlangkah-langkah pembelajaran dengan pendekatan Realistic Mathematics Education (RME) yang dapat meningkatkan kemampuan representasi matematis siswa kelas VI MI Mambaul Ulum. Penelitian ini adalah penelitian tindakan kelas yang dilakukan di MI Mambaul Ulum dan subyek penelitiannya adalah siswa kelas VI tahun ajaran 2009/2010. Penelitian ini dilaksanakan pada bulan Juli 2009 dalam 2 tahap, yaitu (1) tahap pra tindakan dan (2) tahap tindakan. Tahap tindakan terdiri dari tindakan I dan tindakan II. Hasil penelitian ini dapat disimpulkan bahwa Langkah-langkah pembelajaran dengan Pendekatan Realistic Mathematics Education (RME) yang dapat meningkatkan kemampuan representasi matematis siswa kelas VI MI Mambaul Ulum Malang meliputi, (1) memahami masalah kontekstual, peneliti meminta siswa secara individu untuk memahami soal kontekstual yang ada pada LKS dan meminta siswa untuk mengungkapkan maksud soal kontekstual dengan menggunakan representasi gambar, simbol, atau verbal; (2) menyelesaikan masalah kontekstual, peneliti meminta siswa untuk mengerjakan LKS secara berkelompok dengan menggunakan alat peraga. Siswa saling membantu dan bekerja sama untuk meningkatkan kemampuan representasi konkret, gambar, simbol; (3) membandingkan dan mendiskusikan jawaban, peneliti meminta salah satu kelompok mempresentasikan hasil diskusi kelompok dan kelompok lain membandingkan hasil kerjanya dengan kelompok presentator. Tahap ini kemampuan representasi verbal siswa dilatih, serta (4) menyimpulkan, peneliti bersama siswa menyimpulkan hasil dari diskusi kelas. Kemampuan representasi simbol dan verbal siswa dikembangkan. Hal ini ditunjukkan dengan peningkatan rata-rata skor kemampuan representasi matematis (tes awal 22,27%, tes tindakan I 63,63%, tes tindakan II 77,27%). Hal tersebut diperkuat dengan hasil observasi aktivitas siswa dan guru selama pembelajaran masuk dalam kategori “Baik” . ABSTRACT Rofiqoh, Khanifah Nur. 2009. Improving of Mathematical Representation Skill of the Sixth Graders of MI Mambaul Ulum Using Realistic Mathematics Education (RME)Approach.Mathematics Departement , State University of Malang. Advisors: (I) Prof. Dr. H. Ipung Yuwono, M.S., M.Sc., and (II) Drs. Tjang Daniel Chandra, M.Si, Ph.D. Key Word: Improving, Mathematical Representation Skill, RME The sixth Graders of MI Mambaul Ulum still had difficulties in solving contextual mathematics problems. It was caused by the students who were unusual to use varied mathematical representations in solving their mathematics problems. Representation was aimed to make the students easier in accomplishing their mathematics problems which have abstract characteristic to be more concrete for them. One of the instructional models which uses students’ real environment is Realistic Mathematics Education (RME). Therefore, in this study would be conducted a mathematics Instruction using Realistic Mathematics Education approach. This study was aimed to describe instructional steps using Realistic Mathematics Education approach which can improve mathematical representation skill for the sixth Graders of MI Mambaul Ulum. This study was designed as a Classroom Action Research which was conducted at MI Mambaul Ulum with the subjects of the study was the sixth Graders of 2009/2010 academic year. This study was implemented on July 2009 in two stages: (1) preliminary stage, and (2) action stage. The action stage involved of first action and second action. On the basis of the findings, it could be concluded that instructional steps using Realistic Mathematics Education approach which can improve mathematical representation skill for the sixth Graders of MI Mambaul Ulum including: (1) comprehending contextual problems, the researcher asked students to comprehend contextual problems individually which were provided on Students Work Sheet and asked them to express the meaning of contextual problems using picture representation, symbolic representation, or verbal representation; (2) solving contextual problems, the researcher asked students to do Students Work Sheet in group using manipulative materials. The students helped each other and worked together to improve their skills in term of concrete representation, picture representation, and symbolic representation; (3) comparing and discussing their answers, the researcher asked one group to present the result of group discussion meanwhile other groups comparing their results with presenter group, in this phase, the students’ verbal representation skill was drilled, and (4) concluding, the researcher with the students concluded the result of class discussion. Students’ skill of symbolic and verbal representations was developed. It was indicated by improving the students average score of mathematical representation skill (preliminary study test was 22.27%, first action test was 63.63%, and second action test was 77.27%). In addition, observation result of the students and teacher activities during the instructional process was categorized "Good".

Karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan Universitas Negeri Malang / Rizki Dian Nur Hakiki

 

Perguruan Tinggi (PT) adalah suatu institusi pendidikan di atas tingkat Menengah yang mempunyai misi pokok yaitu pendidikan dan pengajaran, penelitian serta pengabdian kepada masyarakat…yang ketiga misi pokok itu lebih dikenal dengan Tri Dharma PT” Universitas Negeri Malang (2005: 9). Dosen sebagai pelaksana utama dalam melaksanakan misi tersebut menjadi kunci pokok terhadap keberhasilan dan kualitas sebuah PT dimana dosen tersebut bernaung, sehingga karakteristik dosen efektiflah yang dibutuhkan sebuah PT agar setiap misi pokok yang telah direncanakan dapat tercapai. Karena dosen efektif itu berada pada kuadran yang optimal pada aspek kemauan dan kemampuan (Suparlan, 2005: 11). Mahasiswa Jurusan Administrasi Pendidikan (AP) Fakultas Ilmu Pendidikan (FIP) Universitas Negeri Malang (UM) menjadi responden dalam penelitian ini. Sebagai responden, mahasiswa Jurusan AP FIP UM dapat berpendapat atau menggambarkan karakteristik dosen efektif baik dalam menjalankan tugas pendidikan dan pengajaran, penelitian, dan pengabdian kepada masyarakat. Tujuan penelitian secara umum adalah untuk mengetahui karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan AP FIP UM, dan secara khusus adalah untuk mengetahui karakteristik dosen efektif dalam melaksanakan tugas pendidikan dan pengajaran, penelitian, dan pengabdian kepada masyarakat. Pendekatan dan rancangan penelitian dengan menggunakan analisis kuantitatif dan pendekatan survai. Sedangkan metode dan jenis penelitiannya adalah jenis penelitian deskriptif dan metode deskriptif kuantitatif. Dalam menganalisis menggunakan hasil persentase dengan bantuan program komputer SPSS for Windows Version 12.0. Adapun hasil penelitian terhadap karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan AP FIP UM secara umum meliputi: 1) tingkat pendidikan minimal S2. 2) karakteristik dosen efektif dalam melaksanakan tugas pendidikan dan pengajaran, meliputi: a) melaksanakan tugas pendidikan dan pengajaran; b) mempunyai kompetensi dalam dirinya yang meliputi kompetensi pribadi, profesional, spiritual, sosial dan intelektual; dan c) melaksanakan kewajiban menjadi penasehat akademik. 3) karakteristik dosen efektif melaksanakan tugas penelitian yang meliputi: a) melaksanakan tugas penelitian; dan b) tanggung jawab sebagai peneliti. 4) karakteristik dosen efektif melaksanakan tugas pengabdian kepada masyarakat. Karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan AP FIP UM secara khusus, meliputi: 1) karakteristik dosen efektif dalam melaksanakan tugas pendidikan dan pengajaran, meliputi: a) melaksanakan tugas pendidikan dan pengajaran selain itu penyelenggaraan sesuai tujuan pembelajaran; memberikan waktu untuk mengikuti seminar; memberikan masukan kepada dosen junior; melaksanakan penelitian sederhana; dosen harus memilih dan mengembangkan bahan perkuliahan; menggabungkan metode mengajar; membuat dan membagikan hand out; memberikan umpan balik; melaksanakan kegiatan akademik response, kolokium dan praktikum; bukan sekedar teori yang diajarkan tapi juga praktek; tidak otoriter; mengerti kondisi/karakteristik mahasiswa; mampu menciptakan suasana belajar yang menyenangkan; dan konsistensi; b) mempunyai kompetensi dalam dirinya yang meliputi kompetensi pribadi, profesional, spiritual, sosial dan intelektual; dan c) melaksanakan kewajiban menjadi penasehat akademik serta melaksanakan bimbingan dan penyuluhan kepada mahasiswa secara personal; bertanggung jawab memberikan informasi/link tentang pekerjaan; memberi motivasi kepada mahasiswa; dan memberikan masukan kepada mahasiswa dalam akademik maupun non akademik. 2) karakteristik dosen efektif melaksanakan tugas penelitian yang meliputi: a) melaksanakan tugas penelitian, intelektual tinggi dan mempunyai pemikiran terbaru; serta b) tanggung jawab sebagai peneliti. 3) karakteristik dosen efektif melaksanakan tugas pengabdian kepada masyarakat adalah dengan melaksanakan tugas pengabdian kepada masyarakat serta bisa bekerjasama dengan pihak lain; menjunjung tinggi nilai kemanusiaan terhadap mahasiswanya; dan bertanggung jawab terhadap semua perkataan dan perbuatan yang dilakukan. Berdasarkan pada hasil penelitian tersebut maka dapat disarankan agar dilakukan penelitian lebih lanjut misalnya pada suatu bidang ilmu tertentu seperti ilmu keolahragaan, kedokteran, hukum dan sebagainya yang mempunyai ciri khusus dalam suatu kajian ilmu tertentu.

Pembuatan gaun pesta dengan perpaduan bustier dan drapery / Novi Dwi Ermawati

 

Busana memegang peranan penting di dalam berpenampilan, sebab selain berfungsi untuk melindungi diri, memenuhi rasa kesusilaan, busana juga berfungsi sebagai alat untuk memperindah tubuh serta menunjukkan gaya hidup seseorang. Menurut kesempatan, busana dibagi menjadi beberapa macam, yaitu busana rumah, busana kerja, busana olah raga, busana rekreasi dan busana pesta. Faktor penting yang membedakan busana dengan berbagai macam kesempatan tersebut adalah di dalam pemilihan desain, bahan, warna, hiasan atau pelengkap busana dan teknik penyelesaian. Pada tugas akhir ini kali ini, penulis membuat Bustier dan Gaun Pesta Drapery untuk wanita dewasa. Menurut Rahayu (2002:3) “Pada usia ini wanita cenderung menonjolkan sifat feminin dan sexy dan meninggalkan gaya remajanya”. Pembuatan gaun pesta siang tersebut perlu memperhatikan faktor-faktor mulai dari model busana pesta tetap harus disesuaikan dengan waktu, kesempatan, usia dan proporsi tubuh sipemakai, serta sifat suatu pesta. Busana pesta dapat dikelompokkan berdasarkan waktu pemakaianya seperti busana pesta siang hari dan busana pesta malam hari. Busana pesta siang hari adalah busana pesta yang dikenakan untuk mengahadiri acara pesta yang diselenggarakan waktu siang hari sampai sore hari. Menurut Harini (2004:8) “Busana pesta siang hari memiliki ciri-ciri seperti model busan sederhana tidak terlalu terbuka, bahan yang digunakan agak lembut dan tidak berkilau seperti sutra, crepe, chiffon atau bahan-bahan lainnya dan warna yang digunakan adalah warna-warna yang agak cerah”.

Hubungan daya tarik interpersonal pasangan dan perasaan cinta terhadap pasangan pada masa dewasa awal / Pramarieditya Ayu Rachmawati

 

ABSTRAK Rachmawati, P. A. 2009. Hubungan Daya Tarik Interpersonal Pasangan dan Perasaan Cinta Terhadap Pasangan Pada Masa Dewasa Awal. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dr. Fattah Hanurawan M.Si M.Ed (II) Ika Andrini Farida S.Psi M.Psi Kata Kunci : daya tarik interpersonal, perasaan cinta, masa dewasa awal Daya tarik interpersonal merupakan salah satu faktor penentu ketika seseorang ingin berhubungan dengan orang lain. Setiap individu mempunyai tingkat ketertarikan personal dalam memulai membina hubungan sosial. Puncak pengalaman psikososial ini tercapai pada masa dewasa awal, dimana individu mulai mengkristalisasikan hubungan dengan seorang individu yang paling dicintai, dipercaya, ataupun yang telah dibina sebelumnya. Cinta menjadi salah satu tugas perkembangan utama pada perkembangan masa dewasa awal. Daya tarik terhadap satu dengan yang lain pada masa dewasa awal akan membawa pada kedekatan khusus yang disebut pacaran. Penelitian ini bertujuan untuk mengetahui hubungan daya tarik interpersonal pasangan dan perasaan cinta terhadap pasangannya pada masa dewasa awal. Rancangan penelitian yang digunakan adalah deskriptif dan korelasional. Pengambilan sampel menggunakan teknik purposive sampling (sampel bertujuan). Teknik pengumpulan data menggunakan skala daya tarik interpersonal dan skala perasaan cinta. Hasil dari penelitian menunjukkan bahwa mahasiswa menilai daya tarik interpersonal pasangan pada kategori tinggi dengan persentase 52%. Sedangkan perasaan cinta terhadap pasangan juga berada pada kategori tinggi dengan persentase 50%. Hasil analisis r = 0,800 dengan Sig 0,000 < 0,050, menunjukkan bahwa daya tarik interpersonal pasangan mempunyai hubungan dengan perasaan cinta terhadap pasangan pada masa dewasa awal. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa ada hubungan positif yang signifikan antara daya tarik interpersonal dan perasaan cinta pada masa dewasa awal terhadap pasangannya. Maka dari itu daya tarik interpersonal perlu terus dipertahankan dan bila perlu ditingkatkan agar perasaan cinta dapat tetap terjaga. Daya tarik ini tidak hanya sebatas daripada terlihat menarik secara aspek fisik (jasmani) saja tetapi bisa dikembangkan dalam segi aspek emosi, mental, spiritual, maupun kepribadian yang baik. Selain itu diharapkan bagi peneliti lain, agar dapat memperluas penelitian ini dengan menggunakan rancangan penelitian yang berbeda, seperti eksperimen ataupun kualitatif dan untuk meneliti dengan variabel lain yang dapat berpengaruh pada perasaan cinta pada masa dewasa awal.

Pengaruh penerapan pembelajaran kooperatif model dua tinggal dua tamu (twi stay two stray) terhadap hasil belajar geografi sisw kelas VII SMP Negeri 1 Bandung Tulungagung / Ria Titis Susantika

 

ABSTRAK Susantika, Ria Titis. 2009. Pengaruh Penerapan Pembelajaran Kooperatif Model Dua Tinggal Dua Tamu (Two Stay Two Stray) terhadap Hasil Belajar Geografi Siswa Kelas VII SMP Negeri 1 Bandung Tulungagung. Skripsi, Jurusan Geografi, FMIPA Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Edy Purwanto, M.Pd, (II) Dr. Ach. Amirudin, M.Pd. Kata kunci: Pembelajaran Kooperatif, Model Dua Tinggal Dua Tamu (Two Stay Two Stray), hasil belajar. Pendidikan merupakan salah satu ukuran kualitas kehidupan bangsa, karena tingkat pendidikan dapat menunjukkan kualitas sumber daya manusia yang dimiliki. Saat ini pendidikan di Indonesia mengalami perubahan menuju perbaikan. Bentuk usaha tersebut adalah perubahan kurikulum. Perubahan paradigma pembelajaran dari Kurikulum 2004 menjadi KTSP adalah orientasi pembelajaran yang semula berpusat pada guru (teacher centered) beralih berpusat pada murid (student centered). Pembaharuan proses pendidikan umumnya dititikberatkan pada metode mengajar. Pendekatan pembelajaran yang sesuai dengan KTSP adalah pembelajaran konstruktivistik, dimana siswa dituntut berperan aktif dalam pembelajaran dan pendekatan pembelajaran yang berorientasi pada konstruktivis adalah pembelajaran kooperatif. Salah satu model pembelajaran kooperatif adalah Dua Tinggal Dua Tamu (Two Stay Two Stray). Penelitian ini bertujuan untuk mengetahui pengaruh pembelajaran kooperatif model Dua Tinggal Dua Tamu (Two Stay Two Stray) terhadap hasil belajar geografi siswa kelas VII SMP Negeri 1 Bandung Tulungagung. Penelitian ini termasuk penelitian eksperimen semu (Quasi Eksperimental) dengan mengambil subjek penelitian dua kelas yaitu kelas VII-F sebagai kelas eksperimen dan kelas VII-E sebagai kelas kontrol. Instrumen penelitian berupa tes untuk pratest dan pascatest. Teknik analisis yang digunakan adalah uji-t tidak berpasangan yang diselesaikan dengan bantuan komputer program SPSS 13.0 for Windows. Hasil penelitian menunjukkan bahwa terdapat perbedaan yang signifikan antara nilai rata-rata kelas eksperimen dan kelas kontrol. Dari analisis data diketahui bahwa rata-rata hasil belajar siswa pada kelas eksperimen sebesar 19,63 sedangkan pada kelas kontrol sebesar 11,67 dengan nilai probabilitas (sig) 0,000. Dengan demikian nilai probabilitas 0,000 < 0,05, maka Ho ditolak, sehingga dapat disimpulkan bahwa penerapan pembelajaran kooperatif model Dua Tinggal Dua Tamu (Two Stay Two Stray) berpengaruh terhadap hasil belajar geografi siswa kelas VII SMP Negeri 1 Bandung Tulungagung. Disarankan bagi guru geografi dapat menggunakan model Dua Tinggal Dua Tamu (Two Stay Two Stray) sebagai alternatif dalam merencanakan proses pembalajaran karena dapat meningkatkan hasil balajar siswa. Bagi peneliti selanjutnya disarankan untuk mengembangkan penelitian dengan model Dua Tinggal Dua Tamu (Two Stay Two Stray) pada materi selain pola permukiman penduduk, penggunaan lahan dan pola permukiman berdasarkan kondisi fisik permukaan bumi.

Visualisasi garis-garis medan listrik oleh distribusi muatan titik dalam ruang / Dedy Yulianto

 

Gaya Coulomb timbul tanpa adanya persentuhan antara ke dua benda, bahkan gaya Coulomb dapat dirasakan pada jarak tertentu, konsep gaya seperti ini relatif sukar untuk dimengerti sehingga perlu dikenalkan konsep medan listrik. Konsep medan listrik ini lebih mudah dipahami apabila menggunakan bantuan berupa garis-garis medan listrik. Garis-garis medan listrik merupakan garis-garis khayal di dalam medan listrik yang menjadi tempat kedudukan titik-titik yang arah kuat medannya sama dengan arah garis itu Pada umumnya garis-garis medan listrik menggunakan dua muatan, namun ketika muatan tersebut lebih dari dua dan terdistribusi dalam ruang maka konsep medan listrik menjadi sulit dipahami.Kemudian jika besarnya muatan yang terdistribusi tersebut tidak sama maka konsep medan listriknya menjadi tambah sulit lagi sehingga diperlukan suatu visualisasi garis-garis medan listrik untuk kasus semacam itu. Visualisasi ini bertujuan untuk mengetahui sifat medan listrik yang terdistribusi dalam ruang baik muatan yang teratur maupun acak. Pada program ini, untuk menghitung kuat medan listriknya menggunakan persamaan )()(rrE sehingga terlebih dahulu harus menghitung potensial skalarnya )(r. Teknik pemrograman tersebut menggunakan bahasa pemrograman Mathematica 5.1. Hasil dari visualisasi ini adalah pola garis-garis medan listrik yang dihasilkan oleh muatan titik yang terdistribusi dalam ruang yang menggunakan variasi jumlah muatan titik, jenis muatan titik, dan besarnya muatan titik. Pada variasi jumlah muatan titik menggunakan 5, 6, dan 8 dengan jenis muatan yang sejenis. Pada variasi jenis muatan titik menggunakan jumlah muatan yang sama tetapi jenis muatannya tidak sama. Kemudian pada variasi besarnya muatan titik juga menggunakan jumlah muatan yang sama tetapi besarnya muatannya berbeda. Pada muatan yang sejenis, garis-garis medan listriknya terlihat saling menjauh hal ini karena pada muatan yang sejenis gaya listriknya saling tolak menolak. Sedangkan garis-garis medan listrik yang dihasilkan oleh muatan yang tidak sejenis terlihat garis-garis medan listriknya menyambung hal ini karena gaya listriknya saling tarik-menarik. Kemudian ketika jarak muatan yang tidak sejenis itu dekat, terlihat garis-garis medan listriknya lebih rapat hal ini menandakan bahwa kuat medan listrik di sekitar muatan tersebut besar. Pola garis-garis medan listrik pada variasi besarnya muatan titik terlihat menyambung untuk muatan yang tidak sejenis dan garis-garis medan listriknya terlihat rapat hal ini karena kuat medan listrik di sekitar muatan tersebut besar

Pengaruh bauran promosi terhadap keputusan pembelian konsumen pada produk kartu prabayar simpati (studi pada mahasiswa S-1 Jurusan Psikologi Fakultas Ilmu Pendidikan UM) / Harsinta Wiradini

 

ABSTRACT Wiradini, Harsinta. 2009. The Effect of Promotional Mix toward Consumers Purchasing decision on “Kartu Prabayar Simpati” (A Study on Psychology Students of Educational Faculty State University of Malang. Thesis, Management Departement Economy Faculty State University of Malang. Advisor: (1) Drs. M. Arief, M.Si, (II) Rachmad Hidayat S.Pd. Keywords: promotional mix, consumers purchasing decision As the time of competition in business become tighter than before, it results in the importance of selling strategy of the company. In marketing concept, the company needs not only to produce qualified goods and service but also the advertise its product in order to make the customer attracted and finally buy it, therefore, Telkomsel with its product “Kartu Prabayar Simpati” do promotional mix which includes advertisement, personal selling, sales promotion, public relations and direct selling. The population in this research are 164 S-1 Student of Psychology, Education Faculty UM who are the customer of “Kartu Prabayar Simpati”. The questionaire are spread by using accidental sampling technique. The number of sample are 62 people , this number are used through counting the sample by using Slovin Formula. This research used 2 variables. Which are X variable as the promotional mix, this variable is independent which are consist of advertisement, personal selling, sales promotion, public relations and direct selling. While variables Y is consumers purchasing decision, this variables is dependent variables. The data gathered from respondents by using closed questionare. After using data analysis the results are: (1) There are partially significant effect between advertisement and consumers purchasing decision of “Kartu Prabayar Simpati”; (2) There are partially significant effect between sales promotion and consumers purchasing decision of “Kartu Prabayar Simpati”; (3) There are partially significant effect between personal selling and consumers purchasing decision of “Kartu Prabayar Simpati; (4) There are not a significant effect between public relations and consumers purchasing decision of “Kartu Prabayar Simpati; (5) There are partially significant effect between direct selling and consumers purchasing decision of “Kartu Prabayar Simpati; (6) There are simultaneoeously significant effect between promotion mix and consumers purchasing decision of “Kartu Prabayar Simpati; (7) Sub Variables of Promotional Mix which has dominant effect in affecting consumers purchasing decisions on Kartu Prabayar Simpati is the Sales Promotions which has spread Beta Coefficients,in this study is 0,341. Based on the result of this research it can be concluded that the effective Promotions Mix in marketing strategy can increase consumers purchasing decision. Based on the results, the researcher suggest that: (1) Advertisement should be done creatively so that it can attract the consumers; (2) Sales Promotion should be increased so that the consumer will be loyal to use Kartu Prabayar Simpati; (3) Personal Selling should be treated in special way so that it can manage the companys image; (4) Public Relations should be more carefully managed so that the company gets the societys trust; (5) Direct Selling should be carefully handled in order to avoid competition with the distributors.

Penerapan metode role playing pada mata pelajaran IPS untuk meningkatkan minat mempelajari sejarah pada siswa kelas VIII MTs Muallimat Malang tahun ajaran 2008-2009 / Agustin Anik Arti Ashe

 

ABSTRAK Ashe, Agustin Anik Arti. 2009. Penerapan Metode Role Playing Pada Mata Pelajaran IPS (Sejarah) Untuk Meningkatkan Minat Mempelajari Sejarah Pada Siswa Kelas VIII MTs Muallimat Malang. Skripsi. Jurusan Sejarah. Fakultas Sastra. Universitas Negeri Malang. Pembimbing (I) Dra. Siti Malikhah Towaf M.A, Ph.D. Pembimbing (II) Drs. Marsudi, M. Hum Kata Kunci: Metode Role Playing, Minat, IPS (Sejarah) MTs Muallimat Malang merupakan salah satu sekolah atau madrasah yang proses pembelajaran untuk mata pelajaran IPS (Sejarah) di kelas VIII masih menggunakan metode ceramah, pemberian tugas dan diskusi. Dalam proses pembelajaran guru lebih mendominasi setiap aktifitas belajar mengajar, sedangkan siswa bersifat pasif, sehingga proses pembelajaran kurang optimal. Hal ini mengakibatkan turunnya minat belajar siswa kelas VIII terhadap mata pelajaran IPS (Sejarah). Oleh karena itu, kekurangan dari metode ceramah dalam proses pembelajaran mata pelajaran IPS (Sejarah) dapat disempurnakan dengan menggunakan metode role playing. Pembelajaran menggunakan metode role playing dapat memberikan kesempatan kepada siswa untuk lebih aktif dan juga mendapatkan pengalaman sehingga siswa memperoleh ide dan konsep-konsep tentang pelajaran yang sedang diterimanya. Berdasarkan penjelasan tersebut di atas, dirumuskan permasalahan sebagai berikut: 1) Bagaimanakah penerapan metode role playing pada mata pelajaran IPS (Sejarah) untuk siswa kelas VIII MTs Muallimat Malang?; 2) Bagaimanakah peningkatan minat siswa kelas VIII MTs Muallimat Malang pada mata pelajaran IPS (Sejarah) setelah diterapkan metode role playing? Penelitian ini bertujuan untuk: 1) mendeskripsikan penerapan metode role playing pada mata pelajaran IPS untuk siswa kelas VIII MTs Muallimat Malang; 2) Mengetahui peningkatan minat siswa kelas VIII MTs Muallimat Malang pada mata pelajaran IPS setelah diterapkan metode role playing. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK). Populasi dalam penelitian ini adalah siswa kelas VIII MTs Muallimat Malang dengan jumlah 30 siswa. Instrumen penelitian menggunakan lembar observasi, angket, catatan lapangan. Hasil penelitian menunjukkan adanya peningkatan minat siswa yang cukup signifikan di semua aspek, yaitu kualitas pemeranan, kesesuaian peran, analisis pemeranan, ketertarikan, dan merasa senang. Hal itu dapat di lihat pada siklus pertama prosentase rata-rata minat siswa MTs Muallimat Malang kelas VIII terhadap mata pelajaran IPS (Sejarah) sebesar 57,17 %. Sedangkan pada siklus kedua prosentase rata-rata minat siswa MTs. Muallimat Malang kelas VIII terhadap mata pelajaran IPS (Sejarah) sebesar 88,20 %, sehingga dalam hal ini terjadi peningkatan minat belajar sebesar 31,03 %. Mengacu pada hasil analisis dari penelitian yang dilakukan dapat disarankan kepada guru khususnya guru mata pelajaran IPS (Sejarah) kelas VIII Madrasah Tsanawiyah (MTs) untuk lebih berupaya terbuka menerima dan menggunakan metode role playing demi tercapainya tujuan pendidikan nasional yaitu bertujuan untuk mengembangkan potensi peserta didik agar menjadi manusia yang beriman dan bertakwa kepada tuhan Yang Maha Esa, berakhlak mulia, sehat, berilmu, cakap, kreatif, mandiri, dan menjadi warga negara yang demokratis serta bertanggungjawab. Sedangkan bagi peneliti selanjutnya yang ingin melaksanakan penelitian serupa diharapkan mengembangkan dan memperluas pokok bahasan penelitiannya agar dapat mengungkapkan hal-hal yang terkait tentang metode role playing yang belum terungkap dari penelitian ini sehingga hasil penelitiannya dapat lebih relevan dengan fakta pendidikan yang ada.

Korelasi kecerdasan intelektual dan perilaku asertif dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang / Wiwin Widyawati

 

Prestasi belajar seorang anak tidak hanya ditentukan oleh kecerdasan intelektual saja, tetapi juga ditentukan oleh kecerdasan emosional yang salah satu keterampilan praktisnya adalah perilaku asertif. Menurut Winkel (1996:53), proses belajar tidak akan terjadi apabila tidak ada suatu yang mendorong pribadi yang bersangkutan. Dalam proses belajar tersebut, semua kecerdasan yang ada pada diri seseorang baik kecerdasan intelektual maupun kecerdasan emosional (termasuk perilaku asertif) dimanfaatkan atau terefleksi secara maksimal. Dengan kecerdasannya, manusia dapat terus menerus mempertahankan dan meningkatkan kualitas hidupnya yang semakin kompleks, melalui proses berpikir dan belajar secara terus menerus. Penelitian ini bertujuan untuk memperoleh (1) deskripsi objektif tentang tingkat inteligensi siswa SMAN 9 Malang, (2) deskripsi objektif tentang perilaku asertif siswa SMAN 9 Malang, (3) deskripsi objektif tentang prestasi belajar siswa SMAN 9 Malang, (4) untuk mengetahui ada tidaknya korelasi antara kecerdasan intelektual dengan prestasi belajar siswa SMAN 9 Malang, (5) untuk mengetahui ada tidaknya korelasi antara perilaku asertif dengan prestasi belajar siswa SMAN 9 Malang, (6) untuk mengetahui ada tidaknya korelasi antara kecerdasan intelektual dan perilaku asertif dengan prestasi belajar siswa SMAN 9 Malang. Penelitian ini menggunakan metode Expost Facto Correlation dengan mengambil sampel secara menyeluruh (sampel total). Berdasarkan sampel penelitian tersebut, diperoleh sebaran data untuk masing-masing variabel yaitu kecerdasan intelektual, perilaku asertif, dan prestasi belajar siswa kelas X SMA Negeri 9 Malang. Data dijaring melalui angket dan studi dokumentasi. Hasil penelitian menunjukkan: (1) Kecerdasan intelektual siswa kelas X SMA Negeri 9 Malang tahun 2008/2009 secara umum termasuk kategori di atas rata-rata. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan sebagian besar (111 siswa atau 39,50%) memiliki IQ 110-119. (2) Tingkat perilaku asertif siswa kelas X SMA Negeri 9 Malang tahun 2008/2009 secara umum termasuk kategori tinggi. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan sebagian besar (238 siswa atau 84,70%) memiliki rentangan skor 225-272. (3) Prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun 2008/2009 secara umum termasuk kategori cukup. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan sebagian besar (230 siswa atau 81,85%) memiliki rata-rata nilai rapor 65-79. Hasil pengujian hipotesis menunjukkan: (1) Tidak terdapat hubungan yang signifikan antara kecerdasan intelektual dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun ajaran 2008/2009, yang dibuktikan dari hasil uji statistik korelasi tata jenjang, bahwa diperoleh r (0,062 dan 0,083) dengan probabilitas (0,158 dan 0,164) > 0.05. (2) Terdapat hubungan yang signifikan antara perilaku asertif dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun ajaran 2008/2009, yang dibuktikan dari hasil uji statistik korelasi tata jenjang, bahwa diperoleh r (0,114**dan 0,153*) dengan probabilitas (0,009 dan 0,010) < 0.05. (3) Terdapat hubungan yang signifikan antara kecerdasan intelektual dan perilaku asertif dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun ajaran 2008/2009, yang dibuktikan dari hasil analisis korelasi ganda, bahwa probabilitas (0,016 < 0,05 dan F hitung (4,211) > F tabel (3,00). Berdasarkan hasil analisis maka peneliti menyampaikan saran: Konselor hendaknya dapat mengadakan pengembangan terhadap diri siswa dengan mengarahkan layanan BK untuk membantu siswa lebih dapat berperilaku asertif dengan efektif, karena terbukti bahwa perilaku asertif berkorelasi secara signifikan dengan prestasi belajar.

Strategi-strategi react dengan menggunakan aktivitas pemecahan masalah pada pembelajaran materi lingkaran kelas VIIIG SMPN 13 Malang / Ari Kusumastuti

 

Hasil observasi awal yang dilaksanakan dalam penelitian ini mendapatkan informasi bahwa pada materi geometri lingkaran terdapat kendala dalam pengajarannya. Siswa selalu mengalami kesalahan dalam mentranser pemahaman mereka pada aktifitas pemecahan masalah. Metode belajar masih menggunakan pendekatan ceramah. Setting belajar juga masih individual dan siswa terkesan pasif. Penelitian ini berupaya memperbaiki pola pembelajaran yang lama dengan menerapkan strategi-strategi REACT dengan aktifitas pemecahan masalah. Materi yang dipilih adalah lingkaran. Penelitian ini merupakan penelitian tindakan kelas. Penelitian ini terdiri dari 7 tindakan. Ketujuh tindakan ini selanjutnya dibagi dalam dua siklus. Setiap akhir pembelajaran dilakukan wawancara dengan siswa untuk melihat pemahaman akan materi yang telah diberikan. Subjek wawancara dipilih dari 3 siswa yang terdiri dari 1 siswa berkemampuan tinggi, 1 siswa berkemampuan sedang, dan 1 siswa berkemampuan rendah. Teknik pengumpulan data dalam penelitian ini yaitu melalui tes, wawancara, observasi langsung, catatan lapangan, dan jurnal siswa. Tes dilakukan untuk memperoleh data non verbal aktifitas pemecahan masalah. Sedangkan observasi langsung, wawancara, catatan lapang dan jurnal siswa untuk memperoleh data verbal aktivitas bermatematika dan aktifitas pemecahan masalah serta respon siswa terhadap strategi-strategi REACT. Teknik analisis data, untuk data berupa bilangan dianalisis dengan menggunakan analisis prosentase, sedangkan untuk data kualitatif dianalisis sesuai dengan model Milles dan Huberman yang meliputi 3 tahap yaitu: (1) reduksi data, (2) menyajikan data, dan (3) menarik kesimpulan. Implementasi pembelajaran dilaksanakan dalam 3 tahap yaitu tahap awal, inti, dan tahap akhir. Tahap awal guru menjalankan strategi relating dengan mengajukan pertanyaan kontekstual. Tahap inti guru menjalankan strategi experiencing, applying, cooperating dan transferring dengan aktifitas pemecahan masalah. Tahap akhir siswa menyimpulkan dan merefleksi hasil pembelajaran dengan bimbingan guru. Hasil penelitian ini menunjukkan adanya peningkatan aktivitas bermatematika dan aktifitas pemecahan masalah siswa dengan strategi-strategi REACT ini. Peningkatan aktivitas dilihat dari analisis prosentase hasil pengamatan dan catatan lapangan selama proses pembelajaran. Respon siswa terhadap pembelajaran dengan strategi-strategi REACT pada materi lingkaran dalam penelitian ini sangat baik. Hal ini dapat dilihat dari hasil analisis jurnal siswa.

Penerapan metode quantum learning melalui teknik windows untuk pembelajaran keterampilan menulis bahasa Jerman di kelas X SMA Negeri 6 Malang / Rosa Ria Rully Ardian

 

ABSTRAK Ardian, Rosa Ria Rully 2009. Penerapan Metode Quantum Learning Melalui Teknik WINDOWS untuk Pembelajar Keterampilan Menulis Bahasa Jerman di Kelas X SMA Negeri 6 Malang. Skripsi. Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra Rosyidah M.Pd, (II) Sri Prameswari M.Pd Kata Kunci : metode Quantum Learning, Teknik WINDOWS, keterampilan menulis Dalam menulis sebuah karangan diperlukan suasana nyaman dan santai, agar keduabelahan otak dapat berfungsi dengan baik, sehingga siswa mudah mengembangkan ide tulisannya. Pada kenyataannya para guru masih menggunakan metode tradisional yang kaku. Hal ini menyebabkan siswa hanya mempergunakan fungsi otak kirinya saja. Berdasarkan hal tersebut, peneliti menggunakan metode Quantum Learning melalui teknik WINDOWS sebagai metode pengajaran untuk keterampilan menulis agar siswa dapat mengoptimalkan fungsi keduabelahan otaknya. Penelitian ini bertujuan untuk mendeskripsikan: (1) kemampuan menulis siswa kelas X5-8 SMAN 6 Malang sebelum menggunakan teknik WINDOWS, (2) penerapan teknik WINDOWS, dan (3) kemampuan menulis siswa dengan menggunakan teknik WINDOWS. Penelitian ini menggunakan rancangan penelitian kualitatif. Sumber data yang digunakan adalah 17 siswa kelas X5-8 yang mengikuti pelajaran Bahasa Jerman. Data dikumpulkan dengan teknik kuesioner, dokumentasi, pemberian tugas, dan pengamatan aktifitas guru dan siswa. Data dianalisis dalam tiga tahap, yaitu klasifikasi data, pengelompokan data, dan interpretasi data. Hasil penelitian ini: (1) kemampuan menulis siswa sebelum menggunakan teknik WINDOWS adalah kurang dari segi pengembangan topik, cukup dari segi organisasi karangan, kurang dari segi tata bahasa, kurang dari segi kosa kata, dan cukup dari segi ejaan dan tanda baca; (2) pembelajaran Bahasa Jerman dengan menggunakan teknik WINDOWS, yaitu (a) pemberian kata kunci/Schlüsselwort, (b) penuliskan hasil imajinasi dari kata kunci dalam beberapa kata sebagai konsep, (c) penggambaran konsep dalam bentuk lukisan, dan (d) penjelaskan lukisan dalam bentuk karangan. Teknik WINDOWS terbukti memotivasi siswa untuk aktif selama pelajaran berlangsung; dan (3) kemampuan menulis siswa pada penerapan teknik WINDOWS terbukti dapat meningkatkan kemampuan menulis siswa pada segi pengembangan topik dan kosa kata. Dari hasil penelitian ini dapat disimpulkan bahwa penggunaan teknik WINDOWS sebagai metode pengajaran untuk keterampilan menulis dapat membantu siswa mengoptimalkan fungsi keduabelahan otaknya, sehingga siswa bisa lebih aktif di kelas. Oleh karena itu, disarankan kepada guru untuk menggunakan teknik WINDOWS dalam pembelajaran bahasa Jerman. Kepada peneliti selanjutnya, disarankan untuk melakukan penelitian tentang penerapan teknik WINDOWS untuk keterampilan menulis pada tingkatan kelas yang lain atau pada tingkat mahasiswa.

Sifat organoleptik smoked duck dengan perbedaan lama pengasapan / Maftuhah

 

Penelitian ini merupakan penelitian eksperimen pembuatan smoked duck dengan perbedaan lama pengasapan 1 jam, 2 jam dan 3 jam. Masing-masing perlakuan dilakukan 3 kali pengulangan. Tujuan penelitian ini adalah untuk mengetahui sifat organoleptik smoked duck yang meliputi warna, tekstur dan rasa melalui uji mutu hedonik dan uji hedonik. Eksperimen dilakukan pada bulan Juli – Agustus 2009 di Laboratorium Tata Boga gedung H4 lantai 2 Universitas Negeri Malang. Data diperoleh dari panelis agak terlatih sebanyak 20 orang yaitu mahasiswa D3 Tata Boga angkatan 2005-2006 secara acak. Data dianalisis dengan analisis sidik ragam dan Duncan’s Multiple Range Test (DMRT). Hasil analisis menunjukan terdapat perbedaan yang sangat nyata warna, tekstur dan rasa antara smoked duck dengan lama waktu pengasapan 1 jam, 2 jam dan 3 jam. Hasil uji mutu hedonik terhadap warna, tekstur dan rasa smoked duck menunjukan bahwa smoked duck dengan lama pengasapan 1 jam memperoleh nilai tertinggi pada warna dengan nilai rata-rata 3,50. Smoked duck dengan lama pengasapan 2 jam memperoleh nilai tertinggi pada tekstur dengan nilai rata-rata 3,02. Dan smoked duck dengan lama pengasapan 1 jam memperoleh nilai tertinggi pada rasa dengan nilai rata-rata 2,93. Hasil uji hedonik diperoleh data bahwa sebagian kecil panelis (46,67%) menyukai warna smoked duck dengan lama pengasapan 1 jam. Sebagian besar panelis (61,67%) menyukai rasa smoked duck dengan lama pengasapan 1 jam. Sebagian kecil panelis (36,67%) menyukai tekstur smoked duck dengan lama pengasapan 2 jam Kesimpulan dari hasil penelitian ini adalah semakin lama pengasapan smoked duck, maka warna smoked duck semakin coklat, tekstur semakin kering dan rasa semakin getir.

Perbandingan efektivitas penempatan fuse cut out (FCO) terhadap lightning arrester (LA) pada trafo 20 KV / Habibi

 

ABSTRAK Habibi. 2009. Perbandingan Efektivitas Penempatan Fuse Cut Out (FCO) Terhadap Lightning Arrester (LA) Pada Trafo 20 KV. Tugas Akhir, Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Drs. Setiadi C.P., M.Pd., M.T., (II) M. Rodhi Faiz, S.T.,M.T. Kata Kunci : Fuse Cut Out, Lightning Arrester, Transformator 20 KV. Trafo distribusi merupakan komponen yang sangat penting dalam penyaluran tenaga listrik dari gardu distribusi ke konsumen. Kerusakan pada trafo dalam gardu distribusi menyebabkan kontinuitas pelayanan terhadap konsumen akan terganggu. Dengan adanya sistem pengaman yang dapat bekerja dengan baik di dalam gardu distribusi diharapkan gangguan-gangguan yang menyebabkan tegangan lebih dan arus lebih dapat diatasi. Peralatan pengaman yang dipasang pada sisi primer trafo distribusi adalah lightning arrester sebagai pengaman tegangan lebih dan fuse cut out sebagai pengaman arus lebih. Tujuan dari penelitian ini adalah untuk mengetahui macam perancangan penempatan fuse cut out terhadap lightning arrester pada trafo 20 KV. Dan juga untuk mendapatkan perbandingan dan analisis serta kesimpulan dari hasil perancangan. Ada dua macam penempatan fuse cut out terhadap lightning arrester pada trafo distribusi 20 KV yaitu pemasangan setelah dan sebelum lightning arrester. Perancangan dan analisis perbandingan ini dilakukan untuk mengetahui efektivitas penempatan fuse cut out terhadap lightning arester pada trafo 20 KV yang sesuai dengan kebutuhan. Metode yang digunakan untuk mendapatkan perbandingan ini adalah dengan menentukan spesifikasi komponen dan rangkaian perancangan. Kemudian berdasarkan pada data sekunder/simulasi dan menganalisis serta menyimpulkan hasil data tersebut. Penempatan fuse cut out dan lightning arrester bisa dengan menganalisa besar dan frekuensi terjadinya gangguan pada suatu daerah. Dengan menganalisa besar arus gangguan yang dapat terjadi dan memperhatikan karakteristik serta pola seting peralatan pengaman yang terpasang, diharapkan dapat diketahui tingkat keandalan dari peralatan pengaman.

Ekspektasi siswa, guru, dan kepala sekolah terhadap penyelenggaraan layanan bimbingan dan konseling di SMA Negeri 1 Sumenep / Riyanti Utami

 

ABSTRAK Utami, Riyanti. 2009. Ekspektasi Siswa, Guru, Dan Kepala Sekolah Terhadap Penyelenggaraan Layanan Bimbingan Dan Konseling Di SMA Negeri 1 Sumenep. Skripsi, Jurusan Bimbingan Konseling Dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dr. H. M. Ramli, M.A, (II) Drs.H. Moh. Bisri. M.Si. Kata kunci: Ekspektasi, Siswa, Guru, Kepala Sekolah, Bimbingan dan Konseling Layanan Bimbingan dan Konseling merupakan bagian yang tidak terpisahkan dari keseluruhan program pendidikan. Bimbingan dan Konseling sangat dibutuhkan peranannya dalam rangka membangun pribadi yang utuh melalui pendidikan formal. Maka dari itu peneliti dalam penelitian ini bertujuan (1) untuk mengetahui ekspektasi siswa terhadap penyelenggaraan program layanan bimbingan dan konseling di SMA Negeri 1 Sumenep, (2) ekspektasi guru terhadap penyelenggaraan program layanan bimbingan dan konseling di SMA Negeri 1 Sumenep, (3) ekspektasi kepala sekolah terhadap penyelenggaraan program layanan bimbingan dan konseling di SMA Negeri 1 Sumenep. Rancangan atau desain penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Populasi dalam penelitian ini yaitu siswa, guru, dan kepala sekolah di SMA Negeri 1 Sumenep. Adapun teknik pengambilan sampelnya menggunakan teknik random sampling atas dasar himpunan cluster random sampling. Instrumen pengumpulan data yang dipergunakan dalam penelitian ini adalah angket atau kuesioner (questionnaires). Sebagai alat bantu dalam analisis data, peneliti menggunakan persentase (%). Berdasarkan hasil penelitian diketahui bahwa siswa, guru, dan kepala sekolah mempunyai ekspektasi yang sangat tinggi terhadap penyelenggaraan layanan bimbingan dan konseling di SMA Negeri 1 Sumenep. Dari hasil penelitian ini, maka saran yang dapat peneliti berikan yaitu: (a) kepala sekolah sangat mengharapkan penyelenggaraan layanan bimbingan dan konseling, maka dari itu kepala sekolah hendaknya memberikan dukungan yang serius dan sistematis terhadap penyelenggaraan program bimbingan dan konseling, seperti dalam menyediakan sarana dan prasarana bimbingan dan konseling, karena dengan dukungan aktif kepala sekolah sangat menentukan kelancaran program bimbingan dan konseling, (b) ekspektasi siswa, guru dan kepala sekolah sebagian besar sangat mengharapkan penyelenggaraan layanan bimbingan dan konseling, maka dari itu konselor harus lebih aktif dan kreatif dalam melaksanakan layanan bimbingan dan konseling, macam-macam kegiatan pendukung, dan sarana dan prasarana bimbingan dan konseling, sehingga layanan bimbingan dan konseling benar-benar sesuai dengan kebutuhan siswa, (c) guru sebagian besar mengharapkan penyelenggaraan layanan bimbingan dan konseling, maka dari itu guru hendaknya membantu dalam penyelenggaraan layanan bimbingan dan konseling agar layanan bimbingan dan konseling dapat berjalan dengan lancar.

Survei tentang sarana dan prasarana pendidikan jasmani yang dimiliki sekolah menengah atas negeri (SMAN) se-kota Pamekasan / Jaka Bachtiar Rachman

 

ABSTRAK Rachman, Jaka Bachtiar. 2009. Survei Tentang Sarana dan Prasarana Pendidikan Jasmani yang Dimiliki Sekolah Menengah Atas Negeri (SMAN) se-Kota Pamekasan. Skripsi Fakultas Ilmu Keolahragaan Jurusan Pendidikan Jasmani dan Kesehatan Universitas Negeri Malang. Pembimbing: (1) Dra. Sulistyorini, M.Pd, (2) dr.Hartati Eko Wardani, M.Si.,Med Kata kunci: Survei, sarana, prasarana, pendidikan jasmani. Salah satu unsur penting dalam mencapai tujuan pendidikan jasmani adalah tersedianya sarana dan prasarana yang memadai. Penelitian ini bertujuan untuk mengetahui: (1) bagaimana sarana dan prasarana pendidikan jasmani di SMAN se-Kota Pamekasan, (2) perbandingan prasarana pendidikan jasmani di SMAN se-Kota Pamekasan dengan standar umum prasarana sekolah. Jenis penelitian ini adalah penelitian observasional (survei). Populasi pada penelitian ini adalah SMAN se-Kota Pamekasan yang berjumlah 5 SMA. Sampel yang digunakan yaitu seluruh populasi. Instrumen pada penelitian ini menggunakan lembar observasi. Sedangkan item-item pada lembar observasi didasarkan pada kurikulum pendidikan jasmani tahun 2004. Analisis data menggunakan statistik deskriptif (rata-rata dan persentase). Hasil penelitian dapat disimpulkan sebagi berikut: (1). (a) sarana dan prasarana atletik yaitu 20% memiliki lintasan lari, stopwacth; 40% memiliki bak lompat jauh, balok tumpu, dan meteran; 60% memiliki start block; 80% memiliki matras, tiang dan mistar, lembing; 100% memiliki tongkat estafet, peluru, dan cakram. (b) sarana dan prasarana aktivitas senam dan ritmik yaitu 40% memiliki gedung/aula, peti lompat, dan tape recorder; 60% memiliki matras. (c) sarana dan prasarana permainan yaitu 20% memiliki lapangan sepak bola; 40% memiliki lapangan tenis meja, meja tenis, lapangan bulu tangkis,dan net bulu tangkis; 80% memiliki tiang voli, dan tiang bulu tangkis; 100% memiliki lapangan voli, lapangan basket, bola sepak,peluit, bola voli, net voli,dan bola basket. (d) sarana dan prasarana bela diri yaitu 40% memiliki gedung/aula. (e) sarana dan prasarana akuatik/aktivitas air yaitu SMAN se-Kota Pamekasan tidak memiliki sarana dan prasarana akuatik/aktivitas air. (2) Perbandingan prasarana Pendidikan Jasmani yang dimiliki SMAN se-Kota Pamekasan jika dibandingkan dengan standart umum prasarana sekolah menunjukkan dari 5 sekolah yang ada hanya satu Sekolah yang prasarananya sesuai dengan standar umum prasarana sekolah yaitu SMAN 3 Pamekasan. Hasil penelitian menunjukkan bahwa sarana dan prasarana Pendidikan Jasmani yang dimiliki SMAN se-Kota Pamekasan masih kurang. Untuk itu saran yang dapat diajukan oleh peneliti antara lain: (1) Kepada kepala sekolah SMAN se-Kota Pamekasan. Hendaknya dalam menyediakan sarana dan prasarana perlu diperhatikan untuk kelancaran kegiatan pembelajaran praktek; (2) Guru Pendidikan Jasmani SMAN se-Kota Pamekasan. Jika sekolah tidak memiliki sarana dan prasarana Pendidikan Jasmani hendaknya dapat mencari sarana dan prasarana alternatif sehingga proses pembelajaran praktek dapat terlaksana; (3)SMAN se-Kota Pamekasan. Hendaknya diperhatikan penyediaan Sarana dan prasarana Pendidikan Jasmani dari segi kualitas maupun kuantitas; dan (4) Bagi Sekolah yang tidak mempunyai prasarana Pendidikan Jasmani. Hendaknya menyewa prasarana (lapangan sepak bola, lapangan tolak peluru, lapangan lempar lembing, lapangan lempar cakram, lari, dan kolam renang) di luar sekolah agar proses pembelajaran praktek bisa terlaksana.

Improving the students' speaking ability at Madrasah Aliyah Sunan Drajat Sugio - Lamongan through role-playing technique / Chothibul Umam

 

Abstrak Based on the preliminary study, the researcher found some problems related to the English instructional activities in MA. Sunan Drajat Sugio-Lamongan. Those are the students' low speaking ability, the students' low motivation in learning English, and the monotonous and inappropriate teaching techniques used by the teacher. Therefore, the researcher is greatly motivated to overcome the problem by implementing role-playing technique in teaching speaking. This research is intended to describe how role-playing technique can improve the speaking ability of the eleventh year students of MA. Sunan Drajat Sugio - Lamongan. The researcher employed collaborative classroom action research design, in which the researcher was assisted by a collaborative teacher (a colleague) in conducting the study. The research is conducted in a single class that consists of twenty four students, in which all of the students are taken as the subjects of the study. The procedure of the research consists of four main steps: planning, implementation, observation and reflection. To collect the data, the researcher uses some instruments i.e. observation checklists, field notes, and questionnaire. The finding of this research showed that the students' skill in speaking improved significantly from one cycle to the following cycle. This can be seen from the result of each cycle. The students' speaking performance improved from 41.7% of all students who could reach at least good level at the first cycle to 66.7% of all students in the second cycle. The students' self-confidence also improved from 37.5% of all students who could fulfill 5 of 7 indicators in this study in the first cycle to 62.5% of all the students in the second cycle. The role-playing procedures implemented by the researcher in this study consist of 7 major steps. Those are deciding on the teaching materials, organizing the group of the students, providing the situation and dialogue to be role played, teaching the dialogue for role plays, having the students practice the role plays, having the students modify the situation and dialogue, and having the students perform the dialogue in front of the class. Based on the effectiveness of the implementation of role-playing technique in teaching speaking, it is suggested for the English teachers whose have similar classroom problems, characteristics and situations with MA. Sunan Drajat Sugio-Lamongan to use role-playing technique as an alternative technique to teach speaking skill at SMA/MA level.

Penerapan model pembelajaran direct instruction berbasis pendekatan kontekstual untuk meningkatkan hasil belajar fisika siswa kelas XI IPA 1 SMA Laboratorium Universitas Negeri Malang / Ahmad Azhar

 

ABSTRACT Azhar, Ahmad. 2009. The Application of Direct Instruction Method Based on Contextual Approach to Improve Students’ Achievement of Grade XI IPA1 in SMA Laboraturium UM. Thesis, Physics Education, Physics Department, State University of Malang. Advisors: 1) Dra. Endang Purwaningsih, M.Si. 2) Drs. Purbo Suwasono, M.Si. Keywords: Direct Instruction Model, Contextual, Achievement. SMA Laboraturium UM applies Direct Instruction method in teaching and learning process as stated in the lesson plan for physics. However, based on the researcher observation, instead of using Direct Instruction method, the school use lecturing method that provides one-way communication. This made the students as passive learners since they rarely did experiments. As result, the students have some difficulties in stringing up the equipment, collecting the data, and analyzing the data. Furthermore, students’ achievement in cognitive aspect are also low that can be proved by the students’ score. Out of the numbers, only two students can achieve the minimum completeness standard. Therefore, this present research want to know the application of direct instruction method based on contextual approach to improve students’ achievement of grade XI IPA1 in SMA Laboraturium UM. This research used classroom action research (CAR) methodology that consists of two cycles. Each cycle comprises of four steps that are planning, implementation, analysis, and reflection. First and second cycle is the application of lesson plan using direct instruction method such as building knowledge, joint construction, feedback and evaluation, and the last is individual exercises. The instruments used in this study are lesson plan, worksheet, pre test and post test, and observation sheet. The result of the study shows that cognitive, affective, and psychometric aspects increase after applying direct instruction method. The cognitive aspect increases on the normalization gain score from 0,31 in the first cycle up to 0,49 in the second cycle. The affective aspect on the teamwork increases from 58,7% in the first cycle up to 75% in the second cycle, students’ activeness increases from 65,7% in the first cycle up to 86,5% in the second cycle, punctuation of submit-ting the assignments increases from 60,3% in the first cycle up to 87,5% in the second cycle. The psychometric aspect increases on the result of the experiments from 82,7% in the first cycle up to 94,7% in the first cycle, carefulness of measurement increases from 72% in the first cycle up to 89,3% in the first cycle, cleanliness and tidiness increases from 72% in the first cycle up to 81,3% in the first cycle, and filling the worksheet increases from 94,6% in the first cycle up to 100% in the first cycle.

Pengembangan paket pembelajaran IPA terpadu berbasis konstruktivisme dengan tema kebakaran hutan untuk siswa SMP negeri 1 Turen / Cahyono

 

ABSTRAK Cahyono. 2009. Pengembangan Paket Pembelajaran IPA Terpadu Berbasis Konstruktivisme dengan Tema Kebakaran Hutan untuk siswa SMP Negeri 1 Turen. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Supriyono Koes H, M.Pd, MA, (II) Drs. Triastono Imam P., M.Pd Kata kunci : Paket IPA Terpadu, Konstruktivisme, Tema Kebakaran Hutan. Peraturan Menteri Pendidikan Nasional nomor 22 tahun 2006 tentang standar isi secara tegas menyatakan bahwa substansi mata pelajaran IPA pada SMP/MTs merupakan IPA Terpadu. Hasil survey terbatas pada guru-guru IPA SMP/MTs di Jawa Timur dalam beberapa pelatihan PAKEM (Pembelajaran Aktif, Kreatif, Efektif, dan Menyenangkan) yang diselenggarakan oleh proyek MBE tahun 1996 menunjukkan bahwa sebagian besar guru (92 dari 118 orang atau 79%) mengalami kesulitan untuk merancang pembelajaran IPA Terpadu berdasarkan standar isi untuk kurikulum IPA. Oleh sebab itu, hampir semua guru SMP belum melaksanakan pembelajaran secara terpadu (Koes dkk, 2008), termasuk di SMP Negeri 1 Turen. Berdasarkan hal tersebut maka dikembangkan Paket Pembelajaran IPA Terpadu yang dapat membantu pelaksanaan pembelajaran IPA Terpadu. Pengembangan ini bertujuan untuk mengetahui kelayakan paket pembelajaran IPA Terpadu berbasis konstruktivisme dengan tema kebakaran hutan untuk siswa SMP Negeri 1 Turen. Metode pengembangan paket pembelajaran IPA Terpadu yang digunakan dalam penelitian ini adalah pengembangan menurut Borg dan Gall yaitu: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal produk, (4) penilaian produk, dan (5) revisi produk (Borg dan Gall, 2003, dalam Koes H., 2008). Instrumen penelitian yang digunakan berupa kuesioner kelayakan paket pembelajaran IPA Terpadu berbasis konstruktivisme dengan tema kebakaran hutan dan panduan pelaksanaannya yang diisi oleh tim penelaah. Jenis data berupa data kualitatif dan kuantitatif. Data kualitatif berupa tanggapan, saran, dan kritik dari tim penelaah, sedangkan data kuantitatif diperoleh dari analisis nilai rata-rata kuesioner skala likert. Hasil uji kelayakan dari tim penelaah menyatakan bahwa paket pembelajaran IPA Terpadu yang dikembangkan layak digunakan namun perlu direvisi, dengan nilai rata-rata untuk paket IPA Terpadu adalah 3,57 dan nilai rata- rata untuk panduan pelaksanaannya adalah 3,59. Berdasarkan hasil pengembangan, disarankan agar dilakukan penelitian lebih lanjut terhadap paket Pembelajaran IPA Terpadu ini dengan melakukan eksperimen terhadap paket Pembelajaran IPA Terpadu dan panduan pelaksanaannya agar diketahui tingkat efektif dan efisiensinya dalam pembelajaran IPA Terpadu. i

Hubungan antara fanatisme terhadap idola dengan konsep diri siswa kelas X dan XI SMAN 3 Malang / Raj Fajariayah Rahmawati

 

ABSTRAK Rahmawati, Fajariyah. 2009. Hubungan antara Fanatisme terhadap Idola dengan Konsep Diri Siswa Kelas X dan XI SMAN 3 Malang . Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Drs. H. IM Hambali, M. Pd (2) Drs. Djoko Budi Santoso Kata kunci: fanatisme terhadap idola, konsep diri, realistis. Masa remaja merupakan masa transisi yang di dalamnya terdapat proses pencarian jati diri. Dalam proses pencarian jati diri tersebut remaja cenderung memiliki sosok idola yang dikaguminya, sehingga dapat mengidentifikasi sikap dan tingkah laku idola tersebut. Namun tak jarang mereka ingin menjadi identik seperti idolanya tanpa berpikir kritis dan rasional, maka remaja tersebut dapat menjadi seseorang yang bukan dirinya atau tidak realistis. Dapat dikatakan remaja tersebut telah kehilangan jati dirinya atau memiliki konsep diri yang rendah, sehingga mereka tidak mampu menempatkan dirinya secara realistis dan tidak dapat memahami keadaan diri sebagaimana adanya. Tujuan penelitian adalah untuk: (1) mengetahui tingkat fanatisme siswa SMAN 3 Malang terhadap idola, (2) mengetahui tingkat konsep diri siswa SMAN 3 Malang, dan (3) untuk mengetahui hubungan antara fanatisme idola dengan konsep diri siswa SMAN 3 Malang. Rancangan penelitian yang digunakan adalah deskriptif korelasional, dengan populasi penelitian adalah siswa SMAN 3Malang kelas X dan XI. Teknik pengambilan sampel menggunakan random sampling. Pengumpulan data menggunakan instrumen inventori, data dianalisis dengan menggunakan teknik korelasi product moment dari Pearson. Hasil penelitian menunjukkan bahwa secara umum siswa memiliki tingkat fanatisme terhadap idola yang rendah dengan prosentase 78,63% .Adapun dalam kategori lainnya yaitu siswa yang memiliki tingkat fanatisme yang tinggi terhadap idola dengan persentase 21,37%, sedangkan dalam kategori sangat tinggi dan sangat rendah memiliki persentase yang sama yaitu 0 % atau tidak ada siswa yang memiliki tingkat fanatisme dalam klasifikasi tersebut. Secara umum siswa kelas X dan XI SMAN 3 Malang memiliki tingkat konsep diri yang tergolong dalam kategori tinggi dengan persentase 73,50%, sedangkan dalam kategori sangat tinggi dengan persentase 16,24%, kemudian dalam kategori rendah memperoleh persentase 10,26%. Namun tidak terlihat adanya siswa yang memiliki tingkat konsep diri yang sangat rendah. Berdasarkan hasil penelitian dengan menggunakan program komputer SPSS diketahui bahwa r hitung lebih besar daripada r tabel yaitu -0,545 > 0,180. Dengan demikian dapat dijelaskan bahwa H1 diterima secara signifikan. Hal ini menunjukkan bahwa ada hubungan negatif yang signifikan antara fanatisme terhadap idola dengan konsep diri siswa kelas X dan XI SMAN 3 Malang. Berdasarkan hasil penelitian ini, dapat disarankan ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang rendah dan konsep diri tinggi hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengembangan, misalnya layanan informasi. Sebaliknya, ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang tinggi dan konsep diri rendah hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengentasan, diantaranya memberikan layananan informasi, bimbingan dan konseling kelompok, konferensi kasus dan home visit. ABSTRAK Rahmawati, Fajariyah. 2009. Hubungan antara Fanatisme terhadap Idola dengan Konsep Diri Siswa Kelas X dan XI SMAN 3 Malang . Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Drs. H. IM Hambali, M. Pd (2) Drs. Djoko Budi Santoso Kata kunci: fanatisme terhadap idola, konsep diri, realistis. Masa remaja merupakan masa transisi yang di dalamnya terdapat proses pencarian jati diri. Dalam proses pencarian jati diri tersebut remaja cenderung memiliki sosok idola yang dikaguminya, sehingga dapat mengidentifikasi sikap dan tingkah laku idola tersebut. Namun tak jarang mereka ingin menjadi identik seperti idolanya tanpa berpikir kritis dan rasional, maka remaja tersebut dapat menjadi seseorang yang bukan dirinya atau tidak realistis. Dapat dikatakan remaja tersebut telah kehilangan jati dirinya atau memiliki konsep diri yang rendah, sehingga mereka tidak mampu menempatkan dirinya secara realistis dan tidak dapat memahami keadaan diri sebagaimana adanya. Tujuan penelitian adalah untuk: (1) mengetahui tingkat fanatisme siswa SMAN 3 Malang terhadap idola, (2) mengetahui tingkat konsep diri siswa SMAN 3 Malang, dan (3) untuk mengetahui hubungan antara fanatisme idola dengan konsep diri siswa SMAN 3 Malang. Rancangan penelitian yang digunakan adalah deskriptif korelasional, dengan populasi penelitian adalah siswa SMAN 3Malang kelas X dan XI. Teknik pengambilan sampel menggunakan random sampling. Pengumpulan data menggunakan instrumen inventori, data dianalisis dengan menggunakan teknik korelasi product moment dari Pearson. Hasil penelitian menunjukkan bahwa secara umum siswa memiliki tingkat fanatisme terhadap idola yang rendah dengan prosentase 78,63% .Adapun dalam kategori lainnya yaitu siswa yang memiliki tingkat fanatisme yang tinggi terhadap idola dengan persentase 21,37%, sedangkan dalam kategori sangat tinggi dan sangat rendah memiliki persentase yang sama yaitu 0 % atau tidak ada siswa yang memiliki tingkat fanatisme dalam klasifikasi tersebut. Secara umum siswa kelas X dan XI SMAN 3 Malang memiliki tingkat konsep diri yang tergolong dalam kategori tinggi dengan persentase 73,50%, sedangkan dalam kategori sangat tinggi dengan persentase 16,24%, kemudian dalam kategori rendah memperoleh persentase 10,26%. Namun tidak terlihat adanya siswa yang memiliki tingkat konsep diri yang sangat rendah. Berdasarkan hasil penelitian dengan menggunakan program komputer SPSS diketahui bahwa r hitung lebih besar daripada r tabel yaitu -0,545 > 0,180. Dengan demikian dapat dijelaskan bahwa H1 diterima secara signifikan. Hal ini menunjukkan bahwa ada hubungan negatif yang signifikan antara fanatisme terhadap idola dengan konsep diri siswa kelas X dan XI SMAN 3 Malang. Berdasarkan hasil penelitian ini, dapat disarankan ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang rendah dan konsep diri tinggi hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengembangan, misalnya layanan informasi. Sebaliknya, ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang tinggi dan konsep diri rendah hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengentasan, diantaranya memberikan layananan informasi, bimbingan dan konseling kelompok, konferensi kasus dan home visit.

Penerapan model pembelajaran learning cycle 5 E berbantuan media pembelajaran komputer untuk meningkatkan hasil belajar kimia pada materi pokok larutan elektrolit dan non elektrolit siswa kelas X SMAN 3 Malang / Uliyatid Dayyinati

 

ABSTRAK Dayyinati, Uliyatid. 2009. Penerapan Model Pembelajaran Learning Cycle 5 E Berbantuan Media Komputer untuk Meningkatkan Hasil Belajar Kimia pada Materi Pokok Larutan Elektrolit dan Non Elektrolit Siswa Kelas X MAN 3 Malang. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Dosen Pembimbing: (I) Drs. I Wayan Dasna, M.Si., M.Ed., Ph.D. (II) Drs. Mahmudi M.Si. Kata kunci: learning cycle, media pembelajaran komputer, konsep mikroskopis, larutan elektrolit dan non elektrolit, hasil belajar kimia Pembelajaran kimia mencakup pemahaman konsep secara mikroskopis dan makroskopis. Berdasarkan penelitian, pemahaman siswa belum optimal dalam penggambaran mikroskopis materi elektrolit dan non elektrolit. Pada kegiatan pembelajaran, konsep yang abstrak tersebut memerlukan media yang dapat membantu pemahaman siswa. Konsekuensi penerapan KTSP adalah pembelajaran berdasarkan pandangan konstruktivisme. Penelitian ini mengkaji penerapan model learning cycle 5 E berbantuan media komputer dengan tujuan penelitian (1) mengetahui perbedaan hasil belajar siswa yang dibelajarkan dengan model learning cycle 5 E berbantuan media komputer dibandingkan siswa yang dibelajarkan dengan model learning cycle 5 E tanpa bantuan media komputer, (2) mengetahui pemahaman siswa yang dibelajarkan dengan model learning cycle 5 E berbantuan media komputer dibandingkan pada siswa yang dibelajarkan dengan model learning cycle 5 E tanpa bantuan media komputer pada konsep mikroskopis larutan elektrolit dan non elektrolit, dan (3) mengetahui tanggapan siswa terhadap pembelajaran yang menerapkan model learning cycle 5 E berbantuan media komputer. Pada penelitian ini digunakan rancangan penelitian eksperimen semu yang melibatkan satu kelas kontrol dan satu kelas eksperimen. Populasi penelitian adalah siswa kelas X MAN 3 Malang dengan sampel dua kelas dari kelas X. Kelompok kontrol adalah kelas X-D dengan jumlah 36 siswa dan kelas eksperimen adalah kelas X-C 36 siswa. Instrumen yang digunakan diantaranya instrumen perlakuan berupa silabus, rencana pembelajaran dan lembar kerja siswa dan instrumen pengukuran hasil perlakuan berupa tes, lembar observasi dan angket tanggapan siswa terhadap pembelajaran yang menerapkan model learning cycle 5 E berbantuan media komputer. Data yang diperoleh dianalisis dengan tenik inferensial komparasi menggunakan uji-t. Cara menganalisis data dapat dibedakan menjadi dua yaitu analisis data statistik pada data nilai tes kognitif dan analisis data deskriptif pada data nilai angket dan lembar observasi kelas. Berdasarkan dari nilai uji-t, tidak terdapat perbedaan prestasi belajar yang signifikan antara siswa yang dibelajarkan dengan model learning cycle 5 E berbantuan media komputer dengan siswa yang dibelajarkan dengan model pembelajaran learning cycle 5 E (nilai Sig. (0,726) > 0,05. dan thitung (0,352) < ttabel (1,994)). Nilai rata – rata hasil belajar kelompok kontrol 76,4 dan kelompok eksperimen sebesar 77,2. Tidak terdapat perbedaan hasil belajar ini disebabkan pembelajaran yang menerapkan model pembelajaran learning cycle 5 E berbantuan media komputer mirip dengan pembelajaran yang menggunakan model pembelajaran learning cycle 5 E tanpa bantuan komputer dan penerapan model pembelajaran learning cycle 5E telah memfasilitasi siswa untuk belajar dan membangun pengetahuannya sendiri. Namun, pemahaman konsep mikroskopis larutan elektrolit dan non elektrolit pada siswa kelas eksperimen lebih tinggi dibandingkan pada siswa kelas kontrol. Berdasarkan hasil angket, siswa memberi-kan respon sangat positif terhadap penerapan model pembelajaran learning cycle 5 E berbantuan media pembelajaran komputer yakni 80,1% . Rata-rata hasil penilaian media oleh siswa sebesar 82,5% dengan kriteria layak. Artinya penggunaan media ini efektif dalam meningkatkan motivasi dan hasil belajar siswa. Hal ini dapat dilihat dari nilai kuis, nilai afektif dan psikomotor siswa kelas eksperimen lebih tinggi daripada kelas kontrol.

Pengembangan komik pembelajaran sebagai alternatif media pembelajaran sains kelas III di SDN 2 Gladag Kabupaten Banyuwangi / Fuad Muttaqin

 

ABSTRAK Muttaqin, Fuad. 2009. Pengembangan Komik Pembelajaran sebagai Alternatif Media Pembelajaran Sains Kelas III di SDN 2 Gladag Kabupaten Banyuwangi. Skripsi, Jurusan Teknologi pendidikan FIP Universitas Negeri Malang. Pembimbing: (I) Dr. Imanuel Hitipeuw, M.A. (II) Dr. Anselmus J.E. Toenlioe, M.Pd. Kata Kunci: komik, pembelajaran sains, pengembangan media, hasil belajar. Pengembangan ini bertujuan untuk mengetahui keefektifan pengembangan komik pembelajaran sebagai alternatif media dalam pembelajaran sains kelas III di SDN 2 Gladag. Acuan materi yang digunakan adalah Sains pokok bahasan makhluk hidup, dengan sub pokok bahasan cir-ciri makhluk hidup. Metode pengembangan yang digunakan adalah modifikasi prosedur pengembangan media pendidikan Sadiman dengan langkah-langkah yaitu identifikasi kebutuhan, perumusan tujuan, pengembangan materi, perumusan alat pengukur keberhasilan, proses produksi pengembangan media komik, evaluasi, revisi, dan media siap untuk digunakan dalam pembelajaran. Untuk mengetahui keefektifan media komik terhadap pembelajaran sains, maka dilakukan analisis berdasarkan data uji coba dengan menggunakan rumusan presentase. Sedangkan untuk mengetahui keefektifan media komik terhadap hasil belajar, maka dilakukan pretest dan post tes dan dihitung rata-ratanya. Sementara itu, untuk melengkapi data angket dan tes, maka pengembang melakukan wawancara dan observasi. Hasil uji coba kelayakan pengembagan media komik pada ahli pembelajaran menunjukkan hasil 92,5% dengan kriteria valid. Data hasil uji coba kelayakan pengembagan media komik pada ahli media menunjukkan hasil 90,2% dengan kriteria valid. Sedangkan, data hasil uji coba kelompok kecil terhadap kelayakan pengembagan media komik pada siswa menunjukkan hasil 85% dengan kriteria valid. Sementara itu, hasil uji coba kelompok kecil untuk rata-rata kelas pada post test mencapai nilai 70 lebih tinggi dari nilai rata-rata pre test yaitu 55. Sedangkan hasil uji coba lapangan untuk rata-rata kelas pada post test mencapai nilai 82,5 lebih tinggi dari nilai rata-rata pre test yaitu 68,5. Berdasarkan hasil tersebut, dapat disimpulkan bahwa media komik yang dikembangkan sesuai dan layak diterapkan di SDN 2 Gladag Kabupaten Banyuwangi. Peneliti menyarankan agar komik pembelajaran dapat diterapkan tidak hanya pada matapelajaran sains, tetapi juga pada matapelajaran lain. Khususnya matapelajaran yang dianggap sulit oleh siswa.

Survei tentang tingkat kapasitas oksigen maksimal (VO2maks) wasit sepakbola Pengcab PSSI Gresik ditinjau dari tingkat lisensi dan usia / Fajar Nurfitranto

 

Perkembangan sepakbola masa kini sangat populer dan digemari di seluruh dunia tetapi sekarang sepakbola tidak hanya dipengaruhi oleh kualitas teknik dan permainan suatu tim sepakbola, tetapi juga dipengaruhi oleh beberapa faktor seperti kualitas wasit sebagai pemimpin pertandingan yang baik. Seorang wasit sepakbola harus mampu menguasai peraturan permainan dan memiliki keterampilan perwasitan yang baik dan mengerti penerapannya di lapangan. Wasit sepakbola itu sendiri berdasarkan lisensi yang mereka punya terbagi menjadi tiga yaitu C1, C2, dan C3 dengan usia yang bervariasi antara 21-48 tahun. Selain harus mampu menguasai peraturan permainan, wasit sepakbola juga harus memiliki kondisi fisik atau kesegaran jasmani yang baik sebagai salah satu sarat untuk dapat mencapai kesuksesan dalam memimpin pertandingan. Komponen kondisi fisik yang penting adalah kesegaran jasmani seorang wasit dalam hal ini adalah tingginya konsumsi oksigen maksimal atau biasa disebut dengan VO2 maks. Walaupun VO2 maks bukan satu-satunya, namun hal ini nampaknya kurang disadari dan cenderung diabaikan. Penelitian ini ingin mengungkap tingkat VO2 maks wasit sepakbola pengcab PSSI Gresik agar dalam memimpin suatu pertandingan tidak ada kendala dan bisa berjalan dengan lancar sampai akhir pertandingan. Penelitian ini merupakan penelitian deskriptif kuantitatif dengan subyek 28 wasit. Subyek dalam penelitian ini diambil dari wasit sepakbola Pengcab PSSI Gresik yang aktif dalam kompetisi di cabang sampai nasional, sedangkan pengumpulan data dilakukan dengan tes lari multitahap yang dikonversi pada tabel prediksi VO2 maks serta di kategorikan berdasarkan lisensi dan usia. Berdasarkan hasil penelitian menunjukkan rata-rata VO2 maks wasit sepakbola pengcab PSSI Gresik keseluruhan dalam kondisi sedang dengan rata-rata sebesar 35,4 ml/kg/min. Sedangkan rata-rata VO2 maks menurut lisensi juga dalam kodisi sedang yang terdiri dari lisensi C1 sebesar 33,5 ml/kg/min, lisensi C2 sebesar 37,7 ml/kg/mnt, dan lisensi C3 sebesar 32,9 ml/kg/mnt. Sedangkan rata-rata VO2 maks menurut usia dalam kondisi sedang yang terdiri dari usia 21-29 tahun sebesar 38,2 ml/kg/mnt, usia 30-39 tahun sebesar 33,4 ml/kg/mnt, dan usia 40-49 tahun sebesar 30,7 ml/kg/mnt. Oleh karena itu disarankan kepada komisi wasit pengcab PSSI Gresik agar mengetahui kesegaran jasmani anak didiknya sebagai kelayakan menjadi seorang wasit sepakbola dan untuk meningkatkan VO2 maks para wasit sehingga dapat mencapai standar VO2 maks pemain sepakbola atau minimal mencapai standar VO2 maks untuk wasit sepakbola.

Efektivitas penerapan pembelajaran metode problem posing-STAD terhadap prestasi belajar dan motivasi belajar fisika siswa SMP Negeri 8 Malang / Nor Eka Fitrianti

 

ABSTRAK Fitrianti, Nor Eka. 2009. Efektivitas Penerapan Pembelajaran Metode Problem Posing-STAD Terhadap Prestasi Belajar dan Motivasi Belajar Fisika Siswa SMP Negeri 8 Malang. Skripsi, Jurusan Fisika FMIPA, Universitas Negeri Malang. Pembimbing: (I) Drs. Mudjihartono, (II) Drs.Sumarjono. Kata Kunci: metode Problem Posing-STAD, prestasi belajar, motivasi belajar. Pembelajaran kooperatif adalah metode pembelajaran yang cukup efektif untuk meningkatkan motivasi maupun prestasi belajar siswa. Salah satu model pembelajaran kooperatif yang paling sederhana yaitu STAD. Model pembelajaran ini dipadukan metode Problem Posing, yang dalam proses kegiatannya memba-ngun struktur kognitif siswa dalam rangka siswa merumuskan (membuat) soal. Pada penelitian terdahulu didapatkan kesimpulan bahwa hasil belajar pada kelom-pok yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada hasil belajar kelompok yang pembelajarannya menggunakan meto-de tanpa Problem Posing-STAD. Akan tetapi, jumlah pertemuan pada kelompok eksperimen dan kelompok kontrol berbeda, selain itu juga variabel yang diukur hanya pada hasil belajar. Oleh sebab itu, dilakukan penelitian serupa dengan jum-lah pertemuan pada kedua kelompok disamakan karena yang membedakan peneli-tian seharusnya hanya pada metode dan rencana pembelajaran. Sedangkan varia-bel terikat yang diukur tidak hanya hasil atau prestasi belajar, tetapi juga motivasi belajar karena motivasi belajar mempengaruhi tinggi rendahnya keterlibatan siswa dalam kegiatan akademik dan hasil kegiatan belajar yang merupakan faktor ter-penting bagi prestasi siswa. Penelitian ini dilaksanakan pada semester 1 tahun ajaran 2008/ 2009 yaitu pada bulan Desember, bertempat di SMP Negeri 8 Malang. Penelitian ini bertuju-an untuk yaitu:1) mengetahui apakah prestasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada siswa yang pembelajarannya menggunakan metode ceramah, 2) mengetahui apakah motivasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada siswa yang pembelajarannya menggunakan metode ceramah. Rancangan penelitian yaitu dengan tipe perbandingan kelompok statis. Populasi penelitian yaitu siswa SMP Negeri 8 Malang. Teknik pengambilan sampel yaitu dengan cara purposive sampling. Sedangkan sampelnya yaitu kelas VIII C sebagai kelompok eksperimen diberi perlakuan metode Problem Posing-STAD dan VIII D sebagai kelompok kontrol diberi perlakuan metode ceramah. Pengumpulan data dilakukan dengan menggunakan tes prestasi belajar, tes motivasi belajar dan lem-bar pengamatan. Dari hasil analisis data uji hipotesis disimpulkan bahwa prestasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD sama dengan siswa yang pembelajarannya menggunakan metode ceramah, akan tetapi motivasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada siswa yang pembelajarannya menggunakan metode ceramah. Sehingga pembelajaran dengan metode Problem Posing-STAD dapat digunakan dalam pembelajaran untuk meningkatkan motivasi belajar siswa.

Marhaenisme (analisa terhadap pemikiran Soekarno) / Firmansyah

 

Ciri pokok hubungan kolonial pada dasarnya berpangkal pada prinsip dominasi, eksploitasi, diskriminasi dan dependensi. Ciri tersebut tidak lepas dari semangat kolonialisme dan imperialisme yang pada dasarnya merupakan proses ekspansi bangsa-bangsa Eropa untuk mendapatkan bahan- bahan (rempah- rempah dan produksi tropis), yang pada waktu itu sedang menjadi komoditi penting di pasar Eropa. Inilah babak baru dari proses interaksi para pelaku sejarah yang menggoreskan warna-warni sejarah dalam suatu zaman yang penuh dengan pergeseran nilai-nilai. Kita sadar atau tidak, pergeseran nilai itu terasa dan terlihat sampai detik ini.

Penerapan metode simulasi untuk meningkatkan aktivitas dan hasil belajar biologi pokok bahasan ekosistem pada siswa kelas X SMA negeri 1 Pakong Pamekasan Madura / Misli Mulyadi

 

Penelitian ini dilatar belakangi oleh skor nilai rata-rata yang didapat siswa kelas I SDN karangsentul I dalam meningkatkan kemampuan menulis permulaan melalui media kartu huruf yang hanya mencapai nilai 5,8. Hal ini disebabkan karena kurangnya minat siswa terhadap kemampuan menulis permulaan dan metode yang digunakan oleh guru dalam menyampaikan materi pembelajaran tidak sesuai serta cenderung masih menggunakan metode ceramah sehingga aktiftas siswa kurang dan siswa hanya sebagai pendengar saja. Dalam penelitian ini, peneliti mencoba menerapkan penggunaan media kartu huruf dengan tujuan: (1) Untuk meningkatkan hasil belajar siswa kelas 1 di SDN karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan, (2) Untuk mendiskripsikan media kartu huruf dapat meningkatkan kemampuan menulis permulaan di kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan. Jenis penelitian yang dilakukan adalah Penelitian Tindakan Kelas (PTK). Subjek penelitian adalah siswa kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan dengan jumlah 50 siswa. Adapaun pelaksanaan penelitian dilakukan sebanyak 2 siklus setiap siklus terdiri dari: (1) Penggunaan kartu huruf dalam pembelajaran menulis permulaan, (2) Hasil belajar dalam pembelajaran menulis, (3) Hasil analisa dan, (4) Refleksi. Hasil penelitian menunjukkan bahwa dengan penggunaan kartu huruf diperoleh pra tindakan 5,8, siklus I diperoleh nilai 74, siklus II diperoleh nilai 92: (1) Hasil belajar siswa dalam penggunaan kartu huruf meningkat ditandai dengan peningkatan aktifitas siswa dalam kerja kelompok, berani dalam mengutarakan pendapat dan dapat menyelesaikan masalah, (2) Siswa dalam penguasaan menggunaan kartu huruf meningkat terbukti diperolehnya skor bila rata-rata kelas mencapai 92. Kendala dalam menggunakan media kartu huruf: Tidak adanya media pembelajaran, daya ingat siswa yang berbeda-beda, latar belakang sosial ekonomi orang tua yang berbeda, cara penyampaian materi dan guru ke siswa yang hanya teori saja tidak menggunakan media pembelajaran. Di sarankan kepada guru untuk membiasakan menerapkan penggunaan kartu huruf dalam meningkatkan kemampuan menulis permulaan. Guru perlu memperhatikan hal-hal yang mendukung peningkatan hasil belajar dan aktifitas belajar. Kepada Kepala Sekolah agar dapat menyediakan yang diperlukan dalam penggunaan kartu huruf.

Perbedaan self esteem antara remaja yang tinggal di panti asuhan dan remaja yang tinggal bersama keluarga di Kecamatan Mojoroto Kediri / Dita Widyawati

 

Penelitian ini bertujuan untuk mengetahui (1) bagaimana gambaran self esteem remaja yang tinggal di panti asuhan, (2) bagaimana gambaran self esteem remaja yang tinggal bersama keluarga, (3) perbedaan self esteem antara remaja yang tinggal di panti asuhan dan remaja yang tinggal bersama keluarga. Rancangan yang digunakan dalam penelitian ini adalah deskriptif komparatif. Populasi penelitian adalah seluruh remaja yang bertempat tinggal di panti asuhan Kecamatan Mojoroto Kediri. Sampel dalam penelitian ini adalah 30 orang siswa yang tinggal di panti asuhan. Adapun pengambilan sampel dengan purposive sampling. Analisis penelitian menggunakan Chi Square. Hasil penelitian ini menunjukkan bahwa sebanyak 17 orang atau 56,67% remaja yang tinggal dalam panti asuhan memiliki self esteem sedang dan sebanyak 16 orang atau 53,33 % remaja yang tinggal bersama keluarga memiliki self esteem tinggi. Terdapat perbedaan self esteem antara remaja yang tinggal di panti asuhan dan remaja yang tinggal bersama keluarga ( hitung = 36,67 > tabel = 36,415). Berdasarkan hasil penelitian disarankan kepada: (1) para pengasuh di panti asuhan mengajak berdiskusi menyampaikan perasaan, pikiran, permasalahan yang sedang dihadapi dan membantu dalam penyelesaian masalah sehingga anak asuh akan mengembangkan perasaan bahwa dirinya berarti, (2) remaja yang tinggal di panti asuhan melihat gambaran diri secara keseluruhan dengan meminta masukan bersifat positif dari teman dan pengasuh di panti asuhan sehingga akan menimbulkan perasaan bangga, (3) pihak sekolah mendorong dan memberi kesempatan kepada siswa yang tinggal di panti asuhan untuk mencapai prestasi sehingga dapat meningkatkan self esteem, (4) peneliti selanjutnya dapat meneliti variabel-variabel lain yang berhubungan dengan self esteem.

Studi kelayakan tentang bengkel/workshop bangunan pada SMK di Kota Malang ditinjau dari peralatannya sebagai tempat uji kompetensi / Isa Rosidin

 

mengetahuai ketersediaan, kondisi, pengaturan penyimpanan, dan perawatan alat-alat pada bengkel/workshop bangunan SMK di kota Malang sebagai Tempat Uji Kompetensi. Rancangan penelitian ini menggunakan rancangan Survey, dengan subyek penelitian adalah 6 bengkel/workshop bangunan pada 3 SMK di Kota Malang yaitu SMK N 6 Malang, SMK Nasional dan SMK PU. Instrumen pengumpulan data menggunakan cheklist yang mengacu pada Pedoman Pelaksanaan Uji Kompetensi (PPUK). Analisis data yang digunakan adalah teknik diskriptif dengan menggunakan prosentase untuk menggambarkan tingkat kelayakan bengkel/workshop bangunan di Kota Malang ditinjau dari peralatannya sebagai Tempat Uji Kompetensi. Kesimpulan dari penelitian ini menunjukkan bahwa:(1) ketersediaan alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 83,333% layak digunakan sebagai Tempat Uji Kompetensi, sedangkan yang lainnya yaitu 16,667% tidak layak digunakan sebagai Tempat Uji Kompetensi (2) kondisi alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 100 % adalah layak digunakan sebagai Tempat Uji Kompetensi. (3) Pengaturan Penyimpanan alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 100% layak digunakan sebagai Tempat Uji Kompetensi (4) Perawatan alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 100% layak digunakan sebagai Tempat Uji Kompetensi. Sehingga, walaupun demikian untuk menunjang keberhasilan pembelajaran di masa yang akan datang, kelayakan peralatan harus ditingkatkan sesuai dengan perkembangan dan kemajuan teknologi.

Survei tentang daya tahan kardiovaskuler (VO2maks) dan kelincahan pada tim bolabasket putri porprov Kabupaten Malang tahun 2009 / Aulia Perwira Sari

 

Hubungan pola asuh authoritative orang tua dengan secure attachment anak prasekolah / Nasliyatul Ula

 

Anak yang baru mengenal sekolah atau anak yang memasuki peralihan jenjang, misalnya dari play group ke TK atau dari TK ke SD biasanya rewel dan menangis sehingga ibu atau pengasuhnya harus selalu terlihat oleh sang anak. Pada umumnya problem tersebut dialami oleh anak-anak ketika mereka menghadapi situasi, lingkungan, atau orang yang baru. Sikap orang tua yang terlalu melindungi anak serta kasih sayang berlebih yang ditunjukkan oleh orang tua pada anak (terutama ibu) dapat menyebabkan berkembangnya ketergantungan emosional pada anak, sehingga anak merasa kurang aman dan gelisah saat menghadapi situasi atau lingkungan baru. Orang tua yang mengasuh anak dengan intensitas komunikasi yang tinggi, akan membuat anak merasa diperhatikan, dihargai serta dapat menumbuhkan keyakinan terhadap penerimaan lingkungannya. Ketika anak merasa yakin dengan penerimaan lingkungan, anak akan mengembangkan secure attachment dan akan mengembangkan rasa percaya tidak saja pada orang tua (khususnya ibu) tapi juga pada lingkungannya, sehingga ini akan berdampak positif untuk perkembangannya. Penelitian ini bertujuan untuk: (1) mengetahui gambaran pola asuh authoritative orang tua, (2) mengetahui gambaran secure attachment anak prasekolah, (3) mengetahui apakah ada hubungan pola asuh authoritative orang tua dan secure attachment anak prasekolah. Penelitian ini menggunakan rancangan penelitian deskriptif dan korelasional. Penelitian ini dilakukan di TK Pancamurni Al-Usman Kertosono. Subyek dalam penelitian ini adalah ibu dari anak prasekolah yang tercatat sebagai siswa TK Pancamurni Al-Usman Kertosono, yang berjumlah 153 orang. Pengambilan sampel dilakukan menggunakan teknik purposive insidental sampling, sejumlah 40 orang. Data pola asuh authoritative dikumpulkan dengan instrumen skala pola asuh authoritative, yang memiliki reliabilitas (α) 0,876 dan data secure attachment dikumpulkan dengan instrumen skala secure attachment, yang memiliki reliabilitas (α) 0,827. Teknik analisis data yang digunakan adalah teknik persentase dan teknik korelasi. Hasil analisis data menggunakan teknik persentase menunjukkan, sebagian besar subyek merupakan orang tua authoritative dalam klasifikasi sedang (sebanyak 70%) dan sebagian besar orang tua memiliki anak prasekolah dengan secure attachment dalam klasifikasi sedang (sebanyak 67,5%). Pengujian hipotesis dalam penelitian ini menggunakan product moment pearson (taraf signifikansi 5%), dan diperoleh koefisien r sebesar 0,276 (p>0,05), yang berarti tidak signifikan. Berdasarkan uji hipotesis tersebut, dapat dikatakan bahwa tidak ada hubungan pola asuh authoritative orang tua dengan secure attachment anak prasekolah. i Bagi orang tua diharapkan menunjukkan kasih sayang, kehangatan, kepedulian pada anak prasekolah, disamping mendorong untuk mandiri agar anak prasekolah dapat mengembangkan kelekatan pada orang tua dan memiliki rasa aman dalam mengeksplorasi lingkungannya. Bagi peneliti selanjutnya yang ingin mengembangkan penelitian tentang secure attachment hendaknya memperhatikan faktor lain yang diduga memberi kontribusi lebih terhadap secure attachment anak selain pola asuh authoritative, seperti temperamen, adanya figur lekat selain orang tua (teman sebaya dan guru), suasana dalam keluarga, serta menambah instrumen penelitian berupa observasi, wawancara dan dokumentasi, sehingga diharapkan data yang diperoleh lebih baik dan akurat.

Pengembangan paket IPA terpadu dengan tema pestisida untuk siswa kelas VII semester 2 di SMP Negeri 1 Wajak Kabupaten Malang / Amalia Marianti

 

ABSTRAK Marianti, Amalia. 2009. Pengembangan Paket IPA Terpadu Tema Pestisida di SMP Negeri 1 Wajak. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Eddy Supramono, (II) Drs. Triastono Imam P., M.Pd Kata kunci : Paket Pembelajaran, IPA Terpadu, Pestisida Dalam Peraturan Menteri Pendidikan Nasional nomor 22 Tahun 2006 menyatakan bahwa substansi mata pelajaran IPA di SMP/MTs merupakan IPA Terpadu. Tetapi pembelajaran di SMP Negeri 1 Wajak belum melaksanakan pembelajaran IPA secara terpadu dan masih terpisahpisah antara fisika, kimia, dan biologi. Salah satu cara untuk mengatasinya yaitu dengan mengembangkan bahan ajar yaitu paket pembelajaran IPA terpadu dalam melaksanakan pembelajaran IPA terpadu. Tujuan dari pengembangan paket pembelajara IPA terpadu ini adalah untuk mengetahui kelayakan paket pembelajaran IPA terpadu dengan tema pestisida untuk siswa kelas VII di SMP Negeri 1 Wajak dan panduan pelaksanaan untuk guru. Metode pengembangan yang digunakan pada penelitian ini menggunakan model yang disarankan Gall dan Brog, yaitu: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal produk, (4) penilaian produk, (5) revisi produk. Instrument yang digunakan dalam penelitian ini berupa angket/kuesioner kelayakan untuk para penilai. Jenis data adalah kuantitatif dan kualitatif. Data kuantitatif diperoleh dari nilai rata-rata kuesioner, sedangkan data kualitatif berupa tanggapan, saran, dan kritik dari dua orang dosen dan dua orang guru IPA SMP Negeri 1 Wajak selaku penilai atau evaluator. Berdasarkan uji kelayakan, paket IPA terpadu diperoleh skor ratarata 3,56 dengan persentase 89%, sedangkan untuk panduan pelaksanaan diperoleh skor rata-rata 3,58 dengan persentase 89,37%. Semua itu artinya bahwa paket IPA terpadu layak untuk digunakan. Paket Pembelajaran ini mempunyai kelebihan, yaitu: (a)Produk yang dihasilkan sesuai dengan KTSP, (b)memadukan materi fisika, kimia, dan biologi, (c)dilengkapi dengan panduan guru sehingga memudahkan guru untuk melaksanakan pembelajaran, (d)Berisi kegitan-kegiatan siswa berbasis kerja ilmiah, (e)evaluasi berlangsung dalam konteks yang alami, kolaboratif, dan berorientasi pada perkembangan intelektual siswa serta lingkungannya. Dalam pelaksanaan penelitian pengembangan ini disarankan agar dilakukan penelitian lebih lanjut terhadap paket IPA terpadu untuk mengetahui tingkat efektifitas dan efisiensi. Pengembangan paket pembelajaran IPA terpadu dan panduan pelaksanaan pembelajaran dapat dilakukan dengan mengambil tema yang berbeda-beda.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 |