Pengaruh Persepsi Anggota tentang tatalaksana Usaha KUD Terhadap Partisipasi Anggota Di Bidang Usaha Pada KUD "Sari Bumi" Bululawang Malang Oleh Widyamah

 

KUD adalahb entukk operasyi angb ersifatm ultipurposeH. inggak ini bentuk usahay angd isebust ebagasio kog urup erekonomianna sionainl i masihs edikit kontribusinydaa lamp embangunaenk onomni asionajilk a dibandingkadne ngan bentuku sahala innyaK. ondisis emacamin i ter1adki arenap artisipasain ggota tergolongre ndah.S alahs atub entukp artisipasai nggotad i koperasai dalahp artisipasi di bidangu saha. Faktory angd idugad apatm empengaruhpia rtisipasai nggotad i bidangu saha salahs atunyaa dalahb agaimanakaphe rsepsai nggotate ntangta talaksanuas ahaO. leh karenait u penelitianin i bertujuanu ntukm engetahupi engaruhp ersepsai nggota tentangta talaksanuas ahate rhadapa rtisipasain ggotad i bidangu saha. Penelitianin i dilaksanakadni KUD "SARI BUMI" Bululawanmg alang. RancangaPne nelitiayna ngd igunakaand alahp enelitiand eskriptif-korelasional (sebaba kibat)d enganm enggunakaann alisisd eskriptifdanre gresgi andaA. dapun penggaliadna tap enelitiand ilakukanm elaluis ebaraann gkette rhadapjurnlasha mpel penelitians ebanya9k l respondedna njugam enggunakadna tad okumeny ang kemudiand iolah. Berdasarkahna silp enelitiand itemukanb ahwa( l) Sebanya6k4 ,g3% respondemn emilikip ersepsyi angp ctsitift entangt atalaksanau iaha sprR. dan sebanyak4 1,76%r espondemn emilikiperse psiy ang negattft entanEta4t aluksana usultut oserbu( 2) Sebanyak6 3,83%r espondenm emilikip urtisipaii tinggiid i bidang u.rahus impunp inlum (sPl'l?),d ans ebanyak3 5,16%r espondemn emlliii partrstpusi rendahd i bidungu sahat rserbu( 3) Atlu penguruhp ositt/'yangs ignifikuna ntaru persep'rui n!:gota! entungt atulaksanau sahat erhadapp artisipa.tinyatI i birtang usuhu,yaitud engand iperolehnyhaa silR 2= 0,g1430p. engaruhva riabeXl terhadap variabelY adalahs ignifikank arenan ilai F ni,*e) F e,b.yl,a ituF li,*e : 192,93791d an F,,&r:3,1Ip adad b2 lawan8 8,N :91, q,:5%. Besarnysau mbangraenl atixf 1: 74,48%s, umbangarne latifx 2: 25,52% dans umbangaenf ektifx , :3O,OSN, sumbangaenfb ktifx 2= 20,78%J. adid apatd isimpulkanb ahwas umbangavna riabel X1t erhadavpa riabeYl lebihb esadr aripadas umbangaXn2 . tsertitikto lakd arit emuanp enelitianin r,d iajukanb eberapsaa rany ang dapat dtyadikasnc bagapi ertirnbangabna gip engurudsa lamu payam eningkatkapna rtisipasi anggotdai bidangu sahato serbay,a itu( l) menambacha bangto serbate rutamad i rvilal'ahk erlaK UD yangp elosok(2 ) melengkapdia nm emviriasbi arang-barangyang dtjuald i toserbag unam emenuhkie butuhaann ggotab aiks ecarain dividuaml aupun bertindaske bagaaig enb agia nggotaya ngm embukau sahak ios/toko(3 ) mencrptakan kenyamanabne rbelanjaan ggotam elaluip enambahafans ilitasb idangto serbad an penataakne mbalri uangto serba(4 ) melakukapnr omossi ederhana'relalluisi an. pemasangapna mfletu ntukb arangy angb elump ernahd rjuald i toserbap,e mberian potongahna rgau ntukp ernbeliasne besanri lair upiaht ertentud, anm enyflenggarakan kuponb erhadiah.

Variasi metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek / Andi Asngari

 

ABSTRAK Asngari, Andi. 2009. Variasi Metode Pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek. Skripsi. Jurusan Hukum dan Kewarganegaraan Fakultas Ilmu Sosial (FIS) Universitas Negeri Malang (UM). Pembimbing: (1) Drs. H. A. Rosyid Al Atok M.Pd., M.H, (II) Siti Awaliyah, S.pd., M.Hum. Kata Kunci: Variasi Metode, Pembelajaran PKn Untuk mencapai hasil pendidikan maksimal sesuai target, maka diperlukan berbagai perencanaan pelaksanaan dan evaluasi terhadap kegiatan yang diselenggarakan dalam istitusi atau lembaga pendidikan. Masalah utama dalam pembelajaran Pendidikan Kewarganegaraan (PKn) ialah penggunaan metode atau model pembelajaran dalam menyampaikan materi pelajaran secara tepat, yang memenuhi muatan tatanan nilai, agar dapat diinternalisasikan pada diri siswa serta mengimplementasikan hakekat pendidikan nilai dalam kehidupan sehari-hari. Guru PKn mengajar lebih banyak mengejar target yang berorientasi pada nilai ujian akhir, di samping masih menggunakan model konvensional yang monoton, aktivitas guru lebih dominan daripada siswa, akibatnya guru seringkali mengabaikan proses pembinaan tatanan nilai, sikap, dan tindakan; sehingga mata pelajaran PKn tidak dianggap sebagai mata pelajaran pembinaan warga negara yang menekankan pada kesadaran akan hak dan kewajiban tetapi lebih cenderung menjadi mata pelajaran yang jenuh dan membosankan. Penelitian ini bertujuan untuk mengambarkan tentang variasi metode pembelajaran PKn di SMP negeri 1 Pule Kabupaten Trenggalek. Secara khusus penelitian ini bertujuan untuk mendeskripsikan: (1) metode pembelajaran yang dipakai dalam pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek, (2) faktor-faktor yang mendorong penggunaan berbagai metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek, (3) faktor-faktor yang menghambat penggunaan berbagai metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek, (4) upaya-upaya yang dilakukan guru untuk menciptakan variasi metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek. Penelitian ini menggunakan pendekatan kualitatif. Kegiatan pengumpulan data adalah obsevasi, yaitu pengamatan khusus dengan pencatatan yang sistematis, wawancara yaitu dengan melaksanakan Tanya jawab secara langsung dengan responden untuk memperoleh informasi yang diperlukan, dokumentasi yaitu dengan menelusuri, mengumpulkan informasi dan dokumen yang berkaitan dengan penulisan skripsi. Hasil penelitian ini menunjukkan bahwa metode pembelajaran yang dipakai guru dalam pembelajaran PKn di SMP Negeri 1 Pule kabupaten Trenggalek antara lain: metode ceramah, metode tanya jawab, metode diskusi, metode penugasan. Perumusan tujuan oleh guru biasanya lebih dari satu rumusan, oleh karena itu di dalam setiap proses pembelajaran guru selalu menggunakan kombinasi/variasi metode. Metode yang satu digunakan untuk mencapai tujuan yang satu, sementara metode yang lain, juga digunakan untuk mencapai tujuan yang lain, (1) metode ceramah, Tanya jawab dan tugas, (2) metode ceramah, diskusi dan tugas. Penggunaan berbagai metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek ditemukan adanya hambatan, yaitu: alasan guru, ketersediaan sarana dan prasarana, karakteristik siswa, karakteristik materi. Berdasarkan penelitian ini, dapat disarankan agar siswa selalu memperhatikan penyampaian pelajaran yang disampaikan oleh guru. Sehingga metode yang digunakan oleh guru dalam proses pembelajaran siswa dapat mengikuti dan mengerti tujuan pembelajaran yang ingin dicapai guru dalam proses pembelajaran.

Peranan Dispenda Dalam Upaya meningkatkan Pendapat Daerah Melalui Penerimaan PBB Di Kabupaten Situbondo Oleh Lindayanti

 

PBB rnerupakansu mbery angs angapt otensiadl alamp enerimaanka bupaten.Untuk itu perlu penanganayna ngs eriuso lehp emerintahd aerahD. ispendad alamh alini yangd iserahti ugaso lehp emerintahd aerahu ntukm enanganai tass emuapenerimaand aerahk hususnyaP BB.D is'pendam erupakanin stansyi angl angsungberadad i bawahd anb ertanggUng-jawakebp adak epalad aerahD. inasP endapatanDaerahin i mempunyapi eranany angs angapt entingk arenad i sampingm enanganisegalaje nis penerimaand aerahju ga diserahti ugasu ntukm empertinggpi endapatandaerah. Penelitianin i bertujuanu ntukm engetahutie ntangp erananD ispendad alarnmeningkatkapne ndapatadna erahm elaluip enerimaanP BB di KabupatenS itubondo, hambatany angd ialalrrid anu payam engatashi ambatante rsebutP. endekatayna ngdipakadi aiamp enelitianin i adalahp endekataknu alitatifdengamn enggunakanjenispeneiitians tudik asus.S umberd atad ipilih danl angsungd itentukanp ihaky angmenjadrin formany aitu bagiar.s ubd inasp enagihand anp ernbukuanse banyatki gaorangd ans ubd inzrsp erencanaapne ndapatasne banyadk uao rangd engana lasanbahrvain fonnani tu benar-benasru mbery angr nemiliki banyaki nlbrmasi,d apatdipercayad anv alid. Pengumpuladna tad ilakukand engano bservaswi awancara<,l an dokumentasUi. ntuk pengecekakne absahatne muand ilakukand enganp gngafr"tatan,triangulasir,e ferensyi angc ukup.U ntuk analisisd atam enggunakaann alisisd atan onstatistikdenganc arar eduksid ata,p enyajiand atad anr nenarikk esimpulan. Hasil p,cnelitianin i menunjukkanp eranany angd ilakukanD ispendaKabupatenS itubondod alamm eningkatkanp endapatadna erahd ari sektorp enerinraanPBB masihp erlu dioptimalkand enganm elakukanu payai ntensifikasdi anekstensifikaslil.a i ini dapatd ilihat dari peningkatanp endapatadna erahti aptahunnyaH. ambatan'hambatadna lamm eningkatkanp endapatadna erahm elaluiP BByaitu masalahte knisa ntarala in (i) sistemp endataa)n/ angb eluma icura(ti i)terbatasnyfaa silitasd ank apasitask erja( iii) kurangm antapnyas istemk omunikasidani nformasi( iv) sulitnyam enerapkasna nkspi adaw ajib pajak.H ambatany angbersifatr on-teknisa ntarala in (i) tingkatp ertumbuhaenk onomir akyat( ii) kurangsadamyam asyarakadta larnr nernbayapra jak( iii) keadaand an situasti ertentul.J paya.untukm engataspi erinasalahayna ngb ersifatt eknis( i) penyediaasna ranad anprasarankae ria( ii) kerjasamdaa nk oordinasyia ngb aika ntarin stans(ii ii) membentuk tim pencariatnu nggakaPnB B( iv) peningkatasnu mbedr ayar nanusiaU. payav angdilakukanu ntukr ne:rgatapsei mrasalahanno n"tekni(si) melakukapne nlruluhaPn! lil (ii) mensosiaiisasikaPnB B lewatr adio (iii) menerjunkanp etugasg abunganu ntukmengklarifikaspi ennasalahaPnB B di suatuw ilayah.Berdasarkapne neiitianin i, makad isarankana garD ispendate rusi ebih giatlagi dalaurm enjalanirapne rannyaa garm ampum eningkatkanp endapatadna etahsehinggpae rlua danyak erjasanlyaa .nglc bihb aikd enganle mbagate rkaitd anmasyarakat.

Model Pembelajaran Observasi Ke Industri Krupuk "YSN" Untuk Sub Pokok Bahasan Industri Pada Kelas II IPS 4 Semester I Tahun Pembelajaran 2003 / 2004 Di MAN 3 Kediri Oleh Marwah

 

Guru sangabt erperand alamm emperbaikpi rosesp embelajaranA' pa yangdialamiw aktum engajars angabt erhargad alamu saham emperbaikpi rosesp embelajaran.G uruh arusm ampum embuatm odelp embela.;arayna ngm empum enuntaskanbelajars iswa. Berdasarkanhasilpengamatandilapangan,hasitbelajardanaktivitasbelajarsiswadalam rosesp emblelajarang eografid alam mengtkuti prosesp embei";uiur-ru"gut purif, ut iuutny a laiangteiganaik etuntasanb elajar.U ntuk mengatasitratt ersebuidiperlukans uatu;odel-pembeiajalayl angm amp!-meningkatkaank -tivitas belajar sis*a dan mencapai kitunasan belajamya' Model pembelajaranyang dimaisud adalahm odel pembelajarano bservaski e indusri krupuk *YSN"'Penelitian tindakan keias ini birtu.luan untuk mendiskripsikan proses danhasilp enerapamn odelp embelajaraonb servaski e industrik rupuk"YSN"dalam upu'u -"ningtutkan keaktifan 6ehjar siswad an ketuntasanh asil belajarp adas iswatelas II IpS 4 MAN 3 Kediri. Pinelitian ini dilaksanakapna das emesteIr t ahunpembelaaj ran2003l2}04y, aitu padab u]anA gustus2 003' Subyekp enelitianadatafsr iswak elasI I IPS 4 MAN 3 kediri denganju mlah siswas ebanya4k 0 siswa.Datap enelitianb erupap enerapamn odelp embelajaryol bservaski e industrikrupuk..V'Sf,berupa; (f) Keaktifan6 slEal sisway angd ikumpulkand enganobservasoi leh seorango bsirver,( 2) Hasil belajars isway angd ikumpulkand engunp""iru*nakhirti-ndakan,dan(3)Kesenanganbelajarsiswayangdikumpul.kin denganm etodea ngket.D ataa ktivitasb elajars iswad ianalisisd enganc aramengkta"sifikasikadna n menarik kaitan-kaitana tauh ubungand ari semuad atayangt erkumpuls ehinggad iperolehs uatuk emantapanDatah asil trJltrljasri iwa menunjukknb ahwam odelp embelajaraonb servasik e industrik rupuf'YSN- dapatm enuntaskabne lajars iswak elasI I IPS4untukS ubP okokB ahasanIn dustri.N ilai tertinggiy angd iperolehs iswaa dalah9 5yaitu sebanyak1 orang( 2,5 o/o)S. iswap alingb anyakm empero-lenhil ai 80 yattui6 ,ir*u (4-0% ) Nilaiterendai yangd iperolehs iswaa dalah7 5 yaitu sebanyak8siswa( 20 %). Lainnyam emperolehn ilal 85 yaitu sebanyak9 siswaQ 2,5 o/o)d annilai 9b sebanyak6 siswa( l\ %). Datat entangk esenangabng lajars iswam enunjukkan28 siswa( 70 %) merasas angats €nang1, 2 siswa( 30%).merassae nang' Hasil analisisd atam enunjukkanb ahwa( 1) penerapamn odelp embelajaranobservaski e industrik rupuk';YSN" untuks ubp okokb ahasanin dustrid apatmeningkatkana ktivitasb elajars ,iswak elasI I IPS4 MAN 3 Kediri. (2) Penerapanmodepl embelajarano bservasik e industri krupuk "YSN" dapatm enun-taskanhlajar siswak elasI I IPS4 MAN 3 Kediri danm embuats iswam erasas enang.Berdasarkante muanp enelitiand apatd ikemukakans aran-saratne rutamakepadap arag uru geografi.G uru geografi dalam menyusuns trategip embelajarankhususnysau bp okok bahasanin dustri diusahakanb isa memanfaatkanli ngkunganberupain dustriu ntukt empatp embelajarasni swa.

Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema kendaraan bermotor untuk siswa kelas VIII semester II di SMP Negeri 2 Malang / Mu'minul Muhaimin

 

Peraturan Menteri Pendidikan Nasional Nomor 22 Tahun 2006 tentang Standar Isi secara tegas menyatakan bahwa subtansi mata pelajaran IPA pada SMP/MTs merupakan IPA Terpadu. Berdasarkan data penelitian yang diperoleh, kebutuhan guru IPA SMP di Malang Raya terhadap paket IPA Terpadu benarbenar mendesak. Oleh sebab itu sangat beralasan bahwa sebagian besar guru IPA ( 35 dari 37 orang atau 94,6%) menyatakan bahwa mereka membutuhkan paket IPA Terpadu untuk pembelajaran IPA SMP (Koes H., 2006: 32). Selain itu, hasil pangamatan di beberapa toko buku di kota dan Kabupaten Malang menunjukkan bahwa belum ditemukan buku IPA SMP yang dirancang secara terpadu. Berdasar-kan hal tersebut maka dikembangkan Paket IPA Terpadu yang dapat membantu pelaksanaan pembelajaran IPA Terpadu di SMP. Penelitian pengembangan ini bertujuan untuk mengetahui kelayakan Paket IPA Terpadu dengan tema Kendaraan bermotor dan Panduan Pelaksanaan Pembelajarannya di SMP Negeri 2 Malang. Penelitian ini merupakan penelitian pengembangan dengan langkahlangkah yang telah disesuaikan dengan kebutuhan peneliti, yaitu: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal, (4) uji lapangan awal, dan (5) revisi produk. Instrumen penelitian yang digunakan berupa angket uji kelayakan Paket IPA Terpadu dan Panduan Pelaksanaan Pembelajarannya. Data hasil uji kelayakan diperoleh dari tim penelaah. Data penelitian terdiri dari dua jenis, yaitu data kualitatif dan data kuantitatif. Data kualitatif berupa tanggapan, masukan, kritik dan saran dari tim penelaah, sedangkan data kuantitatif diperoleh dari tim penelaah dengan cara pengisian angket kriteria uji kelayakan. Data kuantitatif dianalisis dengan menggunakan nilai rata-rata. Hasil uji kelayakan dari tim penelaah menunjukkan bahwa paket pembelajaran yang dikembangkan layak digunakan dengan nilai ratarata untuk Paket IPA Terpadu adalah 3,56 dan nilai ratarata untuk Panduan Pelaksanaaan Pembelajarannya adalah 3,60, namun perlu adanya direvisi. Berdasarkan hasil penelitian ini disarankan untuk melakukan penelitian dan pengembangan lebih lanjut terhadap Paket IPA Terpadu dengan Tema Kendaraan bermotor. Penelitian lebih lanjut adalah dengan melakukan kajian eksperimen dan uji coba yang lebih luas, sehingga diperoleh paket dan panduan pelaksanaan yang teruji validitasnya secara empiris.

Perancangan film dokumenter arung jeram sungai Pekalen sebagai media publikasi oleh Nanang S.E.A.

 

Studi evaluasi pelaksanaan pertandingan tenis lapangan porprov Jawa Timur II tahun 2009 di kota Malang / Arief Darmawan

 

ABSTRAK Darmawan, Arief. 2010. Studi Evaluasi Pelaksanaan Pertandingan Tenis Lapangan PORPROV Jawa Timur II Tahun 2009 di Kota Malang. Skripsi, Jurusan Ilmu Keolahragaan Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (I) Drs. Heru Widijoto, M.S, (II) Dra. Sri Purnami M.Pd Kata Kunci: Evaluasi, Tenis Lapangan, PORPROV Evaluasi adalah suatu penilaian tentang cara membandingkan dan menilai untuk mengetahui tingkat keberhasilan suatu proyek atau even, berdasarkan evaluasi dalam pelaksanan Porprov Jawa Timur II tahun 2009 di kota Malang belum pernah ada evaluasi pelaksanaan pertandingan tenis lapangan PORPROV Jatim II di Kota Malang, untuk itu perlu diadakan evaluasi dalam pelaksanaan pertandingan tenis lapangan Porprov Jawa Timur II tahun 2009 di kota Malang. Penelitian ini bertujuan untuk melakukan evaluasi pelaksanaan pertandingan tenis lapangan PORPROV Jawa Timur II tahun 2009 yang baru pertama kali dilaksanakan di Kota Malang pada tanggal 5-10 Oktober 2009, subyek penelitian ini adalah atlet tenis lapangan dari 31 kota atau kabupaten peserta pertandingan tenis lapangan dengan jumlah 151 atlet, 10 orang wasit luar Kota, 5 orang wasit dalam Kota, 71 orang pelatih dan official, dan panitia pelaksana sebanyak 4 orang yang terdiri dari ketua pelaksana, sekretaris, bendahara dan ketua bidang pertandingan. Pengumpulan data ini dengan menggunakan angket tertutup yang jawaban sudah disediakan. Analisis data yang digunakan adalah analisis deskritif kuantitatif yang pengolahan datanya dipresentasekan. Hasil penelitian ditemukan bahwa pada pelaksanaan Porprov Jawa Timur II tahun 2009 di kota Malang yang terkait dengan layanan untuk atlet, wasit luar Kota, wasit dalam Kota, dan panitia pelaksana yang berhubungan dengan layanan akomodasi untuk atlet dengan persentase 72,78% yang termasuk kategori baik, sedangkan layanan akomodasi untuk wasit luar Kota dengan persentase 83,56% yang temasuk kategori baik sekali, pada layanan konsumsi untuk atlet dengan persentase 63,88% yang termasuk kategori baik, kemudian konsumsi untuk wasit luar Kota dengan persentase 84,67% yang termasuk kategori baik sekali, sedangkan konsumsi untuk wasit luar Kota dengan persentase 68% yang termasuk kategori baik, kemudian layanan transportasi untuk atlet dengan persentase 70,05% yang termasuk dalam kategori baik, layanan transportasi untuk wasit luar Kota dengan persentase 87,42% yang termasuk dalam kategori baik sekali, kemudian layanan kesehatan untuk atlet dengan persentase 69,80% yang termasuk dalam kategori baik, sedangkan layanan kesehatan untuk wasit luar Kota dengan persentase 89,14% yang termasuk dalam katergori baik sekali, layanan kesehatan untuk wasit dalam Kota dengan persentase 72% yang termasuk dalam katergori baik, kemudian layanan keamanan untuk atlet dengan persentase 69,55% yang termasuk dalam kategori baik, kemudian layanan kemanan untuk wasit luar Kota dengan persentase 86,33% yang termasuk dalam kategori baik sekali, layanan kemanan untuk wasit dalam Kota dengan persentase 68% yang termasuk dalam kategori baik kemudian bidang pertandingan untuk atlet dengan persentase 72,04% yang termasuk dalam kategori baik, sedangkan bidang pertandingan untuk wasit luar Kota dengan persentase 82,54% yang termasuk dalam kategori baik sekali, sedangkan bidang pertandingan untuk wasit dalam Kota dengan persentase 70,90% yang termasuk dalam kategori baik, sedangkan bidang pertandingan untuk panitia pelaksana dengan persentase 81,50% yang termasuk dalam kategori baik sekali, sedangkan bidang pertandingan untuk official dengan persentase 70,28% yang termasuk dalam kategori baik, kemudian bidang keuangan untuk wasit luar Kota dengan pesentase 62% yang termasuk dalam kategori baik, kemudian bidang keuangan untuk wasit dalam Kota dengan pesentase 56% yang termasuk dalam kategori cukup, sedangkan bidang keuangan untuk panpel dengan pesentase 60,00% yang termasuk dalam kategori baik. Bedasarkan hasil penelitian ini dapat disarankan agar bidang layanan pada penyelenggaraan PORPROV Jawa Timur II tahun 2009 di kota Malang untuk meningkatkan pelayanannya khususnya dalam layanan penginapan untuk atlet dan wasit, kemudian pada bidang keuangan untuk panpel, sehingga dalam pelaksanaan PORPROV tahun 2011 diharapakan untuk layanan akomodasi dan pada bidang keuangan diharapkan lebih ditingkatkan lagi.

Kesiapan Mental Mahasiswa Fakultas Ilmu Pendidikan Universitas Negeri Malang Untuk Berwirausaha Oleh Ika Murni Hidayati

 

Kewirausahaanm erupakans uatup rosesp encapaians esuatub erdasarkan semangat,s ikap, perilaku, dan kemampurn seseorangd alam menanganiu saha denganm eningka&an efisiensi supayat ercapaik esejahteraanin dividu ataupun nilai tambah bagi masyarakat. Dengan adanya akrualisasi jiwa kewirausahaan diharapkan mahasiswa mampu membaca lingkungan untuk membuka peluang usaha. Dalam mengembangkans ikap berwirausaha,m ahasiswad apat me,mbanguns ikap tersebutm elalui beberapaf aktor antaral ain; kemauank eras, pengambanganra sap ercayad iri, pengernbangans ikap kreatifdan inovatil pengembanganc ina diri yang positif, dan pengembangans ikapjujur dan tanggungjawab. Masalahy ang dikaji dalam penelitian ini adalah:b agaimanakahti ngkat kesiapanm ental kewirausahaanm ahasiswaF akultasI tnu PendidikanU niversitas Negeri Malang. Populasi penelitian ini adalah Mahasiswa FIP UM angkatan tahun 1998 - 2000 yang berjumlah 565 mahasisw4 terdiri dari 77 mahasiswa Jurusan BKP/BK, 99 mahasiswa Jurusan AP, 67 mahasiswa Jurusan TEP, 49 mahasiswa Jurusan PLS, 73 mahasiswa Jurusan PPKN, 36 mahasiswa Jurusan IK/IK 124 mahasiswa Jurusan PJKR/IK, dan 40 mahasiswa Jurusan PSIK/BKP. Sampel yang diambil berjumlah 234 mahasisway ang diteapkan berdasarkanT abel Krejcie. Pengumpulan data dilakukan dengan teknik angket. Teknik analisis data yang digunakana dalaht eknik persentaseu ntuk analisis disftritif menggunakan SPSS For Windows 97 Release 10.0. Berdasarkan hasil analisis data disimpulkan bahwa: kesiapan mental mahasiswa Fakultas Ilmu Pendidikan Untuk Berwirausaha termasuk dalam kriteria tinggi dalam tingkatan persentaseH. asil analisisp ersentasem enunjukkanb ahwad ari 234 mahasiswaa da 165m ahasiswa(7 0,5%)m enyatakanb aik dengams kor 53 - 68. Saran yang dapat dikemukakan dalam penelitian ini adalah mahasiswa hendaknyam empertahankand an meningkatkanp eneftpan pengembangans ikap berwirausaha sehingga motivasi berwirausaha mahasiswa menjadi lebih meningkat.

Kesusaian silabus yang dikembangkan oleh guru bahasa arab Madrasah Tsanawiyah se-kecamatan Donomulyo Kabupaten Malang dengan kurikulum inti / Deni Bayu Wijaya

 

ABSTRAK Bayu Wijaya, Deni. 2010. Kesesuaian Silabus yang Dikembangkan oleh Guru Bahasa Arab MTs se-Kecamatan Donomulyo Kabupaten Malang dengan Kurikulum Inti. Skripsi, Jurusan Sastra Arab Fakultas Sastra Universitas Negeri Malang. Pembimbing: Drs. M. Syatibi Nawawi M.Pd. Kata Kunci: kesesuaian silabus, guru Bahasa Arab, kurikulum inti. Silabus merupakan salah satu perangkat pembelajaran yang harus ada dan dikuasai oleh pendidik, terutama dalam pendidikan formal. Seiring dengan tuntutan profesionalisme guru dan berjalannya Kurikulum Tingkat Satuan Pendidikan maka guru juga harus mampu mengembangkannya. Kesesuaian silabus pelajaran Bahasa Arab yang dikembangkan guru-guru Bahasa Arab MTs di Kecamatan Donomulyo Kabupaten Malang diperoleh dari hasil penelitian di MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Penelitian ini bertujuan mendapatkan deskripsi kesesuaian format silabus, kesesuaian komponen silabus, dan kesesuaian isi silabus yang dikembangkan oleh guru-guru Bahasa Arab kelas VII, VIII, dan IX semester ganjil MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Rancangan penelitian yang digunakan ialah rancangan deskriptif, instrumen utama dalam penelitian ini adalah peneliti (human instrument) dilengkapi dengan dokumentasi dan wawancara sebagai instrumen pendukung, dan hasil penelitian ini diuraikan secara deskriptif. Dalam penelitian ini yang menjadi sumber data ialah kepala sekolah dan guru-guru Bahasa Arab MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Data yang digunakan ialah silabus kelas VII, VIII, dan IX MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Tahapan-tahapan analisis data terdiri atas pengumpulan data dan pemeriksaan kembali catatan lapangan, reduksi data, penyajian data, sintesisasi, dan pengambilan kesimpulan. Pengecekan keabsahan data melalui teknik triangulasi. Tahap-tahap penelitian meliputi tahap pra penelitian, tahap penyelenggaraan penelitian, dan tahap paska penelitian. Hasil penelitian ini ialah (1) format silabus yang digunakan guru-guru Bahasa Arab kelas VII, VIII, dan IX MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo sesuai dengan acuan BSNP, yaitu format matriks/kolom dengan prinsip lebih mudah dibaca dan dipahami oleh guru-guru Bahasa Arab; (2) komponen silabus yang digunakan oleh guru Bahasa Arab MTs Negeri Donomulyo kelas VII dan VIII sesuai dengan acuan BSNP meliputi identitas sekolah, standar kompetensi, kompetensi dasar, materi pokok/pembelajaran, kegiatan pembelajaran, indikator, jenis penilaian, alokasi waktu, dan sumber belajar, sedangkan untuk kelas IX tidak sesuai karena tidak dicantumkan salah satu komponen, yaitu kegiatan pembelajaran. Komponen silabus yang digunakan guru MTs NU Futuhiyyah Donomulyo sesuai dengan acuan BSNP meliputi identitas sekolah, standar kompetensi, kompetensi dasar, materi pokok/pembelajaran, kegiatan pembelajaran, indikator, jenis penilaian, alokasi waktu, dan sumber belajar; dan (3) kesesuaian isi silabus sudah mengalami pengembangan, tetapi jika dianalisis tiap komponen masih ada beberapa yang belum sesuai penggunaannya. Guru-guru belum benar-benar mengembangkan isi silabus sesuai ketentuan atau acuan dari BSNP. Berdasarkan hasil penelitian ini, dapat disarankan kepada Kepala Mapenda Kementerian Agama Kabupaten Malang agar melakukan kegiatan pelatihan bagi guru-guru Bahasa Arab di wilayah pinggiran. Kepada peneliti yang akan datang diharapkan melakukan penelitian misalnya, pengaruh pengembangan silabus Bahasa Arab terhadap pengajaran, pengembangan rencana pelaksanaan pembelajaran Bahasa Arab. Kepada guru Bahasa Arab diharapkan dalam mengembangkan silabus mempertimbangkan kemampuan dan keadaan tiap siswa serta keadaan sekolah.

Penggunaan Model Pembelajaran Andragogi Pada Pelatihan Kewirausahaan (Studi Kasus Pada Lembaga Pengembangan Manajemen dan Kepemimpinan (LPMK) "Insan Dinami" Indonesia, Malang) Oleh Akhmad Hasan Saleh

 

Pendekatamn odel pembelajaradni sekolahs ementarian i banyak menggunakamn odel konvensionatl anpaa daf ormulasi yang disesuaikand engan keinginanp arap esertad idik, sehinggap emahamanp esertad idik terhadapr ealita sosiadl anp engalamanla ngsungs angatt erbatash al ini menyebabkanb anyak lulusany angt idak cukup meiliki kemampuanu ntuk berkompetisid i dunia ke{a. Modelp embelajarana ndragogiy ang lebih menekankanp adap enciptaanp roses pmbelajarasne carate rbukad anm emberikana presiaspi adap engalamainn dividu menjadsi ebuahja wabana kanp ermasalahainn i. Penelitianin i bertujuanu ntukm endiskripsikakne ingrntahuasne jauhm ana perkembangamn otivasi berwirausahap esertad idik selamai ni denganm odel pembelajaraonr angd ewasay ang selamai ni digunakano leh instruktur atau pendidik dalam dunia pelatihan. Penelitiani ni menggunakanm etodep endekatand iskriptif kualitatif, karena memungkinkapne nelitim emperolehd atah olistik sertad irasam ampu menafsirkank enyataan-kenyataayna ng adad i lapanganb erupap roses pelaksanaapne mbelajarana ndragogip adap elatihanm otivasi berwirausahad an efeltifitasnya. Teknik pengumpulan data yang digunakan dalam penelitian ini adalah wawancarao, bservaslia ngsung denganp engamatanb erperanserta(p art isipant Obsevationd) an catatand okumen( berupaa rsip, foto). Sumberd atay ang dipakai berupa informan yang memiliki informasi banyak tentang objek penelitian yaitu instrukturf,a silitatord anp esertad idik. Model analisisy angd ipakaia dalahm odel analisisi nterallif yaitu waktu pengumpuland atap eneliti selalum embuatr eduksi dans ajiand atay angd igunakanu ntukm enyimpulkanh asilp enelitian. Hasil penelitiani ni mengungkapkanb ahway angm elatarbelakangLi PMK "InsanD inami" Indonesiam enggunakanm odel pembelajarana ndragogtp ada pelatihank ewirausahaank,a renap adam odel mampum engeksploraspi engalaman belajar( experientiall earning) sertam ampum emberikank ebebasanb elajarp ada pesertad idik. Dan perancanganp embelajarand ilakukan dengana nalisak ebututran belajarm elaluik uisenerS. ementarap adatahapp engelolaaant aup roses pembelajaranr,u angand itata semeriahm ungkin denganb erbagaim ediay ang digunakand anm etodep embelajarasne suadi engang ayab elajarm asing-masing pesertad idik antarala in ceramahd, iskusi,g ame( ice breaking)r, ole playing. Selanjutnyata hape valuasid ilakukan padaw aktu persiapank egiatan,p roses kegratany angb ersifat intem kelembagaand, an evaluasih asil yang melibatkan peransertap esertad idik dalamm enilai keberhasilans uatup elatihan.

Perencanaan pengembangan sekolah (studi kasus di SMP Negeri 2 Paiton Probolinggo) / Andhika Anang Lubis

 

Lubis, Andhika Anang. 2013. Perencanaan Pengembangan Sekolah (Studi Kasus di SMP Negeri 2 Paiton Probolinggo). Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan. Universitas Negeri Malang, (I) Prof. Dr. H. Ali Imron, M.Pd. M.Si, (II) Teguh Triwiyanto, M.Pd. Kata kunci: perencanaan, pengembangan sekolah     Dalam suatu organisasi agar kegiatan berjalan dengan baik dan terkoordinasi yaitu diperlukan adanya suatu perencanaan. SMP Negeri 2 Paiton Probolinggo sebagai lembaga pendidikan melaksanakan proses manajemen yang menekankan pada pencapaian kualitas output peserta didik yang tinggi. SMP Negeri 2 Paiton Probolinggo merencanakaan pendidikan dalam 1 tahun kedepannya, serta proses pengembangannya. Penelitian ini berawal dari pertanyaan bagaimana perencanaan pengembangan sekolah. Dari hasil studi pendahuluan didapatkan dua subfokus penelitian yaitu bagaimana perencanaan pengembangan sekolah di SMP Negeri 2 Paiton.    Penelitian ini dilakukan di SMP Negeri 2 Paiton yang merupakan salah satu lembaga pendidikan yang terus berkembang. Penelitian ini menggunakan pendekatan kualitatif. Teknik pengumpulan data yang digunakan meliputi: (1) observasi; (2) wawancara; (3) dokumentasi; dan (4) perpanjangan kehadiran peneliti. Data yang diperoleh dari teknik-teknik tersebut dianalisis guna menyusun temuan lapangan. Keabsahan data diuji dengan menggunakan trianggulasi.    Kesimpulan penelitian ini meliputi: (1) Perencanaan pengembangan sekolah di SMP Negeri 2 Paiton disusun dalam dua (2) bentuk yaitu rencana strategis (renstra) dan rencana operasional (renop). Manajemen pengembangan sekolah di SMP Negeri 2 Paiton sejalan dengan berbagai teori pengembangan strstegis. Dalam hal ini pelaksana manajemen sekolah (kepala sekolah beserta perangkat) terlebih dahulu melakukan analisis lingkungan untuk menentukan strategi pengembangan jangka panjang dalam konteks rencana strategis. Dalam hal ini jangka waktu yang ditetapkan adalah lima (5) tahun. Sementara itu rencana operasional diarahkan untuk memberikan panduan yang jelas tentang bagaimana program-program kerja didasarkan untuk kepentingan pencapaian tujuan jangka panjang sebagaimana dituangkan dalam renstra. Pengembangan sekolah di SMP Negeri 2 Paiton sebagaimana dituangkan dalam rencana strategis dan rencana operasional kemudian diterjemahkan kedalam pelaksanaan berbagai program kerja sebagai implementasi nyata. Guna menjaga agar implementasi program yang sesuai dengan apa yang direncanakan, disusun sebuah program pendukung yaitu pengawasan dan evaluasi.    Berdasarkan hasil temuan penelitian disarankan saran kepada kepala sekolah dan guru di SMP Negeri 2 Paiton, penelitian ini hendaknya dapat memberikan informasi atau masukan kepada pengelola dalam mengelola sekolahnya khususnya perencanaan dan pengembangan sekolah. Sehingga dapat dijadikan tolak ukur untuk mengetahui dengan jelas berhasil tidaknya dalam melaksanakan rencana dan pengembangan di sekolah. Di samping itu hasil penelitian ini agar dapat dijadikan suatu perbaikan bila dalam pelaksanaannya masih terdapat kekurangan. Dinas Pendidikan dan Kebudayaan Kabupaten Probolinggo, hendaknya dapat dipakai sebagai bahan pertimbangan untuk lebih memperhatikan perkembangan sekolah dimasa yang akan datang. Jurusan Administrasi Pendidikan, lebih memperdalam tentang perencanaan pengembangan sekolah. Bagi peneliti lain, hasil penelitian ini juga hendaknya dapat memberikan informasi tambahan atau pembanding tehadap yang masalah penelitian yang sejenis.

Bentuk dan fungsi logaritma dan aplikasinya / Ahmad Sato Rahayaan

 

ABSTRAK Rahayaan, Ahmad Sato. 2010. Bentuk Fungsi Logaritma dan Aplikasinya. Skripsi, program Studi Matematika, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Indriati Nurul Hidayah, Spd, M.Si Kata kunci : Fungsi, persamaan, logaritma, turunan, integral. Pada skripsi ini akan dibahas tentang fungsi logaritma dan aplikasinya. Sebelum masuk pada bentuk fungsi logaritma terlebih dahulu dilihat fungsi logaritma asli. Fungsi logaritma asli, dapat ditulis sebagai ln dan dapat didefinisikan dengan ∫=xdttx11ln 0>x Daerah asal fungsi logaritma asli adalah himpunan bilangan real positif. Fungsi logaritma asli memenuhi sifat: Jika a dan b bilangan-bilangan positif dan r sembarang bilangan rasional, maka (i) (ii) 01ln=;lnlnlnbaba+= (iii) babalnlnln−= (iv) .lnlnarar= Untuk fungsi logaritma dapat didefenisikan, andaikan a adalah bilangan positif bukan 1maka yaaxxy=⇔=log Fungsi logaritma memenuhi hukum yang sama seperti fungsi logaritma asli sehingga sifat fungsi logaritma asli adalah: jika , dan maka 1,0≠>aa0,>yx yxxyaaaloglog)(log).1+= 01log).3=ayxyxaaalogloglog).2−= xyxayaloglog).4= Fungsi logaritma ini dapat diaplikasikan pada bidang Fisika, permasalahan yang dibahas pada bidang Fisika tersebut adalah tentang bunyi.

Pengaruh kompensasi finansial dan karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja (studi pada karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung) / Dwi Cahyati

 

ABSTRAK Cahyati, Dwi. 2010. Pengaruh Kompensasi Finansial dan Karakteristik Pekerjaan Terhadap Kinerja Karyawan Melalui Kepuasan Kerja (Studi Pada Karyawan Bagian Produksi PT. Guna Atmaja Jaya, Tulungagung). Skripsi, Jurusan manajemen, Progran Studi S1 manajemen Universitas Negeri Malang. Pembimbing: Dr. Syihabudhin, S.E dan Drs. I Nyoman Saputra, M. Si Kata Kunci: kompensasi finansial, karakteristik pekerjaan, kepuasan kerja, kinerja karyawan. Kompensasi finansial dan karakteristik pekerjaan dapat menumbuhkan kepuasan kerja bagi karyawan. Dengan kepuasan kerja tersebut pencapaian tujuan perusahaan akan akan lebih baik dan akurat, dengan tercapainya tujuan perusahaan dan terpenuhinya kebutuhan karyawan melalui kepuasan kerja, tentu saja kinerja mereka akan meningkat pula. Penelitian ini bertujuan untuk mengetahui pengaruh kompensasi finansial dan karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja pada karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung. Penelitian ini dilaksanakan di PT. Guna Atmaja Jaya, Tulungagung pada bulan November 2009-Januari 2010. Subjek dalam penelitian ini adalah karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung. yang berjumlah 106 orang, sedangkan sampelnya diambil sebanyak 84 orang dan teknik pengambilan sampel menggunakan Proportional Random Sampling. Dalam penelitian ini mempunyai variabel bebas yaitu kompensasi finansial (X1), karakteristik pekerjaan (X2), variabel intervening yaitu kepuasan kerja (Z), dan variabel terikat kinerja karyawan (Y). Instrumen penelitian ini menggunakan item-item dari penelitian terdahulu yang telah teruji, sehingga untuk uji validitas dan reliabilitas tetap dilakukan untuk menguji validitas dan reliabilitas data yang diperoleh. Analisis data yang dipakai adalah analisis jalur (Path Analysis). Tujuan dari analisis jalur adalah untuk mengetahui pengaruh langsung dan pengaruh tidak langsung antar variabel. Hasil penelitian ini dapat diketahui : (1) terdapat signifikansi pengaruh langsung kompensasi finansial terhadap kepuasan kerja. (2) terdapat signifikansi pengaruh langsung karakteristik pekerjaan terhadap kepuasan kerja. (3) terdapat signifikansi pengaruh langsung kompensasi finansial terhadap kinerja karyawan. (4) terdapat signifikansi pengaruh langsung karakteristik pekerjaan terhadap kinerja karyawan. (5) terdapat signifikansi pengaruh langsung kepuasan kerja terhadap kinerja karyawan. (6) terdapat pengaruh tidak langsung kompensasi finansial terhadap kinerja karyawan melalui kepuasan kerja. (7) terdapat pengaruh tidak langsung karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja. ii Berdasar pada hasil penelitian, maka saran yang dapat peneliti berikan kepada PT. Guna Atmaja Jaya, Tulungagung adalah untuk kompensasi finansial yang diterapkan, disarankan pada pimpinan PT. Guna Atmaja Jaya agar lebih memperhatikan pemberian upah lembur. Hal ini dikarenakan pada hasil distribusi frekuensi pernyataan karyawan tentang kompensasi finansial, masih terdapat karyawan yang menyatakan kurang setuju dalam hal pemberian upah lembur. Sedangkan untuk karakteristik pekerjaan, disarankan pada pimpinan PT. Guna Atmaja Jaya agar lebih memperhatikan permasalahan karyawan dalam bekerja, identitas tugas, dan signifikasi tugas. Hal ini dikarenakan masih terdapat beberapa karyawan yang menyatakan kurang setuju terhadap item-item pernyataan tersebut.

Pengaruh Harga Produk Pertanian Terhadap Income Petani Di Kecamatan Kepung Kabupaten Kediri Oleh Murtaji

 

Indonesia adalah negara agraris yang kebanyakan dari penduduknyaberpenghrdupapne tani. Bila petani yang memiliki populasi tbrbesar darikomposisipendudumke ncapaik esejahteraanb,e rarti sejahierab angsad an negaraselamian i petanib elumm encapatia raph idup yang sejalrteras ecara-meratHa.a l initerkait dengan income mereka yang belum rayak. income petani sangat terkaitdengahna rgap rodukp ertanian.Penelitiani ni adlah penelitiank orelasionaly, ang meneliti perihal seberapakuatp engaruhh argap rod_upk ertaniant erhadapin comep etani.s edangkans ubyeknyaadal;ahp ara petani di KeccamatanK epung Kabupatin Kediri. oJngan memakaiteknik samplinga rea, teknik pengumpuland ata dokumentasdi an iiterviu, sertaanalisikso relasdi enganp roductm omentnyam elaluip rogam komputerS pSS.- _ Penelitianb ertujuanu ntukm engetahutii ngkafhaigap roduf pertanian4 tahunlerakhirs ejak1 999,u ntuk mengetahutii ngkatp endapatapne tani,d an seberapaku athargap rodukp ertanianb erpengaruthe rhadapp endapatapne tani. Dari hasil penelitian bahwa tingkat harga prbdut pertanian 4 tahun berturutturutadalah: Tahun t999 tingkat harga sedang sumpai tinggi. Harga sedang :3^7,:9%ti,n gkath argat inggi 62,50.T ahun2 000t ingkath urgus iiung (t6ozo;.r atrun?90_lli ngkat harga rendah sampai tingkat harga sidang. iingkat [aiga rendah43,.75%ti,n gkat hargas edang= s6,25%.t atrun zo0z tingtatiarga .Jnout sampaisedangJingkaht argar endah5 9,37%d ant ingkath argas edang4 O ,6SW.Tingkatp endapatapne tani4 tahunb erturut-turuat dalah:T ahun 1999t ingkatpendapatapne tani sedangs ampai tinggi. Tingkat pendapatans edang 4a,6zvo.Tingkar pendapatan tinggi 59.,38%. Tahun zoOb tingkat pendapatan dari rendah samp_taini ggi. Tingkatp endapatarne ndah: 3j,50% sedang= 31,25%t inggi :3l'25%-T ahun2 001 tingkat pendapatapne tanid ari rendaht i*pr iinggi. rGtatpendapatarne ndah: 43,75%,s edang= 40,62%,d an tinggi : 15',63o/o.\rahu2n0 02tingkatp endapalanp etani-darit ingkat pendapatanre ndal sampait inggi. Tingkatpendapatarne ndah= 68,75%s, edang2 9,13%,danti nggi hanya3,'l2o/o. Dari uji hipotesis terbukti bahwa harga pioduk' pertanian mempunyaipengar.uly, ang kuat (signifikan) terhadap p"naapatunp eiani. Secara simultanmenunjukkanb ahwa r hirung sebesara ,sqi sedangkanr taber 0,334. uii Fl..g ryn:ukqn F hilung 17,27s edangkaFn tabel7 ,50.B esarnyak oefisiend eterminasi;0,841A. rtinyab ahwa8 4,15t ingkat pendapatadni pengaruhoi leh tingkat harga.Scdangkyaann g1 5,9%doip engaruhfia ktor lain.Berdasarkahna sil penelitiani ni perlu disarankank epadap ara petani untukmenanatman amany angm emiliki prospektifh argam aupunp endapatatnin ggi.

Subtitusi tepung kacang merah dalam pembuatan bidaran / Rosyida aini

 

Kata Kunci: Bidaran, Kacang merah, uji kesukaan. Bidaran merupakan makanan ringan yang berbentuk panjang meruncing, berwarna kuning keemasan dan mempunyai rasa gurih. Bahan yang digunakan untuk membuat bidaran adalah, tapioka, garam, telur dan keju. Subtitusi tepung kacang merah pada pembuatan bidaran bisa dijadikan sebagai penganekaragaman pangan, serta untuk meningkatkan nilai gizi karena kandungan protein yang tinggi. Kacang merah merupakan bahan makanan yang mempunyai sumber p[rotein nabati yang potensial. Kadar protein dari kacang merah hampir setara dengan kadar protein kacang hijau yaitu 23,1 g per 100 g kacang merah. Kacang merah kering merupakan sumber protein nabati, karbohidrat kompleks, serat, vitamin B, folasin, tiamin, kalsium, fosfor, dan zat besi. Awal pembuatan biadaran kacang merah terlebih dahulu kacang merah dolah menjadi tepung. Tepung kacang merah adalah tepung dengan butiran halus, berwarna putih kekuningan dan berbau khas kacang merah. Tepung kacang merah yang digunankan sebanyak 100 g (50%) mengasilkan bidaran yang berwarna kuning kecoklatan, rasa gurih dan tekstur yang renyah. Hasil uji kesukaan terhadap bidaran substitusi tepung kacang merah menunjukkan bahwa responden yang menyukai warna bidaran substitusi tepung kacang merah sebesar 51,1%, responden yang menyukai rasa bidaran substitusi tepung kacang merah sebesar 56,6%, dan yang menyukai tekstur bidaran substitusi tepung kacang merah sebesar 55,6%. Produk bidaran substitusi tepung kacang merah memperoleh nilai gizi yang lebih tinggi dilihat dari segi Energi 1,4%, Protein 47,7%, Karbohidrat 76,77%, Ca 25,57%, P 56,37%, Vit A 16,67%, Vit B 80,97%, Vit C 93,67%, kalori yang dimilki oleh bidaran substitusi tepung kacang merah lebih tinggi 11,9% daripada kalori yang dimiliki bidaran yang tidak disubstitusi tepung kacang merah disamping itu kandungan lemak lebih rendah 0,87% dibanding dengan lemak yang terkandung dalam bidaran yang tidak disubstitusi tepung kacang merah. Satu resep bidaran substitusi tepung kacang merah 200 g dapat menghasilkan 500 g produk bidaran substitusi tepung kacang merah. Bidaran substitusi tepung kacang merah dapat dipasarkan dengan harga Rp 1.500 perkemasan dengan berat 50 g.

Pengembangan prototipe layanan informasi sekolah lanjutan berbasis multimedia interaktif bagi siswa SMP Negeri 18 Malang / Wahyu Setiawan

 

ABSTRAK Setiawan, Wahyu. 2010. Pengembangan Prototipe Layanan Informasi Sekolah Lanjutan Berbasis Multimedia Interaktif Bagi Siswa SMP Negeri 18 Malang. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing (I) Dr. Triyono, M.Pd, (II) Drs. H. Widada, M.Si. Kata Kunci: Multimedia, Layanan Informasi, Sekolah Lanjutan. Sekolah lanjutan merupakan pendidikan yang ditempuh setelah lulus dari jenjang pendidikan sebelumnya dalam hal ini SMP dan melanjutkan ke Sekolah Lanjutan Tingkat Atas yaitu sebutan untuk tahap kedua dalam sekolah lanjutan setelah Sekolah Lanjutan Tingkat Pertama di Indonesia. Dalam pemilihan sekolah lanjutan ini masih sering dijumpai kesalahan yang dilakukan oleh siswa setelah lulus SMP, dalam hal ini salah menentukan sekolah yang dipilih. Ini disebabkan karena kurangnya pengetahuan dan informasi yang tepat dimiliki oleh siswa. Dalam memilih sekolah lanjutan setelah lulus SMP, seorang siswa juga harus mempertimbangkan prospek setelah lulus dari SMA. Selain SMA juga ada lembaga pendidikan setingkat SMA, yaitu MA (madrasah aliyah) dan SMK (Sekolah Menengah Kejuruan). SMA adalah lembaga pendidikan dibawah naungan Departemen Pendidikan Nasional yang didalamnya lebih mengutamakan tentang pengetahuan-pengetahuan yang bersifat umum. Madrasah Aliyah (MA) adalah lembaga pendidikan yang berada dibawah naungan Departemen Agama. Madrasah Aliyah disini lebih mengutamakan tentang pengetahuan Agama dan Akhlak. Sedangkan SMK merupakan lembaga pendidikan yang lebih mengutamakan skil untuk menciptakan keahlian para siswa lulusannya agar setelah lulus, bisa siap kerja. Tujuan dari penelitian ini adalah untuk menghasilkan sebuah produk layanan informasi sekolah lanjutan berbasis multimedia interaktif bagi siswa SMPN 18 Malang yang berterima baik secara teoritis maupun praktis dan bisa digunakan oleh siswa maupun konselor di sekolah sebagai media layanan informasi tentang sekolah lanjutan. Menurut penilaian dari ahli media yaitu dosen BK, multimedia interaktif tentang sekolah lanjutan mendapatkan skor 36 dengan nilai rata-rata 2,77 yang berarti sesuai dalam segi kemenarikan media. Sedangkan menurut dari hasil penilaian uji ahli materi yaitu oleh uji materi I adalah 2,75 yang berarti sesuai, dan penilaian uji ahli materi II adalah 3 yang berarti sesuai/akurat. Jadi rata-rata skor total keseluruhan adalah 2,87 yang berarti cukup akurat dalam hal materi yang disusun dalam multimedia interaktif. Jadi berdasarkan hasil penilaian uji ahli materi, dapat disimpulkan bahwa materi yang disusun dalam multimedia berklasifikasi cukup akurat dan dapat digunakan ii Berdasarkan penilaian ahli media dan materi yaitu dosen BK dan konselor SMP, layanan informasi berbasis layanan informasi sekolah lanjutan ini sangat berguna bagi siswa agar mempunyai gambaran tentang sekolah yang akan menjadi pilihan setelah lulus SMP, selain itu bagi konselor bisa memudahkan dalam memberikan layanan informasi karena multimedia interaktif ini sangat mudah dioperasikan. Peneliti menyarankan kepada pihak sekolah khususnya konselor hendaknya memanfaatkan software multimedia untuk mengetahui keefektifan produk yang dihasilkan sehingga pemberian layanan informasi lebih maksimal.

Penerapan model pembelajaran kooperatif tipe Student Teams Achievement Divisions (STAD) untuk meningkatkan motivasi dan hasil belajar kognitif fisika siswa kelas XI IPA 6 SMA Negeri 5 Malang / Mochammad Samsul Arifin

 

ABSTRAK Arifin, Moch. Samsul. 2010. Penerapan Model Pembelajaran Kooperatif Tipe Student Teams Achievement Division (STAD) Untuk Meningkatkan Motivasi dan Hasil Belajar Kognitif Fisika Siswa Kelas XI IPA 6 SMA Negeri 5 Malang. Skripsi, Program Studi Pendidikan Fisika Jurusan Fisika FMIPA UM. Pembimbing: (1) Drs. Asim M.Pd. (2) Drs. Purbo Swasono, M.Si. Kata Kunci: Student Teams Achievement Division (STAD), Motivasi, Hasil Belajar kognitif. Berdasarkan pengamatan awal di SMA Negeri 5 Malang, metode yang sering digunakan pada saat pembelajaran mata pelajaran fisika adalah metode ceramah, jumlah siswa yang telah tuntas belajar hanya 1 siswa dari 34 siswa, siswa berbicara dengan teman sebangku ketika pelajaran berlangsung, siswa jarang mencatat, kurang aktif dalam bertanya dan menjawab pertanyaan, mengirim pesan singkat (SMS) dan lain-lain. Berdasarkan pengamatan awal dapat dikatakan bahwa siswa kurang termotivasi dan hasil belajar kognitifnya rendah. Penelitian ini bertujuan untuk mengetahui penerapan model pembelajaran kooperatif tipe Student Teams Achievement Division (STAD) dalam meningkatkan motivasi dan hasil belajar kognitif fisika siswa kelas XI IPA 6 SMA Negeri 5 Malang. Penelitian ini merupakan penelitian tindakan kelas yang terdiri dari dua siklus. Masing-masing siklus terdiri dari empat tahap yaitu perencanaan penelitian, penerapan tindakan, observasi dan refleksi. Tindakan yang diberikan pada siklus I dan siklus II berupa penerapan skenario pembelajaran model pembelajaran kooperatif tipe STAD yang terdiri dari lima langkah, yaitu 1) tahap penyajian materi, 2) tahap kegiatan kelompok, 3) tahap tes individual, 4) tahap penghitungan skor perkembangan individu, dan 5) tahap pemberian penghargaan kelompok. Instrumen yang dipakai dalam penelitian ini adalah rencana pelaksanaan pembelajaran, lembar kerja siswa, soal tes, angket dan lembar observasi kegiatan guru. Hasil penelitian menunjukkan bahwa motivasi dan hasil belajar kognitif mengalami peningkatan, setelah diberi tindakan dengan menerapkan model pembelajaran kooperatif tipe STAD. Peningkatan persentase motivasi belajar ditunjukkan dengan meningkatnya persentase motivasi belajar secara keseluruhan yaitu 70,7% (Siklus I) menjadi 79,1% (siklus II). Peningkatan persentase motivasi belajar secara keseluruhan diikuti peningkatan persentase motivasi belajar tiap indikator meliputi perhatian dari 71,3% (siklus I) menjadi 79,5% (siklus II), keterkaitan dari 69,1% (siklus I) menjadi 76,5% (siklus II), keyakinan diri dari 70,3% (siklus I) menjadi 78,8% (siklus II), kepuasan dari 72,1% (siklus I) menjadi 81,4% (siklus II). Hasil Belajar Kognitif fisika siswa juga menunjukkan

Penerapan cooperative learning dengan model numbered head together (NHT) untuk meningkatkan keterampilan sosial siswa kelas VIII-D SMPN 18 Malang pada layanan bimbingan dan konseling / Erlin Dessy Trihandayani Anugrahsari

 

A B S T R A K Anugrahsari, Erlin Dessy Trihandayani. 2010 .Penerapan Cooperative Learning dengan Model Numbering Head Together (NHT) untuk Meningkatkan Keterampilan Sosial Siswa Kelas VIII-D SMPN 18 Malang. Skripsi, Program Studi Bimbingan dan Konseling, Jurusan Bimbingan Konseling dan Psikologi FIP Universitas Negeri Malang. Pembimbing: (1) Dra.Ella Faridati Zen, M.Pd (2) Drs. Djoko Budi Santoso. Kata Kunci : Cooperative Learning, Numbering Head Together (NHT) dan Keterampilan Sosial. Pada saat pelaksanaan layanan bimbingan konseling berlangsung di kelas, siswa cenderung kurang memperhatikan konselor yang menyampaikan materi bimbingan, siswa cenderung berbicara dengan teman sebangku, kurang dapat bekerja sama dengan teman yang tidak dekat dan saat konselor memberikan pertanyaan mengenai materi bimbingan, siswa cenderung menjawab bersama-sama sehingga membuat kelas menjadi gaduh. Selain itu konselor cenderung menggunakan teknik ekspositori saat menyampaikan materi di kelas, hal ini kurang memberikan kesempatan pada siswa untuk aktif salama pelaksanaan layanan bimbingan konseling. Siswa kelas VIII-D SMPN 18 Malang kurang memiliki keterampilan sosial yang dapat dijadikan bekal saat berada di masyarakat, maka salah satu model pembelajaran yang di duga dapat meningkatkan keterampilan sosial siswa adalah pendekatan Cooperative Learning model Numbering Head Together yang memiliki empat tahapan yang sistematis yaitu (1) Numbering, (2) Questioning, (3) Head Together dan (4) Answering. Penelitian ini bertujuan untuk mengetahui bahwa pelaksanaan layanan bimbingan dan konseling dengan model Numbered Head Together (NHT) dapat meningkatkan keterampilan sosial siswa kelas VIII-D SMPN 18 Malang. Penelitian ini merupakan Penelitian Tindakan yang dilakukan dalam empat tahapan yaitu (1) perencanaan, (2) pelaksanaan tindakan, (3) observasi dan (4) refleksi. Empat tahapan tersebut membentuk satu putaran yang beruntunan yang diberi nama satu siklus. Pada penelitian ini dilakukan dalam dua siklus penelitian. Hasil data yang diperoleh di analisis dalam bentuk analisis kualitatif dan kuantitatif. Penerapan model numbered head together pada layanan bimbingan konseling dapat mencapai skor maksimal yaitu 100% pada siklus II serta dapat meningkatkan keterampilan sosial siswa kelas VIII-D. Hal ini tampak dari hasil analisis angket keterampilan sosial siswa sebelum tindakan mencapai 77% dan setelah siklus II mencapai 91% sehingga terjadi peningkatan sebesar 14%. Selain itu juga mampu meningkatkan kemampuan dalam memahami materi bimbingan. Berdasarkan hasil penelitian maka dapat disimpulkan bahwa penerapan Cooperative Learning dengan model Numbered Head Together (NHT) dapat meningkatkan keterampilan sosial siswa kelas VIII-D SMPN 18 Malang pada layanan bimbingan konseling karena terjadi peningkatan keterampilan sosial setelah pelaksanaan tindakan. Dari hasil penelitian ini dapat disarankan Bagi konselor saat menggunakan model numbered head together pada saat pelaksanaan layanan bimbingan konseling perlu memiliki kemampuan untuk mengelola kelas dengan baik serta memiliki sikap yang asertif pada siswa sehingga selama proses berlangsung dapat berjalan dengan lancar. Dapat dijadikan salah satu alternatif saat menyampaikan materi bimbingan sehingga dapat memberikan manfaat yang banyak bagi siswa setelah mengikuti layanan bimbingan serta membuat siswa lebih antuasias saat mengerjakan tugas yang diberikan konselor. Untuk peneliti selanjutnya dapat memperhatikan kekurangan yang terjadi saat pelaksanaan tindakan sehingga dapat lebih efektif dalam menerapkan model numbered head together pada layanan bimbingan konseling. Untuk program studi Bimbingan dan Konseling dapat digunakan dapat memperhatikan pelaksanaan model Numbered Head Together karena dijadikan bahan kajian peneliti selanjutnya.

Studi Komparatif Tingkat Pendapatan Petani Antara Petani Yang Menanam Padi Pola Sawit Dupa Dan Petani Yang Menanam Padi Secara Tradisional Di Kecamatan Belawang Kabupaten Barito Kuala Oleh Sumiatun

 

Pendapatan merupakan salah satu indikator kesejahteraan penduduk. semakaint inggi tingkat pendapatanb erarti kesejahteraapne nduduks emakinb aik. Alasand ilaksanakannypae nelitiani ni adalahm asih rendahnyati ngkat pendapatan petanit erutamad i daerahp asangs urut di luar pulau Jawa.K arenas ebagianb esar mereka masih mengelola usaha taninya secara tradisional yang berbasis pada pertanian tanaman pangan. Padahal dengan adanya kemajuan teknologr di bidang pertanians angatm emungkinkanu ntuk peningkatanp roduktivitasp ertaniand engan pemilihanp olat anamy angs esuai. Pola tanams awit dupa merupakans alahs atu alternatifu ntuk meningkatkan jumlah produksi padi, sehinggaa kan dapat meningkatkanp endapatanp elani di daerahp asangs urut. Tujuan penelitiani ni adalahm engetahupi erbedaan:-(l)p ola penggunaanla han antarap etani yang menanamp adi pola tanTms awit dupa dan petanry angm enanamp adi secarat radisional,( 2) pemanfaatanI'a hanta bukana ntara petani yang rlenanam padi pola tanarn sawit dupa dan petani yang menanam padi secara tradisional, (3) produksi padr petani yang menanam padi pola sawit dupa denganp etani yang menanamp adi secarat radisional,( 4) pendapatanp etani yang menanam padi pola tanam sawit dupa dan petani yang menanam padi secara tradisional. Populasi dalam penelitian ini adalah petani yang berada di Kecamatan BelawangK abupatenB arito Kualad an sebagasi ampelw ilayah( daerah)a dalahd esa Karang Dukuh dan Karang Buah yang terdiri dari 35 orang petani yang menanam padi dengan pola sawit dupa dan 35 orang petani yang menanam padi secara tradisional.Datpae nelitiand ikurnpulkand enganm etodeo bservasi,w awancarad an dokumentasui.n tuk mengujia danyap erbedaantin gkatp endapatapne tani,d igunakan metodea nalisaU ji-t ataut test. Hasil analisisd atap enelitianm enunjukkaand anyap erbednn(:l ) pola penggunaanla han pada petani sawit dupa ditandai dengana danyat abukan sedangkan pada pada petani tradisional sebagian besar tidak membuat tabukan, (2) pemanfaatan lahan tabukan, petani pola sawkit dupa menanami lahan sawah untuk tanaman padi sedangkan lahan tabukan dengan jenis tanaman yang mempunyai nilai ekonomis tinggi serta perawatan intensif, dan untuk petani tradisional lahan utamanaya untuk tanamanp adi sedangkany ang mempunyail ahan tabukanb elum dimanfaatkans ecara maksimal, (3) jumlah produksi padi dan tanaman lainnya dimana pada pola sawit dupa rata-rata produksinya diatas 3,5 ton/ha/th sedanlkan pada petani tradisional kurang dari 2,5 ton/ha/th, (4) tingkat pendapatan dimana pendapatan petani pola sawitd upal ebih tinggi dari padap etaniy ang menanamp adi secarat radisional.r lal ini terbukti dengan adanya perbedaan jumlah produksi petani secara keseluruhan setelahm emperhitungkahna sil produksit otal dikurangis eluruhb iayap roduksiy ang dikeluarkans elamas atut ahun( musimt anam1 998/1999).

Peningkatan kemampuan pemahaman bacaan melalui strategi known-want to know-learned (KWL) pada siswa kelas III SDN Lecari Kecamatan sukorejo Kabupaten Pasuruan / Leres Febby

 

ABSTRAK Febby, Leres. 2010. Peningkatan Kemampuan Pemehaman Bacaan Melalui Strategi Know-Want To Know-Learned (KWL) Pada Sisiwa Kelas III SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan. Skripsi, Jurusan Kependidikan Sekolah Dasar Dan Pra Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Rumidjan, M.Pd, (II) Drs. Sjarfuddin A.R, S.Pd, M.Pd Kata kunci: Peningkatan Kemampuan Pemahaman Bacaan, Strategi KWL, SD. Keterampilan membaca dan menulis merupakan modal utama bagi peserta didik. Dengan bekal kemampuan membaca dan menulis, siswa dapat mempelajari ilmu lain. Siswa dapat mengkomunikasikan gagasan dan mengekspresikan dirinya melalui lisan dan tulisan. Oleh kerena itu, kegagalan dalam penguasaan keterampilan ini akan mengakibatkan masalah fatal, baik untuk melanjutkan pendidikan ke jenjang yang lebih tinggi maupun untuk menjalani kehidupan sosial kemasyarakatan. Strategi KWL memberikan kepada siswa tujuan membaca dan memberikan suatu peran aktif siswa sebelum, saat, dan sesudah membaca. Tujuan penelitian ini secara umum adalah untuk mengembangkan kemampuan pemahaman bacaan siswa dengan menggunakan Strategi KWL di kelas III SDN Lecari. Secara khusus, tujuan penelitian ini dirumuskan sebagai berikut: (1) untuk mendeskripsikan proses peningkatan kemampuan pemahaman bacaan melalui penerapan strategi KWL pada siswa kelas III SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan; (2) untuk mendeskripsikan hasil peningkatan kemampuan pemahaman bacaan melalui penerapan strategi KWL pada siswa kelas III SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan. Rencana penelitian dengan menggunakan pendekatan kualitatif, jenis penelitian tindakan kelas (PTK). Subjek penelitian adalah siswa kelas III SDN Lecari kecamatan Sukorejo kabupaten Pasuruan yang berjumlah 24 siswa. Teknik pengumpulan data menggunakan tes, observasi, wawancara, dan dokumentasi selama proses pembelajaran. Penelitian ini dilaksanakan sebanyak dua siklus melalui tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Hasil peningkatan kemampuan pemahaman bacaan melalui penerapan strategi KWL pada siswa kelas III SDN Lecari, nilai hasil belajar berupa tes tertulis dengan soal evaluasi pada pra tindakan nilai rata-rata kelas 49,58%, dengan 9 (37,5%) orang siswa mendapat nilai di atas standar dan 15 (62,5%) orang siswa mendapat nilai di bawah standar nilai. Pada siklus I terdapat nilai rata-rata kelas 52,87%, jumlah siswa yang lulus sebanyak 15 orang siswa atau 62,5% dan siswa yang tidak lulus berjumlah 9 orang siswa atau 37,5%. 6 orang siswa mendapat nilai 54 atau tepat nilai standar, 9 orang siswa mendapat nilai di atas nilai standar, dan 9 orang siswa mendapat nilai di bawah nilai standar. Sedangakan pada siklus II rata-rata kelas adalah 61,5%, 21 (87,5%) orang siswa mendapat nilai di atas standar dan 3 (12,5%) orang siswa yang masih berada di bawah standar nilai yang ditetapkan.

Pengaruh Inflasi Terhadap Tingkat Rentabilitas Pada Perusahaan Manufaktur Yang Dilisting Di Bursa Efek Jakarta Oleh Ulfani

 

Pada kondisi inflasi dimana terjadi kenaikm harga barang secara t€rus menerus, secara tidak langsung akan berpengaruh pada pendapatan perusahaan. Pada saat inflasi pausahaan tidak mampu lagi membiayai operasi perusahaan karena seperti kita tahu bahwa sector riil di Indonesia termasuk indusfri manufakmr yang masih tergantmg pada import barang modal, dan bahan baku. Hd ini akan menyebabkan harga produk meningkat, karena tingginya biaya produksi. Dengan harga produk yang terlalu tinggi, maka akan menunrnkan daya beli konsume,n yang secara otomatis juga akan menyebabkan pendapatan pousahaan turun.. Penelitian ini bertujuan unhrk mengetattui (l) pengaruh inflasi tahadap tingkat rentabilitas ekonomi (Z) pengaruh inflasi terhadap tingkat rentabilitas modal sendiri. Jenis penelitian ini adalah penelitian asosiatif (associarif research) yang b€rtujuan unmk mengetahui pengaruh antara dua vriabel atau lebih yang basifat kausal. Variabel bebas (E dalan penelitian ini adalah inflasi sedmgkm variabel terikat (D adalah tingkat rentabilitas ymg terdiri dari rentabilitas ekonomi (Yl) dan rentabilitas modal sendiri (Y2). Populasi dalam pe'nelitian ini addah seluruh perusahaanm anufaktur yang terdaftar di Bursa Efek Jakarta-S edangkant ekhnik pengambilans mpel me,ng:gunakatne lfui/r. purposive sampling,yaitu mengambil smpel dengan criteria tertqrtu Criteria smpel yang masuk dalam penelitian ini yaitu perusatraanm anuftkhu yang listing di Bursa Ef€k Jakartas ejak tahun 1998 sampai 2002 dan perusahaan tersebut aktif dalam mengeluarkan laporan keuangm. Berdasarkan criteria tersebut terpiih sepuluh perusahaan msrufakhr yang dijadikan sampel. Tekhnik pengrrmpulan data menggunakan tekbnik dokumentasi, sedangkan tekhnik analisa data ymg digunakan adalah analisa regresi sederhana. Hasil penelitian penelitian ini menunjukkan bahwa (l)hngkat inflasi di tndonesia selma tahun 1998 sampai 2002 meiniliki intensitas ymg berbeda tahun 1998i nflasi sebesa7r 7,55yo,A hun 1999 turun tajam sebesa2r ,010/",tahtrlrr 2000 naik sebesar 9,35yo, tahun 2001 naik kerrbali menjadi 12,55y% tahun 2002 inflasi murcapai 10,03%. (2)tingkat rentabilitas *onomi maupun tingkat rentabilias modal sendiri selama tahun 1998 sampai 2002 mengalani fluktuasi. (3)inflasi tidak berpengaruh signifikan terhadap r€ntabilitas ekonomi, hal ini t€rlihat dari hasil uji t yaitu t hitung -0,758t tabe{, -2,021y aor.tg€ rl€takd i daerahg agalt olak Ho, yang artinyat idak adap engaruh yangs igrifikana ntarain flasi denganre ntabilitasm odali bndiri. Berdasarkahna sil penelitiani ni maka sran bagi perusahaana dalah( l) melakukaenf iensim odal dan menekmb iaya produksi agar tingkat rentabilitas tdry ttlaga dan oendaung mengalamik enaika. Kuena perusahanny ang rendabeml encerrninkakni nerja manaj€xn€yna ng baik. (2) munperbaikik inerja rnmajanenp erusahail" untuk kelangsunganp erusahaand alan menghasilkan p€ndapatatann pam engabaikanft ctor ekstemy mg berpengaruhse pertik ondisi social dan politik. Dengan kinerja mmjerne,n ymg baik akan menambah kepercayaamn asyarak* t€rutamap ihak yang berkepentingo sepertik reditor yang akan merrberikro pinjaman dan para investor ymrg ingin menanamkm modalnykae p€rusahaan.

Pengaruh Latar Belakang Sosial Ekonomi Orang Tua Terhadap Sikap Berekonomi Mahasiswa (Studi Komparasi Daerah Asal) Oleh Yati Nurhayati

 

Setiapk egiatany ang dilatrukanm anusiad alam kehidupannyab ermuara pada usaha untuk memenuhi kebutuhan hidup diri pribadi dan keluarganya. Seiringd enganp ergeserana ntaraj umlah manusiad enganju mlah ragam kebutuhannyma,a kat erjadilahk elangkaans umberd ayas ebagafir emuas kebutuhanD. iikuti oleh perkembangank ebudayaanm anusiay ang menyebabkan ragamk ebutuhannyam eningkat,p ermasalahny ang dihadapi manusiad alam pemenuhhakne butuhanm enjadi kompleks.K ompleksitast ersebutm endorong manusiau ntukd apatm enentukans ikap/cara-caryaa ngl ebih efektifdan efisien dalamb eraktivitase konomid ant entus ajam enentukansk alap referens(ip rioritas dari masing-masingk ebutuhant ersebut,g unam engaturb erbagaip ermasalahan yangt imbul dalamp emenuhakne butuhannyaA-t au dengank ata lain manusia harusm emiliki sikapb erekonomid, imanap erilakue konominyam encerminkan adanyap enerapapnr insipprinsipe konomi. Tujuan dilaksanakannyap enelitian ini adalahu ntuk mendeskripsikanla tar belakangs osiale konomio rangt u4 mendeskripsikans ikap berekonomi mahasiswdaa lamh al perencanaaank tivitase konomi,e fisiensid alama ktivitas ekonomio, rientasmi asad epan,d ang ayah idup,m enganalisise caras imultand an parsial pengaruh latar belakang sosial ekonomi oranng tua terhadap sikap berekonommi ahasiswa. Penelitianin i dilaksanakasne lamab ulanD esembe2r 003t erhadap mahasiswFaa kultasE konomij urusanE konomiP embangunadni Universitas Negeri Malang. Teknik yang digunakan dalam pengumpulan data adalah angket. Sedangkapne ngambilans ampeml enggunakapne rtimbangand aeraha sald engan jumlah sampels ebanyak8 0 orangk arenak eterbatasank emampuanp eneliti dalam hal waktut enagad and ana. Pengolaliand atad alamp enelitiani ni dilakukand enganm enggunakan teknika nalisiss tatistikd eskriptifdani nferensialT. eknik analisiss tatistik deskriptifu ntukm endeskripsikakno ndisil atarb elakangs osiale konomio rangt ua dans ikapb erekonommi ahasiswaS. edangkatne knik analisiss tatistiki nferensial melalui analisis regresi linier berganda untuk mengetahui pengaruh latar belakang sosiale konomio rangt ua terhadaps ikapb erekonommi ahasiswa. a) Kondisil atarb elakangs osiale konomio rangt ua dilihat dari tingkat pendidikans ecarak umulatifm asihr endahy aitu sebesa5r 3,75%D. an menurut daeraha sal,t ingkat pendidikano rangt ua respondens ama-samam asih rendah yaitu Jatimb agianb arats ebesa5r 5%od anJ atimb agiant imur sebesa5r 7,50. b) Kondisil atarb elakangs osiale konomio rangt ua dilihat dari besarp endapatan secarak umulatifm asihr endahv aitu sebesa6r 5Yo.Danm enurutd aeraha sal. besarp endapatano rangt ua respondens ama-samam asih rendahy aitu Jatim bagianb arat sebesar5 2,5Vod anJ atim bagiant imur sebesar7 7,5o/o. c) Kondisi sikap berekonomim ahasiswas ecarak umulatif sudahc ukup baik yaitu sebesar8 7,25y o.D an menurutd aeraha sal , sikapb erekonomi mahasiswas ama-samas udahc ukup baik yaitu Jatim bagianb arat sebesar 87,5%d anJ atimb agiant imur sebesa7r 5%o. d) Secarap arsialt erdapatp engaruhy ang signifikan antaral atar belakangs osial ekonomi orang tua dari segi tingkat pendidikan terhadap sikap berekonomi mahasiswate.,r buktid ari nilai sig t (0,000)< cr( 0,05) e) Secarap arsialt erdapatp engaruhy ang signifikan antaral atar belakangs osial ekonomio rang tua dari segi besarp endapatante rhadaps ikap berekonomi mahasiswate, rbulli dari nilai sig t (0,000)< a (0,05) f) Secara simultan terdapat pengaruh yang signifikan antara latar belakang sosial ekonomio rangt ua terhadaps ikapb erekonommi ahasiswat,e rbuktid ari nilai sigF(0,000)

Pengaruh Persepsi Siswa Tentang Kondisi Fisik Sekolah Terhadap Motivasi Belajar Siswa Madrasah Aliyah Ghozaliyah Sumbermulyo Jogoroto Jombang oleh M. Sholeh

 

Dalamb elajars iswad iharapkanm emilikim otivasiy angt inggl,k arenad engan motivasi yang tinggi maka siswa akan mempunyai banyak tenaga atau energi untuk melakukakne giatanb elajarD. emikianju ga sebaliknyas isway angt idakm emiliki motivasim akai a akane ngganu ntuk melakukank egiatanb elajar.U ntuk itu sekolah harusm enyediakans aranad nn prasaranab elajary ang sesuadi engank eadaans iswa saaitn i sebagasi alahs atuf aktor pendorongm otivasib elajars iswa. Masalahy ang dikaji sekaligusm enjadit ujuanp enelitiana dalah1 ) bagaimanakaphe rsepssi iswatentangk ondisi fisik sekolahy angm eliputi saranad an prasaranMa adrasahA liyah GhazaliyahS umbermulyoJ ogorotoJ ombang2, ) bagaimankao ndisi motivasib elajars iswat ahun ajwan2002-20033. ) Adakah pengaruhp ersepssi iswat entangk ondisi fisik sekolaht erhadapm otivasib elajars iswa MadeasahA liyah GhazaliyahS umbermulyoJ ogorotoJ ombang. Rancanganp enelitiany ang digunakand alamp enelitiani ni adalahd iskriptif korelasionalM. etoded eskriptif digunakanu ntuk rnenggambarkanm, enganalisisd an menafsirkand atad ari variabely ang diteliti yaitu persepssi iswat entangk ondisi fisik MadrasahA liyah Ghozaliyahd an motivasib elajars iswaM adrasahA liyah GhazaliyahM. etodek orelasionadl igunakanu ntuk menentukanb esarnyap engaruh antarav ariabely ang diteliti yaitu persepssi iswat entangk ondisi fisik sekolah MadrasahA liyah danM otivasi belajars iswaM adrasahA liyah Ghazaliyah SumbermulyoJ ogorotoJ ombang. Populasid alamp enelitiani ni adalahs eluruhs iswaM adrasahA liyah Ghazaliyahta huna jaran2 002-2003y angt erdiri dari kelasI " IL m yangjunlah seluruhnyaa dalah3 59 siswa.S ampepl enelitiand itetapkand enganm enggunakan tehnik proportional statifiet random sampling, dengan meletakkan 15 % sampel dari keseluruhanp opulasiy aitu sebanyak5 0 siswa.T ehnik pengumpuland atad engan menggunakaanu gketd an dokumentasi. , Berdasarkanh asil analisisd at4 diperolehk esirnpulan1 ) tingkat persepsi siswa tentang kondisi fisik sekolah Madnsah Aliyah Gha"aliyah Menunjukkan dari 50r esponden1,2 r esponde(n2 4%)m enjawabs angabt aik, 18r esponde(n3 6 %) menjawabb aik dan2 0 responde(n4 0%)m enjawabc ukupb aik.2 ) kondisim otivasi belajars iswaM adrasahA liyah Ghazaliyahm enunjukkan5 0 respondenl0, responden (20%)m empunyami otivasbi elajary angs angatti nggi, 22raponden( 44o/o) mempunymaio tivasbi elajary angt inggi, l8 responde(n3 694)m empunyami otivasi belajayra ng cukupt inggi. Sedangkapne nganrhp ersepssi iswat entangk ondisi fisik sekolaht erhadap motivasbi elajarm enunjulkank oefisienk orelasi@ ) sebesa0r ,868a rtinyaa da keeratahnu bunganv ariabelp ersepssi iswat entangk ondisi fisik sekolah( x) dengan notivasbi elajars iswa( y). Koefisiend eterminas@i Squares) ebesa0r, 753a rtinya.pengaruvha riabel persepssiis wat entangk ondisif isik sekolah(x ) terhadapm otivasib elajars iswa sebes7a5r ,3%osi,s anya2 4,7o/okeberhasislaisnw ad itentukanv ariabella in. Nilai F hitung= 146,32le bihb esard arin ilai F tabel0 .0(5r, 4s=) 4,04 dengan probabilita0s. 000( lebihk ecil) dari 0,05)jadia dap engaruhy angn yatav ariabel penepssi iswat urtang kondisi fisik sekolah( x) terhadapm otivasi belajars iswa( y). Sarury ang dapatd iberikany aitu kepadak epalas ekolahs ebagaai dministrator sekolah endaknyam embantum enumbuhkanra sab anggap adap aras taf,p engajar terutamkae padas iswat erhadaps ekolahd enganc aram eningkatkanp engadaansa rana danp rasaranase kolahd enganm emperhatikanku rikulum yangb erlakud ank ondisi siswap adas aati ni, karenad engana danyas aranad an prasaranay angm emadami aka siswaa kanm erasas enangd ant enangd alamm elaksanakabne lajamyas ehinggaa kan menimbulkanm otivasib agi siswad i dalamm elaksanakakne giatanb elajard i sekolah dans iswah enclaknyma eninglcatkamn otivasib elajarnyak, arenad engana danya motivasib elajary arrgt inggi makaa kanm empermudathu juan belajar, vl

Hubungan Antara Pengelolaan Perpustakaan Dengan Motivasi Belajar Siswa Di Perpustakaan SMUN 2 Pare Kediri oleh Muh. Nur Taufiq

 

Hubungan Persepsi Siswa Tentang Kondisi Fisik Sekolah Dengan Motivasi Belajar Siswa Di Sekolah Lanjutan Tingkat Pertama (SLTP) Negeri 3 Lawang Malang Oleh Imam Suhariyanto

 

Motivasi belajar adalah hal yang paling penting bagi seorang siswa untuk dapatm elakukana ktivitas belajar, sebabd enganm otivasi belajar,s eseoranga kan memiliki banyak tenaga dan kemaqan untuk melakukan aktivitas belajar. Sebalikny4 seseoranyga ng tidak memiliki motivasi belajarm akad ia akane ngganu ntuk melakukan aktivitas belajar. Maka yang pertama kali harus dilakukan oleh seseorang unhrkd apatb el4iard enganb aik adalahb €rusaham enumbuhkanm otivasi belEar tersebut,b aikyang datangd ari dalam individu mauplmy ang datangd ari luar individu. Terkait dengan motivasi dari luar individu, salah satu faktor yang paltng urgena dalahs ekolahh arusm enyediakans aranad an prasaranab elajary ang memadai dan relevan dengan kondisi siswa pada saat itu. Masalahy ang dibahasd alam penelitiani ni adalah( l) Bagaimanakahp ersepsi siswa tentang kondisi fisik sekolah di Sekolah Lanjutan Tingkat Pertama Negd 3 Lawang,( 2) Bagaimanakahm otivasi belajar siswad i SekolahL anjutanT ingkat Pertama Negen 3 Lavrang (3) Adakah hubungan antara persepsi siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa di Sekolah Lanjutan Tingkat Psr&amaN egeri 3 Lawang.A dapun tujuan yang ingin dicapai adalah( l) Ingin mengetahupi ersepssi iswat entangk ondisi fisik SekolahL anjutanT ingkat Pertama Negeri 3 Lawang (2) Ingin mengetahui motivasi belajar siswa Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawang (3) Untuk mengetahui ada tidaknya hubungan persepsi siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawang. Rancanganp enelitiannyam enggunakand eskriptif Korelasional.M etode ini digunakanu ntuk menggambarkanko ndisi fisik SekolahL anjutanT ingkat Pertama Negeri 3 Lawangd an Motivasi Belajar Siswa.S edangkanM etode Korelasional digunakanu ntuk menentukans eberapab esarh ubungana ntaraP ersepsSi iswat entang KondisiF isik Sekolahd enganM otivasiB elajarS iswad i SekolahL anjutanT ingkat Pertama Negeri 3 Lawang. Populasi dalam penelitian ini adalah siswa/siswi Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawangy angj umlah keseluruhannya8 11 siswa.M etode pengumpuland ata dilakukan denganm enggunakana ngket,o bservasi,d okumend an wawancara.S edangkante knik pengmbilan sampeld ilakukand enganm enggunakan teknik Proponional RandomS amplingy aitu, pengambilans ampels ecarap roporsip sesuaid enganb esamyak elasm asing-masingd engana lasanu ntuk memberikan i kesempatayna ng samak epadas emuai ndividu sehinggad apatd ipilih meqiadi anggotasa mpeld enganc arau ndiaq yangj umlahnya 81 siswa. Teknik Analisa daa yang digunakan meliputi (1) Analisis deslriptif yaitu untukm endiskripsikank ondisi fisik dan motivasi belajar siswaS ekolahL anjutan Tingkat Pertama Negeri 3 Lawang, (2) Analisis Froduct Moment, yaitu untuk menguji hipotesis nol (H0) dan hipotesis alternatif GIa). Berdasarkana nalisad ata,d iperolehk esimpulanb ahwa, l) 14 dari 81 responde(n1 7,28%) menyatakanb ahwak ondisi fisik SekolahL anjutanT ingkat Pertama(S LTP) Negeri 3 l^awangd alam keadaanb aik, 25 responden( 30,86 %) menyatakacnu kup, 29 responden( 35,807 om enyatakans edangd an 13 responden (16,04%)m enyatakaknu rang.S edangkan2,) Motivasib elajars iswa,l 5 dari 8l responde(n1 8,18% ) memiliki motivasib elajar baik,2 3 responden(2 8,39o /o) ' memiliki motivasi belajar cukup, 26 responden( 32,09 o/o)m emiliki motivasi belajar sedangs erta 17 responden( 2A,98o /o)m asihd alarnk eadaank urang.3 ) Hubungan prsepei siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa menur{ukkanh argar xy sebesa0r ,903p adat arafsignifikasi sebesa0r ,000.O leh karena probabilitas < 0,05 maka Ho di tolak. Dengan demikian dapat dikaakan bahwa terdapat hubungan positifyang signifikan antara persepsi siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa di Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawang. Saran yang dapat penulis berikan dalam penelitian ini, Kepala Sekolah sebagaAi dministrator sekolahh endalnyas elalu memperhatikand an meningkatkan kelengkapans aranap rasaranay ang menadai yang disesuaikand engank urikulum dan keadaans iswap da saati tu. Sebaby ang demikian itu diharapakana kan membangkitkanm otivasi belajar sisway ang padaa khirnyaa kan tercapainyata rget tujuan pendidikan yang maksimal.

Hubungan Antara Latar Belakang Pendidikan Oang Tua, Status Sosial Denga Motivasi Belajar Siswa SLTP Negeri 2 Malang Oleh Yayuk Sriwahyuni

 

Dalam kehidupan manusia tidak lepas dari lingkungan. Lingkungan pertama yang dikenal manusia adalah keluarga. Keluarga merupakanpeletak dasar pembentukan kepribadian seseorang, maka keluarga memberikan andil besar dalam setiap perilaku seseorangte rmasuk motivasi belajar. Motivasi belajar dapat dipengaruhi oteh berbagai hal diantaranya latar belakang pendidikan orang tua yang dapat memicu motivasi anak untuk belajar lebih tinggi atau sebaliknya. Disamping itu yang tak kalah pentingny; dalam pendidikan diperlukan biaya. Dalam belajar anak memerlukan fasilitas dan sarana penunjang untuk kelancaran belajamya. Keadaan sosial ekonomi suatu keluargad apatm empengaruhmi otivasib elajara nak. Penelitian ini bertujuan untuk mendeskipsikan: (1) latar belakang pendidikan orang tua, (2) satus sosial ekonomi keluarga, (3) motivasi belajar siswa SLTP Negeri 2 Malang dan (4) hubungan antara latar belakang pendidikano rangt ua, statuss osiale konomik eluargad enganm otivasib elajar. - Rancangan yang digunakan dalam penelitian ini adalah deskriptif korelasional. Dalam pengumpulan data alat yang digunakan adalah angket t:rtutup dimana responden tinggal memberikan tanda cek pada kolomyang $teltukan Sampel yang digunakan adalah siswa SLTp Negeri 2 Marang kelai II dengan cara m€ngambil secara acak unhrk setiap kelasnya (proportional random Teknik analisisd atay angd igunakana dalahk orelasip roduct Moment Regresi Linier Berganda. Hasil penelitianm enunjukkanb ahwas ebagianb esaro rangt ua siswas LTp Negeri2 Malangb erpendidikans edang(s MU) denganp rosentassee besa4r 2%o. Latar belakang status sosial ekonomi orang tua dengan status sosial sedang sebesa4r 0%.D an rata-ratas iswam empunyami otivasiy angt inggi (660/o). Kesimpulan dari hasil penelitian menunjukkan bahwa ada hubungan yang signifikan antara latarbelakang pendidikan orang tua dengan motivasi uetajar, ada hubungan yang sigaifikan antara latar belakang status sosial ekonomi lefuarga dengan motivasi belajar dan ada hubungan yang signifikan antaralatar belakang pendidikan oranga tua, status sosial ekonomi keluarga dengan motivasi belajar.

Penerapan metode pembelajaran kooperatif model TGT (Team Games Tournament) untuk meningkatkan minat da hasil belajar siswa pada mata pelajaran kewirausahaan kelas X Jurusan Penjualan SMK Wisnuwhardhana Malang / Umi Maghfirotin Nisa

 

ABSTRAK Nisa, Umi Maghfirotin. 2010. Penerapan Metode Pembelajaran Kooperatif Model TGT (Team Games Tournament) Untuk Meningkatkan Minat Dan Hasil Belajar Siswa Pada Mata Pelajaran Kewirausahaan Kelas X Jurusan Penjualan SMK Wisnuwardhana Malang. Program Studi Pendidikan Tata Niaga, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Dr. Wening Patmi Rahayu, S.Pd, M.M, (2) Drs. Djoko Dwi Kusumajanto, M.Si. Kata Kunci: Pembelajaran Kooperatif Model TGT (Team Games Tournament), minat belajar, hasil belajar. Pembelajaran kooperatif adalah salah satu bentuk pembelajaran yang berdasarkan faham konstruktivistik. Pembelajaran kooperatif merupakan model pembelajaran dengan sejumlah siswa sebagai anggota kelompok kecil yang tingkat kemampuannya berbeda. Dalam menyelesaikan tugas kelompoknya, setiap siswa anggota kelompok harus saling bekerja sama dan saling membantu untuk memahami materi pelajaran. Metode pembelajaran kooperatif memiliki beberapa model pembelajaran yang bervariasi, salah satu model pembelajaran kooperatif yaitu Model TGT (Team Games Tournament). Pembelajaran kooperatif model TGT (Team Games Tournament) adalah salah satu tipe atau model pembelajaran kooperatif yang dapat diterapkan, melibatkan aktivitas seluruh siswa tanpa harus ada perbedaan status, melibatkan peran siswa sebagai tutor sebaya dan mengandung unsur permainan dan reinforcement (penguatan). Berdasarkan hasil observasi di SMK Wisnuwardhana Malang, pembelajaran masih didominasi oleh guru dan kurang terpusat pada siswa. Guru hanya menjelaskan dan siswa pasif mendengarkan penjelasan guru, hal ini menyebabkan siswa kurang merespon selama kegiatan pembelajaran berlangsung karena siswa merasa bosan, jenuh, mengantuk, dan kurang dilibatkan dalam kegiatan pembelajaran. Hal ini berpengaruh pada hasil belajar siswa yang menjadi kurang optimal, ini terlihat dalam daftar nilai ulangan harian siswa, hanya 21 siswa atau 47,7% dari jumlah seluruh siswa memperoleh nilai tinggi yaitu 70 sampai 80, sedangkan 23 siswa atau 52,3% siswa yang lain mendapatkan nilai sedang yaitu 65. Penelitian ini terdiri dari siklus I dan siklus II, penelitian dilakukan untuk mengetahui penerapan pembelajaran kooperatif model TGT pada mata pelajaran kewirausahaan, hasil belajar melalui pembelajaran kooperatif model TGT, serta minat belajar terhadap pembelajaran kooperatif model TGT pada mata pelajaran kewirausahaan. Subjek penelitian ini adalah siswa kelas X Jurusan Penjualan SMK Wisnuwardhana Malang. Penilaian penelitian ini terdiri dari aspek kognitif, afektif dan psikomotorik. Hasil penelitian ini menunjukkan hasil dari aspek kognitif siswa yang tuntas belajar siklus I (75%) dan siklus II siswa yang tuntas belajar (88,4%). Sedangkan hasil dari aspek afektif siswa yang tuntas belajar 8 kelompok (35 siswa) dan siklus II siswa yang tuntas belajar 10 kelompok (43 siswa). Hasil Dari aspek psikomotorik siswa yang tuntas belajar 8 kelompok (34 siswa) dan siklus II siswa yang tuntas belajar 10 kelompok (43 siswa). Jadi dapat disimpulkan ketiga aspek diatas hasil belajar siswa mengalami peningkatan. Hasil analisis angket minat belajar pembelajaran kooperatif model TGT adalah sebelum pelaksanaan tindakan sebesar 1.014 dengan rata-rata 23,04 meningkat menjadi 1.098 dengan rata-rata 25,5 sesudah pelaksanaan tindakan kooperatif model TGT. Dari angket yang disebarkan sebelum pelaksanaan tindakan diketahui terdapat 3 siswa yang memperoleh kriteria kurang berminat, 24 siswa memperoleh kriteria berminat dan 17 siswa memperoleh kriteria sangat berminat. Sesudah pelaksanaan tindakan pembelajaran kooperatif model TGT minat belajar siswa menunjukkan peningkatan yaitu terdapat 1 siswa yang memperoleh kriteria kurang berminat, 13 siswa memperoleh kriteria berminat dan 29 siswa memperoleh kriteria sangat berminat. Dibandingkan angket yang diberikan sebelum tindakan, respon siswa setelah proses pembelajaran model TGT pada mata pelajaran kewirausahaan cenderung sangat berminat. Jadi dapat disimpulkan bahwa pembelajaran kooperatif model TGT berpotensi meningkatkan minat belajar siswa pada mata pelajaran kewirausahaan. Berdasarkan hasil penelitian ini, dapat disarankan kepada: (1) SMK Wisnuwardhana Malang, hendaknya lebih memperhatikan kebutuhan siswa akan buku-buku pelajaran agar dapat digunakan untuk memperlancar proses pembelajaran dan agar siswa mempunyai buku panduan untuk belajar. (2) Bagi guru mata pelajaran kewirausahaan SMK Wisnuwardhana Malang/guru mata pelajaran lain disarankan menggunakan model pembelajaran kooperatif model Teams Games Tournament (TGT) yang telah terbukti dapat meningkatkan minat dan hasil belajar siswa. (3) Bagi peneliti selanjutnya, diharapkan dapat dijadikan sebagai bahan informasi dan pertimbangan dalam penelitian penerapan pembelajaran kooperatif model TGT agar menjadi lebih baik.

Pengaruh perputaran kas, piutang, dan persediaan terhadap rentabilitas perusahaan tekstil dan garmen yang listing di BEI tahun 2005-2008 / Yeni Astutik

 

ABSTRAK Astutik,Y. 2010. Pengaruh Perputaran Kas, Piutang dan Persediaan Terhadap Rentabilitas Perusahaan Tekstil dan Garmen yang Listing di BEI Tahun 2005-2008. Jurusan Akuntansi. Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing : (1) Dr. Nurika Restuningdiah, S.E.,M.Si.,Ak (2) Triadi Agung Sudarto, S.E.,M.Si.,Ak Kata Kunci : Tingkat Perputaran Kas, Perputaran Piutang, Perputaran Persediaan, Rentabilitas, Rentabilitas Ekonomi. Rentabilitas perusahaan sangat penting diperhitungkan karena merupakan pengukuran kinerja dalam memperoleh laba. Salah satu pengukuran kinerja berdasarkan rentabilitas adalah melalui analisis rasio rentabilitas berdasarkan rentabilitas ekonomi. Semakin tinggi tingkat rentabilitas ekonomi, maka semakin baik keadaan perusahaan dalam menghasilkan laba. Perputaran kas, perputaran piutang dan perputaran persediaan sebagai elemen modal kerja dapat mempengaruhi panjag pendeknya waktu terikatnya dana dalam modal yang pada akhirnya akan mempengaruhi tingkat rentabilitas yang dicapai. Semakin tinggi tingkat perputaran kas, perputaran piutang dan perputaran persediaan menandakan semakin pendek waktu terikatnya modal dalam elemen modal kerja tersebut. Hal ini menunjukkan adanya efisiensi dalam penggunaan modalnya yang akan menaikkan tingkat rentabilitas yang akan dicapai perusahaan. Penelitian ini merupakan penelitian eksplanasi yang berarti menjelaskan ada tidaknya pengaruh perputaran kas, perputaran piutang, dan perputaran persediaan terhadap rentabilitas. Jenis data yaitu pooling data berupa laporan keuangan periode 2005-2008 perusahaan tekstil dan garmen, teknik pengumpulan data berupa teknik dokumentasi dan sumber data diambil dari Pusat Data Bisnis UM dan wapsite www.idx.com, periode 2005-2008. Analisis data menggunakan teknik analisis regresi linier berganda. Populasi dalam penelitian ini perusahaan manufaktur yang listing di BEI tahun 2005-2008, sedangkan sampel dari penelitian ini adalah 18 perusahaan tekstil dan garmen yang terdaftar di BEI tahun 2005-2008. Berdasarkan hasil penelitian tersebut disimpulkan secara parsial perputaran kas berpengaruh positif yang signifikan terhadap rentabilitas ekonomi dengan nilai sig t = 0.000 < 0.05, perputaran piutang berpengaruh negatif yang signifikan terhadap rentabilitas ekonomi dengan nilai sig t = 0.040 < 0.05, perputaran persediaan berpengaruh negatif yang signifikan terhadap rentabilitas ekonomi dengan nilai sig t = 0.025 < 0.05. Dan secara simultan tiga variabel ini berpengaruh terhadap rentabilitas ekonomi dengan nilai sig f = 0.000 < 0.05 Berdasarkan hasil penelitian tersebut diharapkan investor mampu mengukur hasil pengembalian investasi mereka. Bagi kreditur penelitian ini diharapkan bisa menjadi dasar sebagai pengambilan keputusan untuk menentukan lanjut atau tidaknya dalam pemberian pinjaman. Dan bagi peneliti selanjutnya agar memperhatikan faktor-faktor lain yang dapat mempengaruhi rentabilitas.

Perlindungan Hukum Teehadap Hak-hak Tersangka Pelaku Tindak Pidana Menurut KUHAP Oleh Sutini

 

Negara Indonesia adalah negara hukum. Hal ini sesuai dengan penejelasan UUD 1945y ang mengatakan"N egaraI ndonesiab erdasara tas hukum (rechtsstaat) tidak berdasarkana tas kekuasaanb elaka (machl'tslaat)".S ebagain egarah ukum lndonesima emberit empata tauj aminany ang luasa task eberadaahna k asasin ranusia yaituh ak dasary angd imiliki manusias ejakl ahir dan merupakana nugerahT uhan YangM ahaE sa. Salah satu bentuk perwujudan hak asasi manusiaadalah dalam bidang peradilanp idana.D imana tersangkad alam hal ini adalah seseorangy ang karena perbuatannyaat au keadaanyab erdasarkanb ukti permulaanp atut diduga sebagai pelakuti ndak pidana,t idak bolehd ianggapb ersalahs ebeluma dap utusanp engadilan yangm empunyaik ekuatanh ukum tetap yang menyatakanb ahwa ia bersalah. Demikian juga dalam proses penyidikan yang meliputi tindakan-tindakan penangkapanp,e nggeledahanp, enahanand an penyitaan juga harus selalu memperhatikahna ka sastie rsangkdaa nb erpedomapna dah ukumy angb erlaku. Namun dalam prakteknya sebagian orang mengatakan adanya oknum penyidik yang melakukan kekerasand an kesewenang-wenangadna lam bentuk penekananp,e maksaans erta pemukulanu ntuk mengejarp engakuanb ersalahd ari tersangkHa.a l ini berartit idakm enjunjungti nggih aka sasmi anusiad anb ertentangan dengan hukum yang berlaku. Untuk itu diadakan kajian mengenai perlindungan hukumt erhadaph ak-hakt ersangkap elakut indak pidanam enurutK UHAP Kajian ini bertujuan untuk mendiskripsikanp erlindunganh ukum terhadap hak-hak tersangka pelaku tindak pidana menurut KUHAP. Ada 2 hal yang dideskripsikasne hubungadne nganp erlindunganh ukum terhadaph ak-hakt ersangka pelakuti ndak pidanam enurutK UIIAP, yaitu (1) hak-hakt ersangkam enurutK UHAP dan( 2) pelaksanaapne rlindunganh ukumt erhadapte rsangkam enurutK UHAP. Metodey ang digunakana dalahs tudi kepustakaan(l ibrary reseurch)d engan menganalisisd ata kepustakaans ecara yuridis normatif yaitu pengkajian pada peraturanp erundang-undangayann g erat kaitannyad engan skripsi ini. Sedangkan metodete rsebumt eliputi metode induktif, yaitu untukm enarikk esimpuland atay ang bersifatk hususd enganc aram enganalisids atay angb ersifatu mum.M etoded eduktif digunakan untuk menarik kesimpulan data yang bersifat umum dengan cara menganalisisd ata yang bersifat khusus,d an metodea nalisak ornparatifd igunakan membandingkafna ktor-faktort ertentuy ang berhubungand engans ituasid an yang dikaji dengan membandingkan satu faktor dengan faktor lainnya. Hasil kajian menunjukkan bahwa hak-hak tersangka pelaku tindak pidana dari kegiatan penyelidikan sampai penyidikan yang meliputi tindakan penahananp, enggeledahand an penyitaanm enurut KUHAP sangat dijunjuntgin ggi dan pelaksanaanp erlindungan hukum terhadppt ersangkap elaku tindakp idanao leh penyelidik dan penyidik, juga telah diatur secarar inci dalam Sebagasi arand alam rangkam enghormathi ak asasim anusiak hususnyah ak asatsei rsangkpae lakut indakp idanad alamp enyelidikadna np enyidikanh aruss esuai dan menjunjung tinggi hukum yang berlaku dan untuk lebih mernfungsikan sepenuhnpyae ranank epolisians ebagapi enyelidik dan penyidik perlu ditingkatkan profesionalismek,u alitas, etika dan rnoral penyelidik dan penyidik. Hal ini diperlukaunn tukm engirnbangsie makinc anggihnyak e.iahatatnin, gginyak esadaran hukumra kyatd ans emakinb anyaknyag odaany anga da.

Pembelajaran berbasis inkuiri model siklus belajar untuk meningkatkan keterampilan proses dan prestasi belajar fisika siswa kelas 8D SMP Negeri 18 Malang tahun ajaran 2009/2010 / Susieni

 

ABSTRAK Susieni. 2010. Pembelajaran Berbasis Inkuiri Model Siklus Belajar untuk Meningkatkan Keterampilan Proses dan Prestasi Belajar Fisika Siswa Kelas 8D SMP Negeri 18 Malang Tahun Ajaran 2009/2010. Skripsi, Program Studi Pendidikan Fisika, Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Muhardjito, M. S, (II) Drs. Asim, M. Pd Kata kunci: inkuiri, siklus belajar, keterampilan proses, prestasi belajar Berdasarkan pengamatan pada kelas 8D SMP Negeri 18 malang, tampak bahwa pada saat pembelajaran berlangsung siswa cenderung ramai, ketika diajak melakukan praktikum siswa tampak senang tetapi ada beberapa siswa yang belum mengerti nama alat dan cara menggunakan alat tersebut sehingga siswa tidak dapat mengambil data secara benar dan teliti. Hal ini mengindikasikan bahwa keterampilan proses siswa masih rendah. Dari hasil ulangan materi Bunyi, nilai rata-rata kelas 8D hanya mencapai 54,4. Hal ini mengindikasikan bahwa prestasi belajar siswa masih rendah karena nilai rata-rata yang di capai masih di bawah KKM (Kriteria Ketuntasan Minimum) yang ditetapkan oleh sekolah yaitu 70,0. Rendahnya keterampilan proses dan prestasi belajar siswa ini diatasi dengan cara mengubah pembelajaran konvensional menjadi pembelajaran inkuiri berbasis model siklus belajar. Model siklus belajar ini memiliki lima tahapan yang terencana dan terarah yaitu pendahuluan (engagement), eksplorasi, eksplanasi, elaborasi dan evaluasi. Dampak pembelajaran berbasis inkuiri model siklus belajar terhadap peningkatan keterampilan proses dan prestasi belajar fisika siswa diteliti dengan melakukan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam dua siklus. Siklus I pokok bahasan perambatan cahaya dan cermin datar. Siklus II pokok bahasan cermin cekung dan cermin cembung. Perangkat pembelajaran yang dikembangkan adalah Rencana Pelaksanaan Pembelajaran (RPP), LKS, dan media pembelajaran. Adapun instrumen yang dikembangkan dalam penelitian ini yaitu lembar observasi keterampilan proses, tes prestasi berbentuk soal obyektif, dan lembar observasi pelaksanaan pembelajaran siklus belajar. Hasil yang diperoleh dari penelitian ini menunjukkan peningkatan semua aspek keterampilan proses yang diajarkan dari siklus I ke siklus II. Prestasi belajar fisika siswa juga mengalami peningkatan sebesar sebesar 14,6 point dari nilai rata-rata ulangan pada siklus I 65,4 menjadi 80,0 pada siklus II, dengan peningkatan persentase jumlah siswa yang tuntas belajar dari 42,5% pada siklus I menjadi 80% di akhir siklus II.

Manajemen pelatihan kejuruan otomotif (studi kasus di UPT Pelatihan Kerja Singosari Malang) / Indah Iswidia

 

ABSTRAK Iswidia, Indah. 2010. Manajemen Pelatihan Kejuruan Otomotif (Studi kasus di UPT Pelatihan Kerja Singosari Malang. Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Imron Arifin, M.Pd, (II) Dra. Maisyaroh, M.Pd Kata Kunci : manajemen pelatihan, kejuruan otomotif. Pendidikan merupakan kegiatan yang ditujukan untuk memanusiakan manusia dalam membentuk dirinya menjadi suatu pribadi yang utuh. Di dalamnya termasuk kegiatan-kegiatan belajar yang disengaja ataupun yang tidak disengaja, pendidikan formal, informal, dan nonformal. Pelatihan merupakan sebagian saja dari pada pendidikan yang lebih menitikberatkan pada segi-segi keterampilan kerja individu guna memperbaiki unjuk kerja dalam pekerjaannya. Pada hakekatnya pendidikan dan pelatihan mempunyai tujuan yang sama yaitu meningkatkan pengetahuan (knowledge), keterampilan (skill), dan nilai/sikap (attitude). Manajemen pelatihan adalah suatu proses perencanaan, pengorganisasian, pelaksanaan, dan evaluasi sumber daya secara efektif dan efisien untuk meningkatkan keterampilan seseorang agar kinerjanya meningkat. Kinerja disini diartikan sebagai meningkatnya prestasi kerja yang lebih efektif dan efisien bagi dirinya sendiri maupun organisasinya. Upaya peningkatan keterampilan tersebut dalam rangka menyiapkan calon tenaga kerja yang ahli dan kompeten sesuai keterampilannya. Di Indonesia misalnya, pada pendidikan formal telah digagas dan dijalankan pendidikan vokasional. Pada bagian lain, pemerintah menggagas lahirnya Balai Latihan Kerja Industri (BLKI) pada setiap provinsi. Di Jawa Timur lembaga ini berada di Singosari Kabupaten Malang yang kini berubah nama menjadi Unit Pelaksana Teknis (UPT) Pelatihan Kerja. Oleh sebab itu, maka dilakukan suatu penelitian untuk mengetahui manajemen pelatihan di UPT Pelatihan Kerja Singosari Malang khususnya pada kejuruan otomotif, dengan fokus serta tujuan penelitian diantaranya tentang (1) perencanaan; (2) pengorganisasian; (3) pelaksanaan; dan (4) penilaian pelatihan kejuruan otomotif.    Penelitian ini dilakukan dengan pendekatan kualitatif, yaitu suatu metode penelitian yang tidak menguji hipotesis melainkan memaparkan dan mengolah data. Jenis penelitian ini adalah studi kasus karena terdapat satu kasus pada satu objek penelitian, yaitu UPT Pelatihan Kerja Singosari Malang. Dalam penelitian ini, peneliti sendiri lah yang berperan sebagai instrumen kunci, dengan subjek penelitian adalah kepala UPT Pelatihan Kerja, ketua kejuruan otomotif, dan instruktur kejuruan otomotif. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian pada saat wawancara, tindakan yang dilakukan oleh subjek penelitian, dan dokumen yang berkaitan dengan pelatihan kejuruan otomotif. Setelah data tersebut diperoleh kemudian dilakukan pengecekan keabsahan data dengan menggunakan metode trianggulasi, i     ii    ketekunan pengamatan, pemeriksaan sejawat melalui diskusi, dan pengecekan anggota. Hasil penelitian menunjukkan bahwa manajemen pelatihan kejuruan otomotif di UPT Pelatihan Kerja Singosari Malang, meliputi tahapan-tahapan yaitu perencanaan, pengorganisasian, pelaksanaan, dan penilaian. Perencanaan pelatihan meliputi rekrutmen peserta pelatihan dan persiapan rencana pengajaran yang terdiri dari pembuatan (1) ikhtisar program pelatihan; (2) matriks program pelatihan; dan (3) jadwal pelatihan. Kegiatan pelatihan kejuruan otomotif berada di bawah tanggung jawab ketua kejuruan yang membawahi beberapa instruktur. Pada kejuruan otomotif seluruh instruktur berjumlah sembilan orang. Pelaksanaan pelatihan diterapkan melalui kegiatan-kegiatan yang dilakukan di ruang teori, ruang praktek, dan lapangan. Adapun kegiatan tersebut meliputi kegiatan penunjang yang terdiri dari (1) kegiatan FMD (fisik, mental, dan disiplin); (2) kegiatan apel pagi dan apel siang; (3) kegiatan senam. Dilanjutkan dengan pelaksanaan kegiatan inti yang terdiri dari (1) kegiatan teori dan (2) kegiatan praktek. Pada kegiatan akhir terdiri dari (1) kegiatan on the job training dan (2) uji kompetensi. Penilaian yang dilakukan pada pelatihan kejuruan otomotif ini meliputi evaluasi teori dan evaluasi praktek. Aspek yang dinilai meliputi aspek kemampuan pengetahuan atau teori, keterampilan atau praktek, kedisiplinan, kehadiran, sikap, kerjasama, dan keselamatan kerja. Laporan penilaian yang diberikan dalam bentuk sertifikat pelatihan dan Note Book hasil Uji Kompetensi di Tempat Uji Kompetensi (TUK). Berdasarkan hasil penelitian ini, dapat disarankan bagi (1) Pengelola Jurusan Administrasi Pendidikan hendaknya hasil penelitian ini menjadi tambahan referensi bagi penelitian dalam ruang lingkup pendidikan non formal seperti pelatihan yang saat ini lebih kecil dari pada referensi penelitian dalam lingkup pendidikan umum; (2) Kepala UPT Pelatihan Kerja hendaknya dilakukan perubahan terhadap kegiatan on the job training (OJT) yang dahulu sifatnya tidak wajib menjadi wajib diikuti oleh peserta pelatihan sehingga dapat menghasilkan lulusan yang kompeten di bidangnya; (3) Instruktur Kejuruan Otomotif hendaknya mempertahankan ciri khas pada pelatihan yaitu pembentukan sikap (attitude) peserta pelatihan, dengan demikian pelatihan dapat dioptimalkan mengingat potensi yang dimiliki instruktur sangat tinggi, sehingga dapat meningkatkan daya saing dalam menghadapi dunia kerja; dan (4) Peneliti lain hendaknya dapat melanjutkan penelitian yang sejenis pada berbagai aspek lain dengan latar yang berbeda yang nantinya dapat bermanfaat untuk diteliti.

Pembuatan PC router freebsd pada jaringan komputer di SMP Negeri 2 Bangil Kabupaten Pasuruan / Dian Rachmawati

 

Kata kunci : FreeBSD, Router, DHCP Server. Teknologi Informasi atau Information Technology saat ini sudah menjadi kebutuhan mendasar dalam setiap organisasi atau lembaga pendidikan, hal ini terbukti saat ini hampir tidak ada organisasi bisnis atau perusahaan bahkan instansi pendidikan yang tidak menggunakan teknologi informasi khususnya komputer. Dengan perkembangan teknologi komputer yang sangat pesat ini, SMP Negeri 2 Bangil bisa dibilang tidak ketinggalan dengan perkembangan teknologi, karena di SMP Negeri 2 Bangil sudah tersedia Laboratorium Komputer. Pada Laboratorium Komputer di SMP Negeri 2 Bangil sudah terkoneksi internet yang menggunakan Speedy, sedangkan pada Ruang Tata Usaha belum terkoneksi jaringan Internet sama sekali. Melihat kenyataan ini penulis ingin membangun jaringan Intranet pada lingkungan SMP Negeri 2 Bangil yang terkoneksi dengan Speedy, guna mengoptimalkan penggunaan internet dengan menggunakan PC Router berbasis FreeBSD. Pada perancangan PC router ini diawali instalasi FreeBSD dilanjutkan konfigurasi IP address, kemudian mengkonfigurasi DHCP Server. Dari hasil pengujian PC router FreeBSD secara keseluruhan diperoleh hasil bahwa piranti sesuai dengan rancangan, yaitu: (1) Membagi kedua jaringan Tata Usaha dan Lab Komputer untuk mencegah penyebaran virus atara kedua jaringan dan mengamankan file sharing pada Ruang Tata Usaha agar tidak bisa diakses dari Lab.Komputer, (2) mengaktifkan DHCP Server pada jaringan Lab.Komputer. Dengan melihat hasil yang dicapai, untuk pengembangan lebih lanjut disarankan: (1) Perlu dilakukan upgrade FreeBSD ke versi yang terbaru agar mendapatkan penyempurnaan sistem dan stabilitas dari PC Router, (3) Upgrade PC Router yaitu penambahan memory dan kapasitas hardisk untuk mendukung kinerja PC Server.

Radikalisasi Petani Pedesaan Jawa (Studi Kasus Sengketa Tanah di Desa Cepoko Kabupaten Ngawi - Jawa Timur) Tahun 1992-1999 Oleh Mariana Kushariyati

 

Tanah adalah harta yang paling berharga bagl kaum tani' dimana tanah ,n*fut rpat haCr pet;niuntul melakukan kegiatan ber6ni dan mencari ot*fi. fuo- rani seringtati berada pada posisi yang kurang menguntungkan dalam masalah p"rtanahan. Keadaan ini disebabkan karena petani kurang urernehamaki anh ukum agraria Permasalahatna nahy ang dilami-9leh petanu tiUitr tanyat merugikan fttani. Perlawanan p€tani yang disebabkan -karena ketidakadlan rn"n?o*ng petanj untuk melalrukan prlawaqan fepada ;il;th Petani yag 6"tuOu di Desa Cepoko Kabupaten Ngawi.yang tdut** perlaanans ecrab ersama-samma ernperjuangkanh aknya1 e1k!wt r'*o'o*g*berkorban.Perlawananyangdilakukanolehparapetanipada tahun 199r-1999 itu lermasuk sualu kejadian yang langka kargna saat itu l.g,u titu berada dalam keadaan yarrg tidak memiliki kebebasan untuk *"o!af*nu" pendapat. Kebsranian petari untuk melawan pemerintah yang t**** p"O" saat iiu adalah suatu hal yag panlas ntuk diunglapkan' roiuan dari tulisan ynag berjudul * Radjkalisasj Petanj Ped€saanja wa (Studi X.asus Sengketa fanafr Ai Desa Cepoko Kabupatetn Nggwi Jawa iiln*) f*,* w9r-19g9- ini adalah untuk mengetahuip ermasalahany ang t rj# *ruto masyarakat petani Desa gtpoto dergan pemerintah yang b.i;fitt denganm asalahT anah Gedong' Permasalahany ang akan diangkat datamtu tisan'ini adalah apakahy ang melatarbelakangdt ari sengketat anah yangm elsatkan masyarakatd enganp ihatr,p eTerintatL bagaimanata n-ggapa" atau reaksi dan masyarakat deia terhadap kebejakan yang,diambil oleh pemerintah berkartan dengan Tanah 9"1*g' setq bagaimanakah ienyelesa,any ang diambil oleh pemerintah dalam rangka menyelesaikan ffiasalah yang berkailand engans engketata nah' Dalam rangka mencari daalang birkaitan engan sengketalanah ini mak penulis meng;makan pendekatan kualitxif untuk morggali informasi dari r*trr Onuf rng didapatd ari parap endudukd sad an pra perangkal.desyaa g tsrlibai dan m""gaut"i permasatitran tersebut' Metede yang digunakan adalahd enganw awancaraie rhadaps umberd gnnagnd iperkual oleh datadata y'-m-iiea dsitdt apit dari dokumentasyi angb erkitan dgnSanp enelltig' y'angd iperolehd ari peneliiiai ni diketahubi ahwad alamm asalayl ang berkenaand ingan sengketaia nah masyarkat pelani di Desa Cepoko secara bersama-samab erjuang mtuk mendapatkank embali tanah lahan garapan msreka yang terampas oleh pihak swasta. Perlawanan yang dilakukan oleh para petani ini dapat dilakukan tidak lepas dari dukungan dan partisipasi dari para tokoh desa yang memimpin mereka rmruk berjuang. Ketelatenan dan ketepatan arah ttmtulan yang dilakukan oleh para petani membawa keberhasilany ang diwujudkan dengm keluarnyas urat dari pemerintahu antuk menindaklanjuti tunutan masyarkat desa. Wujud dari keberhasilan dari masyarkal itu adalah dengan trrumla ssrtifikat sebagai bsmuk sah kepemilikan tanah oleh para petani. Sertifikat tanah yang diadapatkm merupahan butti sah yang memiliki kekuatan hukum. Berdasarkan penelitian ini dapat diketahui bahwa pengetatruana kan hukurn sangatp enting dimiliki oleh seluruh masyarakal teruatama oleh paetani. Pihak pemerintah harusnya lebih memperhatikan kepentingand an melakukan sosia.lisaai kan pentingnyaa spek hukum dalam kehidupan serta bertindak adil terhadap masyarkat kecil, dalam hal ini adalah perani yang seringltali dilern.palkand alan situasi dan kondisi yang kurang menguntungkand an selalu dirugikan. Peristiwa tahun' 1992-1999y ang berkailsn dengan seng!,sta tarlah ini hendaknya menjadi pelajaran bagl pemerintah sendiri ataupun bagi petani yang pada umumnya untuk lebih beranim emperjungkanb aknyas elamam asih dalamj alur yag benard an sesuai dengan hukum yang bedaku.

Perbedaan penerapan metode ceramah (konvensional) dan pendekatan kontekstual model bertanya (questioning) dalam meningkatkan hasil belajar siswa pada mata pelajaran ekonomi kelas X SMAN 9 Malang (dalam pembahasan materi konsumsi dan investasi) / Tona Aktodhiarama

 

ABSTRAK Aktodhiarama, Tona. 2010. Perbedaan Penerapan Metode Ceramah (Konvensional) dan Pendekatan Kontekstual Model Bertanya (Questioning) Dalam Meningkatkan Hasil Belajar Siswa Pada Mata Pelajaran Ekonomi Kelas X SMAN 9 Malang (Dalam Pembahasan Materi Konsumsi dan Investasi). Skripsi, Program Studi Pendidikan Ekonomi dan Koperasi Jurusan Ekonomi Pembangunan Fakultas Ekonomi Universitas Negeri Malang. Pembimbing : (I) Dr. Agung Haryono, S.E., M.P, (II) Agus Sumanto, S.E, M. SA. Kata-Kata Kunci : Metode Ceramah (Konvensional), Pendekatan Kontekstual Model Questioning, Hasil belajar Ekonomi. Upaya untuk memperbaiki mutu proses belajar mengajar serta hasil belajar tidaklah cukup dengan perubahan kurikulum saja, melainkan perlu dilihat siapa yang ikut terlibat dalam proses belajar mengajar tersebut dan pendekatan yang di gunakan kepada siswa. Proses belajar mengajar tentunya melibatkan banyak faktor antara lain: siswa, guru, minat belajar siswa, metode dan pendekatan yang di gunakan dan tentunya orang tua juga sangat mendukung tercapainya tujuan yang dicita-citakan, khususnya peningkatan hasil belajar siswa. Proses belajar-mengajar perlu dilakukan dengan tenang dan menyenangkan. Hal tersebut tentu akan menuntut aktivitas dan kreativitas guru dalam menciptakan lingkungan yang kondusif. Proses belajar-mengajar dikatakan efektif apabila seluruh peserta didik terlibat secara aktif, baik mental, fisik maupun sosial dalam pendidikan. Pelaksanaan proses belajar mengajar di SMA Negeri 9 Malang khususnya mata pelajaran Ekonomi seringkali pembelajaran membosankan dan masih menggunakan metode pembelajaran konvensional yaitu metode ceramah yang bersifat berpusat pada guru (teacher centered), sehingga siswa cenderung pasif dan hanya siswa tertentu yang mau aktif. Maka dari itu peneliti akn mencoba menerapkan pendekatan kontekstual model bertanya (questioning). Untuk meningkatkan hasil belajar siswa. Jenis penelitian ini adalah eksperimen semu (quasi experiment) sebab penelitian ini menggunakan dua kelas, satu kelas sebagai kelas eksperimen dan satu kelas sebagai kelas kontrol. Kelas eksperimen dalam penelitian ini adalah kelas yang dalam proses pembelajaran menggunakan Pendekatan Kontekstual model Bertanya (Questioning), sedangkan kelas kontrol adalah kelas yang dalam proses pembelajarannya menggunakan metode ceramah (Konvensional). Rancangan penelitian yang digunakan dalam penelitian ini adalah Nonequivalent Control Group Design dengan pre tes dan post tes, serta pemilihan kelompok sampel yang dilakukan dengan dipilih 2 kelas dengan teknik purposive sampling. Hal ini dilakukan dengan pertimbangan bahwa kedua kelas tersebut memiliki potensi yang hampir sama. Instrumen yang digunakan dalam penelitian ini adalah silabus dan RPP, wawancara, lembar observasi kegiatan guru dalam kelas, soal pre tes, soal post tes, soal tugas kelompok dan catatan lapangan. Hasil belajar siswa diukur berdasarkan hasil pre test dan post test. Hasil belajar siswa yang diajar dengan pendekatan Bertanya (Questioning) lebih tinggi dibandingkan siswa yang diajar dengan metode konvensional. Hal ini dibuktikan dengan adanya nilai rata-rata kelas eksperimen setelah diberi perlakuan pada saat post test yaitu 82.82, sedangkan rata-rata kelas kontrol setelah diberi perlakuan pada saat post test yaitu 76.21. Setelah di adakan perlakuan dan post test maka nilai dari kelas eksperimen dan kelas kontrol berbeda secara signifikan. Dapat di simpulkan bahwa kedua rata – rata tidak identik karena nilai Sig. (0,000) < 0,05. Keadaan ini menunjukkan bahwa pendekatan kontekstual model bertanya (Questioning) dapat menghasilkan hasil belajar yang tinggi. Dengan menggunakan pendekatan kontekstual model bertanya (questioning) siswa dapat meningkatkan hasil belajarnya dengan memilih metode dan pendekatan pembelajaran yang menjadikan siswa lebih aktif dan tidak membosankan siswa dalam mengikuti kegiatan pembelajaran di dalam kelas. Sehingga dapat mendukung kegiatan belajar di kelas, bagi Guru dapat menerapkan pendekatan kontekstual model bertanya dalam kegiatan belajar mengajar untuk meningkatkan hasil belajar siswa. Bagi pihak SMA N 9 Malang perlu kiranya penelitian ini dapat digunakan sebagai bahan pertimbangan dalam upaya meningkatkan keterampilan mengajar guru yang dapat mendukung hasil belajar siswa, Kepada peneliti lain dapat menggunakan populasi dan sampel penelitian yang lebih luas serta dengan materi yang berbeda agar mendapatkan data yang lebih baik dalam penelitian tentang pendekatan kontekstual model bertanya (Questioning).

Fungsi komunikatif bahasa Jawa dan bahasa Indonesia dalam konteks kedwibahasaan kerabat Kraton Kasultanan Yugyakarta / oleh Pranowo

 

Pengaruh kondisi sosial ekonomi dan pengetahuan terhadap perilaku anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan sebagai upaya pelestarian hutan RPH Gunung Tukul Desa Suru Kecamatan Sooko Kabupaten Ponorogo / Aprilia Dwi Jayanti

 

ABSTRAK Jayanti, Aprilia Dwi. 2010. Pengaruh Kondisi Sosial Ekonomi dan Pengetahuan Terhadap Perilaku Masyarakat Anggota MPSDH Sido Makmur Dalam Pelaksanaan Budidaya Tanaman Bawah Tegakan Sebagai Upaya Pelestarian Hutan RPH Gunung Tukul Desa Suru Kecamatan Sooko Kabupaten Ponorogo. Skripsi, Jurusan Geografi FIS Universitas Negeri Malang. Pembimbing (I) Dra. Yuswanti Ariani Wirahayu, M.Si, (II) Drs. Marhadi Slamet Kistiyanto, Msi. Kata kunci : kondisi sosial ekonomi, pengetahuan, perilaku. Hutan di RPH Gunung Tukul tetap mengalami pencurian meskipun telah diadakan budidaya tanaman bawah tegakan. Jika dilihat dari kondisi masyarakat pengelolanya yaitu anggota MPSDH Sido Makmur yang latar belakang pendidikan pendapatan dan pengetahuannya beragam maka perilakunya juga beragam. Oleh karena itu perlu adanya penelitian tentang seberapa besar hubungan dari latar belakang sosial ekonomi yakni tingkat pendidikan, serta pendapatan terhadap tingkat pengetahuan masyarakat, dan besarnya pengaruh dari pengetahuan itu terhadap perilaku masyarakat dalam pelaksanaan budidaya tanaman bawah tegakan sebagai upaya untuk pelestarian hutan. Penelitian ini bertujuan untuk mengetahui 1) pengaruh antara tingkat pendidikan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, 2) pengaruh pendapatan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, dan 3) pengaruh pengetahuan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan. Metode penelitian yang digunakan survey dengan sampel yang diambil secara proporsional dari masing-masing KKP(Kelompok Kerja Prayasawana). Untuk penentuan sampel diambel secara random. Teknik pengambilan data menggunakan metode observasi, dokumentasi dan kuesioner. Analisis data yang digunakan dalan penelitian ini adalah analisa tabulasi dan statistik dengan regresi berganda dan korelasi product moment pearson. Hasil penelitian menunjukkan: 1) terdapat pengaruh yang signifikan antara tingkat pendidikan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, 2) terdapat pengaruh yang signifikan antara pendapatan dengan perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, 3) terdapat pengaruh yang signifikan antara pengetahuan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan. Berdasarkan hasil penelitian ini, dapat disarankan untuk meningkatkan pendidikan dengan pemberian contoh oleh tokoh masyarakat dalam mengikuti penyuluhan oleh Perhutani. Untuk meningkatkan pendapatan adalah meningkatkan hasil budidaya tanaman bawah tegakan dengan mendatangkan penyuluh dari dinas pertanian. Untuk meningkatkan pengetahuan harus ada penyuluhan lebih intensif yang disertai simulasi-simulasinya sehingga masyarakat lebih mudah memahaminya.

Pembelajaran kontekstual pola pemberdayaan berpikir melalui pertanyaan (PBMP) untuk meningkatkan kemampuan berpikir kritis dan hasil belajar fisika siswa kelas X.1 SMAN 1 Tumpang / Sri Handayani Fajarwati

 

ABSTRAK Fajarwati, Sri Handayani. 2010. Pembelajaran Kontekstual Pola Pemberdayaan Berpikir Melalui Pertanyaan (PBMP) untuk Meningkatkan Kemampuan Berpikir Kritis dan Hasil Belajar Fisika Siswa Kelas X.1 SMAN 1Tumpang Tahun Ajaran 2009/2010. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Muhardjito, M.S, (II) Drs. Asim, M.Pd. Kata kunci : Pembelajaran kontekstual, PBMP, kemampuan berpikir kritis, hasil belajar fisika Berdasarkan observasi awal yang dilakukan di kelas X.1 SMAN 1Tumpang, diperoleh informasi metode yang digunakan oleh guru adalah metode klasikal dengan proses pembelajaran berpusat pada guru. Guru menyampaikan materi secara ceramah dan memberikan catatan, sedangkan siswa hanya mendengarkan sambil mencatat. Metode klasikal yang diterapkan oleh guru dapat menghambat kemampuan berpikir kritis siswa dalam memecahkan masalah-masalah fisika dalam kehidupan sehari-hari. Model pembelajaran yang cocok diterapkan untuk dapat menumbuhkan kemampuan berpikir kritis siswa adalah pembelajaran kontekstual pola pemberdayaan berpikir melalui pertanyaan (PBMP). Model pembelajaran PBMP memungkinkan siswa untuk mau mengajukan pertanyaan dan menjawab pertanyaan dalam proses belajar mengajar. Penelitian ini bertujuan untuk mendeskripsikan pembelajaran kontekstual pola pemberdayaan berpikir melalui pertanyaan (PBMP) sehingga dapat meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas X.1 di SMAN 1 Tumpang tahun ajaran 2009/2010. Jenis penelitian yang digunakan adalah penelitian tindakan kelas (PTK) dengan menggunakan pendekatan kualitatif. Kegiatan pembelajaran terdiri dari 2 siklus, setiap siklus terdiri dari kegiatan perencanaan, pelaksanaan, observasi dan refleksi. Pengambilan data dilakukan dengan observasi, tes dan catatan lapangan. Penelitian dilaksanakan di kelas X.1 SMAN 1 Tumpang dengan jumlah siswa 38 orang. Hasil analisis pada siklus I dan siklus II menunjukkan berpikir kritis dan hasil belajar fisika siswa kelas X.I SMAN 1 Tumpang mengalami peningkatan. Kemampuan berpikir kritis mengalami peningkatan dari 49,7 pada siklus I menjadi 76,82 pada siklus II. Peningkatan hasil belajar fisika siswa dapat dilihat dari meningkatnya aspek kognitif dari 74 pada siklus I menjadi 86 pada siklus II, aspek afektif 51,7% pada siklus I menjadi 79,4% pada siklus II, dan aspek psikomotorik dari 56% pada siklus I menjadi 80,9% pada siklus II. Peningkatan kemampuan berpikir kritis dan hasil belajar fisika siswa di atas dipengaruhi oleh peningkatan keterlaksanaan pembelajaran yaitu 69,7% pada siklus I menjadi 100% pada siklus II. Berdasarkan keterangan di atas, dapat disimpulkan bahwa pembelajaran kontekstual pola Pemberdayaan Berpikir Melalui Pertanyaan (PBMP) mampu meningkatkan kemampuan berpikir kritis siswa dan hasil belajar fisika siswa.

Kompetensi pedagogik guru pendidikan kewarganegaraan yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro / Dinar Cindarbumi

 

ABSTRAK Cindarbumi, Dinar. 2010. Kompetensi Pedagogik Guru Pendidikan Kewarganegaraan yang Bersertifikat Pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro. Skripsi, Program Studi S1 Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial Universitas Negeri Malang. Pembimbing I: Drs. H. Suparlan, M.Si. Pembimbing II: Hj. Yuni Astuti, SH, M.Pd. Kata Kunci: Kompetensi Pedagogik, Sertifikat Pendidik Pemberian sertifikat pendidik melalui program sertifikasi pendidik merupakan salah satu upaya yang ditempuh pemerintah untuk meningkatkan mutu pendidikan di Indonesia. Guru dipersyaratkan memiliki kualifikasi akademik minimal S-1 atau diploma IV yang relevan dan menguasai kompetensi sebagai agen pembelajaran. Salah satu kompetensi yang harus dipenuhi adalah kompetensi pedagogik. Tujuan penulisan ini adalah: (1) Untuk mendeskripsikan karakteristik guru profesional, (2) Untuk mendeskripsikan kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro dalam menyusun Rencana Pelaksanaan Pembelajaran, (3) Untuk mendeskripsikan kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro dalam pelaksanaan pembelajaran, (4) Untuk mendeskripsikan kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro dalam pelaksanaan evaluasi pembelajaran. Penelitian ini merupakan penelitian deskriptif kualitatif. Untuk mencapai tujuan tersebut, data dikumpulkan dengan cara observasi non partisipatif, studi dokumentasi serta wawancara. Teknik análisis data yang digunakan adalah model análisis interaktif. Penelitian dilakukan di SMK Kabupaten Bojonegoro dengan obyek penelitian adalah guru PKn yang bersertifikat pendidik, yaitu guru PKn di SMKN 1 Bojonegoro, SMKN 2 Bojonegoro, SMKN 3 Bojonegoro dan SMK PGRI 1 Bojonegoro. Dari hasil analisis menunjukkan bahwa, karakteristik guru profesional antara lain adalah harus memenuhi kualifikasi akademik S-1 atau D-IV, memiliki kompetensi yang dipersyaratkan, mampu menjadi teladan bagi siswa, mampu berkomunikasi dengan baik. Seorang guru harus mempunyai kepribadian yang baik karena tingkah laku guru akan ditiru oleh siswanya. Komunikasi merupakan cara seseorang berinteraksi dengan orang lain. Dengan memiliki kemampuan berkomunikasi yang baik, seorang guru dapat dengan mudah memberikan pengetahuan yang dimikilinya kepada siswa sehingga siswa dapat dengan mudah mencapai kompetensi yang diharapkan. Disamping memiliki kemampuan-kemampuan diatas, seorang guru wajib memiliki kompetensi pedagogik. Kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro sudah sangat baik. Rencana Pelaksanaan Pembelajaran telah tersusun berdasarkan kriteria yang ditentukan. Penyusunan tujuan pembelajaran tidak menimbulkan penafsiran ganda. Pemilihan materi ajar sesuai dengan tujuan pembelajaran. Skenario pembelajaran tercermin tiap langkah mulai dari awal, inti dan penutup. Pelaksanaan pembelajaran sesuai dengan skenario pembelajaran. Kegiatan pembelajaran diawali dengan mempersiapkan siswa dan melakukan kegiatan apersepsi. Dan diakhiri dengan kegiatan refleksi dan penarikan kesimpulan. Evaluasi hasil belajar dilaksanakan untuk mengecek pemahaman siswa. Instrumen-instrumen penilaian disusun untuk mempermudah proses penilaian terhadap siswa dan untuk mengetahui tingkat kesulitan siswa. Berdasarkan hasil penelitian ini, dapat disarankan kepada para guru untuk mempersiapkan diri menuju program sertifikasi pendidik agar pemberian sertifikat pendidik dapat menjadi tolok ukur kemampuan guru dalam melaksanakan tugas sehari-hari. Selain itu untuk bagi para peneliti yang ingin melakukan penelitian agar dilakukan penelitian lebih lanjut misalnya mengenai kompetensi profesional, sosial atau kepribadian. Karena kompetensi-kompetensi tersebut juga sangat menentukan kemajuan pendidikan di negara Indonesia.

Pelaksanaan Pembuktian Tindak Pidana Perkosaan Dalam Sidang di Pengadilan Negeri Malang Oleh Catur Nurharyanti

 

Perkosaamn erupakanb entukk ejahatany ang selalum endapast orotand alammasyarakaPt.e ngadilanN egeri sebagait empat untuk mencan keadilan,s eringkalidituntut untuk dapat menuntaskan kasus perkosaan dengan tidak menempatkanpelakud an korban dalam posisi yang berat sebelah.D alarn persidanganp erkaraperkosaanh,a kims eringd ihadapkanp adap ermasalahayna ngc ukupb eraty akni padatahap pembuktian. Tujuan dari penelitian ini adalah untuk mengkaji (l) prosespersidanganp erkara perkosaand i Pengadilan,( 2) Upaya penuntutanp erkaraperkosaano leh Penuntut Umum, (3) Alat-alat bukti yang digunakan dalampembuktianp erkarap erkosaan(,4 ) Kendala-kendalaya ng di hadapih akim dalampembuktiatnin dakp idanap erkosaand alams idangd i pengadrlan. Metoded alam penelitiani ni menggunakapne ndekatann ormatify uridis danlenisnya adalah studi kasus. Kegiatan pengumpulan data dilakukan denganmenggunaliamn etodew awancarad an dokumentasiA. nalisa data yang digunakanyaitu metoded eskriptif,s edangkanm odel analisad ata melalui reduksi data, sajiandata dan penarikan kesimpulan. Untuk menjaga kesahihan data, penelitian inidilakukans ecarat eliti dan cermat.p erpanjangakne hadirand i lokasi penelitiand ankegiatatnr iangulasi. Hasil penelitianm enunlukkanb ahwa prosesp ersidanganp erkarap erkosaanpadad asarnyas amad enganp rosesp ersidanganp erkarap idanal ainnya,h anyas aiadalam perkarap erkosaanp rosesp ersidangannybae rsifat tertutupm engingatk asusperkosaanm erupakana ib yang menyangkuht argad in wanita sehinggati dak layakjika diketahuio leh publik. Dalam upayap enuntutans, eorangp enuntutu mum harusdapatm embuktikand akwaannyad enganm embuktikanu nsur-unsuyr ang ada dalamtindak pidanap erkosaany aitu (l) unsurb arangs iapa,( 2) unsurd engartk ekerasanataua ncamank ekerasaan(3, ) unsurm emaksap erempuanya ngb ukani strinyad an (4)unsurb ersetubuhd engand ia yangd iperolehb erdasarkafna kta yangt erungkapd alamprosesp emeriksaana lat-alabt ukti. Alat-alatb ukti yangd igunakand alamp embuktiantindak pidanap erkosaanb iasanyad apat berupak eterangans aksi, keterangana hli,keterangant erdakwa, dan barang-barangb uk1i. Alat bukti yang diperiksa dipersidangan tersebut nantinya akan memberikan petunjuk bagi hakim tentangkebernarank ejadianp erkosaanD. alam membuktikanti ndak pidanap erkosaant,i dakjarangh akim menghadapbi anyakk endalaK. endala-kendaltae rsebubt iasanyab erasaldari saksi, saksi korban, ahli dan terdakwa, dimana kendala tersebut akanmenghambajat lannyap rosesp emeriksaadni Persidangan.

Penggunaan tutor sebaya untuk meningkatkan hasil belajar ilmu pengetahuan sosial siswa kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan / Sodikin

 

ABSTRAKSI Sodikin. 2010. Penggunaan Tutor Sebaya untuk Meningkatkan Hasil Belajar Ilmu Pengetahuan Sosial Siswa Kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan. Skripsi, Jurusan S 1 Pendidikan Guru Sekolah Dasar FIP Universitas Negeri Malang. Pembimbing (1). Drs I.Wayan Sutama, M.Pd, (2). Dra, Sri Sugiharti M.Pd Kata Kunci : Tutor Sebaya, Hasil Belajar IPS, SD Berdasarkan observasi terhadap pembelajaran IPS dan hasil wawancara dengan guru kelas serta beberapa siswa, dapat diketahui bahwa selama ini pembelajaran IPS di SDN Susukanrejo I masih berpusat pada guru, sehingga siswa cenderung pasif. Akibatnya hasil belajar yang dicapai tidak dapat memenuhi SKM yang ditentukan. Untuk itu perlu dilakukan Penelitian Tindakan Kelas dengan menggunakan tutor sebaya. Tujuan penelitian ini adalah (1) Mendeskripsikan penerapan tutor sebaya dalam meningkatkan hasil belajar ILmu Pengetahuan Sosial materi peninggalan sejarah di Indonesia siswa kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan dan (2) Mendeskripsikan penggunaan tutor sebaya dalam meningkatkan hasil belajar Ilmu Pengetahuan Sosial materi peninggalan sejarah di Indonesia siswa kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan.Rancangan dalam penelitian ini menggunakan Penelitian Tindakan Kelas (PTK), model Kemmis dan Taggart melalui 2 siklus (siklus I dan siklus II) dan 2 kali pertemuan. Dalam pelaksanaannya, pembelajaran ini dibagi menjadi beberapa tahap yaitu : (1) pra tindakan, yaitu dengan memberikan pre tes sebagai pratindakan yang bertujuan untuk mengetahui data nilai siswa yang mengalami kesulitan belajar, (2) siklus satu, yaitu melaksanakan pembelajaran dengan menggunakan tutor sebaya dan siklus ke dua yaitu melaksanakan pembelajaran dengan menggunakan tutor sebaya yang disempurnakan dari kekurangan yang dialami pada siklus I, atau hasil refleksi dari siklus I. Hasil penelitian ini adalah pada siklus I ketuntasan belajar individu mencapai 56,6%, yang berarti meningkat sebesar 16,7% dari sebelum menggunakan tutor sebaya melalui pre tes pada pra tindakan yang mencapai 23,3%. Selanjutnya pada siklus II ketuntasan individu meningkat menjadi 87%, dan dinyatakan berhasil tuntas. Dengan demikian disimpulkan bahwa pembelajaran tutor sebaya dapat meningkatkan hasil belajar IPS siswa kelas IV SDN Susukanrejo I kecamatan Pohjenytrek kabupaten Pasuruan. Disarankan kepada guru hendaknya menggunakan tutor sebaya khususnya dalam mata pelajaran IPS. Karena menarik minat siswa dalam belajar, sehingga mudah memahami materi dan tujuan pembelajaran akan tercapai secara optimal. Bagi peneliti lain, penelitian ini dapat dijadikan bahan pertimbangan dan acuan dalam penelitian selanjutnya, sehingga hasilnya dapat dijadikan pedoman dan pengembangan profesi dan meningkatkan hasil belajar siswa.

Penerapan model inkuiri terbimbing pada pembelajaran fisika pokok bahasan kalor dan asas Black untuk meningkatkan hasil belajar siswa kelas X-5 SMAN 02 Batu tahun ajaran 2009/2010 / Dewi Khoirina

 

ABSTRAK Khoirina, Dewi. 2010. Penerapan Model Inkuiri Terbimbing Pada Pembelajaran Fisika Pokok Bahasan Kalor Dan Asas Black Untuk Meningkatkan Hasil Belajar Fisika Siswa Kelas X-5 SMAN 02 Batu Tahun Ajaran 2009/2010. Skripsi, Jurusan Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Wartono, M.Pd, (II) Drs. Mudjihartono Kata Kunci: Model Inkuiri Terbimbing, Hasil Belajar. Berdasarkan observasi awal pada kelas X-5 SMAN 02 Batu nampak bahwa pembelajaran masih terpusat pada guru, siswa tidak dilibatkan secara aktif dalam kegiatan pembelajaran. Siswa pada umumnya hanya aktif dalam mengerja-kan tugas yang biasanya dikerjakan secara individu. Hal ini berarti partisipasi siswa dalam kegiatan pembelajaran dirasa masih kurang karena pembelajaran masih terpusat pada guru, hasil belajar siswapun masih banyak yang dibawah KKM, hal ini disebabkan metode pembelajaran yang sering digunakan oleh guru adalah metode ceramah, pemberian latihan soal dan tugas. Salah satu model pembelajaran yang dapat memperbaiki proses pembelajaran di kelas X-5 tersebut adalah model inkuiri terbimbing. Model inkuiri terbimbing (guided inquiry) merupakan kegiatan inkuiri dimana masalah dikemukakan oleh guru atau bersumber dari buku teks kemudian siswa bekerja untuk menemukan jawaban terhadap masalah tersebut dibawah bimbingan dari guru. Penelitian bertujuan untuk menjawab pertanyaan: (1) Bagaimana keterlaksanaan proses pembelajaran dengan menggunakan model inkuiri terbimbing siswa kelas X-5 SMAN 02 Batu. (2) Apakah hasil belajar siswa kelas X-5 SMAN 02 Batu meningkat setelah diterapkan model inkuiri terbimbing?. Subyek penelitian adalah siswa kelas X-5 SMAN 02 Batu tahun ajaran 2009/2010 dengan jumlah 39 siswa. Penelitian ini menggunakan pendekatan kua-litatif dengan jenis penelitiannya adalah penelitian tindakan kelas dengan dua siklus. Teknik analisis data yang digunakan untuk hasil belajar aspek afektif dan aspek psikomotorik menggunakan angka 1-3 dan keterlaksanaan model inkuiri Terbimbing menggunakan persentase. Untuk hasil belajar aspek kognitif diguna-kan rentang 0-100 dari hasil tes siswa. Hasil penelitian menunjukkan bahwa pembelajaran dengan model inkuiri terbimbing telah terlaksana dengan baik, pada siklus I persentasenya 90,33% dan dapat dikategorikan baik, pada siklus II persentasenya 98,33% dan dapat dikate-gorikan sangat baik. Pembelajaran dengan model inkuiri terbimbing dapat meni-ngkatkan Hasil belajar siswa yang terdiri dari: (a) Hasil belajar aspek kognitif dari rata-rata sebesar 44,3 sebelum tindakan meningkat menjadi 61,9 pada siklus I dan meningkat menjadi 68,9 pada siklus II. (b) Hasil belajar aspek afektif meningkat dari siklus I sebesar 67,86 menjadi 77,94 pada siklus II. (c) Hasil belajar aspek psikomotorik meningkat dari siklus I sebesar 71,4 menjadi 78,18 pada siklus II Berdasarkan hasil penelitian di atas dapat disimpulkan bahwa pembelaja-ran dengan model inkuiri terbimbing dapat meningkatkan hasil belajar fisika sis-wa kelas X-5 SMAN 02 Batu

Perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan Universitas Negeri Malang / Rosyidah Nur Hidayati

 

ABSTRAK Hidayati, Rosyidah Nur. 2010. Perbedaan Motivasi dan Prestasi Belajar antara Mahasiswa Penerima dan Bukan Penerima Beasiswa di Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan Universitas Negeri Malang. Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (I) Dra. Mustiningsih, M.Pd, (II) Dr. Bambang Budi Wiyono, M.Pd Kata kunci : motivasi, prestasi belajar, beasiswa Motivasi belajar merupakan daya penggerak aktif (dorongan) bagi mahasiswa jurusan AP FIP UM yang mampu memberikan semangat, gairah, dan keinginan untuk melakukan suatu kegiatan belajar. Dalam motivasi belajar juga terkandung adanya harapan, kebutuhan, tujuan, dan sasaran untuk meningkatkan efektifitas belajar. Keadaan jiwa inilah yang mengaktifkan, menggerakkan, menyalurkan, dan mengarahkan sikap serta perilaku mahasiswa kepada tujuan belajar. Motivasi belajar yang dimiliki oleh setiap mahasiswa berbeda-beda, hal ini dapat dipengaruhi oleh berbagai faktor, baik faktor internal maupun eksternal. Salah satu faktor eksternal untuk memotivasi mahasiswa diberikan dalam bentuk beasiswa. Dengan diberikannya beasiswa diharapkan motivasi belajar mahasiswa akan terus meningkat. Selain itu, diharapkan dengan semakin meningkatnya motivasi belajar mahasiswa akan memberikan dorongan untuk meningkatkan prestasi belajarnya. Rumusan masalah penelitian ini adalah: (1) seberapa tingkat motivasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM?, (2) bagaimanakah prestasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM?, (3) adakah perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM?. Tujuan penelitian ini adalah: (1) untuk mengetahui seberapa tinggi motivasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM, (2) untuk mengetahui prestasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM, (3) untuk mengetahui perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM. Rancangan penelitian ini menggunakan metode deskriptif komparatif, yaitu mendeskripsikan dan menemukan perbedaan unsur-unsur variabel motivasi dan prestasi belajar antara penerima dan bukan penerima beasiswa. Responden dalam penelitian sebanyak 122 orang. Pengumpulan data dilakukan dengan menyebarkan angket tertutup kepada mahasiswa yang telah ditetapkan sebagai responden penelitian. Setelah data terkumpul, kemudian dilakukan analisis dengan menggunakan analisis deskriptif dan uji manova. ii Adapun hasil penelitian menunjukkan bahwa: pertama, tingkat motivasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM termasuk dalam kualifikasi tinggi. Kedua, prestasi belajar mahasiswa penerima dan bukan penerima beasiswa termasuk dalam predikat sangat memuaskan. Ketiga, terdapat perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM. Berdasarkan hasil penelitian tersebut, maka dapat diajukan saran kepada: (1) Pihak Universitas Negeri Malang (UM), diharapkan dapat dijadikan pertimbangan kebijaksanaan dalam hubungan dengan pemberian beasiswa kepada mahasiswa yang dapat meningkatkan motivasi dan prestasi belajar mahasiswa, (2) Ketua Jurusan AP FIP UM, sebagai bahan informasi untuk meningkatkan upaya jurusan dalam menciptakan faktor-faktor yang dapat mendukung motivasi dan prestasi belajar mahasiswa, (3) Dosen Jurusan AP FIP UM, diharapkan dapat membantu meningkatkan motivasi mahasiswa yang memiliki motivasi belajar sedang dan rendah dengan cara menciptakan proses belajar yang lebih aktif, (4) Mahasiswa Jurusan AP FIP UM, untuk tetap dapat mempertahankan serta terus meningkatkan motivasi dan prestasi belajarnya, (5) Peneliti lain, agar dapat mengembangkan penelitian lain yang sejenis dengan lebih memperluas pembahasan pada pokok permasalahan serta variabelnya.

Pelaksanaan Perlindungan Hukum Terhadap Hak-Hak Pekerja/Buruh Wanita Dalam Bidang Keselamatan Dan Kesehatan Kerja Ditinjau Dari UU No. 13 Tahun 2003 Tentang Ketenagakerjaan (Studi Pada PT. Sumber Mas Indah Plywood Gresik) Oleh Wina Desika Indra Cahyati

 

Pekerja/buruwh anitar iterupakana setb erhargay angk emampuannytaid ak bolehd isepetekanta, pi dalamk enyataannypae kerja/buruhw anitas eringk ali tidak mendapatet mpaty angs esuadi enganh ak-haknyas ebagapi ekerja.B erbagabi entuk tindakk etidakadilanb anyakt erjadi padap ekerja/buruwh anita,j aminank eselamatan dank esehatakne rjay angd ibuato leh pemerintahm elaluiU ndang-undang Ketenagakerjaadna lamp elaksanaannydai perusahaabne lums epenuhnybae rjalan, danh al ini mengakibatkasne makinle mahnyap osisip ekerja/buruwh anitad alam perusahaaPn.e nelitianin i bertujuanu ntuk mengetahubi agaimanap elaksanaan pertindungahnu kumt erhadapp ekerja/buruwh anitak hususnyad alamb idang keselamatadna nk esehatakne rja dalamP T. SumberM as IndahP lywood.P enelitian ini termasukjenisp enelitians tudik asus karenap enelitianh anyad ilakukand i satu perusahaaunn tuk mencaria pakahp elaksanaand i lapangand alam hal ini di perusahaasne suaai taut idak sesuadi engank etentuany angd imaksudU ndang-undang No. I 3 Tahun2 003 tentangK etenagakerjaanT. ehnik pengumpuland atad ilakukan denganm enggunakanm etodeo bservasi,w lwancara, dan dokumentasiT. ehnik analisisd atay angd igunakana dalahm etodea nalisisk ualitatifdeskriptif. Hasil penelitianm enunjukkanb ahwap erlindunganh ukumt erhadaph ak-hak pekerjaw anitad alamP T. SumberM as IndahP lywoods ebagianb esars udah dilaksanakasne suadi enganU ndang-undanNgo . 13T ahun2 003t entang Ketenagakerjaankh ususnyad alam bidangk eselamatand an kesehatank erja, kesemua aturand i perusahaain i sudahd ibuatd alamb entuka turant ertulisy angd ituangkan dalamp erjanjiank erjab ersama(P KB) yangd ibuata ntarap engusahdae ngan pekerja/buruyha ngd iwakili oleh SPSIs ebagaoi rganisasrie smip eke{a/buruh. Bentukp erlindunganya ngb erkaitand enganK eselamatadna nK esehataKn erja( K3) antarala in adalah( l) perlindungante rhadapjamk erjad anjam istirahat( 2) perlindungatne rhadapk erjal embur( 3) perlindunganp engupaha(n4 ) perlindungan terhadapke sehatarne produkspi ekerjaAuruhw anitay aitu cuti haidd anc uti hamil (5) perlindungatne rhadapk esejahteraapne kerjad anjaminans osialt enagak erja( 6) pembentukamna najemenke selamatadna nk esehatanke rjad alamp erusahaan. Berdasarkahna silp enelitiadna padt isampaikabne berapsaa rany aitu( l) hendaknypae merinta.h"f ugui pihaky angb erwerrandsa lamm enetapkaantu ran dapabt ertindatke gasp uOufr "ngu'ul"V tlg.t:d"lt,jelis-jetatsid akm elaksanakan ketentuasne pertyl ango trnukttidd alamU U No l3 Tahun2 003t entang Ketenagakerjaunp.tuznl itjit"t"f"-utan dank esehatakne rjas ebagabia danre smi vansa dad alamp erusail;;t;; dapamt elaksanaktaung asnysae suadi engan ffiffir* .;"i"" pil"fu"n pekerja/burautahu pupne ngusa(h3a)b erkaitadne ngan waktuk erjap adam atamh aii oln jui.t remburp, "tiinaunginte lha!1np ekerja/buruh harusle bihd itingkatkan "g"r f".i"*",* danL esehatankerjsag lalut erjagak' arena ;;garm'Jn.p*p Et"tJuib;i;l vangu ttetju berlebihahna nvaa kanm enurunkan produktifitakse ryay ang """liiv""cf"p"t merugikapni hakp engusahsae ndin'

Pengembangan latihan dasar defense bola basket menggunakan permainan tradisional gobaksodor pada ekstrakurikuler di SMK Negeri 5 Malang / Kusrianto Lukman P Saputro

 

ABSTRAK Saputro, K.L.P. 2010. Pengembangan Model Latihan Dasar Defense Bolabasket Menggunakan Permainan Gobaksosor Pada Ekstrakurikuler Di SMK Negeri 5 Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (1) Dr. Saichudin, M.Kes, (2) Drs. Oni Bagus Januarto, M.Kes. Kata kunci: pengembangan, model latihan, dasar defense bolabasket menggunakan permainan tradisional gobaksodor. Dalam permainan bolabasket terdapat 5 teknik dasar salah satunya teknik dasar defense. Teknik dasar defense adalah teknik bertahan untuk menghalangi atau menghambat pemain menyerang memasukkan bola untuk mencetak poin dalam area basket pemain bertahan (Bayu, 2009). Dasar defense adalah kunci pertahanan individu dan tim secara keseluruhan. Oleh karena itu, semua pemain dilapangan harus baik dalam menguasai dasar defense. Latihan dasar defense memang sangat menjenuhkan bagi pemula, tetapi itu salah satu teknik dasar yang harus diberikan, dengan menggunakan kombinasi dalam bentuk permainan seperti gobaksodor pemain tidak akan merasa jenuh dan dasar defense juga akan terbentuk.Berdasarkan hasil surve dan observasi analisis kebutuhan di SMK Negeri 5 Malang khususnya peserta ekstrakrikuler bolabasket diketahui bahwa kurangnya pengembangan variasi model latihan teknik dasar defense. Penelitian ini bertujuan mengembangkan model latihan dasar defense menggunakan permainan tradisional gobaksodor untuk siswa putra dan putri yang mengikuti kegiaatan ekstrakurikuler di SMK Negeri 5 Malang. Sehingga siswa dapat dengan mudah mempelajari latihan dasar defense dengan baik dan benar serta dapat menambah pengetahuan tentang bermain bolabasket dan bisa diterapkan secara maksimal dalam pertandingan. Model pengembangan dalam penelitian ini menggunakan Research and Development yang dikemukakan oleh Borg dan Gall, yang telah dimodifikasi oleh peneliti. Prosedur penelitian pengembangan model latihan dasar defense menggunakan permainan tradisional gobaksodor ini adalah sebagai berikut: (1) kegiatan pengumpulan informasi yakni, penyebaran kuesioner, (2) mengembangkan produk awal (peneliti mengembangkan buku model latihan dasar defense menggunakan permainan tradisional gobaksodor), (3) kegiatan evaluasi ahli (dua ahli pengembangan bolabasket dan satu ahli kepelatihan bolabasket), (4) revisi produk pertama (sesuai tinjauan para ahli) (5) coba tahap I (kelompok kecil) dilakukan dengan melibatkan 12 subjek dengan menguji cobakan revisi produk pertama (6) kegiatan uji coba tahap II (kelompok besar) dengan melibatkan 24 subjek, (7) Hasil akhir, produk pengembangan model latihan dasar defense bolabasket menggunakan permainan tradisional gobaksodor pada ekstrakurikuler di SMK Negeri 5 Malang. Lokasi penelitian ini dilakukan di SMK Negeri 5 Malang. Pengumpulan data untuk evaluasi ahli berupa kuesioner terdiri dari: (1) dua orang pengembangan bolabasket dan (2) satu orang kepelatihan bolabasket. Untuk mendapatkan data uji coba kelompok kecil dan uji coba kelompok besar peneliti ii menggunakan metode pengumpulan data berupa instrumen yang disajikan dalam bentuk kuesioner/angket, untuk: (1) uji coba kelompok kecil sebanyak 12 siswa, (2) uji coba kelompok besar sebanyak 24 siswa. Hasil penelitian model pengembangan diperoleh data sebagai berikut: (1) ahli bolabasket yaitu 97,03% (baik), (2) Uji coba tahap I (kelompok kecil) yaitu 96.38 % (baik), (3) Uji coba tahap II (kelompok besar) yaitu 98.19% (baik). Dari hasil penelitian ini berupa pengembangan model latihan dasar defense bolabasket menggunakan permainan tradisional gobaksodor.Diharapkan dapat diuji cobakan kepada lingkup yang lebih luas dan dapat disosialisasikan kepada sekolah lain dan perguruan tinggi sehingga dapat digunakan sebagaimana mestinya. Hasil pengembangan ini hanya sampai tersusun sebuah produk, belum sampai pada tingkat efektivitas produk yang dikembangkan, jadi sebaiknya dilanjutkan pada penelitian mengenai efektivitas produk yang dikembangkan. Produk yang dihasilkan diharapkan dapat bermanfaat bagi pengguna produk, peneliti sendiri, dan peneliti lain untuk dikembangkan ke arah lebih lanjut.

Peranan Yayasan Lembaga Konsumen Dalam Melindungi Kepentingan Hukum Konsumen (Studi Yayasan Lembaga Konsumen Malang) Oleh Tutik Haditama

 

ABSTRAK Aditamq Tutik. 2003. Peranan YayasanL embagaK onsumend alam Melin&mgi Kepentingan Hulnm Konsumen (studi di Yalnsan Lembaga Konsumen ualang).- slsipsi, JurusanP endidikanP ancasilad an KewarganegaraaFnIP UniverlitasN egeriM alangP. embimbing(l:) Drs.M. YuhdiB atubaraS .H., M.H.( 2) DrsE di SuhartonSo. H.,Lf.Pd' Kata kunci: YayasanL embagaK onsumenk' epentingahnu kum,k onsumen' Pembangunanna sionalb ertgjuanu ntuk mewujudkans uatum asyarakaat dil dan makmur yang merata materiai dan spiritual dalag era demokrasi ekonomi berdasarkan Pancasila dan Undang-Undang Dasar 1945. Pernbangunan PerekonomiaNn asionalp ada efa globalisashi arus dapotm urdukungt umbuhnya dunia usahas ehinggam impu menghasilkabne ranekara gamb arangd an/atauja sa yang memiliki kandungarrte knologi yang dapat meningka*an. kescjahteraan inasyarakasCe kaligusm andapatkakne pastianh ukuma tasb arangd an/atauja say eng diperolehd ari perdagengatna npam engakibatkakne rugrank onsurnetD alamI J[JD 1945t elaha dalaminaniernadahpa k konsumenya itu dalamp €mbt*aanI JUD 1945 alinea4 dand al-anP asal27U UO tq+Sa yat2 . Melalui Undang-UndanNgo .8T ahun 1999 dibarapkan menjadi payung integrasi dari seluruh instrumenlketentuan perlindunganh ukum konsuneny ang telah ada sebelumnyaya ng tersebard alam iprbagar instgmen hukum.B erbagaiu payap €merintahd an fumbaga Konsurnen Swada-yMa asyarakatd ilakukan unuk melindungih {-h"k konsumens ekaligus pernteidayaank onsumen.P erananP emerintahd an LSM dalam hal ini sangat pentingu, ntuki tu diadakanp enelitiante ntangP EranaYn ayasanL embagaK onsumen dalam-melindungkie pentinganh ukumk onsumend i Yayasanl- embap Konsumen Malan-Pg.enelitian ini bertujuan mengetahui gambaran umum Yayasan Lembaga KonsumenM alang,j enis-jenisp erkarap engaduadni YayasanL onbagpK onsumen Malang, p"ranari yayasan Gmbaga Konsumen Malang dalam melindqng tepentinganh ukumk onsumenp, ennasalahan-permasalahan;dniahnagd apYi ayasan HhUag1fonsumenM alangd alamm elindungki epenting3hnu kumk onsumens,e rta opuyu-ipayu yang dilatcukan Yayasan Irmbaga Konsumen Malang untuk memecahkamna salahp erlindungahnu kumk onsumen. penelitian ini -termasuk jenis penelitian sosiologisy undis atau penelitian hukume mpiris( nond oktrinal)y angm engkajpi emnans uatule mbagas ecaran yatad i lapangand,r ogaop endekatsknu alitatif.T eknikp engsmpuladna ta_dil.akukdaenn gan *ingE1rat an-rneioa"o bservasiw, awancarad, an dokumentasiS. edangkatn€ knik analisisd atay angd igunakana dalahte knika nalisisk ualitatifdeslcriptif.

Pengaruh faktor fundamental dan risiko pasar terhadap tingkat underpricing pada penawaran umum perdana di Bursa Efek Indonesia (periode 2006-2008) / Mutia Shorea Ovata

 

ABSTRAK Ovata, Mutia Shorea. 2010. Pengaruh Faktor Fundamental dan Risiko Pasar terhadap Tingkat Underpricing pada Penawaran Umum Perdana di Bursa Efek Indonesia (Periode 2006-2008). Skripsi, Jurusan S1 Akuntasi Universitas Negeri Malang. Pembimbing (1) Sawitri Dwi Prastiti, M.Si, S.E., Ak, Pembimbing (2) Dr. Sunaryanto, Drs., M.Ed. Kata kunci: IPO, Underpricing, Faktor Fundamental, Nilai Penawaran, Financial Leverage, Risiko Pasar, Rata-Rata Kurs, IHSG. Initial Public Offering (IPO) tidak terlepas dari fenomena underpricing, dimana harga saham yang ditawarkan pada pasar perdana justru lebih rendah dibandingkan harga saham ketika diperdagangkan di pasar sekunder. Fenomena ini terjadi hampir di seluruh pasar modal dunia termasuk Indonesia. Berbagai penelitian telah dilakukan untuk menemukan faktor-faktor penyebabnya namun hasilnya berbeda-beda. Oleh karena itu, penelitian ini bertujuan untuk menganalisis kembali faktor-faktor fundamental dan risiko pasar, yang diperkirakan mempengaruhi tingkat underpricing pada saham-saham perusahaan, yang ditawarkan pada penawaran umum perdana di Bursa Efek Indonesia. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh dari faktor fundamental yang diproksikan dengan nilai penawaran dan financial leverage serta risiko pasar yang diproksikan dengan rata-rata kurs dan IHSG terhadap tingkat underpricing. Pengambilan sampel dilakukan dengan menggunakan teknik purposive sampling, yaitu teknik penemuan sampel dengan pertimbangan tertentu yang bertujuan untuk mendapatkan sampel yang representatif. Dengan demikian sampel dalam penelitian ini adalah seluruh perusahaan yang melakukan IPO pada periode 2006-2008 dan mengalami underpricing. Data yang digunakan adalah data sekunder. Teknik analisis data yang digunakan dalam penelitian ini adalah analisis regresi linier baik berganda maupun sederhana. Hasil analisis dalam penelitian ini menunjukkan bahwa secara simultan variabel independen dalam penelitian ini tidak memberikan pengaruh yang signifikan terhadap tingkat underpricing, sedangkan secara parsial hanya variabel financial leverage yang berpengaruh signifikan terhadap tingkat underpricing. Hal ini disebabkan investor lebih mempercayai variabel-variabel lain untuk dianalisis baik dalam faktor fundamental perusahaan maupun risiko pasar dalam pengambilan keputusan investasinya di pasar primer. Berdasarkan hasil penelitian ini, penelitian selanjutnya disarankan untuk menggunakan beberapa variabel lain yang diduga memiliki pengaruh lebih besar terhadap tingkat underpricing. Beberapa variabel tersebut diantaranya reputasi underwriter, prosentase penawaran saham, ukuran perusahaan, serta profitabilitas perusahaan selama minimal 2 tahun sebelum IPO. Sedangkan untuk risiko pasar adalah kondisi ekonomi dalam negeri, tingkat inflasi dan juga tingkat suku bunga.

Pengembangan bahan ajar IPA terpadu berbasis salingtemas dengan tema perubahan partikel dan wujud zat oleh kalor untuk SMP/MTs kelas VII / Anis Fahrurotul Futihat

 

ABSTRAK Futihat. Anis F. 2010. Pengembangan Bahan Ajar IPA Terpadu Berbasis SALINGTEMAS dengan Tema Perubahan Partikel dan Wujud Zat oleh Kalor untuk SMP/MTs Kelas VII. Skripsi. Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Lia Yuliati, M.Pd, (II) Drs. I Wayan Dasna, M.Si, M.Ed, Ph.D. Kata kunci: bahan ajar IPA terpadu, perubahan partikel dan wujud zat, SALINGTEMAS. Salah satu kebijakan pemerintah dalam meningkatkan kualitas pendidikan di Indonesia adalah perubahan kurikulum. Kurikulum yang berlaku di Indonesia saat ini adalah Kurikulum Tingkat Satuan Pendidikan (KTSP) yaitu kurikulum yang ide pengembangannya diletakkan pada posisi paling dekat dengan pembelajaran. KTSP menuntut substansi mata pelajaran IPA pada SMP sebagai IPA Terpadu antara bidang kajian Fisika, Kimia, dan Biologi. Bahan ajar yang beredar di masyarakat saat ini masih bahan ajar yang terpisah antara ketiga bidang kajian tersebut. Penelitian ini bertujuan untuk mengembangkan bahan ajar IPA Terpadu dan mengukur kelayakan pengembangan bahan ajar IPA Terpadu. Penelitian ini merupakan penelitian pengembangan yang menggunakan desain pengembangan Borg and Gall (1983). Prosedur pengembangan terdiri atas 4 tahapan, yaitu studi pendahuluan, pengembangan draf produk, penilaian draf produk, dan revisi draf produk. Draf hasil pengembangan diuji kelayakan oleh 3 orang reviewer yaitu dari dosen dan guru. Uji keterbacaan draf dilakukan oleh 7 orang siswa SMPN 6 Blitar. Penilaian uji kelayakan produk pengembangan menggunakan angket tertutup. Data kuantitatif uji kelayakan dianalisis dengan teknik rerata sedangkan data kualitatif berupa tanggapan, saran, dan kritik digunakan sebagai pertimbangan dalam melakukan revisi produk bahan ajar. Hasil pengembangan ini berupa bahan ajar IPA Terpadu untuk siswa SMP/ MTs Kelas VII dengan tema “Perpindahan Kalor dan Akibat yang ditimbulkannya” yang mencakup bidang kajian Kimia dan Fisika. Bahan ajar hasil pengembangan dalam bentuk teks 75 halaman yang terdiri dari bagian pendahuluan dan bagian isi. Bagian pendahuluan meliputi halaman muka (cover), kata pengantar, daftar isi, daftar gambar, daftar tabel, SK KD dan indikator, dan peta konsep. Bagian isi meliputi peta konsep untuk materi yang dibahas, uraian materi, rangkuman per subbab, contoh soal, latihan mandiri, tugas individu, tugas kelompok, panduan kegiatan eksperimen, latihan, rangkuman, glosarium, evaluasi, kunci jawaban, dan daftar pustaka. Hasil uji kelayakan bahan ajar yang dikembangkan mempunyai skor total rerata sebesar 3,16 dan termasuk dalam kriteria layak. Hal ini berarti bahwa bahan ajar hasil pengembangan dapat ditindaklanjuti melalui kegiatan uji coba di lapangan.

Proses Pengukuhan Status Warga Negara Asing Menjadi Warag Negara Indonesia (Studi Kasus di Pengadilan Negeri Bangkalan) Oleh Sonny Sutanto

 

Penelitian ini bertujuan untuk menggambarkan proses pengukuhan satus warga negara asing menjadi warga negara Indonesia. Secara khusus penelitian ini bertujuan untuk mengetahui : (l) Untuk mengetahui syarat-syarat yang harus dipenuhi oleh seorang warga negara asing untuk memperoleh status sebagai warga negaral ndonesia.( 2) Untuk mengetahuip rosesp engalihans tatusk ewarganegaradni lndonesia, dari status warga negara asing hingga dikukuhkan sebagai warga negara Indonesia.( 3) Untuk mengetahuih ak dan kewajiban, serta upaya-upayay ang harus dilakukan seorang warga negara asing setelah menjadi warga negara Indonesia. (4) Untuk mengetahuik endala-kendalay ang dihadapi dalam prosesp engukuhans tatus warga negara asing menjadi warga negara lndonesia. Rancanganin i menggunakand eskriptif kualitatif dan jenis penelitian adalah studi kasus. Kegiatan pengumpulan data adalah (1) Wawancara. Yaitu dengan melaksanakanta nya jawab secara langsungd engan respondenu ntuk memperoleh informasi yang diperlukan. (2) Kajian Pustaka. Kajian tersebut mengenai peraturan perundang-undangayna ng membahas tentang kewarganegaraanIn donesia, serta literaturJiteratur yang berhubungan dengan penelitian im. (3) Dokumentasi. Yaitu dengan menelusuri dan mengumpulkan informasi dan dokumen yang berkaitan dengan penulisan skripsi ini. Untuk menjaga keabsahan data penelitian dilakukan secara teliti dan cermat, perpanjangan kehadiran peneliti, trianggulasi, Pengecekan data terakhir dengan melacak dari hasil analisi data serta meminu paftisipan (informan) untuk mengecek kebenaran temuan sehingga hasil penelitian nantinya dapatd ipertangungja wabkan kebenarannya. Hasilp enelitianm enunjukkanp rosesp ewarganegaraadni I ndonesiau mumnya dan di PengadilanN egeri Bangkalank hususnyam enggunakanK EPPRESR I No. 13/ tahun 1980 tentang tata cara penyelesaianp ermohonank ewarganegaraaRn epublik lndonesia. Namun dalam pelaksanaannya sering mengalami kendala, hal ini disebabkanU ndang-UndanNg o.62l tahun 1958 sudahk etinggalanja man sehingga banyak sekali istilah yang telah tidak dipakai lagi. Berdasarkapne mbahasapne nelitianb ahwad alamK EPPRESR I No.13/t ahun 1980 yang mengaturp rosesp ewarg€megaftEdna n Undang-UndangN o. 62l tahun 1958, terlalu banyaknya instansi-instansi yang menangani masalah proses

Penerapan media tiga dimensi KIT untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN PAsinan II Kecamatan Lekok / Supaedah

 

ABSTRAK Supaedah. 2010. Penerapan Media Tiga Dimensi KIT Untuk Meningkatkan Aktivitas Dan Hasil Belajar IPA Siswa Kelas V SDN Pasinan II Kecamatan Lekok. Skripsi. Jurusan KSDP, FIP, Universitas Negeri Malang. Pembimbing (1) Drs. Usep Kustiawan, M.Pd (2) Drs. HjSukamti, M.Pd. Kata Kunci : IPA, KIT, Aktivitas, Hasil Belajar. Dari hasil observasi ditemukan bahwa siswa di SDN Pasinan II Kecamatan Lekok, jarang menerapkan pembelajaran dengan menggunakan media. Sebagian siswa merasa bosan dan kurang bersemangat dalam pembelajaran, sehingga siswa belum mampu mencapai kriteria ketuntasan belajar di kelas 70%. Berdasarkan hal tersebut, pembelajaran dengan menggunakan media sangat tepat dan dianjurkan sebagai alternatif proses belajar mengajar. Tujuan yang ingin dicapai dalam penelitian ini adalah: 1) Mendiskripsikan penerapan media tiga dimensi kit pembelajaran IPA di kelas V SDN Pasinan II Kecamatan Lekok. 2) Mendiskripsikan dampak penggunaan media tiga dimensi kit terhadap aktivitas belajar siswa kelas V SDN Pasinan II Kecamatan Lekok. 3) Mendiskripsikan peningkatan hasil belajar siswa kelas V SDN Pasinan II Kecamatan Lekok setelah menggunakan media tiga dimensi kit. Penelitian ini menggunakan metode Penelitian Tindakan Kelas(PTK) kolaboratif dan bersiklus. Subyek penelitian ini adalah siswa kelas V SDN Pasinan II. Teknik pengumpulan data dalam penelitian ini yaitu: observasi, wawancara, tes evaluasi. Sedangkan instrumen pengumpulan data yang digunakan berupa pengamatan guru, tes evaluasi, dan wawancara. Hasil dari penelitian setelah dilakukan Tindakan Kelas, data menunjukkan bahwa hasil belajar siswa pada pra tindakan rata- rata 60,62. Pada siklus I mencapai 84,72, sedangkan pada siklus II mencapai rata-rata 96,19, sehingga ketuntasan belajar mencapai 100%. Kesimpulan isi sesuai dengan bab V dari penelitian ini yaitu penggunaan media tiga dimensi kit dapat meningkatkan aktivitas belajar siswa serta hasil belajar siswa dari pra tindakan mendapat rata- rata 60,62 menjadi 84,72 pada siklus I. Kemudian mengalami peningkatan yang signifikan pada siklus II menjadi 96,19 dengan ketuntasan belajar 100%. Dengan menerapkan media tiga dimensi kit dapat meningkatkan aktivitas(keaktifan, kerjasama) dan hasil belajar siswa dalam pembelajaran. Selanjutnya peneliti menyarankan kepada guru, supaya dapat menggunakan media dalam pembelajaran IPA, dengan begitu siswa dapat mengembangkan potensi diri dan sikap ilmiah. Pembelajaran dalam penelitian ini juga dapat digunakan dalam penelitian- penelitian lain sebagai bahan perbandingan, sehingga dikemudian hari menjadi lebih baik.

Membangun jaringan komputer menggunakan PC router OS Linux Ubuntu di UPT SDN Karanganyar Kota Pasuruan / Mashur, Fitri Mulyani

 

Kata Kunci : PC Router Ubuntu, Manajemen Bandwidth, Sistem Firewall Kebutuhan akses Internet saat ini sangat tinggi sekali. Baik untuk mencari informasi, artikel, pengetahuan terbaru, hanya sekedar untuk chatting atau bahkan sampai mencari penghasilan secara online dan real time. Peredaran situs yang kurang baik untuk di akses dalam proses kegiatan belajar mengajar (KBM) khususnya di Laboratorium Komputer UPT SDN Karanganyar khususnya situs yang berbau pornografi pun juga semakin berkembang, hal ini berdampak negatif jika siswa mengakses situs tersebut, maka diperlukan suatu sistem yang dapat membatasi akses situs baik browsing maupun searching. Disamping itu perlu dilakukan manajemen bandwidth agar bandwidth yang diterima setiap client sama rata. Upaya untuk menanggulangi permasalahan di atas adalah merancang PC Router yang dapat membatasi akses situs yang kurang baik khususnya situs yang berbau pornografi, dan membagi bandwidth secara merata. PC Router dengan menggunakan OS Linux Ubuntu merupakan alternatif untuk menekan biaya pembelian router pabrikan seperti Cisco, Juniper dan BayNetwork yang harganya masih mahal. Digunakannya Linux Ubuntu sebagai sistem operasi karena lisensinya gratis, tidak membutuhkan spesifikasi hardware yang besar, instalasi tidak rumit dan administrasinya mudah, bisa dijalankan dengan Text Mode maupun GUI. Pada perancangan PC Router OS Linux Ubuntu ini diawali instalasi Sistem Operasi Linux Ubuntu versi 7.10 dengan kode Gutsy Gibbon, dilanjutkan konfigurasi IP Address, konfigurasi IP Forward, konfigurasi bandwidth management menggunakan HTB Tools sehingga bandwidth ISP Telkom speedy sebesar 512 kbps dibagi secara merata setiap client dari 7 client yang aktif, kemudian mengkonfigurasi sistem firewall menggunakan aplikasi Firestarter. Pada konfigurasi firewall dengan Firestarter di sini kita dapat melidungi jaringan komputer kita dari serangan luar berupa hacking, virus, dan lain-lain. Selain itu dengan sistem firewall kita dapat mem-filter situs-situs mana yang tidak kehendaki untuk di akses oleh user misal situs porno, situs judi ataupun situs-situs lainnya yang tidak dikehendaki. Dari hasil pengujian PC Router OS Linux Ubuntu secara keseluruhan diperoleh hasil bahwa piranti sesuai dengan rancangan, yaitu: (1) Membagi bandwidth internet secara merata sesuai dengan jumlah client yang sedang aktif ,(2) Melindungi jaringan komputer dari serangan luar berupa hacking, virus maupun serangan lain, dan (3) Membatasi akses situs tidak dikehendaki karena berbau pornografi, perjudian atau lainnya berdasarkan daftar blacklist alamat situs. Kesimpulan yang dapat diambil dari perancangan dan hasil pengujian adalah sebagai berikut: (1) Sistem manajemen bandwidth dengan HTB Tools membagi bandwidth Internet sama rata sesuai dengan konfigurasi yang telah kita lakukan. Bandwidth speedy yang rata-rata sebesar 512 kpbs (Speedy Test) dibagi kepada 7 client sehingga setiap client akan mendapatkan bandwidth rata-rata 64 kbps, (2) Sistem Firewall melindungi jaringan computer dari serangan luar berupa jacking, virus maupun serangan lain, dan (3) Sistem Firewall dapat membatasi akses ke situs-situs yang tidak dikehendaki baik melalui browsing maupun searching. Akses browsing dan searching dapat di-block jika URL situs tersebut mengandung unsur kurang baik dan berbau pornografi atau perjudian dan terdaftar di blacklist situs sehingga jika siswa mengakses situs tersebut muncul keterangan access denied. Dengan melihat hasil yang dicapai, untuk pengembangan lebih lanjut disarankan: (1) Dalam mengatur manajemen bandwidth sebaiknya memperhatikan hak prioritas, misal untuk komputer klien yang dipakai oleh administrator dan pihak atasan mendapatkan jatah bandwidth yang lebih besar. (2) Untuk menghindari serangan dari luar sebaiknya pada komputer user lebih dilengkapi dengan anti virus maupun anti spam lainnya.

Kepemimpinan kepala sekolah dalam meningkatkan prestasi sekolah unggulan (studi multi kasus di TK Anak Saleh dan BA Restu I di Kota Malang) / Misbakhul Arifin

 

ABSTRAK Arifin, Misbakhul. 2010. Kepemimpinan Kepala Sekolah dalam Meningkatkan Prestasi Sekolah Unggulan (Studi Multi Kasus di TK Anak Saleh dan BA Restu I di Kota Malang). Tesis, Jurusan Manajemen Pendidikan Program Pasca Sarjana Universitas Negeri Malang. Pembimbing : (I) Prof. H. Ahmad Sonhadji K.H., M.A., Ph.D., (II) Dr. H. Imron Arifin, M.Pd. Kata kunci : kepemimpinan kepala sekolah, prestasi, sekolah unggulan. Kepemimpinan kepala sekolah adalah segala usaha kepala sekolah dalam mempengaruhi, mendorong, membimbing, mengarahkan dan menggerakkan seluruh staf sekolah dan masyarakat agar dapat bekerja secara efektif dalam rangka merencanakan dan melaksanakan program-program sekolah untuk meningkatkan dan mencapai prestasi. Sehingga perlu dikaji dan diadakan penelitian (research), tentang kepemimpinan kepala sekolah dalam meningkatkan prestasi sekolah unggulan khususnya di Taman Kanak-Kanak. Penelitian ini bertujuan: Pertama, untuk mendeskripsikan dan menjelaskan (explanatory) prestasi yang telah diraih oleh sekolah unggulan, termasuk didalamnya mendeskripsikan sumber-sumber pendukung yang dimanfaatkan untuk mencapai prestasi. Kedua, mendeskripsikan dan menjelaskan kiat kepala sekolah dalam meningkatkan prestasi sekolah unggulan di Taman Kanak-Kanak Anak Saleh Malang dan BA Restu I Malang. Metode penelitian ini menggunakan penelitian studi multi kasus dengan model microetnografi, karena penelitian ini mempunyai latar subjek pada suatu tempat kejadian. Penelitian ini dilakukan dalam tiga tahap : Pertama, orientasi; kedua, tahap pengumpulan data (lapangan) atau tahap eksplorasi; dan ketiga, tahap analisis dan penafsiran data. Obyek penelitian yaitu : TK Anak Saleh Malang dan BA Restu I Malang. Hasil Penelitian menunjukkan bahwa dari segi kualitas prestasi yang diraih TK Anak Saleh Malang relatif lebih baik dibandingkan dengan BA Restu I Malang, khususnya dari segi skala kejuaraan. Tetapi, dari segi kuantitas, kejuaraan BA Restu I Malang relatif lebih baik dibandingkan dengan TK Anak Saleh Malang. Dalam meraih prestasi, kepala sekolah BA Restu I Malang menggunakan kiat kepemimpinan antara lain : bersikap adil, memberikan sugesti, mendukung tercapainya tujuan, katalisator, menciptakan rasa aman, sebagai wakil organisasi, sumber inspirasi dan bersikap menghargai. Sedangkan Kepala Sekolah TK Anak Saleh Malang menggunakan kiat kepemimpinan : bersikap adil, memberikan sugesti, mendukung tercapainya tujuan, katalisator, menciptakan rasa aman, sebagai wakil organisasi, sumber inspirasi, bersikap menghargai, rendah hati dan spiritual transendental.

Pembelajaran integrated model menggunakan bahan ajar IPA terpadu untuk meningkatkan keterampilan berpikir siswa kelas VII SMP Negeri 05 Batu / Lia Widayanti

 

ABSTRAK Widayanti,Lia.2010.Pembelajaran Integrated Model Menggunakan Bahan Ajar IPA Terpadu Untuk Meningkatkan Keterampilan Berpikir Siswa Kelas VII SMP Negeri 05 Batu. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang.Pembimbing (I)Drs.Dwi Haryoto, M.Pd, (II) Dra. Endang Purwaningsih, M.Si. Kata kunci: IPA Terpadu, integrated model, keterampilan berpikir siswa Berdasarkan hasil wawancara dan observasi awal pada kelas VII SMP Negeri 05 Batu ditemukan bahwa pembelajaran IPA sering dilakukan dengan metode ceramah. Rata-rata hasil belajar IPA siswa pada semester sebelumnya 39,19 dan 87,50% siswa mendapatkan nilai di bawah SKM. Kesulitan yang dihadapi oleh guru adalah menyatukan konsep IPA menjadi terpadu, mengaktifkan siswa selama proses pembelajaran, meningkatkan antusiasme siswa terhadap materi yang diajarkan, dan meningkatkan keterampilan berpikir siswa. Untuk mengatasi permasalahan tersebut maka disepakati untuk menerapkan Pembelajaran Integrated Model Menggunakan Bahan Ajar IPA Terpadu. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) yang terdiri atas dua siklus. Rangkaian penelitian dilaksanakan mulai tanggal 18 Januari hingga akhir Mei 2010. Subyek penelitian ini adalah siswa kelas VII SMP Negeri 05 Batu semester genap tahun ajaran 2009/2010 sejumlah 32 siswa. Instrumen yang digunakan terdiri dari instrumen tindakan yaitu RPP dan LKS, serta modul IPA Terpadu dan instrumen pengukuran yaitu lembar observasi pertanyaan dan jawaban siswa, lembar observasi keterlaksanaan RPP, rubrik penskoran jawaban siswa, dan tes. Data penelitan berupa data hasil keterlaksanaan RPP dan keterampilan berpikir siswa. Peningkatan keterampilan berpikir yang dicapai oleh siswa ditandai dengan meningkatnya aktivitas tanya jawab siswa selama proses pembelajaran serta meningkatnya hasil tes siswa tiap akhir siklus. Pembelajaran dilaksanakan menggunakan metode eksperimen, tanya jawab, dan diskusi dengan materi IPA Terpadu. Pelaksanaan pembelajaran integrated model menggunakan bahan ajar IPA Terpadu dengan alokasi waktu 720 menit (3x80 menit perminggu) dengan tema ‘Pemuaian Pada Berbagai Wujud Zat’ menunjukkan hasil sebagai berikut. Keterlaksanaan rencana pelaksanaan pembelajaran 100% aktivitas guru terlaksanakan dan aktivitas siswa meningkat 16,66 %. Persentase aktivitas tanya jawab selama proses pembelajaran meningkat sebesar 28,13% serta meningkatkan keterampilan berpikir siswa kelas VII SMP Negeri 05 Batu sebesar 93,26% pada siklus II. Dampak positif setelah diterapkan tindakan adalah jumlah siswa kelas VII SMP Negeri 05 Batu yang mampu mencapai SKM meningkat dari 12,50% menjadi 93,75% dengan peningkatan sebesar 81,25%. Berdasarkan data tersebut dapat disimpulkan bahwa pembelajaran integrated model menggunakan bahan ajar IPA Terpadu dapat meningkatkan keterampilan berpikir siswa kelas VII SMPN 05 Batu sebesar 93,26% dan jumlah siswa yang berhasil mencapai SKM hingga 81,25%.

Pengaruh persepsi siswa tentang kompetensi profesional dan kompetensi pedagogik guru terhadap prestasi belajar melalui motivasi belajar siswa kelas XI IPS pada mata pelajaran akuntansi di SMAN 1 Karangan Trenggalek / Fironike Primata Dhaniyanti

 

Kata Kunci: Persepsi, Kompetensi Profesional Guru, Kompetensi Pedagogik Guru, Motivasi Belajar, Prestasi Belajar. Kompetensi guru adalah seperangkat penguasaan kemampuan yang harus ada dalam diri guru agar dapat mewujudkan kinerjanya secara tepat dan efektif. Kompetensi guru diantaranya adalah kompetensi profesional dan kompetensi pedagogik. Tujuan Penelitian adalah untuk mengetahui pengaruh: (1) kompetensi profesional guru terhadap motivasi belajar siswa, (2) kompetensi pedagogik guru terhadap motivasi belajar siswa, (3) motivasi belajar terhadap prestasi belajar siswa, (4) kompetensi profesional guru terhadap prestasi belajar melalui motivasi belajar siswa, (5) kompetensi pedagogik guru terhadap prestasi belajar melalui motivasi belajar siswa. Populasi penelitian ini adalah siswa kelas XI IPS SMA Negeri 1 Karangan sebanyak 150 siswa. Teknik pengambilan sampel adalah teknik (proportional random sampling) sehingga diperoleh sampel berjumlah 45 siswa. Variabel bebas dalam penelitian ini adalah kompetensi profesional guru, kompetensi pedagogik guru, variabel interveningnya adalah motivasi belajar, dan variabel terikatnya adalah prestasi belajar siswa. Teknik pengumpulan data yang digunakan dalam penelitian ini adalah kuesioner dan dokumentasi. Metode analisis data menggunakan analisis jalur (path analysis). Analisis data dengan path analysis yang dilakukan dengan menggunakan SPSS for Windows 16. Hasil penelitian yang diperoleh: (1) terdapat pengaruh positif signifikan kompetensi profesional guru terhadap motivasi belajar siswa kelas XI IPS di SMA Negeri 1 Karangan sebesar 0,345, (2) terdapat pengaruh positif signifikan kompetensi pedagogik guru terhadap motivasi belajar siswa kelas XI IPS di SMA Negeri 1 Karangan sebesar 0,497, (3) terdapat pengaruh positif signifikan motivasi belajar terhadap prestasi belajar siswa kelas XI IPS di SMA Negeri 1 Karangan sebesar 0,375, (4) terdapat pengaruh tidak langsung yang positif signifikan kompetensi profesional terhadap prestasi belajar melalui motivasi belajar siswa kelas XI IPS di SMA Negeri 1 Karangan sebesar 0,133, (5) terdapat pengaruh tidak langsung kompetensi pedagogik guru terhadap prestasi belajar melalui motivasi belajar siswa kelas XI IPS di SMA Negeri 1 Karangan sebesar 0,186. Disarankan kepada: (1) pihak kepala sekolah agar tetap memberikan pengawasan dan pembinaan terhadap guru (2) pihak guru lebih meningkatkan kompetensinya sehingga dapat meningkatkan motivasi dan prestasi siswa, (3) untuk siswa diharapkan lebih meningkatkan motivasi dan prestasi belajar dengan baik, (4) penelitian selanjutnya agar melakukan penelitian lebih lanjut untuk mengetahui faktor-faktor lain yang berpengaruh terhadap prestasi belajar siswa.

Perkembangan Industri Batik Tulis Gedog "Kesatriyan" Desa Margorejo Kecamatan Kerek Kabupaten Tuban Tahun 1995-2003 Oleh Sidik Kurniasih Agustina

 

senib atikm erupakasna lahs atuc in khasb angsaIn donesiyaa ngt etahh idup berabad-ablaardn anyaB. eberapate mpatd i Inclonesiidikenasl ebagadi ierahp enghasil batikd, iantaranyTa uban.B atik relahd ikenald i ruban sejaka bad-I6M . sebagai pusafnaydaa lahk ecamataKne rekt epatnyad i DesaM argorejoS. ebagasiu atuin dustri kecilk, cgiatanp roduksinyad ipengaruhoi lch kondisip eiekonomianie gan. Hal ini nampapka dak urunw aktu l9g7-2002d imanap adak urun waktut ersebitk ondisi perekonomiIannd onesiate rpuruka kibatk risise konomis ertap eristiwab om Bali. . Rumusamn asalayha nga kand i bahasp a

Analisis Produktivitas Keuangan Terhadap Harga Pokok Produksi (Studi Kasus Pada PT.PG. Candi Baru Sidoarjo) Oleh Bagus Permadi

 

Studi komparatif antara hasil belajar melalui paket belajar dan hasil belajar melalui pengajaran biasa para siswa kelas III A2 SMA Negeri 2 Ambon (suatu tinjauan terhadap materi hitung integral) / oleh Tanwey Gerson Ratumanan

 

Hubungan persepsi beban kerja dengan kinerja karyawan PT. Sumber Alfaria Trojaya Tbk. Cabang Malang / Lini Hindrasiwi

 

ABSTRAK Hindrasiwi, Lini. 2015.Hubungan Persepsi Beban Kerja dengan Kinerja Karyawan PT. Sumber Alfaria Trijaya Tbk, Cabang Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (I) Drs. Fattah Hidayat, S.Psi., M.Si (II) Pravissi Shanti, S.Psi., M.Psi Kata Kunci: persepsi beban kerja, kinerja karyawan, PT. SumberAlfariaTrijayaTbk, Cabang Malang. Penelitian ini didasari oleh adanya fakta di lapangan,dalammelakukanpelayanankepadapelanggan, Alfamartmemilikistandarpelayanan yang harusdilakukanolehseluruhkaryawantokoAlfamartbaikkasirataupramuniaga. Namunkenyataannyamasihadakaryawan yang tidakmelakukanstandarpelayanan yang di tetapkanolehperusahaan, tidakmenyapapelanggan yang datang, dantidakmemilikiproduct knowledge yang baik. Selainitukemundurankinerjakaryawanjugadapatdilihatdaribanyaknyakaryawan yang absendaritugasnya dan meningkatnya turnover.Oleh karena itu penelitian ini bertujuan untuk mengetahui hubungan antara persepsi beban kerja dengan kinerja karyawan PT. SumberAlfariaTrijaya Tbk, Cabang Malang. Penelitianinimenggunakanpendekatankuantitatifdenganrancangandeskriptifdankorelasional.Populasisebanyak 342 karyawan dengan jumlah sampel 172 karyawan. Teknik sampling yang digunakan adalah sampling insidental. Menggunakan instrumen penelitian skala persepsi beban kerja dengan reliabilitas 0,944 dan data sekunder berupa penilaian kinerja karyawan PT. Sumber Alfaria Trijaya Tbk, Cabang Malang. Hasil penelitian menunjukkan bahwa karyawan yang memiliki persepsi beban kerja tinggi 52% dan karyawan yang memiliki persepsi beban kerja rendah 48%. Karyawan yang memiliki kinerja tinggi 47% dan karyawan yang memiliki kinerja rendah 53%. Terdapat hubungan negatif signifikan antara persepsi beban kerja dengan kinerja karyawan dengan angka korelasi -0,650 dan p<0,05. Karyawandiharapkanuntukbisamembuatprioritasdalambekerja, dan mengasahlagikemampuan yang dibutuhkansepertimemahamimanajemen waktu, standarpelayanan, mengetahuihandling complain, sertamemilikiproduct knowledge yang baiksehinggakinerjakaryawanakanmeningkat. Pimpinandiharapkandapatmemberikanmotivasidanpelatihan, sepertipelatihanmanajemenwaktu, handling complain, danproduct knowledge, sehinggakaryawanmemilikipengetahuan yang lebihdandapatmeningkatkankemampuankaryawandalammenjalankanpekerjaannya.Penelitianselanjutnya, dapatmenambahjumlahsampel agar sampellebihrefresentatiflagi. Kemudianbagipeneliti yang inginmengetahuilebihdalamtentangvariabelkinerjakaryawan, mungkindapatmenambahvariabelselainpersepsibebankerja, sepertimotivasi, kesediaan, harapanimbalan, kemampuan, lingkungan, dankepuasankerja.

Analisis Metode Variabel Costing Sebagai Dasar Penentuan Harga Poko Produksi Pada Perusahaan Pupuk "SPAT" Purwadadi Pasuruan Oleh H. Suprayitno

 

Harga pokok produksi merupakan pengorbanan ekonomis yang dibutuhkanu ntuk memproduksdi an memperolehb arangh inggab arangt ersebutsiap untuk dipasarkanM. anagemenp erusahaanh arus dapatm enentukanh argapokokp roduksis ecarate pat,k arenah al itu sangabt erpengaruthe rhadapp erolehanlabay angm aksimal. Ada duam etodey angd igunakanu ntukm enetapkahna rgap okokp roduksi,yaiiu metode full costing dan metode vctriahel co.sting. tvtitoOe fuli costingmemperhitungkasne muau nsurb iaya kedalamh argap okok produksib aik tetapmaupunv ariabel.S edangkanm etode variabel costing hanya memperhitunganunsur biaya variabel kedalam harga pokok produksr. Penelitian ini menganalisa metode variabel costing sebagai dasarpenentuahna rgap okok produksiy anga dad i perusahaapnu pukS PATP urwodadiPasuruany aitu terdin dari neraca,l aporanr ugi laba, anggaranp enjualanb, ahanbaku,B OP,b iayap roduksid an PerhitungaHn PP selamat ahun2 001d an 2002. Penelitiani ni bertujuan mengetahuip enerapanm etode variabel costing sertapengaruhnytear hadap erolehalna ba.Penelitiani ni dilakukan di kantor perusahaanp upuk SPAT PurwodadiPasuruanR. ancanganp enelitiany ang digunakana dalahd eskriptif.A nalisish asilpenelitiany angd ipakaia dalahle asts quarem ethodd enganp ersamaaYn : a + bX.Hasil penelitianm enunjukkanb ahwap enetapanm etodev ariabelc ostingsebagadi asarp enetapanh argap okok produksil ebih besarp erolehanla banyad ibandingd enganf ull costing.A pabila perusahaamn enggunakavna riabelc ostingmaka laba yang diperoleha dalahR p 156.395.73u4n tuk tahun 2001 dan Rp416.848.77u4n tukt ahun2 002.A kan tetapijika perusahaamn enggunakamn etodefull costingm aka laba yang diperolehs ebesaRr p 39.433.307u ntuk tahun2 001dan Rp 343.985.297u ntuk tahun2 002.C onstnbusmi arginy ang diperoleht ahun2002l ebihb esard arit ahun2 001.Berdasarkanh asil penelitian ini, dapat disarankana gar perusahaand alammenetapkanh argap okok produksid apatm enggunakamn etodev ariabelc osting.Hal itu dapatm enghasilkalna bay angm aksimal.

Hubungan nilai anak dengan sikap masyarakat terhadap keluarga berencana di Kecamatan Wonorejo Kabupaten Pasuruan / oleh Wijaya Sugianto

 

Pola asuh orang tua dalam pendidikan keluarga membentuk kecerdasan budi pekerti anak (studi deskripsi pada keluarga Ibu Mas) / Ahmad Arif Fanani

 

Fanani, Ahmad Arif. 2014. Pola asuh orangtua dalam pendidikan keluarga membentuk kecerdasan budipekerti anak. Skripsi. Jurusan Pendidikan Luar Sekolah Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Dr. Zulkarnaen, M.pd. (2) Drs. Lasi Purwito, M.S. Kata Kunci: Pola asuh orang tua, pendidikan keluarga, kecerdasan budipekerti.     Pendidikan merupakan tanggung jawab bersama antara keluarga masyarakat dan pemerintah. Sehingga orang tua tidak boleh menganggap remeh bahwa pendidikan anak hanyalah tanggung jawab sekolah. Orangtua sebagai lingkungan pertama dan utama dimana anak berinteraksi sebagai lembaga pendidikan yang tertua, artinya disinilah dimulai suatu proses pendidikan. Sehingga orang tua berperan sebagai pendidik bagi anak-anaknya dalam mencerdaskan akhlak budipekertinya. Lingkungan keluarga juga dikatakan lingkungan yang paling utama, karena sebagian besar kehidupan anak didalam keluarga, sehingga penanaman pendidikan kecerdasan budipekerti dalam keluarga sangat penting untuk masa depan anak menjadi lebih baik.     Penelitian ini dilaksanakan dengan tujuan untuk mengetahui pentingnya pendidikan keluarga membentuk kecerdasan budi pekerti dalam keluarga Ibu Mas di Jalan Musi RT1 RW 2 Ngoro Jombang. Mengetahui Pola Asuh orang tua dalam penanaman pendidikan kecerdasan budipekerti pada anak di keluarga.     Penelitian ini menggunakan rancangan penelitian melalui pendekatan kualitatif studi kasus. Data penelitian yang berupa paparan data dari profil keluarga Ibu Mas. Pengumpulan data di lakukan dengan menggunakan tekhnik wawancara dan observasi. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri. Untuk menjaga keabsahan data, dilakukan kegiatan trianggulasi data. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, dan tahap evaluasi data.     Berdasarkan hasil analisis data tersebut, diperoleh dua simpulan hasil penelitian sebagai berikut. Pertama penerapan pendidikan dalam mencerdaskan akhlak budipekerti pada anak di dalam keluarga sangat penting apalagi penanaman akhlak budipekerti itu diterapkan pada anak masih usia dini sampai anak sudah mempunyai keluarga sendiri. Orang tua meyakini bahwa pentingnya penanaman pendidikan kecerdasan budipekerti anak itu sangat penting karena tanpa akhlak budipekerti yang baik serta agama manusia tidak mempunyai nilai agama yang dapat membuat patokan yang dijadikan petunjuk atau pegangan dalam menjalani kehidupan sehari-hari demi mencapai akhlak yang baik terhadap orang tua.     Kedua, peran orang tua untuk anak dalam mengarahkan, meluruskan, dan mendampingi anak hingga anak tumbuh dewasa dan menjadi lebih sempurna, orang tua memberikan penerapan kecerdasan budipekerti yang baik seperti pendidikan akidah, ibadah, serta juga menghargai dan berbuat akhlakul karimah terhadap kedua orang tua. Karena dalam pendidikan akhidah, ibadah dan akhlak budipekerti itulah kelak anak akan menerapkan kehidupan sehari-harinya di dalam lingkungan keluarga dan masyarkat. Sehingga penerapan pendidikan kecerdasan budipekerti tersebut dilakukan denan benar.    Saran bagi (1) Jurusan PLS, memperluas dan mengembangkan penelitian yang program PLS dimayarakat, agar PLS dapat semakin berkembang dan dikenali oleh masyarakat; (2) orang tua, sebagai pendidik yang pertama dan utama dikeluarga, orang tua agar lebih mengenalkan pendidikan kecerdasan akhlak budipekerti yang baik, serta menanamkan kaidah islam dengan benar. Selain itu orang tua lebih bisa menanamkan nilai agama dengan metode-metode yang menarik untuk anak; (3) peneliti, diharapkan hasil penelitian ini lebih bermakna dan berarti, maka pada penelitian lebih lanjut dan dalam berbagai hal atau aspek kehidupan keluarga lebih diperkaya lagi seiring dengan temuan-temuan lapangan yang telah peneliti hasilkan.

Korelasi Antara Perputaran Piutang Dengan Tingkat Rentabilitas Ekonomis (Studi Kasus Pada KPRI "JUJUR") Kecamatan Sampang Kabupaten Ponorogo Oleh Slamet Riyadi

 

Persaingand unia usahas aat ini semakink etat yaitu denganm eningkatnyakuantitas perusahaan dagang yang hampir semuanya terlayani melalui penjualankedit dengan syarat lunak. Koperasi juga harus dapat melayani penjualan kreditdengan syarat yang terjadi pada dewasa ini agar dapat tetap bisa bersaing denganperusahaalna in didalams ituasiy angb erkembangp adap erusahaadna gangtersebut.Penjualan secara kredit sebenamya banyak mengandung resiko misalnyapiutangt ak tertgih,Jatuhte mpoy angm undurd an lainlain.Usahau ntuk memperkecilresiko adalahd engana danyap engelolaanp iutang yang baik. Salah satu caranyaadalah dengan mempercepat perputaran piutangnya. Apabila hal tersebutdilaksanakan maka kemungkinan piutang tak tertagih akan dapat dihindari, dapatmeninggatkalna ba,a khirnyab erpengarukhe padap eningkatanre ntabilitase konomis. Penelitian ini bertujuan untuk mengetahuis eberapac epat perputaranp iutang,seberapab esart ingkat rentabilitas ekonomis,d an mengetahuia dat idaknya hubunganantaxa perputaran piutang dengan tingkat rentabilitas ekonomis pada KPRI "JUJUR"KecamatanS ampungK abupatenP onorogoT. ahun1 9 92 sampadi engan2 002. Penelitian ini termasuk penelitian Asosiatif yang mempunyai hubungankausal.Variabeble bas(X)d alamp enelitiani ni adalahp erputaranp iutangd anV ariabelterikat (Y) adalahr entabilitase konomisM. etodep engumpuland atad alamp enelitianini adalah metode dokumentasi.Teknikn alisis data menggunakan analisis nonparametrik korelasi Spearmen Rank bekerja dengan data ordinal. Data dalampenelitian ini adalah data rasio, maka data tersebut harus diubah menjadi data ordinal.Ilasil penelitianm enunjukkanb ahwa (1) Rata-ratad ari perputaranp iutangKPRI *ruJUR" adalah1 ,530685d an itu sudahs tabil kerenat iap tahunm engalamipeningkatan yang berarti; (2) Rata-rata dari tingkat rentabilitas ekonomis adalah25,44 dmr sangat stabil peningkatannya sesuat dengan peningkatan pertambahandebet juga pertambahan anggota yang terjadi disetiap awal tahun buku. (3) Adahubungan antara perputaxan piutang dengan rentabilitas ekonomis pada KPRI"ruJLIR" denganti ngkatr entabilitaes konomisd engank oefisien korelasi rho =0,027d N sipifikan p = 0,468.Saran yang dapat diberikan kepada KPRI "JUJUR" adalah (1) Dalammernberikatrne dit kepadaa nggotah endaknyyaa ngs elektif;( 2) Untukm empercepatperputarapni utangh endaknyam emperbaharusyi aratk edit, denganc ashd iscount,kepadyaa ngl unass ebelumja tutrt empo;( 3) Untukl ebihm engfelrifkanp eningkatandan stabilitas rentabilitas ekonomis hendaknya mempercepat perputaran,menstabilkadna nm enghemabti aya-biayao perasional.

Penetapan Harga Pokok Produksi Sebagai Dasar Penentuan Harga Jual Pada Percetakan Dan Setting "Q & R" Di Kota Batu Oleh Triono

 

Biaya bahan Baku, biaya tenaga kerja langsung, dan biaya overhead pabrikmerupakanb iaya-biayap enentuh argap okok produksip adap ercetakand an Seftinge& R di kota Batu.T ujuan ditetapkannyah argap okok dari suatup roduksia ntaral ainuntuk menentukanh argaj ual. Untuk mengetahuai pakahh argaj ual sudaht epat ataubelum tepat maka perlu ditenhrkanb esarnyah arga pokok produksi.S elamai niPercetakand an Setting Q & R di Koa Ba$ belun melakukanp elhitungrrnh argapokok produksi secarat epat dan teliti, serta belum mengadakankl asifikasib iaya kemasing-masingb agian yang ada dalam perusahaany, aitu bagian produksi, baglanadministrasi dan umum sena bagian pemasaran. Penelitian ini bertujual untukmengetahubi iaya-biayay ang menenhrkanh argap okok pada perusahaanp ercetakan.Selama ini perusahaan Percetakan dan Setting Q & R di Kota Batu dalarnmenentukahna rgaj ual berdasarkapne saruud alamm encetakd an tingkatk esulitanpengerJaannyaVariabel yang diteliti dalam penelitian ini adalah biaya produksi dan hargajualdari barangc etak yang dihasilkanm ulai bulan April 2003 - Juni 2003. Penelitianin idilakukand i perusahaanP ercetakand an SettingQ & R di Kota Batu yang beralamatdi JalanW R. SupratmaNno . 12 telepon(0 341)5 l1771.L arrcp enelitiadna rir anggal5 April 2003 sampaid engan2 5 Agustus2 003.D itinjau dari sifatnyap enelitianin i termasujke nisp enelitiand eskriptif. Analisis hasil penelitian yang dipakai adalah yang p€rtama untuk menghitungharga pokok produksi, terlebih dahulu biaya lishilq biaya pemeliharaana lat, biayatistrik, air dan telepon, sewa gedrrngd an penyusutanm esin harus diklasifikasikandengan tepat yaitu ke bagian produksi dan ke bagian administrasi dan umum.Selanjutnyab iaya admuristrasdi an umwn sertab iayap emasarand an penjualanh arusd*eluarkan dari biaya overhead pabrik, sebab biaya-biaya tersebut termasuk biayaoperasi.S etelahb esamyah argap okok produksid iketahui,h argajual dapatd itentukandari besarnyah argap okok produksid itambahb iayao perasid an besamyak eunhrnganyang dilrarapkan. Hasil penelitiani ni menunjukkanb ahwa harga pokok produksi setelaha danyapengklasifikasiabni aya ternyatal ebih rendahj ika dibandingkand enganh argap okokproduksi sebelumd iadakanp eng;klasifrkasiabnia ya. Dalam penilaianb ahanb aku, perusahaanti dak menggunakans istem persediaan,a rtinya setiap pengadaanb ahanbaku selalu disesuaikand enganv olume pesanany ang ada, sehinggab ahan bakulangsungd apatd ipakait anpam enungguu ntuk disimpand i gudang.S edangkadna lamhal penentuanh argaj ual, perusahaamn anggunakamn etodeg ross marginp ricing dan.menghasilkahna rgaju al yangl ebih layakj ika dibandingkand eng;amn etodel ainnya.

Analisis sistem dan prosedur pemberian kredit modal kerja pada PT. Bank Rakyat Indonesia Cabang Malang Martadinata / Ika Yaningtias

 

Seiring dengan kehidupan ekonomi dan perdagangan yang semakin berkembang, bank mempunyai peranan penting dalam melaksanakan distribusi, selain itu bank juga berperan sebagai lembaga intermediasi antara pihak yang memakai dana dengan pihak yang membutuhkan dana. Bank memegang fungsi sebagai perantara keuangan dalam masyarkat. Bank menyalurkan dana pada masyarakat yang membutuhkan dalam bentuk kredit. PT. Bank Rakyat Indonesia adalah salah satu bank yang selain menghimpun dana dari masyarakat juga melayani jasa perkreditan. Salah satu jenis kreditnya adalah Kredit Modal Kerja. Penulisan Tugas Akhir ini bertujuan untuk mendeskripsikan tentang sistem dan prosedur pemberian Kredit Modal Kerja pada PT. Bank Rakyat Indonesia Cabang Malang Martadinata. Metode pemecahan masalah yang dilakukan adalah metode deskriptif kualitatif. Berdasarkan dari hasil pengamatan dan pembahasan Tugas Akhir ini, diperoleh kesimpulan bahwa analisis yang diterapkan dalam prosedur pemberian Kredit Modal Kerja pada PT. Bank Rakyat Indonesia Cabang Malang Martadinata telah sesuai dengan konsep 5C, yaitu analisa character, capacity, capital, collateral,dan condition of economy. Prosedur yang dijalankan juga telah melalui tahap-tahap yang sesuai dengan perjanjian yang telah disepakati sebelumnya antara pihak bank dan debitur. Sistem pengendalian intern yang diterapkan dalam pemberian Kredit Modal Kerja juga telah memenuhi unsur-unsur pokok pengendalian intern. Dari hasil pengamatan ini, disarankan kepada PT. Bank Rakyat Indonesia hendaknya Terus meningkatkan kualitas Sumber Daya Manusia yang ada, hal ini dapat dilakukan dengan melakukan training atapun follow up rutin untuk meningkatkan kinerja para karyawannya. Selain itu, Bank Rakyat Indonesia sebaiknya memperketat kegiatan monitoring terhadap usaha yang dijalankan oleh debitur untuk meminimalisir terjadinya kredit bermasalah. Pihak Bank Rakyat Indonesia juga harus menjalin kerjasama yang lebih baik dengan para debitur. Seperti yang telah diketahui dalam pembahasan bahwa kerjasama yang baik antara bank dengan debitur dapat memperlancar kegiatan bimbingan atau pembinaan terhadap debitur. Karena keberhasilan kredit sepenuhnya tergantung pada kemampuan debitur dalam menciptakan keuntungan. Keuntungan yang diperoleh akan menghasilkan kekuatan bagi debitur untuk memenuhi kewajibannya.

Pengaruh pengungkapan tanggung jawab sosial, kepemilikan manajerial, dan kepemilikan institusional terhadap kinerja perusahaan (studi pada perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2006-2008) / Amalia Oktaviana

 

BSTRAK Oktaviana, Amalia. 2010. Pengaruh Pengungkapan Tanggung Jawab Sosial, Kepemilikan Manajerial, Dan Kepemilikan Institusional Terhadap Kinerja Perusahaan (Studi pada Perusahaan Manufaktur yang listing di Bursa Efek Indonesia Periode 2006-2008). Skripsi. Jurusan Akuntansi. Program Studi Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Triadi Agung Sudarto, S.E., M.Si, Ak. (2) Ika Putri Larasati, S.E., M.Com. Kata Kunci: Pengungkapan Tanggung Jawab Sosial (CSDI), Kepemilikan Manajerial (MOWN), Kepemilikan Institusional (INS), dan Kinerja Perusahaan (ROE). Indikator dalam menilai kinerja keuangan perusahaan diantaranya dengan rasio profitabilitas yang salah satunya adalah Return On Equity (ROE). Rasio keuangan ini merupakan suatu alat analisis yang diperlukan untuk mengukur kondisi dan efisiensi operasi perusahaan dalam mencapai tujuan perusahaan yaitu laba bersih. Selain bertanggung jawab secara keuangan (financial), perusahaan juga memiliki tanggung jawab sosial maupun lingkungan hidup tempat perusahaan beroperasi yang ditunjukkan pada kebijakan dan aktivitas tanggung jawab sosial perusahaan .Kepemilikan manajerial yang merupakan kepemilikan saham perusahaan oleh pihak-pihak yang berada dalam perusahaan (insider), serta kepemilikan institusional yang merupakan kepemilikan saham oleh pihak-pihak yang berbentuk institusi juga dapat meningkatkan ROE perusahaan. Penelitian ini bertujuan untuk mengetahui pengaruh variabel-variabel CSDI, MOWN, INS terhadap ROE baik secara parsial maupun secara simultan. Data yang digunakan bersumber dari ICMD (Indonesian Capital Market Directory) dan annual repot perusahaan tahun 2006-2008. Populasi yang digunakan dalam penelitian ini adalah seluruh perusahaan manufaktur yang listing di Bursa Efek Indonesia yaitu sebanyak 124 perusahaan, namun setelah digunakan metode purposive sampling dengan teknik pooled data, didapatkan sampel sebanyak 15 sampel perusahaan. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi linear berganda dengan menggunakan program SPSS. Uji yang dilakukan adalah nilai t dan nilai F. Hasil penelitian ini menunjukkan bahwa secara parsial hanya variabel CSDI dan MOWN dengan nilai signifikansi 0.000 dan 0.041 mempunyai pengaruh signifikan terhadap ROE. Secara simultan variabel-variabel CSDI, MOWN, dan INS berpengaruh signifikan terhadap ROE dengan nilai signifikansi 0.000. Berdasarkan penelitian ini, maka disarankan dalam penelitian selanjutnya untuk menambah jumlah sampel, variabel, dan memperpanjang periode penelitian, serta diharapkan bagi investor, penelitian ini dapat dijadikan gambaran tentang pengaruh pengungkapan tanggung jawab sosial, kepemilikan manajerial, dan kepemilikan institusional terhadap kinerja perusahaan sehingga dapat mengambil keputusan yang tepat.

Culture in descriptive texts of EFL textbook used at International Standard School Project SMPN 5 Malang / Nova Ariani

 

ABSTRACT Ariani, Nova. 2010. Culture in Descriptive Texts of EFL Textbook used at International Standard School Project SMPN 5 Malang. Thesis, English Department, Faculty of Letters State, University of Malang. Advisor: Dr. Hj. Emalia Iragiliati, M.Pd Keywords: Cultural Content, EFL Textbook, Descriptive Texts, International Standard School Project The inevitable relationship between language and culture is not disputable. The need for cultural learning was stated in the curriculum of International Standard School Project. The culture learning for 7 graders in International Standard School Project SMPN 5 Malang is to learn target culture and source culture which can be attained through EFL textbook. Target culture in this study is the culture of countries where English is the first language such as United Kingdom, United States of America, and Australia. Meanwhile, source culture is the students’ own culture which is Indonesian. This study was aimed at analyzing the target and source culture presentation on descriptive texts of the EFL Textbook used at International Standard School Project SMPN 5 Malang by applying the content analysis. The analysis was based on the cultural content criteria of Byram (1993a) in Hinkel (1999). Target culture presentation found in the descriptive texts “Dea” were in the forms of a) name of a school which is “Mondial Lower Secondary School”; b) social class presentation of a middle class in English-Speaking countries. Meanwhile, in the text “Vanessa-Mae Vanakorn” were in the forms of a) regional identity which are “London”, “England”, and United Kingdom, b) social class presentation of upper class in United Kingdom. Source culture presentation was not presented within all the four descriptive texts. There were no vocabulary usage found related to Indonesian’s culture based on the cultural content criteria. In other words, there was no explicit language usage to present source culture in the descriptive texts. In carrying out the analysis, there were new findings found. The first was that most cultural information from the texts titled “My Grandma” and “My Bombi” were bland. Therefore, these two descriptive texts could not be mentioned to present either target or source culture information based on the culture content criteria. The second new findings were the presentations of international target culture in the descriptive texts titled “Vanessa-Mae Vanakorn” and “Dea”. The international target culture is a wide variety of cultures set in English-speaking countries or in other countries where English is not a first or second language but is used as an international language (Cortazzi & Jin in Hinkel 1999). The international target culture presentations in the descriptive text “Vanessa-Mae Vanakorn” were in the forms of: a) regional identity which was “Singapore”, “Thailand”, and “China” b) employment which was “a world–famous violinist”; c) musical instrument which was “violin”; d) musical performance which was “classical violin concerto”. e) morality showed in carrying out a divorce; and f) rites of passage in intercultural marriage. In the descriptive text i “Dea”, the international target culture presentation was in the form of morality which construed in the character of nice and helpful smart student quality. Some suggestions are proposed related to cultural content consideration. The first suggestion is for the materials developer who should develop materials that present cultural content in the reading materials such as descriptive texts to provide the students to learn about either target culture or source culture information. It can be done through the mention of the language usage through the cultural content criteria based on Byram. The second suggestion is for English teachers who would select the reading materials from textbook that could help them enriching their cultural learning by discussing the words or sentence which present target or source culture presentation. The last suggestion is for the future researchers who want to conduct studies related to the cultural content analysis on textbook. Future researchers are suggested to probe and investigate deeper the materials such as textbook in relation to its cultural content to help improving the materials development.

Persepsi konsumen terhadap bauran pemasaran cafe Warna Jurusan Teknologi Industri Fakultas Teknik Universitas Negeri Malang / Rahmayuni

 

ABSTRAK Rahmayuni. 2010 Persepsi Konsumen Terhadap Bauran Pemasaran Cafe Warna Jurusan Teknologi Industri Fakultas Teknik Universitas Negeri Malang. Skripsi, Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dra. Teti Setiawati, M. Pd. (2) Dra. Wiwik Wahyuni, M. Pd. Kata kunci: Persepsi Konsumen, Bauran pemasaran Cafe Warna Penelitian ini adalah penelitian deskriptif dengan pendekatan kuantitatif. Tujuan penelitian mengetahui persepsi konsumen terhadap produk, harga, tempat, dan pelayanan pada Cafe Warna. Populasinya adalah konsumen Cafe Warna Jurusan Teknologi Industri Fakultas Teknik Universitas Negeri Malang, dalam waktu 1 bulan sekitar 1000 orang. Jumlah sampel sebanyak 91 orang dengan teknik pengambilan sampel adalah Purposive Sampling. Instrumen yang digunakan adalah angket, dokumentasi dan wawancara. Analisis data menggunakan statistik deskriptif dengan pendekatan kuantitatif. Hasil penelitian menunjukkan bahwa (1) Persepsi konsumen terhadap produk makanan dan minuman yang ditawarkan Cafe Warna adalah 68,13% baik (sebagian besar), (2) Persepsi konsumen terhadap harga makanan dan minuman yang ditawarkan Cafe Warna adalah 43,96% baik (sebagaian kecil), (3) Persepsi konsumen terhadap tempat yang ada di Cafe Warna adalah 71,43% baik (sebagaian besar), (4) Persepsi konsumen terhadap pelayanan yang dilakukan Cafe Warna adalah59,34% baik (sebagaian besar). Masukan bagi pihak Cafe Warna adalah Sebaiknya menu Cafe Warna dibuat lebih variatif supaya persepsi konsumen menjadi lebih baik. Cafe Warna seharusnya menyediakan toilet untuk mempermudah konsumen yang memerlukan. Ventilasi yang ada di Cafe Warna sangat kurang dan sebaiknya ditambah, karena asap dari dapur masuk keruang makansehingga sangat mengganggu konsumen yang sedang menikmati makanan dan minuman. Pihak Cafe Warna juga perlu menjaga dan meningkatkan pelayanan kepada konsumen, agar tetap cepat dalam pelayanan walaupun dalam keadaan ramai dan supaya persepsi konsumen menjadi lebih baik, dari hasil yang didapat bahwa rata-rata persepsi konsumen adalah baik, dan untuk mendapatkan persepsi konsumen menjadi sangat baik maka pelayanan yang diberikan harus lebih cepat dan menggunakan standar waktu pengolahan agar konsumen tidak terlalu lama menunggu.

Pengaruh relationship marketing terhadap kepuasan nasabah (Studi pada nasabah tabungan PT. Bank Syariah Mandiri, KCP Bojonegoro) / Chandra Bayudahana

 

ABSTRAK Bayudahana, Chandra. 2010. Pengaruh Relationship Marketing Terhadap Kepuasan Nasabah (Studi Pada Nasabah Tabungan PT. Bank Syariah Mandiri, KCP Bojonegoro). Skripsi, Jurusan Manajemen, Fakultas Ekonomi Universitas Negeri Malang. Pembimbing I : Drs. Agus Hermawan, Msi, MBus, Pembimbing II: Titis Shinta Dhewi, SP, MM. Kata Kunci: Relationship Marketing dan Kepuasan Nasabah Perusahaan dituntut mampu menawarkan barang dan jasa yang dihasilkan dengan memberikan mutu pelayanan relationship marketing yang baik. Konsep relationship marketing merupakan metode yang digunakan untuk menarik perhatian pelanggan dan memelihara pelanggan serta meningkatkan dan mengelola hubungan dengan pelanggan. Oleh karenanya, hasil dari strategi relationship marketing adalah proses pembentukan dan keterkaitan di dalam mengelola kolaborasi pelanggan, membangun hubungan mata rantai untuk meningkatkan nilai pelanggan, kelanggengan pelanggan dan profitabilitas. Untuk mewujudkan Relationship yang baik dibutuhkan persyaratan, sebagai berikut ; Yang pertama jika para pelanggan mempunyai kebutuhan yang bersifat jangka panjang dan mempunyai peralihan yang tinggi, yang kedua jika pelanggan sangat terikat pada sistem tertentu dan mengharapkan pelayanan yang konsisten dan tepat waktu. Jenis penelitian yang digunakan dalam penulisan skripsi ini adalah penelitian survey, yaitu penelitian yang mengambil sampel dari satu populasi dan menggunakan kuesioner sebagai alat pengumpulan data yang pokok. Teknik analisis data yang digunakan yaitu statistik deskriptif dan analisis regresi linier berganda dengan uji F dan uji t. Berdasarkan hasil penelitian maka dapat diketahui gambaran keadaan Relationship Marketing dan Kepuasan Nasabah PT. Bank Syariah Mandiri KCP Bojonegoro dimana keuntungan bersama, komitmen, kebenaran dan komunikasi para nasabah PT. Bank Syariah Mandiri KCP Bojonegoro masuk dalam kategori baik dan kepuasan para nasabah PT. Bank Syariah Mandiri KCP Bojonegoro juga masuk dalam kategori baik. Ada pengaruh yang signifikan secara simultan antara variabel keuntungan bersama, komitmen, kebenaran dan komunikasi terhadap kepuasan nasabah PT. Bank Syariah Mandiri KCP Bojonegoro. Diketahui sebesar 71,5% kepuasan nasabah PT. Bank Syariah Mandiri KCP Bojonegoro dipengaruhi oleh variabel keuntungan bersama, komitmen, kebenaran dan komunikasi. Sedangkan sisanya sebesar 28,5% dipengaruhi oleh variabel-variabel lain diluar penelitian. Terdapat pengaruh yang signifikan secara parsial antara variabel keuntungan bersama, komitmen, kebenaran dan komunikasi terhadap kepuasan nasabah PT. Bank Syariah Mandiri KCP Bojonegoro. Beberapa saran yang diajukan dalam penelitian ini yaitu diharapkan PT. Bank Syariah Mandiri KCP Bojonegoro harus terus berupaya meningkatkan ketepatan dalam melayani segala bentuk transaksi yang terjadi, melalui usaha tersebut maka dengan sendirinya para nasabah merasa dihargai keberadaannya sebagai mitra dari bank. Selain itu untuk meningkatkan atau memberikan jaminan atas kepercayaan para nasabah diharapkan untuk bertanggung jawab atas segala pelayanan yang ditawarkan sehingga para nasabah mampu terpenuhi atas jaminan kepuasan sesuai dengan harapan para nasabah. Adapun usaha yang lain yaitu dengan mengatasi keluhan atau masalah nasabah sehingga tidak menimbulkan rasa tidak puas nasabah atas kualitas pelayanan yang diberikan. Dalam upaya untuk meningkatkan kepuasan para nasabah diharapkan pihak pengelola bank untuk berusaha menjaga hubungan yang baik antara nasabah dan pihak bank sehingga mampu menciptakan komitmen para nasabah terhadap bank. Diharapkan pihak pengelola bank selalu berupaya memberikan informasi secara lengkap atas keberadaan produk yang ditawarkan sehingga dapat terjalin komunikasi yang baik antara nasabah dan pihak bank.

Perencanaan mesin parkir type simple elevantion dua tingkat kapasitas enam mobil / oleh Yunani S. Kristanti

 

Pengaruh efikasi diri, motivasi, dan prestasi praktik kerja industri terhadap minat berwirausaha siswa kelas XII SMK Negeri 1 Turen tahu ajaran 2014/2015 / Sisdiani Hari Astuti

 

ABSTRAK Astuti, Sisdiani H. 2015. Pengaruh Efikasi Diri, Motivasi, dan Prestasi Praktik Kerja Industri Terhadap Minat Berwirausaha siswa kelas XII Pemasaran SMK Negeri 1 Turen Tahun ajaran 2014/2015. Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (I) Dr. Sopiah, M.Pd, M.M., (II) Drs. Moh Hari, M.Si Kata Kunci : Efikasi Diri, Motivasi, Prestasi Praktik Kerja Industri, dan Minat Berwirausaha Tingginya jumlah pengangguran di Indonesia tidak terlepas dari kualitas sumber daya manusia yang masih rendah pula. Berdasarkan data data dari Badan Pusat Statistik pada februari 2014 jumlah pengangguran di Indonesia SD kebawah 29, 72 %, SMP 23,7%, SMA 26,5%, SMK 11,85%, Universitas 8,35%. Salah satu cara mengatasi pengangguran di Indonesia yaitu dengan menumbuhkan minat berwirausaha satu faktor pengaruhnya adalah Efikasi diri, motivasi dan prestasi praktik kerja industri. Penelitian ini bertujuan untuk mengatahui: (1) Efikasi diri, motivasi, prestasi praktik kerja industri dan minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen; (2) Pengaruh Efikasi diri terhadap minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen; (3) Pengaruh Motivasi terhadap minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen; (4) Pengaruh Praktik Kerja Industri terhadap minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen. Penelitian ini menggunakan seluruh populasi sebagai objek penelitian yakni kelas XII Pemasaran SMK Negeri 1 Turen yang berjumlah 67 siswa. Teknik pengumpulan data menggunakan kuesioner dan dokumentasi. Skala yang digunakan adalah skala likert dengan 5 alternatif jawaban. Dalam menguji kelayakan instrumen digunakan uji validitas dan reliabilitas dengan bantuan SPSS 16.0 for windows. Penelitian ini merupakan penelitian kuantitatif dengan menggunakan analisis deskriptif, uji asumsi klasik dan analisis Regresi Berganda. Hasil penelitian ini menunjukan bahwa: 1) Efikasi diri, motivasi prestasi praktik kerja industri dan minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen adalah tinggi; 2) Terdapat pengaruh positif signifikan efikasi diri terhadap minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen; 3) Terdapat pengaruh positif signifikan Motivasi terhadap minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen; 4) Tidak ada pengaruh positif signifikan prestasi praktik kerja industri terhadap minat berwirausaha siswa kelas XII pemasaran SMK Negeri 1 Turen. Dari hasil penelitian ini, peneliti menyarankan kepada guru, orang tua dan siswa untuk mendukung, mengarahkan dan meningkatkan yang ada pada diri siswa untuk memunculkan dan mengembangkan minat berwrausaha.

Analisis rasio profitabilitas untuk menilai kinerja keuangan PT. Semen Gresik (Persero) Tbk. / Upik Indrawani

 

PT.Semen Gresik ( Persero) Tbk. is peripatetic company in the field of cement industry, and represent one of the Body of is Effort Publik Ownwrship ( BUMN). Pursuant to monetary ratio analysis of this research aim to to assess performance of PT. Semen Gresik ( Persero) Tbk. according to profitability ratio covering: clean income margin ratio, equity on return, assets on return. Profitability is ratios which is used in doing measurement of efectifities of management at one particular company by totally, which is shown by big the so small advantage which is obtained in its relation with long-range company invesment and also sale during and also short-range. Assessment of performance can be done by using calculation of ratio analysis comparing between related/relevant posts in balance report and balance and also compare the condition of exist in report and contained in financial statement with theory which there are in used references. Technique data collecting in writing of this Final Duty is documentation. Trouble-Shooting method in writing of this Final Duty is descriptive and qualitative, that is from information which have been collected, is later then processed and description to be concluded as according to formula of is problem of. Result of this research indicate that PT. Semen Gresik ( Persero) Tbk. ratio of net margin profit in the year 2006-2008 experiencing of increase that is year 2006 equal to 14,84%, year 2007 equal to 18,49 %, year 2008 equal to 20,67 %. Return ratio to the totalizeing asset in the year 2006-2008 experiencing of increase that is year 2006 equal to 17, 28%, year 2007 equal to 20,85%, year 2008 equal to 23,80%. Return ratio of net worth in the year 2006-2008 experiencing of increase that is year 2006 equal to 23,56%, year 2007 equal to 26,79% and in the year 2008 equal to 31,27%. From result of financial statement analysis can know that PT. Semen Gresik ( Persero) Tbk. be in god condition and is healthy. Where profitability ratio used to yield profit show the existence of high profit improvement of year 2006-2008.

Pengaruh rasio profitabilitas, economic value added, dan market value added terhadap harga saham pada perusahaan real estate dan properti yang listing di Bursa Efek Indonesia tahun 2007 / Purwanto

 

ABSTRAK Purwanto.2009. Pengaruh rasio profitabilitas, economic value added, dan market value added terhadap harga saham pada perusahaan real estate dan properti yang listing di Bursa Efek Indonesia pada tahun 2007. Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I)Dr. Bambang Sugeng, M.A. (2)Ika Putri Larasati,S.E. M.Com Kata kunci : rasio profitabilitas, economic value added, market value added, harga saham Tujuan utama perusahaan adalah untuk memaksimumkan profit. Oleh karena tujuan memaksimumkan profit bersifat statis dan tidak memperhatikan dimensi waktu, maka tujuan utama bergeser dari maksimumkan profit ke memaksimumkan kemakmuran pemegang saham melalui maksimisasi nilai perusahaan. Untuk perusahaan yang go public harga saham merupakan pencerminan dari nilai perusahaan. Banyak faktor yang mempengaruhi harga saham. Faktor utama yang mempengaruhi harga saham adalah kinerja perusahaan. Salah satu indikator dalam mengukur kinerja keuangan perusahaan adalah dengan analisis rasio khususnya rasio profitabilitas. Selain mengunakan rasio juga terdapat metode penilaian kinerja yang lebih unggul yang berorientasi untuk menilai tingkat kemakmuran pemegang saham yaitu economic value added dan market value added. Penelitian ini bertujuan untuk menjelaskan pengaruh rasio profitabilitas, economic value added, dan market value added terhadap harga saham pada perusahaan real estate dan properti yang listing di Bursa Efek Indonesia tahun 2007. Dalam penelitian ini rasio profitabilitas diukur dengan return on asset yang menunjukkan kemampuan perusahaan dalam menghasilkan laba dengan mengunakan total aktivanya dan gross profit margin yang menunjukkan kemampuan menghasilkan laba dari penjualannya. Economic value added merupakan alat ukur kinerja yang memperhatikan unsur biaya modal, sedangkan market value added adalah selisih antara nilai pasar ekuitas dengan jumlah ekuitas yang diinvestasikan dalam perusahaan. Populasi dalam penelitian ini adalah semua perusahaan real estate dan properti yang go public tahun 2007. Kemudian dengan mengunakan metode random sampling ditentukan bahwa sampel penelitian adalah 30 perusahaan. Penelitian ini menguji hipotesis dengan analisis regresi berganda. Pengujian hipotesis menunjukkan bahwa di dalam uji t hanya return on asset yang lebih besar dari 0,05 sehingga hanya variabel return on asset yang berpengaruh terhadap harga saham. Return on asset memiliki pengaruh terhadap harga saham. Hal ini mengindikasikan bahwa investor mengunakan rasio ini untuk menilai kinerja perusahaan. Meskipun konsep economic value added dan market value added lebih unggul tapi pada perusahaan real estate dan properti belum dijadikan landasan dalam mengukur kinerja perusahaan. Selain itu tidak berpengaruhnya economic value added dan market value added juga dikarenakan perbedaan karakteristik dan jenis perusahaan.

Survei tingkat pengetahuan tentang narkoba dan bahaya penyalahgunaannya pada siswa SMP Negeri se-Kecamatan Klojen kota Malang / Sudarmanik

 

ABSTRAK Sudarmanik. 2010. Survei Tingkat Pengetahuan tentang Narkoba dan Bahaya Penyalahgunaannya pada Siswa SMP Negeri se-Kecamatan Klojen Kota Malang. Skripsi, Jurusan Pendidikan Jasmani & Kesehatan FIK Universitas Negeri Malang. Pembimbing: (I) Drs. Mulyani Surendra, M.S, (II) dr. Hartati Eko Wardani, M.Si. Med. Kata kunci: pengetahuan, penyalahgunaan narkoba, dan siswa. Hingga kini penyebaran narkoba sudah hampir tidak bisa dicegah. Penyebaran narkoba juga sudah merajalela di sekolah-sekolah dari tingkat perguruan tinggi bahkan pendidikan dasar. Timbulnya masalah penyalahgunaan narkoba di kalangan remaja/pelajar dewasa ini tidak hanya menyangkut remaja atau pelajar itu sendiri akan tetapi juga ada hubungan dengan berbagai faktor yaitu keluarga, lingkungan tempat tinggal, lingkungan sekolah, serta aparat hukum, baik sebagai faktor penyebab, pencetus maupun yang menanggulangi. Salah satu upaya penanggulangan narkoba di lingkungan sekolah adalah dengan memasukkan materi bahaya penyalahgunaan narkoba ke dalam satuan pembelajaran pendidikan di sekolah misalnya saja pendidikan jasmani pada setiap jenjang pendidikan, dari tingkat SD, SMP maupun SMA. Namun kenyataannya, materi bahaya penyalahgunaan narkoba tidak terdapat pada satuan pembelajaran jenjang SMP baik itu dari tingkat kelas 1, 2 ataupun kelas 3. Observasi awal yang dilakukan oleh peneliti pada guru-guru pendidikan jasmani di SMP Negeri se-Kecamatan Klojen Kota Malang yaitu sebanyak 5 guru di 5 SMP Negeri, menunjukkan bahwa hanya 20% guru yang memberikan materi bahaya narkoba pada muridnya sedangkan 80% guru tidak memberikan materi bahaya narkoba. Untuk mengetahui bahwa siswa SMP Negeri se-Kecamatan Klojen Kota Malang mengetahui bahkan menguasai tentang materi bahaya penyalahgunaan narkoba, maka peneliti ingin meneliti tingkat pengetahuan siswa SMP Negeri di Kecamatan klojen Kota Malang tersebut. Tujuan penelitian ini adalah mengidentifikasi tingkat pengetahuan tentang narkoba dan bahaya penyalahgunaannya pada siswa SMP Negeri se-Kecamatan Klojen Kota Malang. Metode yang digunakan dalam penelitian ini adalah penelitian deskriptif kuantitatif. Populasi dalam penelitian ini berjumlah 2581 siswa. Sampel yang diambil sebanyak 10% dari populasi yaitu 257 siswa. Hasil peneletian menunjukkan bahwa tingkat pengetahuan tentang narkoba dan bahaya penyalahgunaannya pada siswa SMP Negeri se-Kecamatan Klojen Kota Malang secara umum adalah 58,75% siswa mempunyai kategori pengetahuan yang cukup baik, 1,56% siswa mempunyai kategori pengetahuan yang baik, 32,30% siswa mempunyai kategori pengetahuan yang kurang baik, dan 7,39% siswa mempunyai kategori pengetahuan yang tidak baik. Rata-rata tingkat pengetahuan tentang narkoba dan bahaya penyalahgunaannya pada siswa SMPN se-Kecamatan Klojen Kota Malang adalah 58,02, dengan standar deviasi 10,36. Sedangkan nilai pengetahuan siswa yang terendah adalah 30 dan nilai yang tertinggi adalah 80. Dengan demikian dapat disimpulkan bawa tingkat pengetahuan siswa SMP Negeri se-Kecamatan klojen Kota Malang adalah cukup baik.

Persepsi Masyarakat Terhadap Keberadaan Lembaga Kursus BEC (Basic Engliss Course) Dalam Peningkatan Kesejahteraan Ekonomi Masyarakat (Studi Diskriptif Pada Masyarakat Dusun Singgahan Desa Palem Kecamatan Pare Kabupaten Kediri) Oleh Shinda Wulandari

 

Di dalaml ingkunganl embagak 'rsus selalub erhubringand enganl ingkungan masyarakatK. eadaanli ngkungand i sekitar lembagak ursusm gmlerilan pengaruh bagiperkemb*g* r*to le-baga. Lingkungan belajar yang kondusif menjadikan leribaga kunus -nnC yuog beradad i Kota Pares emakinb erkembangD. engana danya lembaia tersebutm asyarakaDt usun Singgahanm emperolehk euntunganp eningkatan kesejahteraaenk onomi Penelitian ini bernrjuan unhrk mengetahui secara garis besar persepsi masyarakatte rhadapl embagak ursusB EC dalamp eningkat4nk efjantel= ekonomi ,n*yututut Dusun singgahan.P enelitiani ni menggunakanm etodep enelitian Kuantitatif deskriptif aJog.t fokus penelitian yaitq (l).Gambaran situasi sosio ekonomim asyarakadt usunS inggahans ebelumB EC didirikan (2).Gambarans osio ekonomit nutyu*tut Dusun Singgahans etelaha danyaB EC (3). Persepsmi asyarakat DusunS inggahante ntang lembagak ursusB EC dalamp eningkatank esejahteraan ekonomim asyarakaDt usun Singgahan. Penelitiani ni dilaksanakand i D.u sun SinggahanD esaP elemK ecamatanP are KabupatenK ediri. Sumberd ata yang digunakana dad ua yaitu datap rimer dan data sekunderD, ata primer terdiri dari Ketua RT 12 RW 16 dan Ketua RT 2 RW 13 besertas ebagianm asyarakast ekitary ang memiliki usaha-usahkae cil, sedangkand ata sekunderte riiri dari iokumen-dokumeny angb erasald ari lokasi penelitiand anb ukubuku yang menunjang penelitian ini. Selanjufirya data digali dengan metode *u*a11"uiu, observasis ertad okumentasi. Analisis datad ilakukans etelatrs emuad ata yang diperlukan terkumpul selama proses p€ngumpulan data yang.dilalgkan dalarn 6"d*pu tuttup yaitu; tahap memasuki lokasi penelitian, tahap ketika berada di lokasi penelitian,t ahapp engumpuland atay ang meliputi observaslia ngsung,w awancara dan dokumentasif.* gkutt-tungkah dalam analisisd atay ang ditempuha dalah analisis deskriptif-anatltik yaitu mendiskripsikan dan menafsirkan hasil pengumpulan datas ecaram endalam. Hasil penelitian ini menunjukkan bahwa gambaran sosio ekonomi masyarakat DusunS inggahans ebeluml embagak ursusB EC ada masihr elatif rendahd engan mengandalkans ektorp erekonomiand ari hasil pertanians aj4 gambarans osio ekonomim asyarakaDt usun Singgahans etelaha danyal embagak ursusB EC menunjukkanp eningkatany ang lebih baik, masyarakast elainm emperoleh pendaiatand ari pertanianj uga mendapatkanta mbahanp enghasiland ari usahak ecil yang mereka miliki misalnya usaha tempat kost, usaha warung nasi, toko, wartel, danusahare ntal komputer.P ersepsmi asyarakat erhadapl embagak ursusB EC adalah persepsyi ang baik karenal embagak ursusB EC selamai ni telah memberikan keuntunganb agi masyarakadt usun Singgahanb aik dari segip eningkatans ektor ekonomi dan sektor non ekonomi. Maka diharapkan ke depan untuk lembaga kursus BEC (Basic English Course) agars elalum engembangkapnr oduk-produknyak hususnyap roduk pelayanan pembelajaradni lembagak ursus.m isalnyam engadakasni stemp embelajarayna ng baik.m eningkatkapnr omosil embagate rsebutg. unap eningkatans umberdaya masyarakakth ususnyad i DusunS inggalranD, esaP elem,K ecamatanP are, KabupatenK ediri.

Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema ion untuk siswa kelas IX di SMP Negeri 1 Malang / Purwaning Handayani

 

ABSTRAK Handayani, Purwaning. 2010. Pengembangan Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Ion untuk Siswa Kelas IX di SMP Negeri 1 Malang. Skripsi, Program Studi Pendidikan Fisika. Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (1) Drs. Supriyono Koes H., M.Pd., M.A., (2) Drs. Parlan, M.Si. Kata kunci: IPA Terpadu, konstruktivisme, tema ion. Peraturan Menteri Pendidikan Nasional Nomor 22 Tahun 2006 tentang Standar Isi menyatakan secara tegas bahwa substansi mata pelajaran IPA untuk SMP/ MTs merupakan IPA terpadu. Di lain pihak, hasil survei terhadap guru IPA SMP di Malang Raya menunjukkan bahwa kebutuhan terhadap paket IPA terpadu benar-benar mendesak. Sebanyak 94,6% guru menyatakan bahwa mereka membutuhkan paket IPA terpadu untuk pembelajaran IPA SMP. Hasil pangamatan di beberapa toko buku di Malang menunjukkan bahwa belum ditemukan buku IPA SMP yang dirancang secara terpadu. Oleh karena itu, dilakukan penelitian dengan menyusun Paket IPA Terpadu beserta panduan pelaksanaan pembelajaran untuk guru. Tujuan penelitian adalah untuk mengetahui kelayakan Paket dan Panduan Pelaksanaan Pembelajaran IPA Terpadu dengan Tema Ion di SMP Negeri 1 Malang. Penelitian ini merupakan penelitian pengembangan yang menggunakan lima langkah awal metode Borg dan Gall, yaitu studi pendahuluan, perencanaan, pengembangan bentuk awal produk, uji lapangan awal, dan revisi produk utama. Kelayakan diukur dengan menggunakan uji validitas oleh tim ahli materi (dua dosen IPA) dan pengguna paket (dua guru IPA SMP Negeri 1 Malang). Selain itu, enam siswa SMP Negeri 1 Malang yang memiliki kemampuan tinggi, sedang dan rendah diminta untuk membaca paket, kemudian menandai kata-kata sulit dan kalimat yang belum dipahami. Hal ini dilakukan untuk mengetahui keterbacaan paket oleh siswa. Hasil penelitian menunjukkan bahwa Paket IPA Terpadu dengan Tema Ion memperoleh nilai rata-rata 3,75 yang berarti layak. Sedangkan Panduan Pelaksanaan Pembelajaran IPA Terpadu memperoleh nilai rata-rata 3,65 yang berarti layak. Walaupun telah dinilai layak, Paket dan Panduan Pelaksanaan Pembelajaran IPA Terpadu dengan Tema Ion yang dihasilkan belum dapat digunakan untuk pembelajaran di kelas. Berdasarkan hasil penelitian ini disarankan untuk melakukan penelitian pengembangan lebih lanjut terhadap Paket IPA Terpadu dengan Tema Ion dengan melakukan kajian eksperimen dan uji coba yang lebih luas, sehingga diperoleh paket dan panduan pelaksanaan yang teruji validitasnya secara empiris dan siap digunakan.

Perbedaan tingkat profesionalisme auditor berdasarkan gender pada KAP di Kota Malang / Fadilla Cahyaningtyas

 

ABSTRAK Cahyaningtyas, Fadilla. 2010. Perbedaan Tingkat profesionalisme Auditor berdasarkan Gender pada KAP di Kota Malang. Skripsi, Jurusan Akuntansi, FE, UM. Pembimbing (1) DR. Nurika Restuningdiah, SE., M.Si., Ak. (2) Triadi Agung Sudarto, S.E., Ak., M.si. Kata Kunci: Profesionalisme, Auditor, Gender Profesionalisme menjadi syarat utama bagi orang yang ingin bekerja sebagai auditor eksternal di KAP. Gambaran seseorang yang profesional dalam profesi dicerminkan dalam lima dimensi, yaitu pengabdian terhadap profesi, kewajiban sosial, kemandirian, keyakinan terhadap profesi, dan hubungan dengan sesama profesi. Penelitian ini bertujuan unuk mengetahui apakah terdapat perbedaan tingkat profesionalisme antara auditor pria dan auditor wanita pada KAP di Kota Malang. Populasi yang digunakan dalam penelitian ini adalah Auditor yang bekerja pada Kantor Akuntan Publik di Kota Malang tahun 2010 yang berjumlah 45 auditor dan seluruhnya dijadikan sampel penelitian karena metode pengambilan sampel menggunakan metode non probability sampling, yaitu convenience sampling. Metode pengumlan data yang digunakan adalah metode survey, yaitu dengan mengirimkan kuesioner melalui pos (mail survey) yang disertai dengan surat permohonan untuk menjadi responden, diantar sendiri maupun menitipkan kuesioner pada contact person dari KAP tempat responden bekerja. Analisis data menggunakan Independent Sampel T test (uji T untuk dua sampel independen). Hasil penelitian ini menunjukkan bahwa tidak terdapat perbedaan tingkat profesionalisme auditor berdasarkan gender pada KAP di Kota Malang. Alasan yang mendasar berkaitan dengan tidak adanya perbedaan tingkat profesionalisme antara auditor wanita dengan pria adalah keunggulan wanita terletak pada kesabaranya, ketekunan, keuletan dan akurasi dalam penghitungan, tepat bagi karir sebagai seorang akuntan. Saran dari penelitian ini untuk penelitian selanjutnya diharapkan (1) melakukan wawancara pada Kantor Akuntan Publik, (2) memperluas area penelitian, (3) ditambah variabel-variabel lain seperti berdasarkan hierarki jabatan, lama pengalaman kerja, dan sebagainya, (4) memperluas sampel penelitian seperti akuntan pendidik, akuntan manajemen, ataupun akuntan pemerintahan. Bagi Kantor Akuntan Publik diharapkan (1) dapat memberikan peluang yang sama baik terhadap auditor pria ataupun auditor wanita dalam merekruitmen akuntan publik, (2) memberikan porsi dan kesempatan yang sama bagi auditornya baik itu wanita ataupun pria untuk mengembangkan kariernya.

Perbedaan keterampilan hubungan interpersonal antara siswa kelas olimpiade dan siswa kelas reguler di SMA Negeri 5 Malang / Fifi Setia Desianti

 

PERBEDAAN KETERAMPILAN HUBUNGAN INTERPERSONAL ANTARA SISWA KELAS OLIMPIADE DAN SISWA KELAS REGULER DI SMA NEGERI 5 MALANG Fifi Setia Desianti* ABSTRAK Keterampilan hubungan interpersonal merupakan kecakapan sosial yang perlu dimiliki oleh setiap anak. Kecakapan itu diperlukan untuk dapat melakukan interaksi dengan lingkungan sekitar. Sekolah merupakan lingkungan untuk mengembangkan keterampilan hubungan interpersonal karena siswa banyak menghabiskan waktu dan kesempatan untuk berinteraksi dengan sesama siswa, guru dan pihak sekolah lain. Tujuan penelitian adalah untuk: (1) Mengetahui tingkat keterampilan hubungan interpersonal siswa kelas olimpiade di SMAN 5 Malang, (2) Mengetahui tingkat keterampilan hubungan interpersonal siswa kelas reguler di SMAN 5 Malang, dan (3) Mengetahui adanya perbedaan keterampilan hubungan interpersonal antara siswa kelas olimpiade dan siswa kelas reguler di SMAN 5 Malang. Rancangan penelitian yang digunakan adalah deskriptif komparatif. Populasi penelitian adalah siswa kelas olimpiade dan siswa kelas reguler SMAN 5 Malang. Sampel penelitian adalah seluruh siswa kelas olimpiade dengan jumlah 65 siswa dan siswa kelas reguler kelas X dan XI berjumlah 127 siswa. Teknik pengambilan sampel menggunakan total sampling untuk siswa kelas olimpiade dan Stratified Random Sampling untuk siswa kelas reguler. Pengumpulan data menggunakan inventori keterampilan hubungan interpersonal dengan skala selalu, sering, kadang-kadang, dan tidak pernah. Teknik analisis yang digunakan adalah persentase dan uji-t. Hasil penelitian menunjukkan bahwa 1) 8% siswa kelas olimpiade memiliki keterampilan hubungan interpersonal sangat tinggi, 82% tinggi, 10% sedang dan tidak ada siswa yang memiliki keterampilan hubungan interpersonal kurang dan sangat kurang, 2) 3% siswa kelas reguler memiliki keterampilan hubungan interpersonal sangat tinggi, 83% tinggi, 18% sedang dan tidak ada siswa yang memiliki keterampilan hubungan interpersonal kurang dan sangat kurang, 3) berdasarkan hasil analisis ujit, nilai t tabel adalah sebesar 1,980 dan nilai t hitung sebesar 0,045 dengan signifikansi (Sig) = 0,964. Karena nilai t hitung (0,045) < t tabel (1,980), dengan demikian hipotesis nihil diterima dan hipotesis alternative ditolak pada taraf signifikansi 95%. Dapat disimpulkan bahwa

Upaya pengelolaan kelas yang efektif oleh guru praktikan bidang studi sejarah: studi kasus di SMP Negeri 4 Kepanjen / Raberty Hary Jatmikaningsari

 

ABSTRAK Jatmikaningsari, Raberty, Hary.2010. Upaya Pengelolaan Kelas yang Efektif Oleh Guru Praktikan Bidang Studi Sejarah: Studi Kasus di SMP Negeri 4 Kepanjen. Skripsi, Jurusan Sejarah FIS Universitas Negeri Malang. Pembimbing Dr. Hj. Siti Malikhah Towaf, M. A. Kata kunci: pengelolaan kelas, guru praktikan, bidang studi Sejarah Guru merupakan salah satu faktor kunci dalam keberhasilan proses pendidikan sehingga kualitas guru menjadi perhatian masyarakat. Sekolah menuntut universitas untuk dapat mempersiapkan calon guru yang siap bekerja secara produktif dalam dinamika sekolah yang unik. Masalah pokok yang dihadapi guru baik pemula maupun berpengalaman adalah kemampuan dalam mengelola kelas yang efektif. Pengelolaan kelas yang efektif adalah syarat bagi pengajaran yang efektif. Fungsi mengelola kelas sangat mendasar karena kegiatan guru dalam mengelola kelas meliputi kegiatan mengelola tingkah laku siswa, menciptakan sosio emosional dalam mengelola proses kelompok. Keberhasilan guru dalam menciptakan situasi belajar yang optimal menandakan proses belajar mengajar berlangsung secara efektif. Pentingnya penelitian ini adalah untuk mengetahui upaya guru praktikan dalam menciptakan kondisi belajar yang kondusif guna mencapai tujuan pendidikan. Penelitian ini berangkat dari pertanyaan bagaimana upaya guru praktikan untuk melaksanakan pengelolaan kelas yang efektif. Dari hasil studi pendahuluan didapatkan empat fokus penelitian yaitu (1) upaya guru dalam pengelolaan kelas yang efektif, (2) pendekatan pengelolaan kelas, (3) efektifitas pengelolaan kelas, (4) faktor pendukung dan penghambat dalam pengelolaan kelas. Tujuan dari penelitian ini untuk (1) mengetahui upaya pengelolaan kelas yang dilakukan guru praktikan bidang studi Sejarah dalam mengelola kelas yang efektif, (2) mengetahui penerapan berbagai macam pendekatan pengelolaan kelas yang digunakan guru praktikan bidang studi Sejarah, (3) mengetahui efektifitas pengelolaan kelas yang dilakukan guru praktikan bidang studi Sejarah, (4) mengetahui faktor pendukung dan penghambat yang mempengaruhi guru praktikan bidang studi Sejarah dalam mengelola kelas. Untuk menjawab permasalahan yang ada penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus. Teknik pengumpulan data yang digunakan meliputi: (1) teknik observasi, (2) teknik wawancara, (3) teknik dokumentasi. Data yang diperoleh dari ketiga teknik tersebut diorganisasikan, ditafsirkan, dan dianalisis, guna menyusun dan mengabstraksi temuan lapangan. Keabsahan data diuji dengan (1) ketekunan pengamatan, (2) teknik triangulasi yaitu dengan memanfaatkan pengamat lainnya untuk keperluan pengecekan kembali derajat kepercayaan data. Hasil penelitian menunjukkan bahwa: (1) upaya pengelolaan kelas yang efektif meliputi perencanaan pengelolaan kelas dengan jalan memerinci kondisi kelas yang ada serta merencanakan pengelolaan kelas yang dituangkan dalam RPP, dalam pelaksanaannya pengelolaan kelas dilakukan dengan menata lingkungan fisik kelas serta menciptakan hubungan yang baik dan terbuka antara siswa dengan guru, tindak lanjut pengelolaan kelas dilakukan dengan cara evaluasi oleh guru pamong, teman sejawat dan siswa, upaya-upaya pengelolaan kelas yang bersifat preventif (pencegahan) dilakukan dengan melakukan interaksi edukatif dan kuratif (penanggulangan) dilakukan dengan mengidentifikasi masalah yang terjadi dan bersama-sama mencari solusi, (2) guru praktikan menggunakan ketiga pendekatan pengelolaan kelas meliputi pendekatan pengubahan tingkah laku, pendekatan penciptaan iklim sosio emosional, pendekatan proses kelompok, (3) Efektifitas pengelolaan kelas dilakukan dengan cara menciptakan dan memelihara kondisi kelas, pembelajaran yang efektif, serta mengembangkan komunikasi yang efektif sehingga terjadi interaksi positif (4) faktor pendukung dan penghambat pengelolaan kelas berasal dari faktor manusia dan non manusia. Faktor manusia berasal dari input siswa dan guru, sedangkan non manusia berasal dari fasilitas IT yang dimililki sekolah. Dalam pelaksanaanya guru praktikan terkadangn juga mengalami kendala, yaitu adanya siswa yang belum siap menerima pelajaran. Fasilitas IT juga kurang bisa dimanfaatkan dengan maksimal, dan waktu pelajaran berkurang karena libur. Dari penelitian yang dilakukan dapat disimpulkan bahwa guru praktikan sudah melaksanakan pengelolaan kelas dengan baik sesuai dengan prosedur pengelolaan kelas Dikdasmen . Dari kesimpulan tersebut peneliti menyarankan: (1) Kepala sekolah terus memberikan motivasi untuk mengembangkan upaya guru praktikan dalam pengelolaan kelas yang efektif, (2) Guru pamong meningkatkan bimbingan kepada guru praktikan sehingga terjadi hubungan timbal balik diantara keduanya, (3) Guru praktikan menambah kreatifitas dan model-model pengelolaan kelas yang efektif, (4) Jurusan Sejarah meperkaya kajian-kajian tentang pengelolaan kelas, (5) Dalam penelitian lebih lanjut peneliti lain dapat mengembangkan lebih dalam mengenai pengaruh pengelolaan pengajaran dalam pengelolaan kelas yang efektif.

Pembelajaran kooperatif model TAI (Team Assisted Individualization) berbasis eksperimen untuk meningkatkan motivasi dan hasil belajar fisika siswa kelas VII SMP Negeri 6 Malang / Koko Ardianto

 

ABSTRAK Ardianto, Koko. 2010. Pembelajaran Kooperatif Model TAI (Team Assisted Individualization) Berbasis Eksperimen untuk Meningkatkan Motivasi dan Hasil BelajarSiswa Kelas VII SMP Negeri 6 Malang.Skripsi, Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (1) Drs. PurboSuwasono, M.Si, (II) Dra. Chusnana Insjaf Yogihati M.Si. Kata Kunci: Model pembelajaran kooperatif TAI, motivasi, hasil belajar Pengalaman belajar yang diberikan guru dalam pembelajaran menentukan tingkat pencapaian keberhasilan proses dan hasil belajar siswa. Berdasarkanhasilwawancaradengan guru fisikadanobservasi yang telahdilaksanakan di SMP Negeri6 Malangdiperolehinformasibahwamulaidarikelas VII-1sampaikelas VII-8, kelas yang memilikimotivasidanhasilbelajar yang rendahadalahkelas VII-8. Indikatorrendahnyamotivasibelajarsiswayaitu: (1) 24 dari 40 anak yang tidaklengkapmengerjakantugas yang mengindikasikankurangnyapersiapansiswadalammengikutikegiatanpembelajaran, (2) siswatidakmemperhatikanketika guru sedangmenerangkanpelajaran, dan (3) tidakadasiswa yang menjawabpertanyaandari guru secarasukarela yang mengindikasikanrendahnyapartisipasisiswadalamkegiatanpembelajaran. Selainmotivasi yang rendahkelas VII-8 jugamempunyai rata-rata hasilbelajar yang rendah, yaitu 54.Rata-rata nilaiinilebihrendahdarinilai KKM (kriteriaketuntasan minimal) SMP Negeri 6 Malang yaitu 68.Berdasarkan permasalahan tersebut diterapkan model pembelajaran yang dapat membuat siswa aktif selama proses pembelajaran dan saling membantu untuk memperoleh pemahaman Pembelajaran tersebut adalah model pembelajaran kooperatif TAI yang bertujuan untuk meningkatkan motivasi dan hasil belajar fisika siswa. Model pembelajarankooperatif TAI dalampenelitianinimeliputitahapplacement test and team, teaching group, student creative, team study, whole class unit, fact test, team score and team recognition. Subjekpenelitianiniadalahsiswakelas VII-8 SMP Negeri 6 Malang.Penelitianinitermasukpenelitiantindakankelas yang berlangsungdalamduasiklus.Teknikpengumpulan data aktivitas guru selamapembelajaranberlangsungmelalui 1) keterlaksanaanpembelajarandanmotivasibelajarmelaluimenggunakanlembarobservasidan 2) data prestasibelajardiperolehdarites.Data tersebutdianalisisdenganperhitungan rata-rata danpersentase yang kemudiandiartikansecaradeskriptifkualitatif. Hasil penelitian menunjukkan bahwa persentase keterlaksanaan pembelajaran mengalami peningkatan dari siklus I ke siklus II. Motivasi siswa juga mengalami peningkatan. Perolehan persentase pencapaian aktivitas siswa secara klasikal pada siklus I 69,5 % dengan taraf baik pada siklus II meningkat menjadi 78% dengan taraf sangat baik. Hasil belajar siswa meningkat dari data awal sebesar 57,41 menjadi 72,33 pada siklus I dan 75,42 pada siklus II. Data awal menunjukkan siswa yang tuntas belajar sebanyak 9 orang, pada siklus I sebanyak 30 orang dan pada siklus II meningkat menjadi 34 orang. Dengandemikiandapatdisimpulkanbahwamodelpembelajarankooperatif TAI dapatmeningkatkanmotivasi dan hasilbelajarsiswakelas VII-8 SMP Negeri 6 Malang.

Penerapan pembelajaran finger painting sebagai suatu proses kreatif dalam menggambar dan mewarna siswa TK Halimah 05 Banjararum Singosari Malang / Ayung Candra Padmasari

 

ABSTRAK Padmasari, Ayung Candra. 2010. Penerapan Pembelajaran Finger Painting Sebagai Suatu Proses Kreatif Siswa dalam Menggambar dan Mewarna Siswa TK Halimah 05 Banjararum Singosari. Skripsi, Jurusan Seni Dan Desain Universitas Negeri Malang. Pembimbing:(1) Drs. Andi Harisman, (II) Fenny Rochbeind S.Pd, M.Sn Kata Kunci : Pembelajaran Finger Painting, Proses kreatif, Menggambar, Mewarna Penerapan Pembelajaran Finger painting Sebagai Suatu Proses Kreatif Siswa TK Halimah 05 Banjararum Singosari merupakan salah satu bentuk aplikasi lain dalam menggambar yang menjadi trend saat ini. Finger painting merupakan suatu gerakan motoris yang global bagi anak, seluruh badan seakan-seakan ikut terlibat melakukan gerakan itu. Pembelajaran finger painting diarahkan pada pengembangan kreativitas dan keterampilan anak serta pembentukan kepribadian anak sesuai dengan tingkat perkembangan usia dan karakter anak. Oleh karena itu peneliti tertarik menerapkan finger painting dalam pembelajaran menggambar dan mewarna sebagai suatu bentuk proses kreatif siswa dalam menuangkan ide dan gagasan dalam berkarya seni serta sebagai media untuk menyampaikan materi cara mencampur warna yang sangat efektif untuk anak. Penelitian ini bertujuan untuk mendeskripsikan kemampuan siswa dalam proses kreatif dalam menggambar dan mewarna siswa TK Halimah 05 Bajararum Singosari. Selain itu dalam penelitian ini juga dideskripsikan perencanaan dan juga proses kegiatan menggambar dan mewarna menggunakan pembelajaran finger painting. Penelitian ini menggunakan rancangan penelitian kualitatif. Sumber data yang digunakan adalah 15 anak dari siswa kelompok B TK Halimah 05 Banjararum Singosari Malang. Data dalam penelitian ini adalah hasil pretes dan postes, hasil kuesioner dan hasil observasi. Instrumen yang digunakan adalah angket, tes dan pedoman observasi. Hasil penelitian ini menunjukkan bahwa pembelajaran finger painting dapat meningkatkan proses kreatif siswa dalam menggambar dan mewarna. Hal ini terbukti dari 10 siswa dari 15 siswa memperoleh skor dengan kategori sangat baik, dan 5 siswa dari 15 siswa tersebut memperoleh skor baik. Dari penilaian tersebut dapat dsimpulkan bahwa pembelajaran finger painting sangat efektif terutama ketika dimanfatkan dalam penyampaian materi mencampur warna dasar kepada anak. Oleh karena itu peneliti menyarankan kepada guru Taman Kanak -Kanak untuk menerapkan pembelajaran finger painting sebagai proses kreatif anak dalam penggalian ide pada kegiatan menggambar dan mewarna anak terutama sebagai media untuk pemahaman teori mencampur warna. Hal ini dikarenakan pembelajaran finger painting merupakan salah satu bentuk pembelajaran yang lebih menciptakan kondisi anak untuk bermain sambil belajar. iii

Pengembangan bahan ajar IPA terpadu berbasis kontekstual tema pemuaian pada berbagai wujud zat untuk siswa SMP kelas VII / Khoirun Nisa

 

ABSTRAK Nisa, Khoirun . 2010. Pengembangan Bahan Ajar IPA Terpadu berbasis kontekstual Tema Pemuaian pada berbagai wujud Zat untuk SMP kelas VII. Skripsi, Program Studi Pendidikan Fisika, Jurusan Fisika, FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Lia Yuliati, M. Pd., (II) Drs. I Wayan Dasna, M.Si. M.Ed, Ph.D Kata Kunci: bahan ajar, IPA terpadu, pendekatan kontekstual Pembelajaran yang dianjurkan dalam pelaksanaan KTSP berdasarkan standar proses adalah dengan pendekatan kontekstual. Pada jenjang SMP/MTs mata pelajaran IPA adalah terpadu. IPA Terpadu merupakan perpaduan dua bidang kajian atau lebih yang berhubungan dan diajarkan dalam bentuk satu kesatuan tema. Salah satu kendalanya adalah bahan ajar IPA Terpadu yang disajikan dalam bentuk tema masih belum ada yang beredar di masyarakat. Penelitian ini bertujuan untuk mengembangkan bahan ajar IPA Terpadu berbasis kontekstual dengan tema Pemuaian pada berbagai Wujud Zat untuk siswa SMP kelas VII. Pengembangan bahan ajar menggunakan desain penelitian pengembangan (Research and Development) oleh Borg dan Gall 1983. Langkah langkah yang dilakukan adalah studi pendahuluan, pengembangan produk, penilaian produk, revisi produk. Penilaian draf produk dilakukan oleh dosen fisika, dosen kimia dan guru SMP masing masing satu orang . Penilaian menggunakan dua instrumen yang berbeda yaitu angket penilaian bahan ajar IPA Terpadu dan instrumen penilaian bahan ajar.teknik analisis yang digunakan adalah analisis perhitungan rata-rata yang diadaptasi dari Arikunto. Hasil penelitian berupa bahan ajar IPA Terpadu berbasis kontekstual dengan tema pemuaian pada berbagai wujud zat untuk SMP kelas VII. Bahan ajar hasil penelitian berupa buku teks 82 halaman yang terdiri dari halaman muka, daftar isi, daftar gambar, daftar tabel, peta konsep, bagian isi dari bahan ajar yang terdiri materi bahan ajar dan lembar kegiatan siswa, rangkuman, soal evaluasi, kunci jawaban, glosarium, dan daftar pustaka. Hasil penilaian dari uji kelayakan adalah 3.27dari rentang nilai 1-4 dengan kriteria bahan ajar yang dikembangkan adalah sangat layak.

Pengaruh pemberian kompensasi terhadap disiplin kerja melalui motivasi kerja (Studi pada pegawai tidak tetap Depo Farmasi RSU Dr. Saiful Anwar Malang) / Apsari Puspitaning Ati

 

ABSTRAK Ati, Apsari Puspitaning. 2010. Pengaruh Pemberian Kompensasi Terhadap Disiplin Kerja Melalu Motivasi Kerja (Studi pada Pegawai Tidak Tetap Depo Farmasi RSU Dr. Saiful Anwar Malang). Skripsi, Jurusan Manajemen Konsentrasi Sumber Daya Manusia. Program studi S1 Manajemen Universitas Negeri Malang. Pembimbing: (1) Dr. Syihabudhin, S.E., M.Si. (2) Drs. I Nyoman Saputra, M.Si. Kata kunci : kompensasi finansial, kompensasi non finansial, motivasi kerja, disiplin kerja. Salah satu bentuk perhatian yang dapat diberikan perusahaan kepada pegawai dalam mensejahterakan pegawainya adalah dengan pemberian kompensasi yang memadai. Kompensasi merupakan unsur yang dapat digunakan untuk memotivasi pegawai. Selain itu, kompensasi atau balas jasa dapat berperan penting dalam menciptakan disiplin kerja pegawai, artinya, semakin besar balas jasa yang diberikan kepada pegawai, maka semakin baik pula kedisiplinan pegawai tersebut. Adanya disiplin yang baik dalam perusahaan merupakan salah satu kunci suksesnya sebuah perusahaan. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian kompensasi terhadap disiplin kerja melalui motivasi kerja pegawai tidak tetap Depo Farmasi RSU Dr. Saiful Anwar Malang. Penelitian ini dilaksanakan di Depo Farmasi RSU Dr. Saiful Anwar Malang pada bulan Januari-Februari 2010. Jenis penelitian yang digunakan adalah explanatory research yaitu menjelaskan hubungan kautsal antar variabel-variabel melalui pengujian hipotesis. Subjek dalam penelitian ini adalah pegawai Depo Farmasi dengan status kepegawaian adalah pegawai tidak tetap (Non PNS) yang berjumlah 104 orang, sedangkan sampelnya diambil menggunakan rumus slovin sehingga diperoleh sampel sebanyak 83 orang dan teknik pengambilan sampel menggunakan Proportional Random Sampling. Dalam penelitian ini mempunyai variabel bebas yaitu kompensasi finansial (X1), kompensasi non finansial (X2), variabel intervening yaitu motivasi kerja (Z), dan variabel terikat yaitu disiplin kerja (Y). Analisis data yang dipakai adalah analisis jalur (Path Analysis). Tujuan dari analisis jalur adalah untuk mengetahui pengaruh langsung dan pengaruh tidak langsung antar variabel. Hasil penelitian ini dapat diketahui : (1) terdapat signifikansi pengaruh langsung kompensasi finansial terhadap motivasi kerja sebesar 0,333. (2) terdapat signifikansi pengaruh langsung kompensasi finansial terhadap disiplin kerja sebesar 0,204. (3) terdapat signifikansi pengaruh langsung kompensasi non finansial tehadap motivasi kerja sebesar 0,438. (4) terdapat signifikansi pengaruh langsung kompensasi non finansial terhadap disiplin kerja sebesar 0,373. (5) terdapat signifikansi pengaruh langsung motivasi kerja terhadap disiplin kerja sebesar 0,340. (6) terdapat pengaruh tidak langsung kompensasi finansial terhadap disiplin kerja melalui motivasi kerja sebesar 0,113. (7) terdapat pengaruh tidak langsung kompensasi non finansial terhadap disiplin kerja melalui motivasi kerja sebesar 0,148. Berdasarkan hasil penelitian, dapat disarankan agar pihak pimpinan Depo Farmasi RSSA Malang perlu lebih memperhatikan hak-hak pegawai yang belum diberikan, diantaranya hak cuti tahunan yang sesuai UU Ketenagakerjaan, transparansi pemotongan insentif dan adil dalam pemberlakuan tata tertib di Depo Farmasi RSSA Malang. Sedangkan untuk absensi setiap datang dan pulang kerja, sebaiknya tetap dipertahankan dan ditingkatkan.

Profil Pengelolaan Usaha Dan Perilaku Ekonomi Pengrajin Gerabah Di Desa Karang Kecamatan Semanding Kabupaten Tuban Oleh Ro'ufah Inayati

 

Seiringd engans emakinm engglobalnyear a modemisasif,u ngsib arangbaransge macamge rabahte lahd igantikano leh barang-barandga ri plastik, alumuniumd,a nl ain sebagainyaS. ebagrabne sark onsumenju ga lebih menyukai baransgu bstitusinyiatu . Berdasarkafne nomenate rsebutta mpik sepintasb ahwa usahkae cilg erabahti dak mempunyapi rospeku ntukb erkembangy.a ng menjadi !€rtanyaana dalahm engapap arap engrajing erabahd i desaK arangk ecamatan Semandinkga bupatenT ubanm asihs etiam enekunui sahanyate rsebutp. enelitiani ni bertujuaunn tukm engkajis ecaram endalamd ank omprehensift entangp engrajin gerabadhi desaK arangk ecamatanS emandingk abupatenT uban.M otifapisaJa yangm endasamri erekau ntukt etaps etiap adau sahanyab,a gaimanas eluk-beluk kegatanu sahanyad,a nb agaimanam erekam engelolau sahanyah inggat etapb isa eksiss ampasi aati ni. Penelitianin i menggunakapne ndekatadne skriptifkualitatif.S edangkanjenis penelitiayna ngd igunakana dalahs tudik asus.o rientasit eoretisy angd igunakan bertumppua dap endekataent nometodologLi.o kasip enelitiani ni terletakd i desa Kanng( bagianu tara)k ecamatans emandingk abupatenT uban, tepatnyad i rumah BuR uminah( pengrajing erabahje nis kuali) danM bah Dasri( pengrajing erabahje nis perabortu maht angga)P. enelitianin i dilakukanp adaJ uni 2003-Juni 2004.y ang menjadsi ubyekd ani nformanp enelitiani ni adalahp engrajing erabahjenisk uali besertak aryawannyap, engrajing erabahje nis perabotr umah tangga, pedagang gcrabahm, asyarakapt enggunag erabah,d an kepalad esaK arang.D ata dijanng {:ngunt eknik bola salju( snowballs ampling)T. eknik pettgu-p.,lan datayang dipakaia dalahp engamatanb erperansertad an wawancaram endalam.A nalisis data yangd igunakana dalaha nalisisd atas ecarain duktifdenganp rosedurre duksid ata, penyajiand ata,d anm enarikk esimpulans. edangkanu ntukk eperluanp engecekan keabsahadna tad igunakanp erpanjangakne ikutsertaank,e tekunanp engamatand,a n triangulasi. Hasil penelitianm enunjukkanb ahwau sahag erabahd i desaK arangt elaha da sejakp uluhant ahuny angl alu, danm erupakanu sahat urun-temurunp.e ngrajin termotivasmi endirikanu sahag erabahk arenaa lasane konomi.p engrajins angat tergantungp adap enyuplaid alam hal pengadaanb ahanb aku Tenagak e{a berasal dank eluargap engrajins endiri,d an sifatnyah anyam embantuM. odal usahab erasal darip engrajins endirid anp injamand ari tengkulaka pabilaa dak ekuranganU. ntuk satuk ali pembakaranm, odaly angd ibutuhkana ntaraR p 220.000,00-Rp3 00.000,00 tanpam emperhitungkatenn agas endiri,u paht enagak erja serumahd, anb iaya pemakaiapne ralatanT. eknik produksig erabahd ilakukans ecaram anuald engan tangank,a ki, dan dibantu alat-alats ederhanab, elum memanfaatkante knologi modemA. da2 jenis produkg erabahy angd ihasilkany, aitu kuali (sebagatie mpat pengawetaikna n)d ang erabahjenisp erabotr umaht anggaP. rosesp roduksig erabah meliput3i tahapany, aitu tahapp ersiapanp, embuatand, anp embakaranA. da perbedaadna lamp emasaragne rabahje nis kuali danj enis perabotr umaht anggab, aik daris egid aerahp emasarans,a lurand istribusi,k onsumenm, aupunk ebijakanh arga. Fahorp endukungd an penghambaut tama.usahag erabaha dalahm usim. Faktor pendukunlagi nnyal ebih bersifatk ekeluargaanS. edangkafna ktor penghambat lainnyale bihd isebabkaonl eh kurangnyak emampuanS DM, baik dalamh al penguasataenk nologim aupunm anajemenu sahaP. engrajing erabahte taps etia menekunuis ahanysaa mpasi aati ni karenaa danyak eajeganp ermintaank onsumen terhadagpe rabahm erekad ank esulitana lih profesi.P endapatayna ngd iperoleh pengrajidna ri usahag erabahd apatm emberikanm anfaate konomisb agi usahad an keluarganyaS. ampais aati ni belum adau payad ari pengrajinu ntuk mengatasi dampakn egatifu sahanya. Temuanp okokp enelitianm: asiha das ekelompokm asyaraka(tp engrajin gerabadhi desaK arang)y angm enganupt ola kehidupane konomit radisionadl i era modernisasini i, sehinggaa lasan-alasamne rekau ntukt etaps etiam enekunui sahanya adalahr asional( dikaitkan dengane konomi tradisionaly ang merekaa nut) dan adanya kecenderungapno la perilakue konomim erekam engarahp adat ingkatk ehidupan subsistensi. Berdasarkahna silp enelitiani ni, dapatd isarankana garP emda( melalui Depperindagd) apatm emberikanp embinaank epadap engrajing erabaht entang tekniku saham isalnyap erubahand esainp roduk.S elaini tu Pemda( melaluiD iknas) jugad iharapkand apatm enanganpi ola perubahanp erilakup engrajin( misalnya denganm emberikanp endidikanlu ar sekolah)a pabilas uatus aata dap embaharuan dalamu sahag erabahB. agi penuntutil mu disarankana gard apatm elakukan penelitianla njutan( kualitatif)t entangu sahak ecil dan lebih intensm elakukan penelitiante ntangp olak ehidupane konomit radisionaly angpadak enyataannya masiha dad alamm asyarakadt i zamanm odemi ni. Bagi pengrajind isarankana gar dapatm enemukanid e-ideb arug unam engembangkauns ahanyas,e misadl enganc ara membentukp erserikatanu ntuk mengataski endala-kendalay ang ada,d anjuga dapat meminimalisird ampakn egatify angt imbul akibatp embakaragne rabahd enganc ara menambajhu mlah tanamand i sekitamyaB. agi kalangana kademisdi isarankana gar senantiasma emberikanb imbingand anp embinaans ertam engenalkatne knologig una mempermudaphr osesu saham, isalnyam engenalkatne knologip embuatano ven pembakara(ns ederhanaa)g arp engrajint etapb isab erprodukspi adam usim penghujan,

Penerapan pembelajaran kooperatif model STAD (Student Teams Achievement Divisions) untuk meningkatkan aktivitas belajar dan prestasi belajar biologi pada siswa kelas VIII SMP PGRI 02 Batu / Agus Samsul Huda

 

Berdasarkan hasil wawancara dengan ibu Riyani selaku guru mata pelajaran biologi dan observasi yang telah dilakukan di SMP PGRI 2 Batu Jl. Raya Pandanrejo. No.1A Kecamatan Bumiaji Kota Batu pada tanggal 28 September dan 1 Oktober 2009, bahwa prestasi belajar siswa masih rendah, dengan rerata skor ketuntasan belajar siswa pada tes formatif Sistem Pencernaan pada Manusia yaitu 64.64 %. Berdasarkan SKBM (Standar Kelulusan Belajar Minimal) di SMP PGRI 2 Batu seorang siswa disebut tuntas belajar jika telah mencapai SKBM dengan nilai 65 dan daya serap klasikal 70 %. Hal ini menunjukkan masih banyak siswa yang masih belum mencapai SKBM (Standar Ketuntasan Belajar Minimal) yang ditentukan oleh sekolah. Selain itu, guru jarang menerapkan pembelajaran kooperatif dalam pengajaran di kelas, masih cenderung menggunakan metode ceramah dan merangkum. Penelitian ini menerapkan pembelajaran STAD yang tahapan pembelajarannya: 1) Penyajian kelas, 2) Belajar kelompok, 3) Tes atau kuis, 4) Skor peningkatan individu, dan 5) Penghargaan kelompok. Pada pembelajaran ini jumlah siswa sebanyak 39 orang yang terdiri dari 27 siswa perempuan dan 12 orang siswa laki-laki. Siswa dibentuk dalam 6 kelompok yang terdiri dari 4-6 siswa perempuan dan 2 siswa laki-laki. Pada saat diskusi 2 orang anggota kelompok mempunyai tanggung jawab terhadap 2 soal pada lembar diskusi siswa. Penelitian ini bertujuan untuk meningkatkan aktivitas dan prestasi belajar siswa serta mengetahui presepsi siswa terhadap pembelajaran kooperatif model STAD. Penelitian ini merupakan jenis Penelitian tindakan Kelas (PTK) yang dilakukan dalam 2 siklus. Masing-masing siklus terdiri atas lima tahap, yaitu: perencanaan tindakan, pelaksanaan tindakan, observasi, dan refleksi tindakan. Penelitian ini dilakukan pada kelas VIII SMP PGRI 02 Batu yang dilaksanakan pada tanggal 24 November sampai 15 Desember 2009. Instrumen yang digunakan pada penelitian ini adalah: lembar observasi aktivitas guru, lembar aktivitas siswa, soal tes, catatan lapangan, dan angket respon siswa. Berdasarkan hasil penelitian yang telah dilakukan, diketahui bahwa penerapan pembelajaran kooperatif model STAD dapat meningkatkan aktivitas belajar dan prestasi belajar siswa. Pada siklus I aktivitas belajar siswa 52,69 %, sedangkan pada siklus II 74,91% dan peningkatan prestasi dapat dilihat dari peningkatan jumlah siswa yang mencapai SKBM. Pada siklus I mencapai SKBM sebesar 66,7%, dan siklus II sebesar 79,49 %.

Pengaruh strategi pengelolaan diri (self-management) terhadap peningkatan kedisiplinan siswa datang tepat waktu kelas VIII SMP Negeri 1 Malang / Gladys Exellsa

 

Abstrak : Kedisiplinan merupakan jalan bagi siswa untuk sukses dalam sekolah. Siswa yang disiplin akan mematuhi ketentuan-ketentuan sekolah sehingga mereka berkembang optimal dan berhasil studinya, sebaliknya siswa yang kerap melanggar ketentuan sekolah pada umumnya terhambat optimalisasi potensi dan prestasinya. Siswa yang sering datang terlambat masuk sekolah diartikan sebagai siswa yang tidak disiplin waktu. Siswa yang tidak disiplin waktu memerlukan pemahaman diri, sehingga ia perlu merubah perilaku tersebut agar disiplin datang tepat waktu di kelas sesuai dengan peraturan yang sudah ditetapkan oleh sekolah. Dalam kasus ini, guru BK perlu memberikan bantuan agar siswa tersebut dapat membiasakan disiplin masuk kelas tepat waktu. Pengelolaan diri (self-management) adalah suatu kemampuan yang berkenaan dengan kesadaran diri dan keterampilan di mana individu mengarahkan pengubahan tingkahlakunya sendiri dengan pemanipulasian stimulus dan respon baik internal maupun eksternal. Dengan kata lain self-management merupakan kemampuan individu dalam mengelola potensi diri dan potensi lingkungan untuk mengubah perilakunya. Dalam penelitian ini menguji apakah strategi self management berpengaruh terhadap peningkatan kedisiplinan siswa. Penelitian ini bertujuan mengetahui pengaruh strategi pengelolaan diri (self management) terhadap peningkatan kedisiplinan siswa. Rancangan penelitian ini adalah quasi experimental dengan jenis single case experimental design. Desain eksperimen yang digunakan dalam penelitian ini adalah desain A-B-A. Subyek adalah siswa kelas VIII di SMPN 1 Malang. Instrumen pengumpulan data adalah daftar cek kedisiplinan siswa dan self raport. Data dianalisis dengan rerata dan presentase. Berdasarkan hasil analisis data dari visual inspection pada saat sebelum perlakuan, perlakuan, dan sesudah perlakuan menunjukkan bahwa self management berpengaruh terhadap peningkatan kedisiplinan siswa. Hal ini tampak dari perbedaan jumlah frekuensi dari baseline I dan baseline II. Dari 6 subyek yang dianalisis, menunjukkan adanya peningkatan kedisiplinan yang dimilikinya. Masing-masing subyek mampu meningkatkan kedisiplinan datang tepat waktu di atas 50% dan terdapat 2 subyek yang dapat meningkatkan kedisiplinan datang tepat waktu hingga 100%. Berdasarkan hasil penelitian ini, dapat disarankan agar (1) konselor menggunakan strategi self management untuk meningkatkan kedisiplinan siswa datang tepat waktu di kelas, (2) peneliti selanjutnya dapat mengembangkan design penelitian ini misalnya A-B-A-B atau melakukan penelitian tentang strategi tersebut dengan penelitian tindakan. Artinya perlu didesain strategi paska baseline II dan fase pemeliharaan perilaku. Kata kunci : Pengelolaan Diri (Self Management), Kedisiplinan Datang Tepat Waktu, siswa SMP

Efektifitas penggunaan bahan ajar IPA model integrasi terhadap prestasi belajar siswa kelas VII SMP Negeri 7 Malang / Ferdi Reza Fahrisal

 

ABSTRAK Fahrisal, Ferdi Reza. 2010. Efektifitas Penggunaan Bahan Ajar IPA Model Integrasi terhadap Prestasi Belajar Siswa Kelas VII SMP Negeri 7 Malang. Skripsi, Program Studi Pendidikan Fisika, Jurusan Fisika, FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Lia Yuliati, M. Pd., (II) Drs. Agus Suyudi, M. Pd. Kata Kunci: efektifitas, bahan ajar IPA model integrasi, prestasi belajar. Wawancara dengan guru IPA di SMP Negeri 7 Malang diketahui bahwa pembelajaran IPA terpadu sudah diterapkan. Penyajian materi pada bahan ajar masih terpisah-pisah berdasarkan bidang-bidang kajiannya meskipun sudah disatukan dalam sebuah buku. Sebelumnya sudah ada hasil pengembangan bahan ajar IPA terpadu yang sesuai dengan kurikulum yang diberlakukan oleh pemerintah dengan tema perpindahan kalor dan akibat yang ditimbulkannya, namun penulisan yang dilakukan baru dalam tahap pengembangan belum diimplementasikan ke lapangan. Tujuan penelitian ini adalah untuk mengukur perbedaan prestasi belajar antara siswa yang mendapat pembelajaran menggunakan bahan ajar IPA model integrasi dengan siswa yang mendapat pembelajaran menggunakan bahan ajar IPA konvensional dan menentukan efektifitas bahan ajar terhadap prestasi belajar siswa pada kelompok prestasi tinggi dan kelompok prestasi rendah yang menggunakan bahan ajar IPA model integrasi. Penelitian ini merupakan jenis penelitian eksperimen semu (quasi experiment). Populasi penelitian adalah siswa SMP Negeri 7 Malang kelas VII semester 2 tahun ajaran 2009/2010 yang terdiri dari 7 kelas. Sampel penelitian adalah kelas VII-A sebagai kelas eksperimen dan VII-B sebagai kelas kontrol, masing-masing kelas terdiri dari 43 siswa. Teknik sampling yang digunakan adalah purposive cluster sampling, yaitu berdasarkan pertimbangan nilai rata-rata IPA yang hampir sama, yaitu 57 dan 54. Instrumen yang digunakan dalam penelitian adalah (1) Instrumen perlakuan yang digunakan adalah bahan ajar IPA model integrasi tema perpindahan kalor dan akibat yang ditimbulkannya untuk kelas eksperimen. (2) Instrumen pengukuran penelitian berupa tes yang terdiri dari 23 soal pilihan ganda dengan r = 0,73 (nilai reliabilitas tinggi). Untuk mengetahui adanya perbedaan postes terhadap kelas eksperimen dan kelas kontrol digunakan Scheffe Test. Berdasarkan hasil uji hipotesis dapat disimpulkan bahwa tidak ada perbedaan prestasi belajar siswa yang signifikan antara kelas eksperimen dan kelas kontrol setelah diberi perlakuan berupa pembelajaran menggunakan bahan ajar IPA model integrasi. Bahan ajar dikatakan efektif bila prestasi belajar siswa yang diajar menggunakan bahan ajar IPA model integrasi lebih tinggi dari prestasi belajar siswa yang diajar menggunakan bahan ajar IPA konvensional. Berdasarkan Scheffe Test untuk kelompok prestasi tinggi dan kelompok prestasi rendah memberikan hasil t_(A_1 B_2-A_2 B_2 )= 0,063 < 2,014 t_((45;0.05) )dan t_(A_1 B_1-A_2 B_1 )= 0,067 < 2,020 t_((41;0.05) ), menunjukkan bahwa bahan ajar IPA terpadu efektif diterapkan pada siswa kelompok prestasi tinggi maupun kelompok prestasi rendah.

Upaya pengembangan rasa nasionalisme di SDN Madyopuro 1 Kota Malang / Siti Choiriyah

 

Kata Kunci: Pengembangan, Nasionalisme, SD Upaya pengembangan rasa nasionalisme di SDN Madyopuro 1 Kota Malang dilatar belakangi oleh lunturnya rasa nasionalisme siswa pada saat ini. Pendidikan cenderung menekankan aspek kecerdasan otak sedangkan penekanan semangat nasionalisme melalui nilai-nilai luhur seperti tata krama dan kesantunan dilalaikan. Tujuan dari penelitian upaya pengembangan rasa nasionalisme di SDN Madyopuro 1 Malang ini, yaitu: (1) Mendeskripsikan upaya guru dalam mengembangkan rasa nasionalisme melalui pembelajaran Pendidikan Kewarganegaraan (PKn) pada siswa kelas V SDN Madyopuro 1 Kota Malang; (2) Mendeskripsikan peran sekolah dalam mendukung upaya pengembangan rasa nasionalisme pada siswa kelas V SDN Madyopuro 1 Kota Malang; (3) Mengetahui rasa nasionalisme siswa kelas V SDN Madyopuro 1 Kota Malang. Penelitian ini menggunakan metode deskriptif kualitatif, dimana pengumpulan data dilakukan dengan teknik observasi, wawancara, angket, catatan lapangan, dan dokumentasi. Selanjutnya data dianalisis dalam beberapa tahap, dimulai dengan mereduksi data, penyajian data, dan penarikan kesimpulan serta verifikasi. Sementara pengecekan keabsahan temuan dilakukan dengan triangulasi. Hasil penelitian menunjukkan bahwa guru telah mengintegrasikan nilai nasionalisme dalam pembelajaran PKn. Sekolah juga turut berperan dengan memprogramkan pendidikan karakter nasionalisme pada kegiatan sekolah dan diketahui rasa nasionalisme siswa kelas V termasuk pada kategori tinggi. Pembahasan dari hasil penelitian tersebut, dinyatakan bahwa guru telah mengupayakan pengembangan rasa nasionalisme siswa dengan mengintegrasikan pendidikan karakter nasionalisme dalam pembelajaran PKn, pembiasaan, dan pemberian keteladanan, namun strategi yang digunakan guru dalam pembelajaran masih kurang relevan dalam mengembangkan kemampuan afektif siswa. Peran sekolah dalam mengembangkan rasa nasionalisme siswa meliputi penyediaan fasilitas yang sudah mencukupi, namun dengan pemanfaatan fasilitas sekolah yang kurang optimal menyebabkan hasilnya kurang optimal. Diketahui rasa nasionalisme siswa kelas V SDN Madyopuro 1 tidak hanya diperoleh melalui sekolah namun juga diperoleh melalui peran keluarga dan masyarakat. Disimpulkan, guru telah mengintegrasikan pendidikan karakter nasionalisme dalam pembelajaran PKn, sekolah juga telah menjalankan perannya dalam mendukung pendidikan karakter nasionalisme, dan rasa nasionalisme siswa kelas V termasuk dalam kategori tinggi. Adapun saran penulis, guru hendaknya menggunakan strategi pembelajaran yang lebih menekankan pada peningkatan kemampuan afektif siswa daripada penekanan kemampuan kognitif siswa.

Membangun jaringan LAN berbasis Windows di Sekolah Dasar Negeri Blimbing 5 Malang / Laily Istiqomah

 

Kata Kunci : jaringan LAN, sistem operasi Jaringan LAN yang sebelumnya banyak terdapat di perkantoran yang mana digunakan untuk mendukung pekerjaan dan bisnis, saat ini jaringan LAN juga mulai dikembangkan di dalam ranah pendidikan yang memungkinkan pengguna jaringan dapat melakukan sharing data serta perangkat lainnya. Sekolah Dasar Negeri Blimbing 5 Malang merupakan salah satu institusi pendidikan dasar yang ada di kota Malang yang mana telah mempunyai sarana dan prasarana yang berperan penting salah satunya dengan telah terakses dengan internet. Akan tetapi belum secara keseluruhan sarana dan prasarana tersebut dapat terkoneksi dengan jaringan LAN, hal ini menyebabkan terbatasnya dalam hal mengkses data. Oleh karena itu dengan keberadaan jaringan LAN yang terhubung antara ruang administrasi dan kantor maka akan sangat membantu dan mendukung sekali dalam hal mengakses data, mendukung proses belajar mengajar, dan memperlancar proses administrasi sekolah. Komputer dalam pengoperasiannya juga membutuhkan sebuah sistem operasi untuk mendukung kinerja komputer itu sendiri termasuk dalam pengadaan jaringan LAN. Dalam hal membangun jaringan LAN di Sekolah Dasar Negeri Blimbing 5 Malang juga menggunakan salah satu sistem operasi yakni Windows. Sistem operasi Windows selain sudah familiar juga dapat membantu memudahkan dalam menjalankannya khususnya bagi orang yang awam tentang komputer sebelumnya. Bertitik tolak dari penulisan ini, dapat disimpulkan bahwa dengan adanya jaringan LAN berbasis Windows di Sekolah Dasar Negeri Blimbing 5 Malang, maka dapat digunakan sebagai perangkat yang dapat mendukung dalam proses tata administrasi sekolah dan dalam proses kegiatan belajar mengajar. Di samping itu topologi yang digunakan dalam jaringan adalah topologi star, yang mana apabila salah satu kabel putus maka proses akses data yang lain tidak akan terganggu. Dengan adanya jaringan yang terhubung antara komputer satu dengan yang lain dapat saling berkomunikasi, saling bertukar data, dan dapat menggunakan koneksi internet secara bersamaan.

Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema pemanasan global bagi siswa kelas IX di SMP Negeri 2 Singosari / Haris Mahmudi

 

ABSTRAK Mahmudi, Haris. 2010. Pengembangan Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Pemanasan Global bagi Siswa Kelas IX di SMP Negeri 2 Singosari. Skripsi, Program Studi Pendidikan Fisika. Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (1) Drs. Supriyono Koes H., M.Pd, M.A, (2) Drs. Triastono Imam Prasetyo, M.Pd Kata kunci : paket IPA Terpadu, konstruktivisme, tema pemanasan global Peraturan Menteri Pendidikan Nasional Nomor 22 (2006) yang menyatakan bahwa substansi mata pelajaran IPA di SMP/MTs merupakan IPA Terpadu. Sedangkan pembelajaran IPA SMP/MTs di Malang Raya kebanyakan belum menerapkan pembelajaran terpadu. Hal ini disebabkan oleh kurang adanya buku yang menerapkan pembelajaran IPA Terpadu untuk SMP/MTs. Oleh sebab itu diperlukan pengadaan bahan ajar/paket IPA Terpadu untuk membantu penerapan pembelajaran IPA Terpadu. Pengembangan ini bertujuan (1) mengembangkan paket IPA Terpadu berbasis konstruktivisme dengan tema pemanasan global bagi siswa kelas IX di SMP Negeri 2 Singosari, (2) mengembangkan panduan pelaksanakan pembelajaran IPA Terpadu berbasis konstruktivisme dengan tema pemanasan global bagi siswa kelas IX di SMP Negeri 2 Singosari. Penelitian ini merupakan penelitian pengembangan yang menggunakan lima langkah yaitu : (1) Studi Pendahuluan, (2) Perencanaan, (3) Pengembangan Bentuk Awal Produk, (4) Uji coba lapangan awal, (5) Revisi Produk Utama. Instrumen penelitian yang digunakan berupa angket kelayakan paket IPA Terpadu dan panduan pelaksanaan pembelajaran IPA Terpadu yang diisi oleh 4 validator yaitu: 2 dosen (fisika dan kimia) dan 2 guru mata pelajaran IPA (biologi dan fisika) SMP Negeri 2 Singosari. Selain itu, uji keterbacaan yang dilakukan oleh 6 siswa kelas IX SMP Negeri 2 Singosari. Jenis data berupa data kuantitatif dan data kualitatif. Data kuantitatif diperoleh dari analisis nilai rata-rata angket skala Likert, sedangkan data kualitatif berupa tanggapan,saran, dan kritik dari validator. Hasil penelitian menunjukkan bahwa paket IPA Terpadu berbasis konstruktivisme dengan tema pemanasan global memenuhi kriteria layak dengan nilai rata-rata sebesar 3,63. Sedangkan panduan pelaksanaan pembelajaran IPA Terpadu berbasis konstruktivisme dengan tema pemanasan global juga memenuhi kriteria layak dengan nilai rata-rata sebesar 3,52. Berdasarkan hasil penelitian ini, disarankan kepada peneliti lain untuk melakukan penelitian lebih lebih lanjut yaitu dengan melakukan kajian eksperimen dan uji coba yang lebih luas, sehingga diperoleh paket dan panduan pelaksanaan pembelajaran yang teruji secara empiris.

Pemaparan fisika pokok bahasan listrik statis dengan bantuan aplikasi Swishmax / Patilongan Suat

 

ABSTRAK Suat, Patilongan. 2010. Pemaparan Fisika Pokok Bahasan Listrik Statis dengan Bantuan Aplikasi Swishmax. Skripsi, Jurusan Fisika Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing : Drs. Asim. M. Pd. Kata Kunci : listrik statis, swishmax Listrik statis adalah listrik yang tidak mengalir atau listrik yang muatan-muatan listriknya berada dalam keadaan diam. Listrik statis merupakan bentuk listrik yang dihasilkan bila beberapa benda digosokkan satu sama lain. Sebuah benda netral dapat bermuatan listrik statis dengan jalan digosokkan. Contoh lainnya, yaitu ketika batang plastik digosok dengan kain wol, elektron-elektron dari kain wol berpindah ke batang plastik, sehingga batang plastik kelebihan elektron. Dengan demikian, batang plastik menjadi bermuatan negatif. Sebaliknya, ketika batang kaca digosok dengan kain sutera, maka elektron - elektron dari batang kaca berpindah ke kain sutera, sehingga batang kaca kekurangan elektron. Dengan demikian, batang kaca menjadi bermuatan positif. Dalam kehidupan terdapat aplikasi dan gejala yang sering kali dijumpai yang erat hubungannya dengan listrik statis. Seperti ilmu lainnya, Listrik statis juga mempunyai kegunaan dan dapat pula membahayakan manusia. Contohnya seperti percikan api adalah gejala listrik yang membahayakan manusia, sedangkan salah satu kegunaan listrik statis adalah mesin fotokopi. SwishMax merupakan pengembangan dari Program Swish v.2, yang kini telah memiliki 230 bulit-in efek seperti efek Explode, Vortex, 3D Spin, Snake dan banyak lainnya. Seperti halnya Swish, SwishMax juga memilki alat bantu untuk membuat garis, kotak, elips, kurva bazier, gerak animasi, sprite, tombol roll over dan lainnya. Format dasar SwishMax adalah swi file, namun dapat juga diekspor kedalam file flash (swf), movie (avi) ataupun execute(exe) program yang dapat dijalankan berdiri sendiri. Sehingga animasi Swishmax dapat diletakkan langsung di web, atapun diikutkan dalam presentasi Microsoft Powerpoint dan Microsoft Word. Saran yang dapat disampaikan adalah agar pembelajaran dengan menggunakan komputer dapat juga diterapkan pada bidang studi ataupun materi lainnya yang terdapat dalam fisika ataupun ilmu pengetahuan lainnya.

Hubungan antara tipe kepribadian dan kecenderungan penggunaan gaya mengajar pada guru Taman Kanak-kanak / Asy Nurida Rohmati'a

 

Kata kunci: tipe kepribadian, gaya mengajar Tipe kepribadian adalah keseluruhan pola tingkah laku yang relatif permanen dengan kecenderungan karakteristik khas yang stabil serta menjadi individualitas bagi perilaku seseorang. Kepribadian dalam diri seseorang dapat mempengaruhi tingkah laku individu tersebut. Dalam penelitian ini kepribadian yang diteliti, yaitu introvert dan ekstravert. Gaya mengajar adalah suatu cara melaksanakan pengajaran yang ditampilkan oleh guru dan cenderung konsisten. Gaya mengajar dalam penelitian ini yaitu teacher centered dan student centered. Penelitian ini bertujuan untuk mengetahui apakah terdapat hubungan antara tipe kepribadian dan kecenderungan penggunaan gaya mengajar pada guru Taman Kanak-kanak. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Subyek penelitian ini adalah guru yang mengajar di TK yang berada di Kecamatan Jetis Kabupaten Mojokerto sebanyak 56 orang. Teknik pengambilan sampel adalah cluster sampling. Instrumen penelitian yang digunakan adalah EPI-A Adaptasi Indonesia dan skala gaya mengajar. EPI-A Adaptasi Indonesia terdiri dari 56 aitem dengan reliabilitas 0,862 dan skala gaya mengajar terdiri dari 32 aitem dengan reliabilitas 0,907. Data hasil penelitian dianalisis dengan menggunakan teknik analisis deskriptif dan analisis korelasi product moment Pearson. Hasil penelitian menunjukkan bahwa guru TK di Kecamatan Jetis Kabupaten Mojokerto lebih banyak yang memiliki tipe kepribadian ekstravert. Dan guru TK di Kecamatan Jetis Kabupaten Mojokerto lebih banyak yang memiliki kecenderungan menggunakan gaya mengajar student centered. Uji hipotesis menyimpulkan terdapat hubungan positif antara tipe kepribadian dan kecenderungan gaya mengajar pada guru TK di Kecamatan Jetis Kabupaten Mojokerto (rxy = 0,363; p = 0,006 < 0,05). Hal ini dapat diartikan bahwa guru dengan tipe kepribadian ekstravert memiliki kecenderungan menggunakan gaya mengajar student centered dan guru dengan tipe kepribadian introvert memiliki kecenderungan gaya mengajar teacher centered. Berdasarkan hasil penelitian maka disarankan: (1) bagi keilmuan, diharapkan untuk mengembangkan pembelajaran teacher centered (2) bagi sekolah, diharapkan mengadakan pelatihan mengenai pembelajaran yang sesuai dengan paradigma pendidikan saat ini, yaitu pembelajaran student centered, (3) bagi guru, diharapkan menggunakan gaya mengajar yang lebih sesuai dengan tuntutan dan kurikulum, agar pencapaian tujuan pembelajaran dapat ditingkatkan, (4) bagi peneliti selanjutnya diharapkan dapat mengembangkan variabel yang diteliti, memperluas wilayah, dan tingkat sekolah yang berbeda, misal guru SD, SMP, atau SMA agar diperoleh keanekaragaman pengetahuan dari penelitian yang berbeda.

Faktor-Faktor Yang Mempengaruhi Pendapatan Nelayan Udang Di Desa Pantai Kecamatan Kelumpang Selatan Kabupaten Kotabaru Kalimantan Selatan Oleh Salamah

 

Secara ekonomi tingginya ekspor udang dari Kabupaten Kotabaruakan sangat berpengaruh pada pendapatan nelayan setempat. Akan tetapi haltersebut sangat bertolak belakang dengan apa yang semestinya terjadi. Penjualan udnng di Kabupaten Kotabaru umumnya dan Desa pantaikhususnya tidak sesuai dengan apa yang diharapkan nelayan udang.Faktor-faktor yang mempengaruhi pendapatan nelayan udang di DesaPantai Kecamatan Kelumpang Selatan dalam penelitian ini adalah besarnyamodal, jarak tangkapan, jenis alat tangkap, curahan waktu ke{a dan hargapemasaranu dang. Penelitian ini bertujuan untuk mengetahui seberapa besar pengaruhmasing-masing faktor tersebut terhadap pendapatan nelayan udang di DesaPantai Kecamatan Kelumpang Selatan Kabupaten Kotabaru KalimantanSelatan. Populasi dalam penelttian iai adalah keseluruhan nelayan udang yangada di Desa Pantai, sedangkan sampel penelitian diambil secara purposiveSampling. Penelitian ini dilakukan di Desa Pantai Kecamatan KelumpangSelatan. Rancangan penelitian yang digmakan adalah dengan pendekatansurvei yang menggunakan daftar pertanyaan. Analisis hasil penelitian yangdipakai adalah regresi dan tabulasi silang untuk faktorjenis alat.Hasil penelitian penunjukkan bahwa faktor modai deur faktor jaraktangkap tidak berpengaruh terhadap pendapatan nelayan udang. Sedangkanfaktor jenis alat, curahan waktu dan faktor harga pemasaran berpengaruhterhadap pendapatan nelayan udang. Namun secara simultan semua variabelbebas mempunyai pengaruh yang signifrkan terhadap faktor pendapatannelayan udang di Desa Pantai Berdasarkan hasil penelitian ini dapat disarankan agar informasimengenai letak aktivitas udang laut dapat dipertajam lagi, perlindunganterhadap nelayan lokal lebih diutamakan, pendirian koperasi nelayan danpengurangank etergantungante rhadapl anggan( pemilik modal).

Modifikasi circle pada busana pesta berbahan denim / Yustin Sagita Dwi C.

 

Kata kunci : Modifikasi Circle, Busana Pesta, Denim. Busana adalah salah satu kebutuhan pokok manusia. Segala sesuatu yang dikenakan seseorang mulai dari ujung rambut hingga ujung kaki beserta pelengkapnya adalah termasuk busana. Dulu seseorang berbusana hanya untuk kebutuhan saja, namun sekarang seseorang lebih mementingkan trend pada saat berbusana. Penulisan tugas akhir ini bertujuan untuk menggambarkan trend dan keinginan seseorang berbusana saat ini. Denim adalah jenis bahan yang biasanya digunakan untuk busana casual. Namun disini, penulis mencoba merubah image denim yang biasanya digunakan untuk busana casual menjadi denim untuk pembuatan busana pesta. Selain itu denim sangat mudah dibentuk sesuai keinginan seseorang. Untuk menjadikan denim sebagai bahan pembuatan busana pesta, perlu sesuatu yang membuat busana tersebut terlihat lebih indah dan mewah. Seperti penambahan payet swarosky dan bros, juga pada bentuk busana itu sendiri. Bentuk busana disini terlihat unik dan lain daripada yang lain karena busana ini merupakan busana khusus. Dengan memodifikasi circle akan membuat busana ini telihat unik dan menarik. Circle dimodifikasi menjadi a quarter of circle kemudian ditambahkan stand dan kain keras sebagai penyempurna bentuk a quarter of circle. Dari sini kita bisa melihat bahwa seseorang berbusana bukan hanya untuk memenuhi kebutuhan, namun juga mengikuti trend. Seseorang berbusana ingin terlihat menarik dan lebih menonjol daripada yang lain terutama pada saat acara-acara khusus seperti pesta. Pembuatan modifikasi circle mencerminkan kepercayaan diri pada seseorang yang memakainya.

Pemutaran musik klasik sebagai upaya membangun konsentrasi belajar siswa dalam pembelajaran PKn di SMA Negeri 1 Kedungwaru Tulungagung (studi kasus di kelas X-D dan X-H tahun pelajaran 2009/2010) / Siti Baidah

 

Pembelajaran dengan pemutaran musik diduga mampu memfasilitasi suasana pembelajaran terutama dalam membangun konsentrasi belajar siswadalam pembelajaran termasuk dalam pembelajaran PKn. Pembelajaran yang kondusif memungkinkan siswa terlibat langsung secara aktif baik fisik maupun psikis. Konsentrasi dalam belajar merupakan salah satu yang mempengaruhi belajar siswa karena terkait dengan daya pikir. Penelitian ini bertujuan untuk mendeskripsikan (1) latar pertimbangan pemutaran musik klasik dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung, (2) jenis-jenis musik klasik yang digunakan dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung, (3) pelaksanaan pemutaran musik klasik dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung, (4) kendala yang ditemui dalam pemutaran musik klasik dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung. Penelitian ini menggunakan pendekatan kualitatif yang bersifat deskriptif. Jenis penelitian ini adalah penelitian studi kasus. Subyek penelitian adalah kelas X-H dan X-D. Teknik pengumpulan data yang digunakan pada penelitian ini adalah observasi, wawancara dan dokumentasi. Data yang diperoleh dianalisis secara deskriptif. Penelitian ini dilaksanakan di SMA Negeri 1 kedungwaru Tulungagung pada semester genap tahun pelajaran 2009/2010. Hasil penelitian ini menunjukkan bahwa (1) Latar pertimbangan pemutaran musik klasik dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung meliputi beberapa faktor antara lain; faktor kebutuhan, factor kesesuaian, dan faktor kemanfaatan. Hal ini yang menjadikan alasan dalam pemilihan musik klasik untuk dijadikan sebagai variasi dalam pembelajaran di kelas, (2) Jenis-jenis musik klasik yang digunakan dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung adalah Komposisi musik klasik yang berasal dan berkembang di negara barat (Eropa) sekitar tahun 1750-1825. Jenis musik klasik tersebut meliputi musik klasik Mozart, Kenny G, Beethoven, Barok, Jenis musik tersebut memiliki karakteristik yang hampir sama yang membedakan hanyalah pada instrumen yang dimainkan. Musik klasik Mozart instrumen yang dimainkan adalah piano, Kenny G instrumen yang dimainkan adalah alat musik tiup (terompet), Beethoven instrumen yang dimainkan adalah piano dan bass , sedangkan Barok instrumen yang dimainkan adalah alat musik gesek (biola), (3) Pelaksanaan pemutaran musik klasik dalam pembelajaran PKn di kelas X SMA Negeri 1 Kedungwaru Tulungagung telah dilaksanakan sesuai dengan pelaksanaan pembelajaran yang menekankan pada proses pembelajaran. Pemutaran musik klasik memberikan manfaat kepada pembelajaran antara lain: Menghilangkan kejenuhan dan kebosanan, menghidupkan suasana kelas, membangun konsentrasi belajar. Proses pembelajaran PKn yang berbasis pemutaran musik klasik menjadikan proses pembelajaran lebih menyenangkan, konsentrasi, dan penuh semangat. (4) Kendala yang ditemui dalam pemutaran musik klasik dalam pembelajaran PKn di kelas X SMAN 1 Kedungwaru Tulungagung antara lain; (a) kendala teknis; listrik padam, alat rusak, alokasi waktu yang singkat, (b) kendala dari guru; kurang kesiapan dalam pelaksanaan dan persiapan, (c) kendala dari siswa; karakter siswa yang berbeda-beda antara siswa yang satu dengan yang lain, (d) kendala minimnya sarana prasarana sekolah, terbatasnya sarana dan banyaknya pengguna.

Pembuatan busana pesta dengan pewarnaan pelangi pada Denim / Mery Iswianti

 

Kata Kunci: Busana Pesta, Pewarnaan Pelangi, Denim Melihat dari tren busana 2010 yang masih mengacu pada denim, maka penulis ingin membuat sebuah busana berbahan baku denim. Dari masa ke masa denim masih menjadi sebuah tren. Namun selama ini denim hanya digunakan untuk busana sehari-hari atau casual, masih jarang ditemui denim digunakan untuk acara formal atau busana pesta. Hal inilah yang mendorong penulis untuk membuat sebuah busana berbahan denim dengan desain yang menarik dan elegan sehingga bisa digunakan untuk acara formal atau pun pesta. Tujuan yang ingin dicapai dalam pembuatan Tugas akhir ini adalah menciptakan suatu desain busana pesta dengan pewarnaan pelangi pada denim. Manfaat yang diperoleh dalam pembuatan Tugas Akhir ini adalah dapat dijadikan sumber inspirasi bagi pembaca untuk membuat busana pesta dengan pewarnaan pelangi pada denim. Proses pembuatan yang dilakukan adalah pattern, cutting, sewing, dan finishing. Biaya yang dikeluarkan adalah Rp. 259.000,- Hasil yang diperolah dari pembuatan busana pesta ini adalah berupa long coat dan gaun bersiluet A, yang keduanya menggunakan bahan denim, sedangkan untuk pewarnaan pelangi menggunakan teknik airbrush. Aksesories dan milineris yang digunakan adalah hiasan rambut dari bahan denim, sepatu, anting-anting dan legging. Saran yang dapat diberikan adalah pada saat menandai kain sebelum proses airbrush, sebaiknya menggunakan kapur jahit jangan menggunakan pensil. Hal ini karena goresan menggunakan pensil membekas pada kain dan susah untuk dihilangkan.

Pengembangan media pemahaman kepribadian berbentuk permainan monopoli dalam upaya mengembangkan perencanaan karir siswa SMP ditinjau dari perspektif teori Holland / Septinda Rima Dewanti

 

ABSTRAK Dewanti, Septinda Rima. 2010. Pengembangan Media Pemahaman Kepribadian Berbentuk Permainan Monopoli dalam Upaya Mengembangkan Perencanaan Karier Siswa SMP Ditinjau dari Perspektif Teori Holland. Skripsi, Jurusan Bimbingan Konseling dan Psikologi, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (I) Dra. Ella Faridati Zen, M.Pd, (II) Drs. Hariyadi Kusumo. Kata kunci: media, permainan monopoli, tipe kepribadian Holland. Dewasa ini sering kali ditemui permasalahan di Sekolah Lanjutan Tingkat Atas, dimana banyak siswa yang salah jurusan. Bahkan berdasarkan observasi yang dilakukan di salah satu Sekolah Menengah Tingkat Atas di kota Malang 1-10 orang siswa mengalami salah jurusan di setiap kelasnya. Permasalahan tersebut menunjukan bahwa siswa pada tingkat SMP masih belum dapat menentukan sekolah lanjutan yang sesuai dengan dirinya. Siswa SMP menurut Super berada pada tahap perkembangan karier “pengembangan/growth” dengan tugas perkembangan mengembangkan bakat-bakat, minat, kebutuhan, dan potensi, yang akhirnya dipadukan dalam struktur konsep diri (self-concept structure). Berdasarkan penjelasan tersebut ditarik kesimpulan bahwa diperlukan suatu inovasi yang dapat digunakan untuk membantu siswa mengembangkan karier sesuai dengan kepribadiannya. Menangggapi kebutuhan tersebut, maka penelitian ini bertujuan untuk mengembangkan media yang dapat digunakan untuk membantu siswa mengenali kepribadiannya sehingga siswa dapat mengembangkan karier dengan tepat terutama dalam menentukan sekolah lanjutan. Penelitian ini dilakukan untuk mengembangkan media yang teruji validitasnya, mengetahui cara penggunaan media, dan mengetahui keterlaksanaan dari media ini. Kegiatan pengembangan yang dilakukan ini menggunakan rancangan penelitian pengembangan Borg and Gall, yang dalam penerapannya dilakukan adaptasi, disesuaikan dengan kondisi lapangan dan kebutuhan penelitian. Langkah penelitian dilakukan mulai dari need assessment, kemudian penyusunan produk yang selanjutnya dilakukan validasi produk dengan melakukan uji ahli dan uji coba produk. Hasil dari kegiatan pengembangan ini adalah media pemahaman kepribadian berbentuk permainan monopoli. Hasil akhir menunjukan bahwa media ini telah memenuhi syarat keberterimaan sebagai media pemahaman tipe kepribadian berbentuk permainan monopoli. Media ini memiliki validitas konstruk dimana validasi dilakukan untuk mengetahui kesesuaian isi media dengan dasar teori yang digunakan, yaitu teori minat karier Holland. Validasi dilakukan dengan melakukan uji ahli kepada ahli teori, ahli media dan ahli bimbingan. Ketiga ahli tersebut selain menilai isi, bentuk media juga menilai buku pedoman penggunaan media. Penilaian ahli menunjukan rata-rata skor yang diberikan pada deskriptor masing-masing tipe kepribadian adalah “3”, hal ini menunjukan bahwa produk yang dihasilkan sesuai dengan teori yang digunakan. Untuk mengetahui kelayakan media pemahaman kepribadian berbentuk permainan monopoli ini juga di uji cobakan pada kelompok kecil dan pengguna. Kesimpulan dari hasil uji coba produk menunjukan bahwa media ini layak digunakan. Saran yang dapat disampaikan pada penelitian ini adalah sebagai berikut, (1) untuk konselor di SMP penggunaan media ini secara tuntas dapat dilakukan pada 2 atau 3 kali pertemuan sehingga proses permainan dan evaluasi dapat dilakukan secara maksimal. Pengkondisian siswa untuk mengikuti proses diskusi tidak hanya dilakukan pada akhir permainan saja. Pada saat permainan berlangsung konselor dapat mengarahkan diskusi misalnya dengan mendiskusikan pekerjaan yang terpilih, bagaimana pekerjaan itu dan keterampilan apa yang harus dimiliki untuk mendapatkan pekerjaan tersebut. (2) untuk peneliti selanjutnya, pengembangan yang telah dilakukan dalam mengembangkan media permainan monopoli ini telah sampai pada tahap uji coba produk pada kelompok kecil namun belum sempat melakukan uji lapangan. Untuk itu saran bagi peneliti selanjutnya diharapkan dapat melakukan uji lapangan sehingga produk yang dikembangkan benar-benar efektif digunakan.

Pengembangan media layanan informasi bahaya penyalahgunaan narkoba berbasis multimedia interaktif bagi siswa SMP Negeri 18 Malang / Susiati

 

ABSTRAK Susiati. 2010. Pengembangan Media Layanan Informasi Bahaya Penyalahgunaan Narkoba Berbasis Multimedia Interaktif bagi Siswa SMP Negeri 18 Malang. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Universitas Negeri Malang. Pembimbing (I) Dr. Triyono, M.Pd. (II) Drs. Hariadi Kusumo Kata Kunci : Multimedia, Layanan Informasi, Narkoba Fenomena penyalahgunaan narkoba di kalangan remaja semakin mengkhawatirkan. Hal tersebut sangat mempengaruhi perilaku remaja yang berada dalam masa transisi dan pencarian identitas diri. Bimbingan dan konseling sebagai bagian yang integral dari pendidikan harus dapat memberikan pemahaman yang memadai kepada para remaja mengenai dunia remaja, terutama penghindaran diri dari bahaya penyalahgunaan narkoba. Namun, BK di SMP Negeri 18 Malang belum memiliki media dalam bentuk multimedia interaktif yang menunjang proses pemberian informasi bahaya penyalahgunaan narkoba yang termasuk dalam layanan informasi bidang bimbingan sosial. Pengembangan ini bertujuan untuk menghasilkan produk media layanan informasi bahaya penyalahgunaan narkoba berbasis multimedia interaktif yang berterima baik (memenuhi aspek ketepatan, kejelasan, kegunaan dan kemenarikan) baik secara teoritik maupun praktis. Media ini berisi empat (4) menu utama yaitu profil pengembang, pendahuluan, petunjuk penggunaan dan informasi. Di dalam menu informasi terdapat empat (4) sub menu informasi antara lain: dunia remaja, fakta penyalahgunaan narkoba, bahaya penyalahgunaan narkoba dan remaja anti narkoba. Pengembangan media layanan informasi ini mengikuti tahapan model pengembangan Borg and Gall (1983). Tahapan yang diambil meliputi: 1) identifikasi kebutuhan, 2) perumusan tujuan bimbingan, 3) penyusunan produk, 4) uji coba produk, 5) revisi dan 6) produk akhir. Untuk mengetahui media yang berterima secara teoritik maupun praktis, dilakukan uji validitas produk kepada ahli media, ahli materi dan audiens/uji kelompok kecil yang berjumlah 10 orang. Instrumen penelitian yang digunakan untuk mengumpulkan data validitas adalah angket. Adapun hasil pengisian angket kemudian dianalisis menggunakan teknik analisis deskriptif. Hasil pengembangan menunjukkan bahwa keberterimaan multimedia interaktif dengan topik bahaya penyalahgunaan narkoba, menurut ahli media adalah sesuai (2,93), menurut ahli materi adalah sesuai (3,13) dan hasil uji audiens/kelompok kecil adalah sangat jelas (3,43). Kesimpulannya, media layanan informasi tersebut sesuai dari aspek kemenarikan, sesuai dari aspek ketepatan dan kegunaan, serta sangat jelas dari aspek kejelasan dan kemudahan sehingga dapat digunakan dalam pemberian layanan informasi bahaya penyalahgunaan narkoba. Saran yang diberikan dalam hal ini adalah 1) media ini hendaknya digunakan oleh guru BK dalam pemberian layanan informasi mengenai bahaya penyalahgunaan narkoba, 2) terhadap peneliti selanjutnya, agar multimedia ini diteliti lebih lanjut hasil pengembangan dan efektivitasnya dengan melakukan penelitian tindakan (action research) dalam bimbingan.

Penerapan Manajemen Pemasaran Perusahaan Pengembang Perumahan Tipe Besar Di Malang / Oleh Wisnu Wijaya

 

ABSTRAK Wijaya, Wisnu. 2OO2P. enerapanM anajemen PemasaranP erusahaan Pengembang Perumshan Tipe Besar dl Malang. Skripsi, Program Studi PendidikanT eknik Bangunan.JurusaTne knik Sipil. UniversitasN egeriM alang. Pembimbing(I ) Drs. Ir. H. SudomoP, embimbing(I I) Drs. Priyono Manajemenp emasaranw, awasant erhadapp asar,p rosesd an perencanaanp emasarans, istemi nformasi dan penelitianp asar, pengembangti pe besar Penelitian ini dilakukan untuk mengetahui sejauh mana perusahaan pengembanpge rumahan'tipeb esard i Malang menerapkanm anajemenp emasaran yang di dalamnya mencakup wawasan terhadap pasar, proses dan perencanaan pemasarans ertas istemi nformasi dan penelitianp asar.A dapunr umusanm asalah yangd iajukan adalah( l) Bagaimanaw awasanp erusahaanp engembangtip e besar terhadapp asar? (2) Bagaimanap rosesd an perencanaanp emasaranyandgi lakukan oleh perusahaanp engembangti pe besar? (3) Bagaimanas istemi nformasi dan penelitianp emasarany ang dilakukan oleh perusahaanp engembangti pe besar? Penelitiani ni merupakanp enelitiand eskiptif. Desainp enelitiannyam etiputi perencanaa(np enentuans arnpel),s ampling( pengambilank eputusanm engenai subyek),p embuatanin strumenp engumpuld ata,p elaksanaans urveyd an pengolahan data.P opulasiy angm enjadi penelitian ini adalahp erusahaanp engembang perumahanti pe besard i Malang. Teknik samplingy ang digunakana dalaht eknik simpler andoms amplingd enganm engambils ampel5 perusahaanp engembangd an dari masing-masingp erusahaanp engembangp erumahante rsebutd iambil 5 respondenI.n strumenp enelitiany ang digunakana dalahk uesioner/angkeUt. ntuk mengumpulkand ata selainb erdasarkana ngkety ang diisi respondenju ga dilalrukan wawancarate rhadapr espondenU. ntuk analisisd ata dilalrukand enganc ara statistik deskriptif. Hasil penelitianm enunjukkanb ahwap adau mumnyap erusahaanp engembang perumahanti pe besard i Malang mempunyaiw awasant erhadapp asary angb agus yakni 78,66% . Sedangkan2 1,34o cenderungm empunyawi awasany angr endah sehinggad iperkirakanp erusahaante rsebuta kank esulitanu ntuk bersaingd alam meraihk onsumenD. ari keseluruhansa mpejlu ga diperolehb ahwap erusahaan pengembandgi Malangs epakamt enghasilkamn utu dank inerjap erusahaatne rbalk, membuapt rodukt erbaikd anm elakukanp enyempurnaapnr oduks ecarate rusmenerusD. engand emikian dapatd ilihat bahwap erusahaanp engembangp erumahan vl tipe besar di Malang cenderungm enerapkank onsepb erwawasanp roduk..D alam menyusrmd an memprosesre ncanap emasaranp engembangp erumahanti pe besard i Malang juga mempunyai standart yang bagus. Hal ini dibuktikan dengan 87 ,28 o/o mempunyai standart yangjelas dan terarah yang meliputi analisis pasar, pertumbuhan pasard, ans istemo rganisaspi emasarayna ngjelas.S edangkan1 2,72%m empunyai kualitasp erencanaanp emasarany ang rendah.S edangkanu ntuk sistemi nformasid an penelitian pasar ini ditemukan hal yang penting untuk dijadikan catatan yaitu dari dari 4 perusatraa(n8 0 % ) dari 5 perusahaanp engembangd i Malangyangmenjadi sampel penelitian tidak pernah danjarang melakukan tes preferensi produk yang dihasilkan,2 perusahaanp engembang(4 0 %) dari 5 perusahaanp engembangya ng menjadis ampepl enelitiant idak pemahm elatihs umberd ayap emasaradna n2 perusahaapne ngembang(4 0 o/o)d ari 5 perusahaanp engembanjga rang melatih sumberd ayap emasarannyuan tuk melaporkank ondisi pemasarante rbaru,3 perusahaanp engembangd ari 5 perusahaanp engembangp erumahany angm enjadi sampel( 60 o/ot)i dak punyas istemi ntelijenp emasarand,a n6 0 7op erusahaan pengembang(3 perusahaant)i dak mempunyaip usats istemi nformasi internal. Tetapi dari skor ruta-rataa khir yang diperolehd ari seluruhp oint pertanyaanm engenai sistemi nformasi dan penelitianp asard iperolelt 52,827 op erusahaanp engembang perumahatnip e besarm empunyasi istemi nformasid anp enelitianp emasaradne ngan skalab agus.S edangfan4 7.18o/op erusahaanp engembangm empunyais istem informasid anp enelitiany angb erkualitasre ndah.

Perbedaan Persepsi Tentang Kenakalan Remaja Antara Siswa SMU Negeri 8 Dan Siswa SMK Negeri 2 Di Malang oleh Sri Wilujeng

 

Persepsmi erupakantn terpretasiin form.asyi angd atangd ari indra' pemberiana rtt stimuluisn drawi,a rtr rtu ;#;.k"";;iu*- ca.i"stlm"tusi ndrawid an sebagiand ari caras eseorang." nyrrrun--informasi tersebut,a tau dari pengetahuany ang sudah oti*t};HX' yang semakinm aju sepertii ni. ada kecenderungabne rbagaik enakaran vane dilakukan oleh ,"b;gi;;;a1a, telatr banvak diberitakan diberbagai media, ill?u]li];#k ,;ilt- kenakalanya ns mensarapha dab- entukk riminalb erupa keiahatdaann k ekerasaRne' majad alaghe neraps:i 1tt*, b-9111t::t1 vanga kan ffiffi;;;g" atu"i"rrt"" pengetahuamne ngenakie adaayna nga dad isekitarnva ffi; ;biffika, dapafr'" rpiti.i"t"t lebihm ajula gid anl ebihb aikl agi Remajaad ad i sekola;-i'IrnjN8 danS MKN2 , kiduanyam emplnylk urikulum vaneb erbeddai mungkinkamne mpunypa"i t'"p'i yangb erbedpau. l'uD ] St*I ? ffiilffi;ff ;;;s";'(sejenii) yuitu p"r".puan.b erdasarksaunr ver lapangadni SMKN 2 perkelass iswap erempuannytai0 % sedangka2n0 olonylaa ki'laki (._hansitial-dsiupravnelaio paanngg-aanap aridsaes ta

Eksistensi Pendidikan Moral Dalam Upaya Mengembangkan Kepribadian Para Santri Pondok Pesantren Salafiyah (Suatu Studi di desa Kebonsari Kota Malang) Oleh Nur Lailatul Mufidah

 

Pcndidikanm oralp adah akekatnyaad alahu sahas adary angd ilakukan denganse ngajas,i stematisu ntukm endorongm, embantud anm embimbing seseoranggu nam engembangkasne galap otensinyas ertam engubahd iri sendiri dari kualitas satu ke kualitas yang lain yang lebih tinggi. Pendidikan moral di jamanm odems epertis ekarangin i sudahm enjadis ahrf enomenak emasyarakatan yangu niversal,h ampir semuam asyarakamt oderna dak ecenderungaunn tuk menempatkapne ndidikanm oral sebagabi agiani ntegrald ari sistem pendidikannyaP. rosesp endidikant idak hanyad i sekolah-sekolauhm umt etapi juga di lingkunganp esantrenR. umusanm asalahd ari penelitiani ni adalah( l) Bagaimanbae ntukp endidikanm orald i PondokP esantreSn alafiyah(,2 ) Kendalakendalaa pas ajay angd ihadapiP ondokP esantrenS alafiyahd alamm elaksanakan pendidikanm oral, (3) Bagaimanap eranp endidikanm oral di PondokP esantren Salafiyahd alamu payam engembangkakne pribadianp aras antri. Sedangkan tujuand ari penelitiani ni adalahu ntuk mendekripsikanb entukp endidikanm oral di PondokP esantreSn alafiyahK ebonsarPi asuruaqm engetahukie ndala-kendala yangd ihadapPi ondokP esantreSn alafiyahd alamm elaksanakapne ndidikan moral,d anm endeskripsikanp eranp endidikanm oral di PondokP esantren Salafiyahd alamu payam engembangkakne pribadianp aras antri. Mengamatim asalahp endidikanm oral di pesantrenm, akat erlebih dahulu harusm engetahupi engertiann ilai, norma,m oral, pesantrenk, epribadiand an peranp endidikanp esantrend alamm engembangkakne pribadian.S alahs atu komponedna ri pendidikann on-formaal dalahn ilai karenan ilai merupakan realitasa bstraky ang dirasakand alamd iri orangm asing-masings ebagadi aya pendoronyga ngm enjadip edomanh idup.N ormay aitut atak elakuany ang terdapadt alamm asyarakats, ecarau mumn orma-normad alamm asyarakabt erakar padas uatus istemn ilai budayay angm empunyaki ekuatany ang berbedaM. oral seringd isinonimkand engane tikay angb erartin ilai-nilai.G ambaranp esantredni Indonesiam erupakanli ngkunganl embagay ang sulit diajak kerjasamam engenai perubahanse rtas ulit dipahamip andangand unianya.P erkembangakne pribadian seseorandgip engaruhoi leh( 1) warisanb iologis( 2) lingkunganfi sik (3) kebudayaa(n4 ) pengalamank elompokd an (5) pengalamany angu nik. Peran pendidikanp esantrend alamp erkembangakne pribadianp aras antri setidaknya akanm emperolephe ndidikany angb ermanfaadta lamm engahadappie rsoalan lingkungadna np erjalananh idupnya. Jenisp enelitianin i adalahs urveyd enganm enggunakanjendisa ta kualitatif.P engumpuland atam enggunakante knik observasiw, awancarad an dokumentasTi. eknik analisisd atad enganm enggunakanm odel interaktif yaitu (l) reduksdi ata(2)p enyajiand atad an( 3) penarikank esimpulanP. engecekan keabsahadna tam enggunakatne nik (1) perpanjangakne ikutsertaa(n2 ) ketekunan pengamata(3n) kecukupanre ferenssi erta( 4) trianggulasi. Hasilp enelitianm enunjukkanb ahwab entukk gitanp endidikanm orald i pondokp esantreSn alafiyaha dalahs ebagabi erikut:k egiatanm entauhidkaAn llah, kegiatanb eribadahk epadaA llah, kegiatanu khuwahI slamiyahk, egiatan kekeluargaadna n kebersamaank,e giatanp ersahabatayna ngt ulus, kegiatanh idup serasdi ans eimbangk,e giatanq ona'ahd ans ederhansae rtak egiatank eikhlasan danp engorbanaMn.a teri( isi) dari pendidikanm oralt ersebuat dalahs holat, puasat,a uhid,w irid, istighosahp, engajiank itab kuning,d iba', berjanji,t horiqoh, dans uluk.K endala-kendaylaa ngd ihadappi ondokp esantreSn alafiyahd alam melksanakapnr osesp endidikanm orala dalahf aktor( l) fasiltasy and imiliki pondokp esantren(2 ) kurannyat enagap engajar( 3) santri berasadl ari keluarga yangk urang( mampu)( 4) latar belakangs antriwatip ondokp esantrenP. eran pendidikanm oral dalamm engembangkakne pribadiand apatd itujukkand engan perilakus antriy angn ampakd alamk ehidupans ehari-harmi elalui tindakan,t utur kata,s ertab ahasay angd igunakand alamb erkomunikasdi enganl ingkungana tau orangy angs edangd ihadapinyaK. epribadiany ang ditampakkans antri adalah kepribadiank eagamaank,e pribadiany angt ercermind ari etosk erja yangt inggi, qona'ah,t idak kenal menyerahd an putusa sad alamm enghadapmi asalah, kepribadiany angm uaddib( sifat keguruan)s ertam empunyari asap ercayad iri yang tinggi. Kesimpulan dari penelitian yang dilakukan bahwa pola kehidupan yang mengintegrasianni lai-nilai agamisd alamb entukp elaksanaansp iritualitasy ang tinggi,d enganp enuhk edisiplinand anp enerapapne ndidikanm orald i pondok pesantreSn alafiyahm ampum embangucni tra diri individua taus antriy ang berkepribadiayna nga gamisb, erkepribadiamn uaddib( sifatk eguruan)d, an memiliki sifat atauk arakteristikk epercayaadni ri yang mantap.S arany angd apat dijadikanm asukanb agip ondokp esantreSn alafiyaha dalah(: l) hendaknydaa pat meningkatkanp rosesp endidikanm oral yanga dam elalui studi padap esantrenpesantrenla innya( 2) hendaknyam engembangkafna silitas dn mediap endidikan yangd irasak urangs elamai ni (3) dapatm encontohp esantreny ang lebih modem sehinggad apatd apatd ijadikana cuans ertad apatm emadukaann taraji wa atau nilai-nilaik epesantrenadne ngann ilai-nilaiy angl ebihm odern.S edangb agi lnstansPi emerintaKh ota Pasuruaand alah(: l) hendaknypae merintahle bihp eduli dengana danyap rosesp endidikand i pondokp esantrend, iharapkanb antuand ana untukm enunjangke giatan-kegiatayna nga dad i pondokp esantrenS alafiyah(2 ) diharapkanm elakukanp endekatany ang lebih baik dalamr angkap roses pendidikany angd iajarkand i pesantrens ehinggas esuadi enganh arapan masyarakaut mum.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 |