Kontribusi motivasi terhadap kinerja guru SD se-kecamatan Labuhan Haji Lombok Timur (NTB) / Sri Rosdiani

 

Kata kunci: motivasi, kinerja guru Pendidikan Sekolah Dasar (SD) merupakan pendidikan formal yang mempersiapkan peserta didik untuk memperoleh ilmu pengetahuan yang lebih ke jenjang pendidikan selanjutnya, sehingga tuntutan kinerja yang kreatif dan profesional sangat diperlukan agar tujuan pendidikan dapat berjalan dengan baik dan sesuai dengan visi dan misi tujuan pendidikan. Tetapi masih banyak guru kurang mempunyai motivasi dalam menjalankan tugasnya sebagai tenaga pengajar. Di samping itu kurangnya dorongan untuk meningkatkan kinerja juga dapat mempengaruhi kreatifitas dan kualitas kerja. Oleh karena itu, untuk meningkatkan kinerja, guru memerlukan motivasi kerja yang tinggi. Rumusan masalah penelitian ini adalah: (1) seberapa tingkat motivasi guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB)?; (2) seberapa tingkat kinerja guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB) ?; (3) bagaimana kontribusi motivasi terhadap kinerja guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB)? Tujuan penelitian ini adalah: (1) mengetahui tingkat motivasi guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB); (2) mengetahui tingkat kinerja guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB); (3) mengetahui bagaimana kontribusi motivasi terhadap kinerja guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB). Populasi penelitian ini adalah guru SD se-Kecamatan Labuhan Haji, Lombok Timur, (NTB) yang berjumlah 348 orang, dengan jumlah sampel 181 orang yang diambil berdasarkan rumus Krecjie, dengan teknik proporsional random sampling. Data yang terkumpul menggunakan instrumen angket dianalisis dengan teknik analisis deskriptif dan regresi sederhana. Penelitian ini menggunakan instrumen berupa angket untuk mengumpulkan data. Setelah data terkumpul, diolah, dan dianalisis dengan teknik analisis deskriptif dan regresi sederhana sehingga diketahui hasil penelitian yang menyatakan: (1) motivasi guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB) rata-rata termasuk dalam kategori tinggi, hal ini mengartikan bahwa guru memiliki motivasi yang tinggi dalam bekerja. Misalnya: prestasi-prestasi yang diraih oleh guru, gaji yang diperoleh guru, (2) kinerja guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB) rata-rata termasuk dalam kategori sangat tinggi, hal ini menunjukkan bahwa kinerja guru sangat tinggi. Misalnya: selalu menjaga kode etik sebagai guru, mematuhi peraturan yang ada di lembaga, menjalankan proses belajar mengajar dengan baik, dan (3) motivasi memiliki kontribusi terhadap kinerja guru SD se-Kecamatan Labuhan Haji Lombok Timur (NTB), sehingga hal ini berarti bahwa motivasi guru berpengaruh terhadap kinerja guru. Bertitik tolak dari hasil penelitian ini, beberapa saran yang disampaikan adalah: (1) bagi guru-guru SD se-Kecamatan Labuhan Haji, Lombok Timur (NTB), sebaiknya meningkatkan motivasi kerja agar bisa sangat tinggi dan mempertahankan kinerja yang sudah sangat baik sesuai kompetensi dan kemampuan yang dimiliki; (2) bagi peneliti lain, penelitian ini dapat dijadikan acuan untuk mengadakan penelitian selanjutnya dengan variabel dan subjek yang lebih luas.

Hubungan antara latar belakang pendidikan peserta dengan partisipasinya dalam program-program Posyandu di tiga desa Kecamatan Dau Kabupaten Malang
oleh Yuliati

 

Pelaksanaan sistem kearsipan di Kantor Cabang Dinas Pendidikan Kecamatan Singosari Kabupaten Malang tahun 2005 / oleh Arief Budiono

 

Pengaruh metode pembelajaran pemecahan masalah vs metode curah pendapat dan motivasi belajar terhadap hasil belajar IPA mahasiswa PGSD FKIP Undana Kupang / Taty Rosiana Koroh

 

ABSTRAK Koroh, Taty. R., 2016. Pengaruh Metode Pemecahan Masalah vs Metode Curah Pendapat dan Motivasi Belajar terhadap hasil belajarMahasiswa PGSD FKIP Undana Kupang., Program Studi Teknologi Pembelajaran, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof DrPunad-jiSetyosari., M. Pd., M. Ed. Pembimbing (2) Prof Dr I NyomanSudanaDe-geng., M. Pd., (3) Dr I WayanDasna., M. Si., M. Ed Kata Kunci:problem solving, brainstorming, motivasi belajar, hasil belajar. Pencapaian hasil belajar mahasiswa terkait dengan penggunaan metode pembelajaran dan motivasi belajar. Masalah yang dihadapidalampembelajaran IPA di PGSD FKIP UNDANA adalah; penggunaanmetodepembelajaran yang bersifatteacher centereddankurangnyakeaktifanmahasiswadalampembelajaran. Untukitudiperlukanperubahandalampembelajaran. Perubahandaripembelajaran-bersifatteacher centeredmenjadibersifatstudent centered sehinggadapatmening-katkankeaktifanmahasiswa. Tujuandaripenelitianiniadalah: 1)mengujiperbedaan hasil belajar mahasiswa dalam penerapan metode problem solving dan metode brainstroming. 2)mengujiperbedaan motivasi belajar antara mahasiswa mahasiswa yang bermotivasi tinggi dengan mahasiswa yang bermotivasi rendah. 3) menguji interaksi antara metode problem solving dengan metode brainstroming terhadap motivasi dan hasil belajar. Instrumen pengukuran hasil belajar berupa test pilihan ganda yang dikembangkan oleh peneliti. Sebelum digunakan, instrumen divalidasi isi dan analisis item setelah uji coba. Reliabilitas tes menunjukkan nilai alpha cronbach’s sebesar 0. 573, sedangkan validasi isi yakni 87% dan layak untuk digunakan. Penelitian ini menggunakan jenis penelitianfactorial design secara khusus penelitian ini menggunakan rancangan kelompok kontrol yang versi faktorial 2x2 pretest-post test nonequivalent control group design. Subjekpenelitianberjumlah 50 orang. Terbagidalamduakelas, mahasiswa semester III, tahunangkatan 2015/2016 PGSD FKIP UNDANA. Analisis data dilakukan melalui tahapan (1) deskripasi data, (2) Uji asumsi, dan (3) uji hipotesis penelitian, yang dilakukan dengan teknik analisis statistik ANAVA dua jalur (2x2) Hasil penelitian menunjukkan bahwa : 1) terdapat perbedaan hasil belajar antara mahasiswa yang diajar dengan menggunakan metode pembelajaran prob-lem solving dan metode pembelajaranbrainstormingdimanaF sebesar 27.071 dan nilai signifikansi .000, sehingga sig < p .0.05dannilai mean nilai rerata dari metode problem solving yakni 69.739 dan metode brainstorming 67.323.2)terdapat perbedaan hasil belajar antara mahasiswa dengan motivasi belajar tinggi dan mahasiswa bermotivasi belajar rendah, dengannilai F sebesar 75.389, nilai signifikansi (sig .000 < p .0.05).3). Terdapatinteraksi antara metode pembelajaran dan motivasi belajarpada hasil belajar kognitif, dikarenakan sig .039

Identifikasi kesalahan konsep pada materi laju reaksi siswa kelas XI SMA Negeri 1 Pagak dan perbaikannya menggunakan strategi konflik kognitif / Dhamas Mega Amarlita

 

Kata kunci : kesalahan konsep, laju reaksi, strategi konflik kognitif Ilmu kimia mempunyai tingkat kesulitan yang tinggi karena konsep-konsep dalam kimia bersifat abstrak, merupakan penyederhanaan dari keadaan sebenarnya, dan sifatnya berurutan. Salah satu materi kimia yang diajarkan di SMA adalah laju reaksi. Kesulitan dalam memahami konsep-konsep dalam materi laju reaksi dapat menyebabkan terjadinya kesalahan pemahaman. Pemahaman salah yang terjadi secara konsisten disebut dengan kesalahan konsep (misconseption). Salah satu upaya untuk memperbaiki kesalahan konsep adalah dengan menggunakan strategi konflik kognitif. Tujuan dari penelitian ini adalah untuk: (1) mengidentifikasi dan memaparkan jenis-jenis kesalahan konsep materi laju reaksi yang terjadi pada siswa kelas XI IPA, (2) mengidentifikasi dan memaparkan sumber-sumber penyebab kesalahan konsep materi laju reaksi yang terjadi pada siswa kelas XI IPA; (3) mengidentifikasi keefektifan strategi konflik kognitif dalam memperbaiki kesalahan konsep materi laju reaksi yang terjadi pada siswa kelas XI IPA, dan (4) mengidentifikasi adanya persistensi kesalahan konsep materi laju reaksi yang terjadi pada siswa kelas XI IPA. Penelitian ini menggunakan rancangan deskriptif dan pra eksperimen. Rancangan deskriptif digunakan untuk mengidentifikasi kesalahan konsep, sumber penyebab terjadinya kesalahan konsep, dan persistensi kesalahan konsep. Rancangan penelitian pra eksperimen digunakan untuk mengetahui keefektifan strategi konflik kognitif dalam memperbaiki kesalahan konsep siswa. Subyek penelitian ini adalah siswa kelas XI IPA SMA Negeri 1 Pagak tahun pelajaran 2009/2010 yang terdiri dari 27 siswa. Instrumen penelitian berupa tes pilihan ganda dengan empat pilihan jawaban dan tes wawancara. Tes pilihan ganda memiliki validitas isi sebesar 95,7 % dan koefisien reliabilitas tes, dihitung dengan menggunakan korelasi product moment, sebesar 0,97. Urutan langkah-langkah dalam penelitian adalah: (1) pre tes dilanjutkan dengan wawancara, (2) pembelajaran strategi konflik kognitif, (3) pos tes dan wawancara, (4) tes persistensi yang dilakukan setelah selang waktu dua minggu. Data yang diperoleh analisis dengan menggunakan paired sample t-test dan analisis deskriptif. Kesalahan konsep ditetapkan berdasarkan jawaban salah siswa pada saat tes tulis dan wawancara. Persistensi kesalahan konsep siswa dianalisis berdasarkan siswa yang mengalami kesalahan konsep secara konsisten, yaitu mengalami kesalahan konsep pada saat pre tes, pos tes dan tes persistensi. Hasil penelitian menunjukkan bahwa: (1) jenis kesalahan konsep siswa pada materi laju reaksi diantanya adalah (a) dengan bertambahnya waktu reaksi jumlah reaktan semakin berkurang tetapi laju reaksi semakin meningkat (81,5%), (b) Pada reaksi A + B  C, jika pereaksi B berlebih maka pada akhir reaksi pereaksi B akan mendekati nol atau akan habis (63%); (c) laju reaksi rata-rata merupakan perbandingan antara perbedaan konsentrasi produk pada saat awal dan akhir reaksi dengan waktu reaksi (96,3%); (d) orde reaksi ditentukan oleh semua reaktan beserta koefisien reaksinya (66,7%); (e) tumbukan dengan orientasi yang tepat hanya terjadi antara atom-atom yang sama (100%); (f) laju reaksi meningkat dengan bertambahnya ukuran pereaksi (66,7%); (g) kenaikan suhu akan meningkatkan energi aktivasi dan laju reaksi (77,8%); dan (h) katalis dapat meningkatkan energi aktivasi dan meningkatkan laju reaksi (63%). (2) Kemungkinan sumber kesalahan konsep pada siswa adalah kurang lengkapnya penjelasan tentang materi laju reaksi pada buku pelajaran kimia siswa dan tidak akuratnya pemahaman guru tentang materi tersebut; (3) strategi konflik kognitif adalah efektif dalam memperbaiki kesalahan konsep siswa pada materi laju reaksi. (4) Setelah dua minggu, persistensi kesalahan konsep terjadi pada 14,8 % siswa, dan termasuk dalam kategori sangat rendah.

Pengaruh metode pembelajaran kooperatif model stad terhadap prestasi belajar siswa SMA Negeri 1 Lamongan tahun ajaran 2004/2005 / oleh Zuliana

 

Pengaruh metode pembelajaran inkuiri terbimbing vs inkuiri bebas dan motivasi belajar terhadap hasil belajar / Markus Umbu Kalola Yewang

 

ABSTRAK Yewang, Markus 2016. Pengaruh Metode Pembelajaran Inkuiri Terbimbing VS Inkuiri Bebas dan Motivasi Belajar terhadap Hasil Belajar. Disertasi. Program Studi Teknologi Pendidikan. Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I. Nyoman Sudana Degeng, M.Pd., (II) Prof. Dr. H. Punadji Setyosari, M.Pd., M.Ed., (III) Dr. Sulton, M.Pd Kata Kunci: metode pembelajaran inkuiri terbimbing, metode pembelajaran inkuiri bebas, motivasi belajar, hasil belajar. Penelitian ini dilatarbelakangi oleh kurangnya penggunaan metode yang bervariasi dalam pembelajaran dasar-dasar akuntansi yang berakibat pada rendahnya hasil belajar mahasiswa. Metode pembelajaran yang diharapkan untuk digunakan dalam pembelajaran dasar-dasar akuntansi bukan hanya metode pembelajaran langsung/ekspositori yang lebih berorientasi kepada dosen, tetapi juga metode pembelajaran tidak langsung yang berorientasi pada mahasiswa. Dengan metode pembelajaran tidak langsung diharapkan mahasiswa diberi kesempatan untuk mengembangkan kemampuan berpikir kritisnya dalam memaknai konsep-konsep dasar-dasar akuntansi dan kemampuan mengobservasi lingkungan yang terkait dengan permasalahan pembelajaran yang ingin dipecahkannya. Masalah yang akan dikaji dalam penelitian ini antara lain, (1) Apakah ada perbedaan hasil belajar mahasiswa semester I Jurusan Pendidikan Ekonomi antara kelompok yang mendapat metode pembelajaran inkuiri terbimbing dengan kelompok yang mendapat metode pembelajaran inkuiri bebas? (2) Apakah ada perbedaan hasil belajar mahasiswa semester I Jurusan Pendidikan Ekonomi antara kelompok yang memiliki motivasi belajar tinggi dengan kelompok yang memiliki motivasi belajar rendah? (3) Apakah ada interaksi antara metode pembelajaran (inkuiri terbimbing dan inkuiri bebas) dan Motivasi belajar terhadap hasil belajar mahasiswa semester 1 Jurusan Pendidikan Ekonomi? Tujuan penelitian ini adalah untuk mengetahui (1) perbedaan hasil belajar mahasiswa semester I Jurusan Pendidikan Ekonomi antara kelompok yang mendapat metode pembelajaran inkuiri terbimbing dan kelompok yang mendapat metode pembelajaran inkuiri bebas. (2) perbedaan hasil belajar dasar-dasar akuntansi mahasiswa semester I Jurusan Pendidikan Ekonomi antara kelompok yang memiliki motivasi belajar tinggi dan motivasi belajar rendah. (3) interaksi antara metode pembelajaran dan motivasi belajar terhadap hasil belajar dasar-dasar akuntansi mahasiswa semester I Jurusan Pendidikan Ekonomi. Penelitian ini menggunakan metode eksperimen. Penelitian dilaksanakan di Jurusan Pendidikan Ekonomi Fakultas Keguruan dan Ilmu Pendidikan Universitas Nusa Cendana Tahun Akademik 2015/2016. Subyek penelitian ini adalah mahasiswa semester I Jurusan Pendidikan Ekonomi FKIP Undana sebanyak 70 mahasiswa, dimana 40 mahasiswa di kelas A sebagai kelas eksperimen dengan menggunakan metode pembelajaran inkuiri terbimbing dan 30 mahasiswa di kelas B sebagai kelas kontrol dengan menggunakan metode pembelajaran inkuiri bebas. Analisis data menggunakan teknik ANAVA dua jalur dengan uji prasyarat analisis yaitu uji normalitas dengan menggunakan metode Lilliefors significant corection dari Kolmogorov-Smirnov Test dan uji homogenitas dengan uji F. Hasil analisis data menunjukkan bahwa: 1) ada perbedaan yang signifikan antara metode pembelajaran inkuiri terbimbing dan inkuiri bebas terhadap hasil belajar, yang ditunjukkan dengan nilai F = 14,503, nilai p = 0,00 < 0,05. 2) ada perbedaan yang signifikan antara mahasiswa yang memiliki motivasi belajar tinggi dan mahasiswa yang memiliki motivasi belajar rendah yang ditunjukkan dengan nilai F = 27,975, nilai p = 0,00 < 0,05. 3) tidak ada interaksi antara metode pembelajaran dan motivasi belajar mahasiswa terhadap hasil belajar dasar-dasar akuntansi yang ditunjukkan dengan nilai F= 0,564, nilai p = 0,651> 0,05.

Faktor-faktor yang berpengaruh terhadap partisipasi sasaran dalam pelaksanaan posyandu di Kecamatan Kedungkandang Kotamadya Malang
oleh Nurhadi

 

Pengaruh struktur kepemilikan perusahaan terhadap kebijakan dividen di Perusahaan-perusahaan Go-Public yang listing di Bursa Efek Jakarta / oleh Jula Dian Februarina

 

Usaha tani dan tingkat ekonomi petani kakao di Desa Suruh Kecamatan Suruh Kabupaten Trenggalek / Agus Setya Rachmad

 

ABSTRAK Setya,Agus Setya. Usahatani dan Tingkat Ekonomi Petani Kakao di Desa Suruh Kecamatan Suruh Kabupaten Trenggalek. Skripsi, Jurusan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. Singgih Susilo, M.S M.Si, (II) Drs. Mustofa, M.Pd. Kata-kata Kunci: Usaha tani, tingkat ekonomi, petani kakao Kakao merupakan salah satu komoditas utama perkebunan yang peranannya cukup penting bagi perekonomian di Indonesia. Indonesia merupakan salah satu pemasok kakao terbesar di dunia, padahal setiap tahun nya pasokan kakao untuk di ekspor masih kurang. Hal ini membuat masyarakat Indonesia tergiur untuk menjadi petani kakao khususnya warga Desa Suruh Kecamatan Suruh Kabupaten Trenggalek untuk meningkatkan ekonomi rumah tangga mereka. Kenyataan di lapangan tidak sesuai dengan harapan, tingkat ekonomi petani kakao di Desa Suruh masih rendah. Kenyataan itu dilihat dari pendapatan dari pertanian kakao belum sepenuhnya dapat mencukupi kehidupan sehari-hari. Tujuanpenelitianiniuntukmengidentifikasifaktor nonfisik yang berkaitandenganusahatanikakao, mendeskripsikanpengelolaanusahatanikakao, mendeskripsikanproduksikakaoserta mendeskripsikantingkatekonomipetanikakao di Desa Suruh KecamatanSuruh Kabupaten Trenggalek.Penelitianinimerupakanpenelitiandeskriptif. Populasipadapenelitianiniadalahsemuapetanikakao yang ada di Desa Suruh. Populasidalampenelitianiniberjumlah50 petani kakao yang mempunyaiusahatanikakao. Metodepengumpulan data yang digunakanadalahmetodeobservasidanwawancara. Teknikpengolahan data meliputi editing, kodingdantabulasi data, kemudiandianalisissecaradeskriptif. Hasilpenelitianmenunjukkanbahwa kondisi non fisik yang berkaitanterhadapusahatanikakao di daerahpenelitianadalah modal, tenagakerja, transportasi, pemasaran, fasilitaskredit, teknologi, pengelolaanusahatanikakaosertaproduktivitasusahatanikakao. Produktivitaskakao di daerahpenelitianmasihrendah, haliniditunjukkandenganrendahnyaproduktivitasdanpendapatan yang diperolehdariusahatanikakao. Hasilpenelitianmenunjukkanbahwa 80% respondenhanyamemproduksikurangdari 500 kg kakaokering/tahunper 1000 m2. Pendapatanbersih yang diperolehpetanisebesarRp 12.441.600,00per 1000 m2luaslahan. Rendahnyaproduktivitasdanpendapatantersebutdisebabkankarenaadanyagangguandarihamadanpenyakit.Tingkat ekonomi rumahtanggaresponden 80% termasukdalamkategori rendah, 12% termasukdalamkategori sedang, 6% termasukdalamkategori tinggi dan 2% respondentermasukkedalamkategorisangat tinggi.

Pengaruh nilai ekuitas merek terhadap keputusan siswa SMA dalam memilih lembaga bimbingan belajar : studi pada Lembaga Pendidikan Primagama Cabang Semeru Malang / oleh Yan Maulana Hariyanti

 

Pengembangan disain instruksional menurut Dick & Carey pada sub bidang studi ekonomi kelas II caturwulan I sekolah menengan pertama (SMP) / oleh Banghkit Titik Aryani

 

Analisis terjadinya Differential Item Functioning (DIF) pada tes ulangan umum pembelajaran kimia kelas II SMA Negeri 8 Malang semester gasal 2004/2005 / oleh Ainul Mizan

 

Analisis hakekat pembangunan manusia Indonesia seutuhnya sebagai pusat orientasi pembangunan nasional
oleh Moh. Murtadho

 

Pengembangan modul dengan model pembelajaran kontekstual untuk materi pokok bahan kimia di bidang industri, pertanian, dan kesehatan untuk pembelajaran sains kimia siswa SMP kelas IX semester II / oleh Puji Sri Martini

 

Hubungan antara kematangan emosi dengan harga diri wanita pelaku pernikahan siri di desa Srambah Kecamatan Proppo Kabupaten Pamekasan / Yuniarti Habsari Ningsih

 

Kata Kunci: kematangan emosi, harga diri, pernikahan siri. Pernikahan siri merupakan pernikahan yang dilakukan berdasarkan aturan agama dan adat istiadat serta tidak dicatatkan di kantor pegawai pencatat nikah (KUA bagi yang beragama islam, kantor catatan sipil bagi non muslim). Dalam sebuah pernikahan terdapat gejolak psikologis yang terjadi didalam diri wanita seperti emosi dan harga diri. Kematangan emosi dan harga diri yang sehat sangat diperlukan untuk kokohnya sebuah rumah tangga setelah pernikahan dilakukan. Kematangan emosi seseorang ditandai oleh suatu sikap yang tenang dalam usaha menyelesaikan masalah maupun mengekspresikan perasaannya dan memiliki kontrol diri dalam emosinya serta lebih mempertimbangkan aspek logis dari pada emosinya dalam menghadapi suatu permasalahan. Sedangkan harga diri adalah penilaian individu yang ditunjukkan dalam sikapnya yang mempercayai bahwa dirinya yaitu merasa memiliki kebajikan, kompetensi, kekuatan, dan signifikansi. Tujuan dari penelitian yaitu untuk menguji hubungan antara kematangan emosi dengan harga diri wanita pelaku pernikahan siri di Desa Srambah Kecamatan Proppo Kabupaten Pamekasan. Penelitian ini menggunakan penelitian populasi. Pengumpulan data menggunakan skala kematangan emosi dan harga diri dengan analisis deskripsi dan korelasional menggunakan produck moment dengan tingkat kesalahan 5%. Hasil penelitian menunjukkan bahwa cukup banyak wanita yang memiliki kematangan emosi dengan jumlah 16 wanita. Selain itu diperoleh juga data bahwa cukup banyak wanita pelaku pernikahan siri yang memiliki harga diri tinggi yaitu 15 wanita. Hal tersebut menunjukkan adanya hubungan positif antara kematangan emosi dengan harga diri wanita pelaku pernikahan siri, sehingga semakin tinggi kematangan emosi maka semakin tinggi harga diri. Berdasarkan hasil penelitian tersebut diharapkan dapat dijadikan sebagai bahan kajian selanjutnya untuk kepentingan bimbingan konseling khususnya untuk bimbingan preventif terhadap konseli melalui kerjasama dengan berbagai pihak terkait misalnya orang tua dan masyarakat. Selain itu dapat digunakan untuk konseling keluarga sehingga rumah tangga bisa menjadi kokoh dan bahagia karena keluarga merupakan tempat pertama yang dapat memberikan warna pada anak.

Prosedur pengelolaan bidang sosial budaya oleh Badan Perencanaan Pembangunan Daerah (BAPPEDA) Kotamadya Daerah Tingkat II Malang
oleh Ade Priyono

 

Penerapan metode kooperatif model GI (Group Investigation) untuk meningkatkan kinerja dan hasil belajar biologi pokok bahasan sistem koordinasi kelas II-6 SMAN 2 Jombang / oleh Ratna Pillar Pamungkas

 

Integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi di sekolah adiwiyata (studi kasus di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan) / Wahid Fahruddin Is Purwono

 

ABSTRAK Fahruddin Is Purwono, Wahid. 2016. Integrasi Pendidikan Berwawasan Lingkungan pada Pembelajaran Ekonomi di Sekolah Adiwiyata (Studi Kasus di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan). Tesis Program Studi Pendidikan Ekonomi, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Wahjoedi, M.E. M.Pd., (II) Prof. Dr. Hj. Sri Umi Mintarti Wijaya, SE. MP. Ak. Kata kunci : integrasi, berwawasan lingkungan, pembelajaran ekonomi Integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi merupakan pembelajaran ekonomi yang pada pelaksanaannya diintegrasikan muatan berwawasan lingkungan agar peserta didik terbentuk karakter sadar dan bertanggung jawab terhadap permasalahan ekonomi dan lingkungan. Penelitian ini bertujuan untuk meneliti integrasi pendidikan lingkungan pada pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan sebagai sekolah adiwiyata yaitu sekolah yang telah melaksanakan program lingkungan hidup dengan baik. Fokus penelitian ini adalah 1) Bagaimana pemahaman guru tentang pendidikan berwawasan lingkungan melalui pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan. 2) Bagaimana proses integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan. 3) Faktor yang mempengaruhi integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan. Untuk mencapai tujuan tersebut maka penelitian ini menggunakan pendekatan kualitatif dengan pendekatan studi kasus. Sumber data dalam penelitian ini adalah Wakasek kurikulum, pembina adiwiyata, guru mata pelajaran ekonomi, dan peserta didik. Dalam pengumpulan data peneliti menggunakan teknik observasi, wawancara, dan dokumentasi. Analisis data penelitian menggunakan analisis deskriptif kualitatif. Pengecekan keabsahan data dilakukan dengan perpanjangan waktu pengamatan, triangulasi sumber data, member check dan expert opinion. Hasil Penelitian menunjukan (1) guru di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan memiliki pemahaman tentang integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi, (2) integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan dilakukan dalam perencanaan, pelaksanaan dan evaluasi pembelajaran yang disusun berlandaskan prinsip-prinsip pembelajaran yang mengarahkan pada integrasi pendidikan ekonomi berwawasan lingkungan, (3) faktor yang mempengaruhi integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan yaitu faktor pendukung dan penghambat. Faktor pendukung dari integrasi pendidikan berwawasan lingkungan pada pembelajaran ekonomi di SMA Negeri 1 Lamongan dan SMA Negeri 2 Lamongan adalah komitmen dari semua pihak baik pihak internal sekolah seperti guru maupun eksternal sekolah seperti pemerintah daerah untuk selalu mendukung pelaksanaan kegiatan yang berwawasan lingkungan. Sedangkan faktor penghambat yaitu faktor pembiayaan dan faktor gaya hidup peserta didik. Setelah mempelajari ekonomi yang terintegrasi dengan pendidikan lingkungan siswa memiliki kesadaran, sikap dan perilaku yang peduli terhadap lingkungan dalam kegiatan dan aktivitas ekonominya, misalnya kegiatan konsumsi dan produksi yang tujuannya bukan untuk memenuhi kebutuhan hidup dan memperoleh keuntungan saja, tetapi juga harus memperhatikan kelestarian lingkungan.

Teknik supervisi kepala sekolah dan hubungannya dengan sikap profesional guru SMA negeri di Pamekasan / oleh Taufiqurrahman

 

Pengaruh variasi material elektroda busi dan putaran mesin terhadap daya dan kadar emisi gas buang motor toyota tipe 4K / oleh Muhsinah

 

Hubungan antara pengelolaan kelas dan prestasi belajar siswa SMAN 8 Malang semester ganjil tahun ajaran 1991-1992
oleh Subekti Marhaenik

 

Zona sebaran populasi wereng hijau empoasca sp. (Homoptera:cicadellidae) pada tanaman teh (Camellia sinensis L.O.K.) di area kebun teh Wonosari Singosari Kabupaten Malang / Eka Corneliyawati

 

Kata kunci: zona sebaran, Empoasca sp., faktor abiotik Sebaran/distribusi adalah sebuah gerakan individu-individu atau anakanaknyakedalam atau keluar populasi. Zona sebaran merupakan area sebaran Empoasca sp. yang ditentukan berdasarkan kepadatan relatif populasi disetiap area petak klon teh dengan zona yang tersusun secara radial dan jarak antar lingkaran adalah 10 meter. Empoasca sp. merupakan hama utama pada tanaman teh. Untuk itu, perlu ada kajian tentang sebaran kepadatan relatif populasi Wereng hijau (Empoasca sp.) pada tanaman teh yang diharapkan dapat memberikan tambahan informasi untuk pertimbangan pengendalian biologis yang bersifat alami dengan membiarkan musuhmusuh alami (predator) tetap hidup. Penelitian ini bertujuan untuk (1) mengetahui sebaran kepadatan relatif populasi wereng hijau (Empoasca sp.) antar klon, zona, dan waktu pada tanaman teh (Camellia sinensis L.O.K) di area kebun teh Wonosari Singosari Kabupaten Malang, (2) mengetahui faktor abiotik yang paling menentukan sebaran kepadatan relatif populasi Empoasca sp. pada setiap klon, zona, dan waktu yang berbeda di area kebun teh. Penelitian ini merupakan penelitian deskriptif eksploratif dengan pendekatan kuantitatif. Pengambilan data dilakukan pada bulan April-Mei 2010 di kebun teh Wonosari Singosari Kabupaten Malang. Penentuan zona dan titik cuplikan dengan cara membuat zona yang sesuai dengan garis transek yang dimulai dari titik pusat sampai tepi area yang ditentukan secara sistemik. Indikator pengamatan sebaran kepadatan relatif populasi Empoasca sp. dilakukan dengan pengamatan jumlah kepadatan relatif populasi imago Empoasca sp. secara langsung pada setiap perdu tanaman teh. Faktor abiotik yang diukur meliputi kecepatan angin, kelembaban udara, suhu, dan intensitas cahaya. Untuk mengetahui faktor abiotik yang mempengaruhi sebaran kepadatan relatif populasi Empoasca sp. antar klon, zona, dan waktu pada tanaman teh dilakukan dengan analisis regresi ganda bertahap (Stepwise-backward multiple regression) dengan program SPSS. Hasil penelitian menunjukkan bahwa sebaran kepadatan relatif populasi Wereng hijau (Empoasca sp.) antara klon TRI 2024, TRI 2025, dan Assamica nilai persentase tertinggi dapat dijumpai pada klon TRI 2024 sebesar 20%. Sedangkan untuk pengamatan kepadatan relatif populasi Wereng hijau (Empoasca sp.) antar zona A, B, C dalam setiap petak klon TRI 2024, TRI 2025, dan Assamica nilai persentase tertinggi dapat dijumpai pada zona A dengan persentase sebesar 20% untuk klon TRI 2024, sedangkan klon TRI 2025 dengan persentase sebesar 17.647% dan Assamica sebesar 18.333%. Untuk pengamatan kepadatan relatif populasi Wereng hijau (Empoasca sp.) antar waktu pagi, siang, dan sore hari di area kebun teh Wonosari ii didapatkan hasil nilai persentase kepadatan relatif populasi Empoasca sp. yang tertinggi dapat dijumpai pada siang hari sebesar 43.333% pada klon Assamica. Hasil uji statistik dengan analisis regresi ganda bertahap (Stepwise-backward multiple regression) dengan program SPSS terhadap faktor abiotik menunjukkan bahwa faktor abiotik berpengaruh secara signifikan dimana pengaruh faktor lingkungan tersebut secara simultan terhadap sebaran kepadatan relatif populasi Wereng hijau (Empoasca sp.) pada setiap klon, zona, dan waktu pada tanaman teh di area kebun teh Wonosari Singosari Kabupaten Malang. Sedangkan sumbangan faktor abiotik yang paling menentukan terhadap sebaran kepadatan relatif populasi Wereng hijau (Empoasca sp.) pada klon TRI 2024 adalah kecepatan angin (R2 total = 7,4% dan r2 parsial= 0,3776%), untuk klon TRI 2025 adalah kecepatan angin (R2 total = 4,9% dan r2 parsial = 0,4301%), sedangkan untuk klon Assamica adalah kelembaban udara (R2 total = 3,7% dan r2 parsial = 0,1239%). Sedangkan sumbangan faktor abiotik terhadap sebaran kepadatan relatif populasi Wereng hijau (Empoasca sp.) pada zona A adalah kelembaban udara (R2 total = 5,6% dan r2 parsial = 0,3198%), zona B adalah intensitas cahaya (R2 total = 3,1% dan r2 parsial = 0,1363%), dan pada zona C adalah kecepatan angin (R2 total = 5,0% dan r2 parsial = 0,2553%). Sumbangan faktor abiotik terhadap kepadatan relatif populasi Wereng hijau (Empoasca sp.) pada pagi hari adalah intensitas cahaya (R2 total = 6,9% dan r2 parsial = 0,2913%), pada siang hari adalah intensitas cahaya (R2 total = 2,9% dan r2 parsial = 0,2412%), dan pada sore hari adalah intensitas cahaya (R2 total = 6,0% dan r2 parsial = 0,3937%).

Pengembangan model pembelajaran proyek bidang studi geografi menurut paradigma konstruktivisme / oleh Amar Ma'ruf

 

Internalisasi nilai-nilai kewirausahaan: studi fenomenologi di SMA Selamat Pagi Indonesia Batu / Prayogo Richi Noveris Mianto

 

ABSTRAK Mianto, Prayogo Richi Noveris. 2016. Internalisasi Nilai-Nilai Kewirausahaan Studi Fenomenologi Di SMA Selamat Pagi Indonesia Batu. Tesis. Jurusan Pendidikan Ekonomi, Program Pascasarjana Universitas Negeri Malang. Pembimbing : (I) Dr. Sunaryanto M, Ed., (II) Prof. Dr. Sri Umi Mintarti Widjaja, M,Ak Keywords : nilai, kewirausahaan, sekolah menengah atas Banyak diakui bahwa kewirausahaan (entrepreneur) memiliki peranan penting karena berkontribusi terhadap pemerintah, dunia usaha maupun masyarakat secara luas. Kewirausahaan dapat mendorong pertumbuhan ekonomi sekaligus penyediaan lapangan pekerjaan baru melahirkan kreativitas serta dapat meningkatkan daya saing atau nilai tambah bagi masyarakat, serta terjadinya peningkatan produktivitas Dengan demikian maka Indonesia perlu meningkatkan jumlah wirausahawan agar dapat menjadi negara maju dan mampu bersaing dalam MEA. Upaya peningkatan jumlah wirausaha dapat dilakukan dengan penanaman nilai-nilai kewirausahaan melalui pembelajaran kewirausahaan. Haryati (2014:67) mengatakan bahwa pembelajaran kewirausahaan mampu membentuk perilaku wirausaha dan jiwa kepemimpinan dalam keterkaitannya dengan pengelolaan usaha untuk membekali siswa agar mampu berusaha sendiri. Penelitian di SMA Selamat Pagi Indonesia Batu ini bertujuan melihat proses internalisasi nilai-nilai kewirausahaan pada siswa dengan melihat (1) pemahaman dan komitmen guru/ pengelola dalam memaknai kewirausahaan ; (2) implementasi rangkaian proses internalisasi nilai-nilai kewirausahaan pada peserta didik yang dilakukan guru meliputi aspek perencanaan (pembuatan RPP), aspek proses pembelajaran, dan aspek evaluasi; (3) peran lingkungan dan organisasi (sekolah) dalam mendukung proses pembelajaran dalam upaya internalisasi nilai-nilai kewirausahaan pada siswa. Dengan fokus penelitian yang didasarkan pada pengalaman guru dan pembimbing kewirausahaan, maka penelitian ini dilakukan dengan pendekatan kualitatif fenomenologi. Dari hasil penelitian didapatkan bahwa guru dan pembimbing memaknai pembelajaran kewirausahaan sebagai proses menemukan bakat siswa dan menanamkan nilai-nilai kewirausahaan, yakni kreatif, inovatif, disiplin, percaya diri, konsisten, tidak mudah putus asa, berani mengambil resiko, memiliki jiwa kepemimpinan, dan komunikatif. Melalui pemahaman tersebut, guru dan pembimbing menuangkannya dalam perencanaan, mengimplementasikannya dalam proses pembelajaran, dan juga melakukan evaluasi. Terdapat peran dan dukungan dari pihak yayasan dan sekolah terhadap pembelajaran kewirausahaan dalam upaya internalisai nilai-nilai kewirausahaan. Peran dan dukungan tersebut berupa penyediaan sarana dan prasarana pembelajaran, kebijakan yang mendukung proses pembelajaran, dan pemberian apresiasi bagi siswa.

Pengaruh layanan usaha terhadap partisipasi anggota di bidang usaha pada KPRI Kandepag Kabupaten Malang / oleh Rochani Ningsih

 

Hubungan antara efektifitas kerja manajer (pengelola) dengan pengembangan usaha KUD di Kabupaten Tulungagung
oleh Ida Nuryanti

 

Perbedaan motivasi mengajar guru senior dan junior di Sekolah Menengah Atas Negeri (SMAN) Kota Tuban / Tya Widya Sari

 

Kata kunci: motivasi mengajar guru, Sekolah Menengah Atas Negeri (SMAN) Motivasi adalah dorongan dasar yang menggerakkan tingkah laku seseorang untuk mencapai tujuan tertentu. Mengajar yaitu kegiatan guru membimbing dan mendorong murid memperoleh pengalaman yang berguna bagi perkembangan semua potensi yang dimilikinya semaksimal mungkin. Sedangkan motivasi mengajar guru yakni kesadaran yang dimiliki guru dalam melaksanakan tugas-tugasnya tanpa ada unsur keterpaksaan menjalani tugas. Mengingat saat ini mutu pendidikan terus ditingkatkan, maka setiap guru dituntut aktif dalam bekerja. Untuk itu guru harus mempunyai motivasi dalam kegiatan mengajarnya. Guru yang tidak mempunyai motivasi, maka siswanya pun tidak ada gairah dalam belajar. Sebaliknya, jika guru mempunyai motivasi yang tinggi, maka siswa akan semangat terhadap pelajaran yang diterima, mempunyai motivasi untuk belajar dan berprestasi. Masalah yang diteliti, meliputi: (1) Seberapa tingkat motivasi mengajar guru SMAN Kota Tuban, (2) Seberapa tingkat faktor motivasional dan higiene pada motivasi mengajar guru SMAN Kota Tuban, dan (3) Adakah perbedaan motivasi mengajar guru senior dan guru junior SMAN Kota Tuban. Penelitian ini merupakan penelitian deskriptif komparatif, dengan populasi guru SMAN Kota Tuban yang berjumlah 187 orang terbagi menjadi 119 orang guru senior dan 68 orang guru junior. Penentuan sampel diambil dengan menggunakan pedoman tabel Krejcie dan Morgan sehingga diperoleh sampel sebanyak 128 orang yang terbagi menjadi 79 orang guru senior dan 49 orang guru junior. Pengambilan sampel menggunakan teknik random sampling dengan tujuan tidak membedakan subjek yang diteliti. Instrumen yang digunakan dalam penelitian ini adalah angket (kuesioner). Angket penelitian ini diukur dengan menggunakan skala Likert yang kemudian diolah menjadi MSI. Pengujian validitas angket menggunakan rumus Product Moment Pearson sedangkan untuk menguji reliabilitas angket digunakan rumus Alpha Cronbach. Teknik analisis data yang digunakan yaitu analisis statistik deskriptif dan analisis komparatif. Kesimpulan penelitian yang diperoleh: (1) tingkat motivasi mengajar guru SMAN Kota Tuban tergolong dalam klasifikasi sangat tinggi. Karena guru mempunyai peranan penting dalam pencapaian keberhasilan proses belajarmengajar, guru harus mempunyai motivasi yang baik dalam melaksanakan tugas mengajarnya agar siswa dapat menerima pelajaran dengan mudah dan timbul motivasi belajar siswa secara intrinsik, (2) faktor motivasional pada guru SMAN Kota Tuban cenderung pada faktor kemajuan dengan rata-rata paling tinggi, yang mencakup adanya usaha guru dalam mengembangkan pengetahuannya, adanya peluang bagi guru untuk menduduki suatu jabatan dan menambah pengetahuan ii seperti mengikuti seminar, diklat, melanjutkan pendidikan ke jenjang yang lebih tinggi, dan sebagainya, sikap guru berusaha melakukan yang terbaik dalam tugas mengajarnya, terdorong untuk mengup-date sistem mengajar terbaru agar siswa tidak jenuh dan terdapat variasi dalam mengajar, variasi dalam sumber bahan pustaka, serta tidak ada kesulitan dalam meningkatkan pengetahuan sehingga guru lebih mempunyai motivasi intrinsik karena ada jalan bagi pemenuhan kebutuhannya. Kemudian kedua adalah, faktor tanggung jawab, prestasi, pengakuan, dan sifat pekerjaan sedangkan faktor higiene pada guru SMAN Kota Tuban terletak pada faktor hubungan antar pribadi kemudian supervisi, gaji, kondisi kerja, serta banyak dikeluhkan pada faktor kebijakan organisasi dan administrasi yang tidak memuaskan guru, karena pimpinan tidak memberikan kesempatan bagi guru untuk mengatur pekerjaannya sendiri dan beratnya beban tugas baik beban mengajar maupun selain tugas mengajar, dan (3) Tidak ada perbedaan motivasi mengajar antara guru senior dan junior karena mempunyai rata-rata yang sama tinggi. Kesimpulannya adalah baik guru senior maupun guru junior sama-sama mempunyai motivasi yang tinggi dalam melaksanakan tugas mengajarnya. Berdasarkan kesimpulan penelitian, maka saran ditujukan kepada: (1) bagi guru, hendaknya mempertahankan faktor motivasional yang sudah tinggi dan meningkatkan rasa cinta terhadap pekerjaan karena faktor sifat pekerjaan mempunyai nilai yang paling rendah. Sebagai tenaga pendidik, rasa cinta terhadap pekerjaan ini sangat penting karena dari sinilah seseorang akan melaksanakan pekerjaannya dengan rasa penuh tanggung jawab, (2) bagi kepala sekolah, perlu diperhatikan pada faktor kebijakan organisasi dan administrasi (faktor higiene) yang membuat ketidakpuasan kerja guru dan dapat mengakibatkan menurunnya motivasi serta kinerja guru dalam mengajar. Faktor hubungan antar pribadi tetap dipertahankan, agar guru merasa nyaman menjalin komunikasi dengan orangorang yang berada di lingkungan sekolah, dan (3) bagi Ketua Jurusan Administrasi Pendidikan, hendaknya mengembangkan mata kuliah manajemen sumber daya manusia khusunya pada peningkatan motivasi kerja, dan (4) bagi peneliti lain, dapat dijadikan acuan peneliti yang ingin mengembangkan jenis penelitian ini dengan responden, variabel, serta tempat yang berbeda. Sehingga dapat memperkaya referensi di Jurusan Administrasi Pendidikan.

Hubungan antara pendidikan dan latihan (Diklat) manajer dengan keberhasilan usaha Koperasi Unit Desa (KUD) se Kabupaten Malang
oleh Program Studi Pendidikan Koperasi

 

Study diskriptif korelatif mengenai teknik pembinaan pendidikan oleh kepala sekolah dengan kualitas mengajar guru SDN / oleh Puji Hastutie

 

Pengaruh iklim motivasional berorientasi tugas terhadap motivasi intrinsik, displin diri dan kemampuan motorik siswa / Anung Priambodo

 

ABSTRAK Priambodo, Anung. 2015. Pengaruh Iklim Motivasional Berorientasi Tugas Terhadap Motivasi Instrinsik, Disiplin Diri dan Kemampuan Motorik Siswa. Disertasi. Program Studi Psikologi Pendidikan, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Marthen Pali, M.Psi, (II) Dr. Dany M. Handarini, M.A., (III) Dr. Wasis D. Dwiyogo, M.Pd Kata Kunci: iklim motivasional berorientasi tugas, motivasi instrinsik, disiplin diri, kemampuan motorik, Motivasi intrinsik dan disiplin diri merupakan faktor yang memberi energi dan daya tahan untuk meraih prestasi. Pendidikan jasmani adalah mata pelajaran yang bertujuan meningkatkan potensi fisik, nilai-nilai sportifitas dan budaya hidup sehat. Banyaknya suasana kompetisi dan komparasi antar siswa dalam pendidikan jasmani menimbulkan kecemasan dan ketidaknyamanan pada beberapa siswa yang tidak memiliki kemampuan motorik yang baik. Untuk itu, perlu adanya suatu iklim pembelajaran yang lebih memicu munculnya motivasi intrinsik dan disiplin diri. Penelitian ini bertujuan melihat pengaruh iklim motivasional berorientasi tugas terhadap motivasi instrinsik, disiplin diri dan kemampuan motorik siswa dalam pendidikan jasmani. Penelitian eksperimen ini menggunakan rancangan pre and posttest quasy experimental design. Jumlah subyek penelitian sebanyak 65 siswa kelas VIII diambil dengan teknik purposive sampling terbagi dalam dua kelompok yaitu 32 siswa kelompok eksperimen dengan iklim motivasional berorientasi tugas dan 33 siswa sebagai kelompok kontrol dengan pembelajaran penjasorkes yang biasa dilakukan. Iklim motivasional berorientasi tugas diawali dengan membimbing siswa membuat target hasil belajar secara individual sesuai kemampuan siswa, kemudian memberikan pilihan kegiatan pembelajaran untuk mencapai target tersebut, memotivasi siswa untuk memilih cara belajar (latihan) yang paling sesuai, dan menilai keberhasilan belajar berdasar target dan upaya yang sudah dilakukan, tanpa membandingkan dengan siswa lain. Perlakuan diberikan selama 12 kali pertemuan pada semester gasal 2013/2014. Instrumen utama pengumpul data menggunakan kuesioner yang telah divalidasi, kemudian metode dokumentasi dan wawancara juga digunakan untuk menganalisis proses pelaksanaan perlakuan. Berdasar hasil analisis uji beda selisih (gain score) dan uji manova membuktikan bahwa: (1) iklim motivasional berorientasi tugas memengaruhi motivasi instrinsik siswa (2) iklim motivasional berorientasi tugas memengaruhi disiplin diri siswa (3) iklim motivasional berorientasi tugas memengaruhi kemampuan motorik siswa (4) iklim motivasional berorientasi tugas memengaruhi secara menyeluruh terhadap motivasi instrinsik, disiplin diri dan kemampuan motorik siswa. Berdasarkan hasil tersebut, maka disarankan bahwa untuk meningkatkan motivasi intrinsik dan disiplin diri siswa, sebaiknya digunakan iklim motivasional berorientasi tugas.

Hubungan iklim organisasi, masa kerja, dan prestasi kerja karyawan bagian operator mesin jahit PT. Rasindo Indah Ngoro Mojokerto / oleh Titi Nurwati

 

Hubungan antara faktor-faktor geografis dan demografis dengan minat melanjutkan sekolah ke SMTP bagai anak usia 13-15 tahun di wilayah Kecamatan Bantur, Kabupaten Malang / oleh Indayan Budi L. Sir

 

Persepsi mahasiswa Universitas Negeri Malang terhadap kualitas layanan referensi di UPT Perpustakaan Universitas Negeri Malang / Faisal Mulana

 

ABSTRAK Maulana, Faisal. 2015. Persepsi Mahasiswa Universitas Negeri Malang terhadap Kualitas Layanan Referensi di UPT Perpustakaan Universitas Negeri Malang. Tugas Akhir, D3 Perpustakaan Fakultas Sastra Universitas Negeri Malang. Pembimbing (I): Dr. Titik Harsiati, M.Pd, Pembimbing (II): Drs.Moh. Asrukin, M.Si. Kata Kunci: persepsi, mahasiswa, layananreferensi, UPT PerpustakaanUniversitasNegeri Malang. Perpustakaanmerupakansalahsatubagian yangsentraldalamsebuahperguruantinggi.UPT PerpustakaanUniversitasNegeri Malang merupakanperpustakaan yang menyediakanlayananreferensi.MahasiswaUniversitasNegeri Malang sebagaipenggunalayananreferensitentumemilikipersepsitersendiriterhadaplayananreferensidi UPT PerpustakaanUniversitasNegeri Malang.PenelitianinibertujuanuntukmengetahuipersepsimahasiswaUniversitasNegeri Malang terhadaplayananreferensi di UPT PerpustakaanUniversitasNegeri Malang yang mencakuppersepsimahasiswaterhadapfasilitaslayananreferensi, pustakawan, koleksi, danprosedur yang berlaku di layananreferensi. Penelitianinimenggunakanmetodedeskriptifkuantitatif.Data daritugasakhiriniberupapersepsimahasiswaUniversitasNegeri Malang terhadaplayananreferensi di UPT PerpustakaanUniversitasNegeri Malang.Pengumpulan data dilakukandenganteknikkuesionerdanpengamatanterlibat.Instrumen yang digunakanadalahpedomankuesionerdanpedomanpengamatanterlibat.Teknikanalisis data yang digunakanadalahanalisis statistik dengan metode deskriptif. Hasildaritugasakhirinimenunjukkan (1) persepsimahasiswaUniversitasNegeri Malang terhadapfasilitas di layananreferensi UPT PerpustakaanUniversitasNegeri Malang menunjukkan, 83 orang (83%) menyatakan nyamanmembaca pada tempat yang telah disediakan di layananreferensi, 59 orang (59%) menyatakan koleksi yang terdapat pada OPAC tidak tersedia di rakkoleksi(2) persepsimahasiswaUniversitasNegeri Malang terhadappustakawan di UPT PerpustakaanUniversitasNegeri Malang menunjukkan,83 orang (83%) menyatakan pustakawanmemberikaninformasiterkaitdenganfotokopikoleksisecaratepatkepadamahasiswa, 35 orang (35%)menyatakanpustakawanreferensitidakramah(3) persepsimahasiswaUniversitasNegeri Malang terhadapkoleksi di layananreferensi UPT PerpustakaanUniversitasNegeri Malang menunjukkan,73 orang (73%) menyatakan lembar yang boleh difotokopi pada karya ilmiahcukupdalammemberikan informasibagi kebutuhan mahasiswa, 32 orang (32%).menyatakankoleksilayananreferensitidakmutakhir(4) persepsimahasiswaUniversitasNegeri Malang terhadapprosedur di layananreferensi UPT PerpustakaanUniversitasNegeri Malang menunjukkan, 76 orang (76%) menyatakan nyamansaatharus mengisi daftar presensi, 45 orang (45%) menyatakan sulit meminjam koleksikaryailmiah yang berada di gudang

Penggunaan metode kerja kelompok untuk meningkatkan prestasi belajar ilmu pengetahuan sosial siswa kelas V SDN Tegalweru Kecamatan Dau Kabupaten Malang / Donna Sutrisna

 

Kata kunci : kerja kelompok, IPS, hasil belajar Salah satu disiplin ilmu yang diajarkan di sekolah dasar dan erat kaitannya dengan masalah kehidupan sosial dan lingkungan masyarakat di sekitar siswa adalah mata pelajaran Ilmu Pengetahuan Sosial. Di SDN Tegalweru Kecamatan Dau Kabupaten Malang, pembelajaran Ilmu Pengetahuan sosial masih saja cenderung pada metode pembelajaran klasik, yaitu metode ceramah yang kegiatan pembelajarannya hanya didominasi oleh guru, pembelajaran yang kurang berorientasi pada siswa, siswa hanya mendengarkan, mencatat dan melakukan kegiatan sesuai perintah guru yang menyebabkan siswa pasif dan tidak mempunyai kesempatan untuk mengembangkan kecakapan berpikir. Frekuensi penggunaan metode ceramah, pemberian tugas dan tanya jawab terlalu mendominasi. Dari hasil PreTest (tindakan awal/tes awal) yang telah diberikan kepada 29 anak (tes diberikan secara individu), maka dapat diketahui data siswa yang mengalami kesulitan belajar, sebesar 72,4% (21 anak) mendapat nilai di bawah 70, sisanya 27,6% (8 anak) memperoleh nilai diatas 70 dengan nilai rata-rata kelas 56,72. Untuk mengarah pada perubahan yang lebih baik dalam pembelajaran Ilmu Pengetahuan Sosial di SDN Tegalweru Kecamatan Dau Kabupaten Malang, maka peneliti mencoba dengan menerapkan metode kerja kelompok, dengan tujuan untuk meningkatkan prestasi belajar siswa. Penelitian ini menggunakan pendekatan kualitatif dengan jenis PTK, model Kemmis & Taggart. Penelitian tindakan kelas ini dilaksanakan dalam dua siklus yang masing-masing siklus terdiri dari perencanaan, pelaksanaan, observasi dan refleksi, dengan instrumen penelitian wawancara, tes dan dokumentasi. Subyek penelitian ini adalah siswa kelas V SDN Tegalweru Kecamatan Dau Kabupaten Malang. Data yang dianalisis adalah data tentang kemampuan guru melaksanakan pembelajaran dengan menggunakan kerja kelompok, tingkat pemahaman siswa terhadap konsep Jenis Usaha dan Kegiatan Ekonomi di Indonesia yang diukur dari aspek kognitif yang berupa soal pre-test dan post-tes, aktivitas siswa serta tingkat keberhasilan siswa yang diukur dari pengamatan keseharian siswa di lingkungan sekolah selama siklus I dan siklus II. Hasil penelitian menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan metode kerja kelompok dapat meningkatkan prestasi belajar IPS siswa kelas V SDN Tegalweru. Hal ini terbukti dengan meningkatnya nilai rata-rata kelas sebelum menggunakan metode kerja kelompok adalah 56.72. Setelah peneliti menerapkan metode kerja kelompok, pada siklus I, rata-rata hasil belajar siswa di kelas mengalami peningkatan, yaitu menjadi 71.20, atau mengalami peningkatan 44.83%. Pada penerapan metode kerja kelompok siklus II, rata-rata hasil belajar siswa meningkat menjadi 84.13, atau mengalami peningkatan 24.19%. Siswa yang mengalami ketuntasan belajar individu adalah sebanyak 28 siswa (96.6%) dan siswa yang belum mengalami tuntas belajar sebanyak 1 siswa (3.4%). Ketuntasan belajar kelas sudah tercapai karena ketuntasan belajar individu telah mencapai 80% dari jumlah siswa. Berdasarkan hasil penelitian dapat disimpulkan bahwa penggunaan metode kerja kelompok dapat meningkatkan hasil belajar Ilmu Pengetahuan Sosial siswa SDN Tegalweru Kecamatan Dau Kabupaten Malang. yang ditandai dengan meningkatnya hasil belajar siswa (aspek kognitif), metode kerja kelompok juga mampu meningkatkan aspek afektif dan aspek psikomotor siswa. Hal ini terbukti dengan meningkatnya kerjasama, keberanian dan kedisiplinan siswa dalam pembelajaran. Dari penelitian yang telah dilaksanakan, saran yang diharapkan dapat menjadi rekomendasi dalam upaya meningkatkan mutu pendidikan di SD, khususnya pada mata pelajaran Ilmu Pengetahuan Sosial yaitu, hendaknya guru dapat menerapkan dan mengembangkan metode pembelajaran kerja kelompok pada pembelajaran IPS kedalam kompetensi atau tema-tema yang lain dan pembelajaran hendaknya dilaksanakan dengan memberi kesempatan kepada siswa untuk terlibat langsung dalam proses pembelajaran. Bagi sekolah, hasil penelitian ini diharapkan dapat menjadi pertimbangan dalam upaya memperbaiki pembelajaran di SDN Tegalweru Kecamatan Dau Kabupaten Malang. Serta bagi Dinas Pendidikan, hendaknya selalu memberikan bimbingan terhadap guru tentang pemilihan strategi dan metode dalam pembelajaran Bahasa Indonesia yang sesuai, serta selalu memberikan kesempatan kepada

Pembagian warisan menurut hukum adat di desa Puru Kecamatan Karangan Kabupaten Trenggalek
oleh Sukarni

 

Pengembangan media pembelajaran interaktif kompetensi dasar memasang instalasi penerangan 1 fasa pada mata pelajaran kompetensi kejuruan kelas X Teknik Instalasi Tenaga Listrik di SMK Negeri 1 Blitar / Wisnu Laksono

 

ABSTRAK Laksono, Wisnu. 2015.Pengembangan Media Pembelajaran InteraktifKompetensi Dasar Instalasi Penerangan 1 Fasa pada Mata Pelajaran Kompetensi Kejuruan Kelas X Teknik Instalasi Tenaga Listrik di SMK Negeri 1 Blitar. Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs. Suwasono, M.T., (2) Dr.Eng. Siti Sendari, S.T., M.T., Kata Kunci: Media pembelajaran interaktif, Adobe Flash CS3, Instalasi penerangan 1 fasa. Penelitian ini merupakan penelitian pengembangan yang bertujuan untuk menghasilkan media pembelajaran Kompetensi Kejuruan dengan materi instalasi penerangan listrik 1 fasa untuk memfasilitasi kemampuan pemecahan masalah siswa SMKNegeri 1 Blitar menggunakan Adobe Flash CS3. Penelitian ini juga bertujuan untuk mengetahui tingkat kelayakan media pembelajaran instalasi penerangan 1 fasa dengan menggunakan Adobe Flash CS3. Penelitian pengembangan media pembelajaran instalasi penerangan 1 fasa menggunakan Adobe Flashini melalui 5 tahap yaitu: (1) Analisis kebutuhan; (2) Desain; (3) Pengembangan; (4) Implementasi; dan (5) Evaluasi.Subyek dalampenelitian ini berjumlah 6 siswa untuk uji coba kelompok kecil dan 28 siswauntuk uji coba kelompok besar jadi jumlah keseluruhan subyek penelitian padapenelitian ini sejumlah 34 siswa kelas X Teknik Instalasi Tenaga Listrik di SMKN 1 Blitar. Hasil dari penelitian ini berupa sebuah produk media pembelajaran berbasisAdobe Flash yang sesuai dengan materi dalam silabus dan RPP yang di terapkan di SMK Negeri 1 Blitar. Kemudian penelitian ini juga bertujuan untuk mengetahui kelayakan media pembelajaran yang digunakan baik dari segi pembelajaran, isi, dan tampilan. Uji coba produk perlu dilakukan untuk mengetahui kelayakan produk media pembelajaran yang dihasilkan agar sesuai dengan kelayakannya. Hasil ujicoba media pembelajaran secara keseluruhan responden, dari pakarmedia menyatakan 86,9 % dengan kriteria sangat valid, dari ahli materi 1 menyatakan 90,6 % dan ahli materi 2 menyatakan 87,5% dengan kriteria sangat valid, dari siswa menyatakan 89,7% untuk kelas TITL 1 dan 83,9% untuk kelas TITL 2 dengan kriteria sangat valid. Hasil ujicoba kepada seluruh responden media pembelajaran instalasi penerangan 1 fasaini layak digunakan sebagai media pembelajaran di SMK dan telah memenuhi indikator keberhasilan yang layak dan efektif serta memberikan dampak yang positif terhadap pembelajaran instalasi penerangan 1 fasa. Oleh karena itumedia ini dapat digunakan siswa alternatif sumber belajar, bagi guru sebagai alternatifmedia pembelajaran, dan bagi pengembang lain sebagai masukan dalam melakukan pengembangan media pembelajaran untuk materi lainnya.

Penerapan prinsip-prinsip belajar orang dewasa dalam pelatihan bisnis Multi Level Marketing (MLM) : studi kasus MLM High Desert Jalan Kunir No. 1 Malang / oleh Endah Lukitaningsih

 

Pentingnya kesadaran hukum warga negara dalam menunjang stabilitas politik nasional bangsa / oleh Sufa'at

 

Pengaruh kualitas layanan terhadap kepuasan nasabah bank syariah Mandiri Cabang Pasuruan / Erike Youlandha

 

Kata kunci: kualitas layanan, kepuasan nasabah Saat ini perbankan syari'ah telah memasuki persaingan berskala global, merupakan suatu tantangan yang harus dihadapi dan ditangani oleh bank syari'ah untuk dapat memberikan kontribusi dalam pembangunan bangsa melalui pemberdayaan ekonomi umat. Demikian pula dengan bisnis perbankan, merupakan bisnis yang berdasarkan pada azas kepercayaan, masalah kualitas layanan (service quality) menjadi faktor penting dalam menentukan keberhasilan bisnis ini. Sehingga ketika bank syari'ah yang selama ini dirindukan kehadirannya ternyata pelayanannya tidak sesuai syari'ah Islam maka akan berakibat merugikan bank itu sendiri dan menghilangkan kepercayaan masyarakat terhadap bank syari'ah. Oleh karena itu persaingan akan sangat dipengaruhi oleh kemampuan bank memberikan pelayanan terbaik yang bermutu dibandingkan pesaingnya. Tujuan dari penelitian ini adalah ingin mengetahui variabel-variabel kualitas layanan yang mempengaruhi kepuasan nasabah. Penelitian ini mempuyai dua variabel , yaitu variabel bebas (X) dan variabel terikat (Y). Variabel bebas (X) terdiri dari sub variabel, yaitu keandalan (X1), daya tanggap (X2), jaminan (X3), empati (X4) dan bukti fisik (X5) sedangkan variabel terikatnya (Y) adalah kepuasan nasabah. Penelitian ini merupakan penelitian deskriptif dan kausalitas. Penelitian ini berusaha untuk menjelaskan pengaruh kualitas layanan secara parsial maupun secara simultan terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan, serta untuk mengetahui variabel kualitas layanan mana yang paling dominan mempengaruhi kepuasan nasabah. Populasi dalam penelitian ini adalah nasabah Bank Syariah Mandiri Cabang Pasuruan. Sedangkan sampel dalam penelitian ini adalah 73 responden. Sampel diambil dengan menggunakan teknik Accidental Sampling. Pengambilan jumlah sampel tersebut karena keterbatasan penulis dalam hal tenaga, biaya dan waktu. Hasil penelitian ini menyimpulkan bahwa: (1) ada pengaruh positif yang signifikan keandalan secara parsial terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan dengan nilai B=0,345; thitung=3,801; dan Sig t=0,000; (2) tidak ada pengaruh positif yang signifikan daya tanggap secara parsial terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan dengan nilai B=-0,113; thitung=-1,265; dan Sig t=0,210; (3) tidak ada pengaruh positif yang signifikan jaminan secara parsial terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan dengan nilai B=0,004; thitung=0,043; dan Sig t=0,966; (4) ada pengaruh positif yang signifikan empati secara parsial terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan dengan nilai B=0,554; thitung=8,068; dan Sig t=0,000; (5) ada pengaruh positif yang signifikan bukti fisik secara parsial terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan dengan nilai B=0,355; thitung=3,871; dan Sig t=0,000; (6) terdapat pengaruh positif yang signifikan keandalan, daya tanggap, jaminan, empati dan bukti fisik secara simultan terhadap kepuasan nasabah Bank Syariah Mandiri Cabang Pasuruan dengan nilai Fhitung =35,351; Ftabel=2,38; Sig. F=0,000; R=0,852; R square =0,725; dan Adjusted R Square=0,705. Dari hasil penelitian juga disimpulkan bahwa variabel empati memiliki pengaruh paling dominan terhadap kepuasan nasabah. Berdasarkan penelitian ini, dapat disarankan agar Bank Syariah Mandiri Cabang Pasuruan dalam memberikan layanan perlu memperhatikan hal-hal yang dapat mempengaruhi kepuasan nasabah terutama pada variabel daya tanggap dan jaminan.

Pelaksanaan hak asasi manusia bagi terpidana di Lembaga Pemasyarakatan Wanita Malang / oleh Eny Kusmiyatin

 

Pengaruh strategi pembelajaran reading questioning and answering (RQA) dipadu student team achivment division (STAD) terhadap kemampuan berpikir kritis dan kemampuan metakognitif di MTs Negeri Rejosa Kab. Pasuruan / Nina Zunaidah

 

ABSTRAK Zunaidah, Nina. 2014. Pengaruh Strategi Pembelajaran Reading Questioning and Answering (RQA) Dipadu Student Team Achievment Division (STAD) Terhadap Kemampuan Berpikir Kritis Dan Kemampuan Metakognitif Di MTs Negeri Rejoso Kab.Pasuruan, Tesis. Program Studi Pendidikan Biologi, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (1). Prof. Dr. Aloysius Duran Corebima, M.Pd (2). Dr. H. Hadi Suwono, M.Si Kata Kunci: RQA, STAD, Kemampuan Berpikir Kritis, Kemampuan Metakognitif Keterampilan berpikir kritis merupakan suatu karakteristik yang perlu dikembangkan di sekolah pada setiap jenjangnya, meskipun jarang diajarkan oleh guru di kelas baik secara eksplisit maupun implisit. Berpikir kritis merupakan suatu kompetensi yang harus dilatihkan pada peserta didik. Hubungan ketrampilan metakognisi dengan berpikir kritis dari komponen Self-regulation. Self regulation merupakan salah satu komponen berpikir kritis. Self regulation merupakan salah satu komponen berpikir kritis. Tujuan penelitian yang ingin dicapai dalam penelitian ini adalah sebagai berikut: 1) Menganalisa pengaruh strategi pembelajaran Reading Questioning and Answering (RQA) dipadu Student Team Achievment Division (STAD) terhadap kemampuan berpikir kritis di MTsN Rejoso Kabupaten Pasuruan. 2) Menganalisa pengaruh strategi pembelajaran Reading Questioning and Answering (RQA) dipadu Student Team Achievment Division (STAD) terhadap kemampuan metakognitif di MTsN Rejoso Kabupaten Pasuruan. Hasil penelitian mengungkapkan bahwa: tidak ada pengaruh strategi pembelajaran terhadap kemampuan berpikir kritis, namun pada strategi pembelajaran RQA dipadu STAD berpengaruh signifikan terhadap kesadaran metakognitif inventori MAI dan ketrampilan metakognitif dengan rubrik. Peningkatan kesadaran metakognitif inventori MAI siswa mengalami peningkatkan sebesar 4,02% lebih tinggi daripada strategi konvensional dibandingkan dengan menggunakan pembelajaran konvensional sebesar 3,86%. Pada ketrampilan metakognitif mengalami kenaikan ketrampilan metakognitif siswa dengan rubrik yang diajar dengan RQA dipadu STAD lebih tinggi 123,2 % dibandingkan menggunakan pembelajaran konvensional 55,2 % . Bertitik tolak dari temuan penelitian ini, beberapa saran yang dapat diajukan oleh peneliti adalah 1) Perlu dilakukan penelitian berikutnya terkait dengan strategi pembelajaran yang lain misal paduan RQA dengan tipe kooperatif lainnya. 2).Variabel terikat yang sudah diteliti dalam penelitian ini terbatas pada hasil belajar yang meliputi: kemampuan berpikir kritis dan kemmapuan metakognitif. Perlu dilakukan penelitian untuk jenis hasil belajar lainnya misalnya hasil belajar kognitif, retensi atau kemampuan akademik bawah atau akademik atas. 3). Perlu dilaksanakan penelitian yang memadukan strategi-strategi pembelajaran berbasis konstruktivisme berbasis student centered selain RQA dipadu STAD 4).Penelitian ini dilakukan satu semester, kalau memungkinkan perlu dilakukan penelitian dalam kurun waktu lebih lama lagi untuk memperoleh hasil yang lebih baik, terutama dalam pengembangan kemampuan berpikir kritis dan kemampuan metakognitif.

Peran kepala sekolah dalam implementasi manajemen berbasis sekolah (studi kasus di Sekolah Dasar Negeri Pandanwangi 1 Malang) / Siti Mistrianingsih

 

Mistrianingsih, Siti. 2015. Peran Kepala Sekolah dalam Implementasi Manajemen Berbasis Sekolah (Studi Kasus di Sekolah Dasar Negeri Pandanwangi 1 Malang). Skripsi, Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Ali Imron, M. Pd, M. Si, (II) Ahmad Nurabadi, S. Pd, M. Pd. Kata kunci: peran, kepala sekolah, implementasi, manajemen berbasis sekolah     Manajemen Berbasis Sekolah (MBS) dapat menjadikan peran para kepala sekolah sangat penting dalam meningkatkan kualitas lembaga pendidikan, tenaga kependidikan, input, serta output sekolah. Dengan adanya MBS, sebuah lembaga pendidikan memiliki otonomi pengelolaan terhadap substansi-substansi manajemen pendidikan. Munculnya MBS di beberapa negara memiliki latar belakang yang berbeda-beda, antara lain sistem pendidikan. Pada tahun 1960 hingga 1970 ada pengenalan kurikulum baru dan pendekatan metode pengajaran baru, akan tetapi hasilnya tidak memenuhi tujuan dalam meningkatkan kualitas pendidikan.     Fokus penelitian yaitu: (1) Implementasi MBS di SDN Pandanwangi 1 Malang, (2) Peran kepala sekolah dalam implementasi MBS di SDN Pandanwangi 1 Malang, dan (3) Faktor pendukung dan penghambat peran kepala sekolah dalam implementasi MBS di SDN Pandanwangi 1 Malang. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Penelitian ini, peneliti merupakan satu-satunya pengumpul data dan melakukan beberapa teknik pengumpulan data di dalam proses penelitian. Pengumpulan data dilakukan dengan metode observasi partisipan, wawancara, dan dokumentasi. Teknik pengecekan keabsahan data yang digunakan dalam penelitian ini adalah triangulasi sumber, teknik, dan waktu. Peneliti melakukan analisis data, yaitu pengumpulan data, reduksi data, penyajian data, dan verifikasi data/kesimpulan.     Hasil yang diperoleh dari penelitian ini pada masing-masing fokus penelitian dijelaskan sebagai berikut. Pertama, SDN Pandanwangi 1 Malang melaksanakan MBS dengan menerapkan tujuh pilar MBS, meliputi manajemen kurikulum, manajemen pendidik dan tenaga kependidikan, manajemen peserta didik, manajemen sarana dan prasarana, manajemen pembiayaan, manajemen humas, dan manajemen budaya dan lingkungan sekolah. Implementasi MBS, kepala sekolah memiliki prinsip dan strategi yaitu pengelolaan mandiri oleh sekolah sesuai dengan kebutuhan sekolah yang dianalisis melalui EDS dan kuesioner, manajemen sekolah berpedoman dengan SOP, pelibatan warga sekolah dalam kegiatan sekolah, dan komunikasi dengan banyak pihak, serta duduk dalam satu ruang. Kedua, dalam menerapkan konsep MBS, diperlukan berbagai peran dari kepala sekolah sebagai pemimpin di sekolah. Peran yang dilakukan oleh kepala SDN Pandanwangi 1 Malang antara lain yaitu sebagai edukator, manager, administrator, supervisor, leader, innovator, dan motivator. Ketiga, faktor pendukung peran kepala sekolah adalah motivasi guru untuk bekerja dan belajar, terciptanya kekeluargaan di sekolah, peran serta masyarakat baik, fasilitas belajar lengkap, adanya Standart Operating Procedure (SOP), guru menguasai Ilmu Teknologi (IT), dan progam sekolah sebagai upaya meningkatkan kedisiplinan peserta didik. Faktor penghambat peran kepala sekolah antara lain sulitnya adaptasi guru terhadap perubahan, minimnya jumlah guru, minimnya inovasi dan kreasi guru dalam penggunaan sumber belajar, belum optimal dalam menggunakan teknologi ke dalam proses pembelajaran, SOP belum dilaksanakan secara optimal, metode pembelajaran kurang variatif, pendampingan dalam kegiatan pembelajaran di perpustakaan masih rendah, dan didominasi oleh masyarakat ekonomi menengah ke bawah. Solusi terhadap permasalahan yang ada yaitu kepala sekolah membuat dan menyusun SOP. SOP tersebut terdiri dari SOP sie kurikulum, SOP UKS, SOP Keuangan, SOP Profesi Siswa, SOP Sarpras, dan SOP sie Keamanan. Selain SOP ada juga Evaluasi Diri Sekolah (EDS) yang merupakan alat tolok ukur untuk mengidentifikasi dan menganalisis kekuatan dan kelemahan sekolah terkait dengan manajemennya.     Saran yang dapat peneliti sampaikan kepada beberapa pihak yaitu (1) kepala sekolah untuk lebih intensif dalam mengidentifikasi kelebihan dan kekurangan yang dimiliki sekolah dengan melibatkan seluruh komponen sekolah dan masyarakat. Mendokumentasikan seluruh administrasi pada setiap pilar MBS dengan lebih rapi dan tetap melibatkan potensi masyarakat dalam kegiatan sekolah dan pengambilan keputusan. Serta menganalisis hasil temuan sebagai bahan evaluasi program dan kegiatan dalam MBS berikutnya; (2) pengawas sekolah diharapkan lebih intensif dalam melaksanakan pengawasan terhadap kinerja kepala sekolah dalam pelaksanaan MBS, lebih mampu dalam menyatukan komponen antara pemerintah pusat dan sekolah, serta berperan aktif dalam membantu kepala sekolah dalam memajukan sekolah; (3) guru dan staf lebih mengembangkan potensi dan profesionalitas kerja, mempertahankan sikap disiplin yang telah dibina, tetap menegakkan budaya kekeluargaan, dan apabila ada kendala dalam melaksanakan MBS dan belum menemukan solusi, maka diharapkan mencari literatur yang berkaitan dengan MBS disamping solusi yang diberikan oleh kepala sekolah; (4) komite sekolah berperan lebih aktif dalam membantu kegiatan-kegiatan sekolah, membangun komunikasi dan kerja sama yang lebih baik antara pengurus komite sekolah, orangtua peserta didik, dan kepala sekolah, serta lebih aktif dan kreatif dalam memberdayakan potensi-potensi masyarakat; (5) bagi ketua jurusan AP hasil penelitian dapat dijadikan sebagai referensi tambahan dalam pengembangan teori kepemimpinan pendidikan, sehingga dapat memperkaya ilmu terutama di jurusan AP sendiri; (6) hasil penelitian ini masih terbatas, sehingga disarankan kepada peneliti lain agar lebih mengembangakan pemikiran terhadap konsep implementasi MBS dengan beracuan pada hasil penelitian.     

Pengembangan media pembelajaran seni budaya berbasis adobe flash tentang penerapan ragam hias pada cangkang untuk kelas VII SMP / Ach. Riyan Hidayat

 

ABSTRAK Riyan Hidayat, Ach. 2015.Pengembangan Media Pembelajaran Seni Budaya Berbasis Adobe Flash tentang Penerapan Ragam Hias pada Cangkang Telur untuk Kelas VII SMP. Skripsi, Program Studi Pendidikan Seni Rupa, Jurusan Seni dan Desain, Fakultas SastraUniversitas Negeri Malang. Pembimbing: (I) Drs.Iriaji, M.Pd (II)Andy Pramono, S.Kom, MT. Kata kunci : Media Pembelajaran,Ragam Hias, Cangkang Telur Peserta didik SMP dinilai kurang berminat terhadap pembelajaran ragam hias, salah satunya di SMP Negeri 18 Malang. Media Pembelajaran yang interaktif dan menarik akan merangsang motivasi peserta didik dalam pembelajaran yang akan berdampak pada kualitas pembelajaran dan hasil belajar.Tujuan penilitian ini adalah mengembangkan dan menghasilkan produk media pembelajaranberbasis adobe flashbernuansa animasi Jepang yang komunikatif, interaktif, menarik, dan menantang tentang penerapan ragam hias pada cangkang telur untuk kelas VII SMP serta menguji kevalidan produk secara konseptual. Jenis penelitian ini adalah Penelitian dan Pengembangan. Model yang digunakan dalam penelitian dan pengembangan ini adalah model prosedural yang memodifikasi dari model pengembangan Sugiyono dan Sutopo dengan tahapan (1) latar belakang, (2) pengumpulan data, (3) analisis data, (4) pengembangan prototype yang meliputi konsep, desain, pengumpulan bahan, pembuatan, pengujian, distribusi, (5) validasi, (6) revisi, (7) uji coba, dan (8) revisi. Teknik pengumpulan data yang digunakan berupa angket sedangkan teknik analisis data yang digunakan berupa persentase deskriptif. Hasil penelitian ini adalah: (1) Uji validasi ahli media sebesar 90%, bagian yang direvisi adalah penggunaan layout dan ilustrasi lebih disesuaikan dengan materi serta ukuran font diperbesar pada bagian video,(2) validasi ahli materi 80%, bagian yang direvisi adalah KD dan penggunaan bahasa lebih disesuaikan dengan pembahasan, (3) uji coba pengguna memiliki kriteria sangat baik tanpa adanya revisi, dan (4) uji coba pemakaian kelompok kecil 80%, dilakukan revisi pada ukuran font yang diperesar serta mengganti audio yang mengganggu. Secara keseluruhan persentase dari uji coba sebesar 84,8% yang berarti produk yang dikembangkan memiliki kriteria sangat baik dan layak digunakan. Saran yang dapat dikemukakan penulis adalah sebagai berikut: (1) sebaiknya mengembangakan media digital yang berbasis 3D,(2) sebaiknya mencari bahan pustaka dan konsultasi dengan pakar yang ahli di bidang media dan ragam hias. (3) Bagi pihak sekolah sebaiknya mengintegrasikan multimedia pembelajaran.

Pengaruh perubahan arus kas terhadap tingkat rentabilitas melalui tingkat likuiditas pada perusahaan food and beverages yang listing di BEI tahun 2006-2008 / M. Imam Fauzi

 

Kata Kunci : Perubahan Arus Kas, Likuiditas, Rentabilitas. Memasuki era globalisasi yang pesat, sektor industri makanan dan minuman merupakan salah satu sektor industri di BEI yang mempunyai peluang untuk tumbuh dan berkembang dengan pesat, karena potensi pasarnya dari tahun ke tahun makin berkembang seiring dengan tingkat pertumbuhan jumlah penduduk. Untuk itu dalam kegiatan operasionalnya, pengendalian arus kas pada perusahaan sangat di butuhkan dalam menjaga likuiditas dan guna meningkatkan likuiditas. Tujuan dari penelitian ini adalah 1. Untuk mengetahui kondisi perubahan arus, 2. Untuk mengetahui kondisi tingkat likuiditas, 3. Untuk mengetahui kondisi tingkat rentabilitas, 4. Untuk menguji pengaruh perubahan arus kas aktivitas operasi terhadap tingkat likuiditas, 5. Untuk menguji pengaruh perubahan arus kas aktivitas investasi terhadap tingkat likuiditas, 6. Untuk menguji pengaruh perubahan arus kas aktivitas pendanaan terhadap tingkat likuiditas, 7. Untuk menguji pengaruh perubahan arus kas aktivitas operasi terhadap tingkat rentabilitas, 8. Untuk menguji pengaruh perubahan arus kas aktivitas investasi terhadap tingkat rentabilitas, 9. Untuk menguji pengaruh perubahan arus kas aktivitas pendanaan terhadap tingkat rentabilitas, 10. Untuk menguji pengaruh tingkat likuiditas terhadap tingkat rentabilitas. Populasi dalam penelitian ini adalah perusahaan Food and Beverages yang listing di BEI tahun 2006 – 2008, sedangkan pengambilan sampel menggunakan teknik Purposive Sampling. Analisis penelitian ini menggunakan analisis jalur dengan pengujian hipotesis dilakukan dengan uji t dan uji F. Dengan nilai α sebesar 5% atau 0,05 dan sebelum dilakukan analisis data di uji normalitas dan uji multikolinieritas. Hasil penelitian ini menunjukkan bahwa tidak terdapat pengaruh yang signifikan antara perubahan arus kas pada likuiditas dan rentabilitas, kecuali arus kas investasi yang berpengaruh signifikan terhadap likuiditas dan terdapat pengaruh yang signifikan antara likuiditas dan rentabilitas. Pada perubahan arus kas operasi, investasi, pendanaan, dan likuiditas cenderung mengalami penurunan pada setiap tahunnya, sedangkan pada tingkat rentabilitas dari setiap tahunnya mengalami peningkatan. Hal tersebut secara umum menunjukkan bahwa perusahaan kurang produktif dalam mengelola modal, baik yang berasal dari laba maupun penambahan modal sehingga banyak modal yang menganggur. Berdasarkan hasil penelitian ini disarankan kepada investor dalam melakukan investasi tidak hanya melihat dari labanya saja, akan tetapi perlu melihat kemampuan perusahaan dalam mengendalikan arus kas bagi perusahaan atau dapat dilihat dalam laporan arus kas.

Efektifitas dan efisiensi PAC (Polyalumminum Chloride) dan tawas sebagai koagulan pada treatment pendahuluan dalam pengolahan limbah cair industri penyamakan kulit / oleh Handri Cahyono

 

Salah satu limbah industri yang dapat menyebabkan pencemaran lingkungan adalah limbah cair industri penyamakan kulit. Umumnya metode pengolahanli mbah cair dalam industri tersebuta dalahd enganp enambahan_ loa6rlan PAC Qtolyalumminumchloride)d an tawas.S ejauhi ni keefektifan d11 efisienspi enggunaakne duak oagulant ersebutm asihb elum diketahuis ecarajelas. Oleh karenaitu penelitian ini dilalalkan dengan tujuan untuk mengetahui sejauh mana efekifitas dan efisiensi penggrmaim PAC dan tawas sebagai koagulan dalam pengolahanlim bah cair industri penyamakank ulit (khususnyap ada treatment pendahuluan). Padap enelitian ini dilakukan pengolatranli mbah cair dengan menggunakanm etodek oagulasi.P rinsip dari metode ini adalahp enetralanm uatan partiiiel negatif dari koloid oleh PAC dan tawas yang bermuatan partikel positif, sehinggad ihasilkan gumpalany ang akhirnya dapat disaring' Langkahk erja-yang dilakilian antaral ain dengan penambahank oagulan (PAC dan tawas)k edalam limbah cair kernudian dilanjutkan dengan pengadukan dan penyetimbangan. Analisis nilai pH, TS, TDS, TSS, kekeruhan, dan coD pada limbah tersebut dilakrftan sebitum dan sesudah perlakuan.Variabel dalam penelitian ini antma lain, variabel bebas meliputi kadar atau jumlah PAC dan tawas per volume tertentuli mbah cair danv ariabelt erikaty ang meliputi TS, TDS, TSS,C OD, pH, dan kekeruhan hasTl treatment pendahuluan dengan pengaruh jumlah PAC dan tawas (variabel bebas). Flasil penelitian menunjukkan bahwa penggunaan PAC dan tawas sebagar koagulan pada trcatment petdahuluan pengolahan limbah cair mampu *.u:ittgko:** koalitas limbah. Penurunan nilai TS, TDS, dan TSS r**jokk* bahwa kekeruhan (turbiditas) dari limbah semakin turun. Efektifitas keduakoagulan relatif sama, yaitu pada rentang konsentrasi 0,5-1,0 7o. Namun jika dilihaidari kualitas limbah hasil olahan (elfluen) berdasar paramet€r-pH, |n*u pec lebih efektif daripada tawas. Dari segi efisiensi biaya pengolahan, tawasle bih efisisend ariPadaP AC.

Hubungan antara prestasi akademik sebelum dan sesudah memogram paket khusus pendidikan kepelatihan dan pendidikan kesehatan & rekreasi pada mahasiswa PSSJ POK angkatan tahun 1992
oleh Kati Sri Wilujeng

 

Pengembangan modul geografi model Alec E. Aitken pada materi mitigasi dan adaptasi bencana alam kelas X sekolah menengah atas / Indah Istimin Cahyani

 

ABSTRAK Cahyani, Indah Istimin. 2015. Pengembangan Modul Geografi Model Alec E. Aitken Pada Materi Mitigasi dan Adaptasi Bencana Alam Kelas X Sekolah Menengah Atas. Tesis, Program Studi Pendidikan Geografi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Edy Purwanto, M.Pd., (II) Dr. Budijanto, M.S. Kata Kunci: Pengembangan Modul, Model Alec E. Aitken, Mitigasi dan Adaptasi Bencana Alam Materi teks geografi SMA kelas X materi mitigasi dan adaptasi bencana alam banyak dijumpai kesalahan. Hasil kajian buku teks tersebut ditemukan kesalahan konsep, kalimat, dan gambar itu belum berfungsi. Kelemahan yang mendasar dari buku teks tersebut yakni belum menggunakan pendekatan keruangan dan materi berupa ilmu bantu geografi. Beberapa kelemahan tersebut menunjukkan bahwa kualitas buku teks geografi masih rendah dan memerlukan pengembangan. Pengembangan ini bertujuan menghasilkan modul geografi SMA kelas X dengan model Alec E. Aitken untuk materi mitigasi dan adaptasi bencana alam. Penelitian pengembangan ini mengadopsi model Dick and Carey. Model pengembangan ini terdiri dari lima tahap yaitu identifikasi kompetensi inti dan kompetensi dasar, analisis materi, penulisan dan pengembangan modul, validasi dan uji coba produk, dan revisi produk. Produk hasil pengembangan telah divalidasi oleh ahli materi. Setelah dilakukan revisi, selanjutnya diujicobakan. Subjek uji coba, yakni siswa kelas X IIS SMA Selamat Pagi Indonesia. Uji coba untuk mengetahui tanggapan, penguasaan materi modul dan hasil belajar siswa setelah menggunakan produk. Berdasarkan hasil analisis uji coba diperoleh terbukti bahwa penguasaan siswa terhadap modul geografi model Alec E. Aitken materi mitigasi dan adaptasi bencana pada modul 1 91%, modul 2 86,36%, modul 3 81,82%, dan modul 4 77,27%. Hasil belajar siswa melalui tes mencapai standar ketuntasan belajar, yakni nilai rata-rata kelas 82. Hasil tersebut menunjukkan produk sudah baik dan layak digunakan dalam pembelajaran. Modul geografi model Alec E. Aitken pada materi mitigasi dan adaptasi bencana alam kelas X SMA mempunyai kekurangan pada: penyajian deskripsi materi mitigasi dan adaptasi bencana alam terkesan berbelit-belit dan kurang jelas, kekurangan produk juga terdapat pada aspek bahasa berupa: terdapat istilah geografi berkaitan dengan mitigasi dan adaptasi bencana perlu dijelaskan lebih rinci agar mudah dipahami oleh siswa. Kesalahan dalam penulisan kata-kata atau kalimat juga masih terdapat pada modul hasil pengembangan Disarankan adanya penelitian lebih lanjut dengan memperbaiki kekurangan yang terdapat pada komponen materi dan bahasa. Desiminasi produk dilakukan melalui MGMP geografi dan seminar dalam skala lokal.

Kontribusi pedagang wisata Coban Rondo terhadap ekonomi rumah tangga di Desa Pandesari Kecamatan Pujon Kabupaten Malang / Putri Kustantinah

 

Pengambilan Keputusan berdasarkan Teorema Bayes : suatu kajian terhadap penentuan jenis kartu prabayar yang paling hemat / oleh Dian Nurul Y.A.

 

Using learning log strategy to improve writing ability of the second year students at MTs Wachid Hasyim Surabaya / Bambang Kustriadi

 

Thesis, English Language Teaching, Graduate Program of State University of Malang. Advisors: (I) Drs. Fachrurrazy, MA., Ph.D., (II) Dr. Enny Irawati,M.Pd. Key terms: learning log, writing ability The study was conducted based on the result of the preliminary study in MTs Wachid Hasyim Surabaya, it was found out that the students of the school had some problems in learning writing. First, the teacher did not give a model of to write a paragraph that makes the students know what to do for writing. Second, the teacher did not provide more portion of time in writing activities for the students in class. Third, the strategies used in the teaching and learning process did not vary and interesting. To answer the problem, this study was designed to improve the students’ writing ability in English through learning log strategy. The focus of this study is to promote the students’ idea and to help them acquire their writing habit so that their journals will not be assessed on the term of accuracy of writing but on fluency ideas. It is expected that the more the students practice writing regularly, their writing ability will improve. This study employed a classroom action research design in which the researcher and the collaborative teacher worked together in designing the lesson plans, implementing the action, observing and making reflection. The subjects of the study were the second-year students of MTs Wachid Hasyim Surabaya, East Java of the 2010-2011 academic year. The instruments used to collect data are observation checklist, journal entries, field notes and questionnaire. The procedures of implementing learning log strategy in teaching and learning process in this study were: (1) giving students the topics ; (2) asking the students to tell their experience; (3) asking the students to write down what they have learn in the classroom; (4) showing the students models of sentences and paragraphs; (5) asking the students to compare between their sentences and paragraphs and the models; (6) asking the students to rewrite their sentences and paragraphs; (7) showing the students models of learning logs;(8) giving explanation about learning logs to the students;(9) asking the students to write journals based on the topic given the week before after the end of the class or at the beginning of the class; (10) asking the students to write their own journals in class in paragraph of recount text. The findings of the study show that the strategy can improve the students’ writing ability. The improvement can be seen from the students’ products both in quantity and quality. It can also be seen from the students’ final scores. In terms of quantity, the students can write sentences and paragraph with the topic given with increasing number of sentences and paragraphs in each entry. In terms of quality, the students show significant improvement in four aspects of writing: content, organization, vocabulary and grammar. Regarding final scores, the number of students whose scores are 60 or higher is increasing from cycle 1 cycle 2. Based on the students’ involvement also improves it can be seen in cycle 1, the average scale of the students level is 2.25 which has not reached the predetermined criteria yet. In cycle 2, the average scale improves to 4.0. On the basis of the findings, some suggestions are made. First, the English teachers are suggested that they apply learning log when teaching writing to the students. Second, in applying learning logs, the teachers should be sure that the students have mastered basic vocabulary items and basic concept of sentences and paragraphs. Third, the teachers have to show to the students some models of journals. Models of sentences and paragraphs are also important to be given to the students. Fourth, for beginning activities in learning log writing, it is necessary for the teachers to give topic to the students. And finally, it could give valuable contribution for further research on the application of learning log.

Analisis buku teks bahasa Indonesia kelas IV sekolah dasar
oleh Muchtar

 

Pengembangan bahan ajar menggunakan pendekatan saintek untuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis pada materi pengenalan ilmu kimia SMA/MA kelas X/ Elisa Umami

 

ABSTRAK Umami, Elisa. 2015. Pengembangan Bahan Ajar Menggunakan Pendekatan Saintifik untuk Mengeksplisitkan Hakikat Sains (NOS) dan Berpikir Kritis pada Materi Pengenalan Ilmu Kimia SMA/MA Kelas X. Skripsi, Jurusan Kimia, Fakultas MIPA, Universitas Negeri Malang. Pembimbing: (I) Drs. Prayitno, M.Pd, (II) Dr. Aman Santoso, M.Si. Kata kunci: Bahan ajar, literasi sains, pendekatan saintifik, hakikat sains (NOS), berpikir kritis Ilmu kimia merupakan ilmu yang mempelajari peristiwa ataupun fenomena yang terjadi di alam semesta. Siswa menganggap materi kimia sebagai ilmu yang sulit karena bersifat abstrak,berjenjang, dan terdiri dari banyak pokok bahasan. Salah satu materi tersebut adalah pengenalan ilmu kimia yang masih belum dipahami dengan baik oleh siswa. Kesulitan dalam memahami materi kimia disebabkan karena pola pembelajaran yang masih menjadikan guru sebagai pusat pembelajaran (teacher centered), sehingga belum mampu meningkatkan kemampuan literasi sains siswa. Menurut penelitian PISA, literasi sains siswa Indonesia masih rendah, yaitu menduduki peringkat ke 64 dari 65 negara. Salah satu penyebab rendahnya literasi sains siswa Indonesia adalah karena sebagian besar buku pelajaran yang ada memuat aspek hakikat sains (NOS) secara implisit sehingga kurang mendapat perhatian dari pembaca (siswa). Tujuan dari penelitian ini adalah menghasilkan bahan ajar dengan materi pengenalan ilmu kimia yang menggunakan pendekatan saintifik (scientific approach) untuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis, serta untuk mengetahui tingkat kelayakan bahan ajar yang dikembangkan. Pengembangan bahan ajar menggunakan pendekatan saintifik (scientific approach) untuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis pada materi pengenalan ilmu kimia SMA/MA Kelas X ini menggunakan model 4D (four D model).Model pengembangan 4D(four D model)terdiri dari tahap pendefinisian (define), perancangan (design), pengembangan (develop), dan penyebaran (disseminate). Tetapi, dalam pengembangan bahan ajar ini hanya terbatas pada tahap define, design, dandevelop.Data pada pengembangan ini berupa data kuantitatif yang berdasarkan skor angket dari 2 validator ahli dan 2 validator praktisi yang disusun dalam skala Likert, serta data kualitatif yang berdasarkan tanggapan dan saran-saran perbaikan yang diisi oleh 2 validator ahli dan 2 validator praktisi. Hasil dari penelitian dan pengembangan adalah bahan ajar yangterdiri dari buku siswa dan buku guru. Dari hasil validasi bahan ajar menunjukkan bahwa buku siswa memenuhi kriteria layak dengan nilai rata-rata 80,6% dan buku panduan guru memenuhi kriteria sangat layak dengan nilai rata-rata 81,4%. Sehingga dapat disimpulkan bahwa bahan ajar menggunakan pendekatan saintifik (scientific approach) untuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis pada materi pengenalan ilmu kimia SMA/MA kelas X ini layak untuk diterapkan dalam pembelajaran.

Penerapan pembelajaran tematik dengan tema lingkungan untuk meningkatkan hasil belajar siswa kelas III di SDN Purwantoro 7 Kecamatan Blimbing Kota Malang / Rasmi Patty

 

Kata Kunci : Pembelajaran Tematik, hasil belajar siswa. Hasil observasi data pra lapangan di kelas 3 SDN Purwantoro 7 terlihat fakta bahwa guru dalam pembelajaran dengan tema lingkungan di SDN Purwantoro 7 masih belum menggunakan prinsip-prinsip pembelajaran secara optimal, kegiatan masih banyak didominasi oleh guru, siswa lebih banyak duduk, diam dan dengar. Dengan sikap yang pasif dalam menerima pelajaran tentu saja akan mempengaruhi perolehan hasil belajar, data hasil belajar yang diberikan oleh peneliti berupa soal tes sebanyak 5 soal menunjukkan bahwa siswa SDN Purwantoro 7 kurang mampu dalam hal penguasaan konsep materi pembelajaran tema lingkungan. Dari hasil tes awal yang diberikan oleh peneliti hanya ada 3 siswa (11,5%) yang penguasaan konsep materinya mencapai 75-100; terdapat 12 siswa (46,2%) yang mencapai nilai antara 50-75, dan ada 11 orang siswa yang (42,3%) yang memperoleh nilai di bawah 50. Padahal standar ketuntasan minimal yang ditentukan oleh SDN Purwantoro 7 adalah 75. Nilai rata-rata yang dicapai siswa kelas IV SDN Purwantoro 7 hanya mencapai rata-rata 53,75. Nilai ini adalah nilai rata-rata yang jauh di bawah standar ketuntasan minimal. . Hal-hal tersebut melatarbelakangi penelitian ini. Salah satu upaya untuk mengatasi permasalahan tersebut dengan penelitian tindakan kelas melalui tindakan penerapan pembelajran tematik dan dilakukan di SDN Purwantoro 7 Kecamatan Blimbing Kota Malang di Kelas III mulai tanggal 5 Maret sampai dengan 29 April 2010. Adapun tujuan dari penelitian ini adalah Penelitian ini bertujuan untuk meningkatkan kualitas pembelajaran siswa kelas 3 tentang tema lingkungan SDN Purwantoro 7 kota Malang dengan menggunakan pembelajaran terpadu. Desain penelitian yang digunakan model spiral dari Kemmis dan Taggart, dengan instrumen penelitian berupa lembar observasi, wawancara, catatan lapangan, LKS dan lembar tes. Berdasarkan penerapan pembelajaran tematik, guru sudah dapat memfokuskan diri dan siswa pada pembelajaran, menghargai jerih payah siswa dalam mengerjakan tugas atau soal, dan ramah dalam bersikap dan berkomunikasi. Sikap menghargai yang ditampilkan oleh guru terhadap siswa memberikan efek positif pada kenyamanan siswa dan keaktifan siswa dalam pembelajaran, hal ini terbukti dengan siswa mulai bisa rileks ketika duduk dengan untaian senyum tulus terlihat dirona wajah-wajah siswa. Salah satu penyebab siswa menjadi lebih aktif dikarenakan siswa merasa nyaman dalam pembelajaran, ini sesuai dengan yang pernyataan DePorter, (2001 : 36) bahwa membangun rasa memiliki akan mempercepat proses pengajaran dan meningkatkan rasa tanggung jawab. kunci membangun ikatan emosional yaitu dengan menciptakan kesenangan dalam belajar, menjalin hubungan dan menyingkirkan segala ancaman dari suasana belajar (DePorter, 2001 : 23), karena ketiadaan ancaman adalah salah satu kondisi yang dibutuhkan untuk berjalannya proses belajar (Hart, 1983, dalam DePorter, 2001 : 47). Sebaliknya keadaan stress dan rasa takut yaitu perasaan yang sering muncul apabila proses belajar hanya melibatkan aspek otak kiri saja, dapat menghambat proses berpikir dan mengingat. (Megawangi, 2004 : 49-50). Berdasarkan perbandingan hasil belajar siswa pada penelitian awal, siklus I dan siklus II, dilihat dari perbandingan nilai rata-rata, pada penelitian awal nilai rata-rata tes kelas 5,64, pada siklus I rata-rata kelas menjadi 6,42, dan pada siklus II rata-rata kelas menjadi 8,17. Pada penelitian awal jumlah siswa yang lulus hanya 12 orang (42,85%), dan 16 orang lainnya (57,15%) tidak lulus. Pada siklus I jumlah siswa yang lulus bertambah menjadi 21 orang (75%) siswa yang tidak lulus 7 orang (25%). Peningkatan jumlah siswa yang lulus juga terlihat pada siklus II jumlah siswa yang lulus 28 orang (100%) atau dengan kata lain seluruh siswa lulus.

Pengaruh kebiasaan belajar terhadap prestasi belajar siswa kelas I, II pada bidang studi ekonomi di SMA Negeri 01 Rejotangan Kabupaten Tulungagung / oleh Triana

 

Pengaruh fasilitas belajar terhadap prestasi belajar mahasiswa Jurusan Pendidikan Ekonomi Fakultas Pendidikan Ilmu Pengetahuan Sosial IKIP MALANG
oleh Edi Soeryono

 

Pengembangan perangkat pembelajaran materi fungsi kuadrat berdasarkan pendekatan saintifik model penemuan terbimbing untuk siswa kelas X SMA / Anggun Dafilla Widysari

 

ABSTRAK Widyasari, Anggun Dafilla. 2015. Pengembangan Perangkat Pembelajaran Materi Fungsi Kuadrat Berdasarkan Pendekatan Saintifik Model Penemuan Terbimbing untuk Kelas X SMA. Skripsi. Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: Dr. A.R. As’ari, M.Pd, M.A. Kata Kunci : perangkat pembelajaran, pendekatan saintifik, model penemuan terbimbing, fungsi kuadrat Tujuan dari pengembangan yang dilakukan adalah menghasilkan perangkat pembelajaran materi fungsi kuadrat berdasarkan pendekatan saintifik model penemuan terbimbing untuk siswa SMA kelas X yang valid, efektif dan praktis. Perangkat pembelajaran ini mengacu pada modelpengembangan Plomp dalam Hobri (2010:17) yaitu: (1) fase investigasi awal, (2) fase perancangan, (3) fase realisasi, dan (4) fase tes, evaluasi, dan revisi. Selanjutnya diuji cobakan dan dilakukan analisis data. Berdasarkan analisis data diperoleh hasil yaitu : (1) persentase kevalidan RPP dan LKS berturut-turut adalah 95,45% dan 95,83%, (2) persentase kepraktisan RPP dan LKS berturut-turut adalah 90% dan88,54%, (3) persentase siswa yang mendapatkan nilai di atas SKM adalah 100%. Dengan demikian, perangkat pembelajaran materi fungsi kuadrat berdasarkan pendekatan saintifik model penemuan terbimbing yang dihasilkan memenuhi kriteria valid, praktis dan efektif. Hasil pengembangan perangkat pembelajaran materi fungsi kuadrat berdasarkan pendekatan saintifik model penemuan terbimbing kelas X dapat digunakan sebagai alternatif dan peertimbangan pembelajaran di kelas. Adapun saran untuk pengembangan selanjutnya perlu untuk mengujikan perangkat pembelajaran kepada siswa yang belum menempuh materi fungsi kuadrat dan diujikan pada satu kelas, sehingga memungkinkan didapat hasil yang berbeda.

Pengaruh good corporate governance terhadap kinerja keuangan dan return saham perusahaan manufaktur yang terdaftar di BEI periode 2005-2008 / Andika Widiarsa

 

Kata Kunci: Good Corporate Governance, Kinerja Keuangan, dan Return Saham. Perusahaan merupakan lembaga yang memiliki tujuan menghasilkan keuntungan untuk meningkatkan nilai perusahaan dan kesejahteraan pemegang saham selaku pemilik perusahaan. Saat ini perusahaan dituntut untuk dapat mengelola keuntungan atau laba secara optimal, karena besar kecilnya laba yang diperoleh perusahaan akan menentukan keberlangsungan perusahaan tersebut masa yang akan datang. Pengelolaan perusahaan yang baik akan menghasilkan manfaat bagi kinerja perusahaan dan pemegang saham baik untuk jangka pendek maupun jangka panjang. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh good corporate governance terhadap kinerja keuangan dan return saham secara langsung dan tidak langsung. Penelitian ini merupakan penelitian eksplanatif. Populasi penelitian ini adalah perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia tahun 2005-2008. Pengambilan sampel dilakukan dengan menggunakan teknik combine sampling (purposive random sampling), yaitu perusahaan manufaktur yang melaksanakan mekanisme good corporate governance berupa kepemilikan institusional selama empat tahun berturut-turut pada tahun 2005- 2008. Data yang digunakan adalah data sekunder, berupa laporan keuangan yang dipublikasikan pada Indonesian Capital Market Directory 2006-2009. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis jalur (path analysis). Hasil analisis menunjukkan bahwa baik secara langsung maupun tidak langsung good corporate governance berpengaruh secara singnifikan terhadap kinerja keuangan dan return saham. Hal ini menunjukkan bahwa penerapan good corporate governance membawa manfaat terhadap kondisi kinerja keuangan dan berakibat pada meningkatnya return saham. Selain itu, hasil pengujian juga menunjukkan bahwa kinerja keuangan mampu menjadi variabel moderator yang memperkuat pengaruh good corporate governance terhadap return saham. Berdasarkan hasil penelitian ini, disarankan agar dilakukan penelitian lebih lanjut dengan menambah indikator pengukuran dan menggunakan data pada tahun yang normal atau stabil.

Penerapan pembelajaran kooperatif model numbered heads together (NHT) untuk meningkatkan hasil belajar ilmu pengetahuan sosial siswa kelas IV SDN Klampok III Singosari / Sri Soekarni

 

Kata Kunci: Pembelajaran Kooperatif, Numbered Heads Together (NHT), Hasil Belajar Berdasarkan hasil observasi yang dilakukan di kelas IV SDN Klampok III Singosari tanggal 3 Mei 2010 sampai 8 Mei 2010, diketahui bahwa hasil belajar Ilmu Pengetahuan Sosial siswa masih rendah, diketahui bahwa rata-rata skor tes 67 dan ketuntasan klasikal hanya 60%. Ketentuan persentase ketuntasan belajar secara klasikal minimal 80% dari jumlah siswa yang mencapai daya serap ≤ 65%. Rendahnya hasil belajar disebabkan oleh beberapa dari tingkah laku siswa pada saat pembelajaran, antara lain 1) Pada saat pembelajaran mayoritas siswa menunjukkan sikap kurang berminat mengikuti pelajaran. Siswa kurang aktif bertanya, menjawab serta mengungkapkan pendapatnya selama kegiatan pembelajaran berlangsung walaupun guru sudah sering memberikan kesempatan kepada siswa untuk bertanya, 3) Pada saat diskusi, tidak semua antusias mengikuti pelajaran, hanya beberapa siswa yang aktif mengerjakan tugas sedangkan siswa yang lain banyak yang mengobrol di luar materi pelajaran, 4) Beberapa siswa tidak mendengarkan pendapat temannya dan tidak mendengarkan penjelasan guru. Guru sudah berusaha untuk meningkatkan hasil belajar siswa dengan menggunakan beberapa metode pembelajaran misalnya dengan praktikum dan diskusi kelas tetapi belum menunjukkan hasil yang maksimal. Hal tersebut berdampak pada hasil belajar siswa yang masih rendah, yaitu rata-rata skor tes 67 dan ketuntasan klasikal hanya 60%. Untuk mengatasi masalah tersebut diperlukan metode pembelajaran yang dapat meningkatkan hasil belajar siswa. Pembelajaran yang diterapkan dalam penelitian ini adalah pembelajaran kooperatif model Numbered Heads Together (NHT). Penelitian ini bertujuan untuk meningkatan hasil belajar Ilmu Pengetahuan Sosial siswa kelas IV SDN Klampok III Singosari melalui penerapan pembelajaran kooperatif model Numbered Heads Together (NHT). Penelitian ini merupakan penelitian kualitatif dengan desain Penelitian Tindakan Kelas (PTK) yang terdiri atas dua siklus. Pengambilan data penelitian dilaksanakan pada tanggal 5 Juni 2010 sampai tanggal 19 Juni 2010. Data penelitian berupa penerapan pembelajaran kooperatif model Numbered Heads Together (NHT) yang diperoleh melalui observasi selama penelitian, sedangkan data hasil belajar siswa diperoleh melalui tes setiap akhir siklus. Hasil penelitian penerapan pembelajaran kooperatif model Numbered Heads Together (NHT) dapat meningkatkan hasil belajar siswa dari skor rata-rata kelas sebesar 67,00 dan ketuntasan klasikal 60% sebelum siklus I meningkat menjadi 76,40 dan ketuntasan klasikal 76,67% setelah siklus I dan meningkat lagi menjadi 83,60 dan ketuntasan klasikal 90% setelah siklus II.

Karakteristik pekerja wanita usia 15-18 tahun di pabrik rokok di desa Parangargo Kecamatan Wagir Kabupaten Malang / oleh Syarifudin Bal'an

 

The readability level of reading texts in english for senior high school book 1 for the first year by Depdikbud / by Gunawati Dwi Utami

 

Kesulitan-kesulitan guru kelas I dan IV dalam menerapkan kurikulum 2013 di SD se-Kota Malang / Rohmaniyah

 

ABSTRAK Rohmaniyah. 2015. Kesulitan-Kesulitan Guru Kelas I dan IV dalam Menerapkan Kurikulum 2013 di SD Se-Kota Malang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (1) Dra.Harti Kartini, M.Pd, (2) Dra. Sri Harmini, S.Pd, M.Pd. Kata Kunci: Kesulitan, guru SD, Kurikulum 2013 Berdasarkan wawancara pada tanggal 12 november 2014 di SDN Madyopuro 4 Malang ditemukan fakta bahwa dalam menerapkan Kurikulum 2013 guru mengalami kesulitan. Kesulitan yang dialami yaitu, dalam mengaktifkan siswa melalui pembelajaran berbasis saintifik dan dalam melakukan penilaian. Tujuan dari penelitian ini untuk mendeskripsikan kesulitan-kesulitan guru Kelas I dan IV dalam menerapkan Kurikulum 2013 dan usaha yang dilakukan untuk mengatasinya. Penelitian ini menggunakan pendekatan deskriptif kuantitatif. Populasi berjumlah 59orang, terdiri dari guru Kelas I dan IVSD rintisan pemerintah yang menerapkan Kurikulum 2013 danditetapkan sebagaisampel total. Data dikumpulkan dengan angket dan wawancara bebas. Data dianalisis menggunakan statistik deskriptif dengan persentase dan disajikan dalam bentuk tabel dan diagram. Hasil penelitian menunjukkan bahwa hampir seluruh guru (93%) SD rintisan yang menerapkan Kurikulum 2013 telah mengikuti pelatihan bahkan 76% mengikuti lebih dari sekali, meskipun demikian hasil angket menunjukkan beberapa guru SD Kelas I dan IV masih menyatakan sulit dalam menerapkan Kurikulum 2013 yaitu, 40% dalam memahami Kurikulum 2013; 39% dalam merencanakan pembelajaran; 36% dalam melaksanakan pembelajaran; 41% dalam melakukan penilaian dan usaha yang dilakukan guru dalam mengatasi kesulitan diantaranya mengikuti pelatihan implementasi Kurikulum 2013, sharing antar guru dalam KKG, dan mempelajari panduan teknis Implementasi Kurikulum 2013 SD. Berdasarkan temuan di atas dapat disimpulkan bahwa, kesulitan yang dialami guru SD Kelas I dan IV Se-Kota Malang dalam menerapkan Kurikulum 2013 masih cukup tinggi. Saran peneliti1) kepala sekolah, hendaknya melakukan kunjungan kelas secara intensif untuk memonitor guru dalam melaksanakan pembelajaran, penilaian dan penyusunan RPP dan 2) bagi guru, perlu menambah wawasan dari berbagai sumber untuk mengatasi kesulitan yang dialami melalui memperbaruhi informasi dan aturan-aturan terkait Implementasi Kurikulum 2013 di SD.

Survei tingkat bahaya erosi dan arahan konservasi lahan di desa Sumbersuko Kecamatan Wagir Kabupaten Malang / oleh Loka Widiastuti

 

Berbagai hal yang melatarbelakangi tenaga kerja wanita bekerja keluar negeri di daerah pesisir Kabupaten Sampang / oleh Moh. Husin

 

Analisis bahan pelajaran membaca dan menulis buku teks bahasa Indonesia sekolah dasar kelas IV, V, dan VI berdasarkan pendekatan komunikatif / oleh In Hari Purwanto

 

Anak autis sebagai sumber inspirasi penciptaan karya seni lukis / Muhammad Agus Ramadhan

 

ABSTRAK Bagus Ramadhan, Muhammad. 2015. Anak Autis Sebagai Sumber Inspirasi Penciptaan Karya Seni Lukis. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Drs.Triyono Widodo, M.Sn, (II) Drs. Andi Harisman. Kata Kunci: Anak Autis, Penciptaan, Seni lukis Representasional Anak autis merupakan anak dengan kebutuhan khusus yang mengalami kelainan pada otak, yang mempengaruhi interaksi sosial mereka, pola komunikasi, emosi, dan memiliki keterbatasan gerak. Anak autis merupakan anak dengan perkembangan yang unik sehingga perhatian dari orang-orang disekitar mereka sangat dibutuhkan untuk membantu tumbuh kembang mereka secara sempurna. Ide penciptaan karya lukis ini adalah anak autis sedangkan temanya adalah prilaku anak autis yang diwujudkan ke dalam karya seni lukis dekoratif. Pencipta memilih seni lukis dekoratif sebagai media berkreasi untuk mengekspresikan rasa jiwa melalui tampilan visual karya dua dimensional dengan menggunakan garis, bentuk, dan warna yang menghasilkan lukisan semi abstrak. Proses penciptaan karya seni lukis semi abstrak ini bermula dari perancangan konsep yang didalamnya terdapat ide, tema, dan objek yang akan diciptakan yaitu objek anak autis. Setelah itu menentukan karakteristik karya, teknik, alat, dan bahan yang akan digunakan. Langkah selanjutnya adalah proses visualisasi yaitu membuat sketsa di atas kertas lalu memindahkannya ke kanvas. Kemudian teknik yang digunakan dalam proses pewarnaan antara lain adalah teknik blok, sapuan kuas basah, dan teknik plakat. Setelah itu proses finishing karya. Penulis menampilkan 6 karya seni lukis representasional dengan media estetik berupa titik, garis, bentuk, dan warna, sebagai simbolisasi dari konsep. Karakteristik dari keenam lukisan yang diciptakan adalah, dominan menggunakan warna biru, wajah separuh yang datar, penggambaran ruang kosong dan datar, dan dekorasi pada objek. Berdasarkan hasil penciptaan ini diharapkan dapat memberikan pengalaman baru kepada pencipta maupun orang lain dalam mempelajari karya seni lukis semi abstrak dekoratif. Mulai dari perancangan konsep, hingga proses visualisasi karya, dan diskripsi karya berdasarkan pengamatan pribadi penulis. Melalui keenam karya lukis ini dapat memberikan informasi berupa pesan moral bahwa anak autis perlu mendapat perhatian dan perlakuan selayaknya dari masyarakat. Karya penciptaan ini bisa menjadi wacana dan perenungan bagi masyarakat untuk menghargai hasil karya seni lukis semi abstrak sehingga yang muncul adalah persepsi positif terhadap anak autis. Manfaat bagi dunia pendidikan terkait tema prilaku anak autis yang diwujudkan ke karya lukis semi abstrak dapat menambah wawasan apresiasi bagi peserta didik dan memberi pemahaman kepada para pendidik tentang prilaku unik anak autis yang membutuhkan perlakuan khusus.

Pengaruh model pembelajaran herrmann whole brain terhadap kemampuan representasi dan prestasi belajar siswa SMA kelas X pada materi suhu dan kalor / Nichla Maimanata

 

Kata kunci : whole brain, kemampuan representasi, prestasi belajar fisika Model pembelajaran Herrmann Whole Brain adalah model pembelajaran yang didasarkan pada teori Whole Brain. Model pembelajaran Herrmann Whole Brain merupakan model pembelajaran yang dapat mengasah dan menstimulus kerja otak di keempat bagian. Representasi fisika merupakan proses yang mewakili kerja otak kanan dan kiri, sedangkan prestasi belajar merupakan bentuk pencapaian siswa setelah mengikuti pembelajaran. Penelitian ini bertujuan untuk mengetahui pengaruh Model pembelajaran Herrmann Whole Brain terhadap kemampuan representasi dan prestasi belajar siswa. Penelitian ini menggunakan rancangan nonequivalent comparison group: post only, dengan 1 kelompok eksperimen (N= 35) dan 1 kelompok kontrol (N=31). Selama perlakuan, kelompok eksperimen menerima model pembelajaran Herrmann Whole Brain dan kelompok kontrol menerima pembelajaran ceramah dan diskusi. Pada akhir pertemuan, tes kemampuan representasi dan prestasi belajar diberikan kepada kedua kelompok. Tes dilakukan untuk mengetahui pengaruh model pembelajaran Herrmann Whole Brain terhadap kemampuan representasi dan prestasi belajar. Untuk mengetahui perbedaan antara kelompok eksperimen dan kontrol digunakan uji Mann-Withney U. Nilai mean rank digunakan untuk mengetahui pengaruh model pembelajaran Herrmann Whole Brain terhadap kemampuan representasi dan prestasi belajar siswa. Hasil uji beda kemampuan representasi dengan uji Mann-Whitney U menunjukkan nilai U sebesar 256,50. Hasil konversi nilai U ke nilai z menunjukkan nilai z sebesar 3,69, dengan taraf signifikansi 0,05 zkritis=1,65. Hasil uji beda prestasi belajar dengan uji Mann-Whitney U menunjukkan nilai U sebesar 373,00. Hasil konversi nilai U ke nilai z menunjukkan nilai z sebesar 2,20, dengan taraf signifikansi 0,05 zkritis=1,65. Perolehan mean rank data kemampuan representasi pada kelompok eksperimen adalah 41,7, sedangkan perolehan mean rank data kemampuan representasi pada kelompok kontrol adalah 24,3. Perolehan mean rank data prestasi belajar pada kelompok eksperimen adalah 38,3, sedangkan perolehan mean rank data prestasi belajar pada kelompok kontrol adalah 28,0. Hasil analisis ini menunjukkan bahwa model pembelajaran Herrmann Whole Brain berpengaruh terhadap kemampuan representasi dan prestasi belajar siswa. Hasil ini diperoleh karena tahap-tahap pembelajaran dalam model pembelajaran Herrmann Whole Brain dapat melatihkan kemampuan representasi serta prestasi belajar siswa. Kemampuan representasi siswa terlihat pada tahap discussion dan repeating. Prestasi belajar siswa terlihat pada tahap investigation, discussion dan repeating.

Pengaruh geographical inquiry terhadap kemampuan berpikir analitis siswa dalam mata pelajaran geografi kelas XI IPS di SMAN 7 Malang / Rizka Nur Afivah

 

ABSTRAK Afivah, Rizka Nur . 2016. Pengaruh Geographical Inquiry terhadap Kemampuan Berpikir Analitis Siswa pada Mata Pelajaran Geografi Kelas XI IPS di SMAN 7 Malang. Skripsi, Jurusan Pendidikan Geografi, Fakultas Ilmu Sosial, Universitas Negri Malang. Pembimbing: (I) Dr. Budi Handoyo, M.Si, (II) Ir. Juarti, M.P. Kata Kunci: Geographical Inquiry, kemampuan berpikir analitis Pembelajaran saat ini hanya menekankan pada kemampuan berpikir tingkat dasar seperti hapalan dan mengetahui sebuah informasi. Kurikulum 2013 menekankan proses analisis yang mengharuskan siswa tidak hanya pada tingkatan memahami. Perlu adanya pengembangan kemampuan berpikir analitis agar pembelajaran tidak hanya bermanfaat sebagai pengetahuan saja tetapi dapat menumbuhkan wawasan yang baru pada siswa. Kemampuan berpikir analitis sangat dibutuhkan dalam kajian Geografi salah satunya adalah materi Dinamika dan masalah penduduk. Materi ini membahas mengenai kuantitas dan analisis demografi, kualitas penduduk dan permasalahan penduduk. Salah satu model pembelajaran yang mampu melatih kemampuan berpikir analitis dalam pembelajaran geografi adalah model Geographical Inquiry. Penelitian ini bertujuan untuk membuktikan adanya pengaruh model Geographical Inquiry terhadap kemampuan berpikir analitis geografi siswa kelas XI IPS SMAN 7 Malang. Penilitian ini dirancang menggunakan quasi eksperimen dengan posttest only control group design. Subyek penelitian adalah kelas XI IIS 2 sebagai kelas eksperimen dan kelas XII IIS 3 sebagai kelas kontrol. Instrumen penelitian menggunakan 4 soal essai yang telah diuji sebelumnya menggunakan validitas dan reliabilitas. Analisis data yang digunakan adalah Independent sample t-Test dengan bantuan SPSS 16.0 for windows. Hasil analisis uji t yang diperoleh, membuktikan bahwa nilai sig (2-tailed) 0.01 < 0.05 dan nilai rata-rata kelas eksperimen (85.06) lebih besar dari pada kelas kontrol (74.87), maka H0 ditolak. Dapat disimpulkan bahwa model pembelajaran Geographical Inquiry berpengaruh terhadap kemampuan berpikir analitis geografi siswa kelas XI SMAN 7 Malang. Berdasarkan penelitian yang dilakukan, saran diajukan kepada: (1) guru bidang studi geografi harus merencanakan pembelajaran model Geographical Inquiry dengan baik sehingga dapat dijalankan secara maksimal dan mengelola ketepatan waktu; (2) sekolah menganjurkan model Geographical Inquiry melalui pelatihan atau workshop pada guru pada materi yang bersifat analisis; (3) peneliti selanjutnya mampu mengelola kelas lebih baik dan terarah, menerapkan pada materi lainnya, mengambil lokasi penelitian di sekolah lain.

Persepsi mahasiswa Jurusan Pendidikan Luar Sekolah Fakultas Ilmu Pendidikan IKIP MALANG terhadap skripsi / oleh R. Dian Mursyidah Kholidiyati

 

Stigmatisasi perempuan dalam lagu dewa / Anisa Nur Rohma

 

ABSTRAK Nur Rohma, Anisa. 2014. Stigmatisasi Perempuan dalam Lirik Lagu Dewa. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Djoko Saryono, M.Pd, (II) Dr. Martutik, M.Pd. Kata Kunci: ketidakadilan gender, stigmatisasi perempuan, lirik lagu. Lirik lagu merupakan salah satu bagian dari karya sastra yang digemari oleh banyak kalangan masyarakat mulai dari anak-anak hingga orang dewasa. Lirik lagu memiliki bahasa dan makna yang sederhana sehingga mudah dipahami dan dijangkau oleh pemikiran masyarakat dari berbagai kalangan. Hampir seluruh lirik lagu yang ada di Indonesia mengandung ketidakadilan gender terutama tentang stigmatisasi perempuan. Misalnya pada lirik-lirik lagu Dewa, hampir seluruh lirik lagunya mengandung stigmatisasi perempuan yang berupa label-lebel negatif tentang anggapan bahwa perempuan adalah makhluk yang lembut, lemah, irasional, jahat, materialistis, dan sombong. Berkaitan dengan itu, maka diperlukan pembahasan mengenai hal tersebut. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal, yang mencakup ketidakadilan gender khususnya tentang stigmatisasi unsur gender, bentuk stigmatisasi perempuan, dan strategi musisi menstigmatisasi perempuan dalam lirik lagu Dewa. Penelitian ini menggunakan pendekatan penelitian kualitatif dan menggunakan pendekatan feminis. Sumber data pada penelitian ini yaitu lirik lagu Dewa yang terdapat pada Haiklip Dewa Risalah Lima Bintang edisi Februari 2001 yang diterbitkan oleh PT Penerbit Remaja Hai, Jakarta 2001, dengan tebal 80 halaman. Data penelitian berupa kalimat-kalimat dalam lirik lagu Dewa yang mengandung stigmatisasi perempuan. Pengumpulan data dilakukan dengan cara studi dokumentasi. Instrumen kunci dalam penelitian adalah peneliti sendiri, namun peneliti menggunakan instrumen pembantu berupa panduan kodifikasi data dan tabel panduan analisis data. Untuk menjaga keabsahan temuan, dilakukan kegiatan triangulasi data dengan tiga langkah. Pertama, membaca teks lirik lagu Dewa yang diteliti secara berulang-ulang untuk dapat memahami teks-teks yang terdapat di dalamnya sehingga peneliti memperoleh keakuratan dan kevalidan data. Kedua, mengamati dan mengidentifikasi data dengan ketelitian, kesungguhan, dan kecermatan agar dapat diperoleh data yang relevan. Ketiga, melakukan pemeriksaan terhadap keabsahan dengan memanfaatkan sesuatu luar data itu, yaitu dengan konsultasi kepada dosen pembimbing dan berdiskusi dengan teman sejawat agar hasil analisis dapat dipertanggung jawabkan keakuratannya.. Kegiatan analisis data dimulai dari tahap memilih dan mengodifikasi data, menganalisis data sesuai sesusi dengan rumusan masalah yang akan dikaji, dan tahap menarik kesimpulan serta verifikasi. Berdasarkan analisis data diperoleh tiga hasil penelitian sebagai berikut. Pertama, stigmatisasi unsur gender. Dalam lirik lagu Dewa, stigmatisasi unsur gender berupa stigmatisasi peran gender, stigmatisasi identitas gender, dan stigmatisasi perilaku gender. Stigmatisasi peran gender berupa anggapan bahwa perempuan tidak memiliki peran yang penting. Stigmatisasi identitas gender berupa anggapan bahwa ciri-ciri yang dimiliki oleh perampuan patut untuk dipublikasikan. Stigmatisasi perilaku gender berupa anggapan bahwa perilaku perempuan adalah sebagai daya pikat lawan jenisnya. Kedua, bentuk stigmatisasi yang dialami oleh perempuan. Dalam lirik lagu Dewa bentuk-bentuk stigmatisasi tersebut berupa pelabelan negatif tentang perempuan yang lembut, lemah, jahat, tidak setia, matrealistis, dan sombong. Perempuan yang lembut adalah perempuan yang memiliki perilaku yang baik dan santun. Namun kelembutan perempuan membuat laki-laki mudah untuk menyakiti perempuan. Perempuan yang lemah adalah perempuan yang mudah disakiti dan tidak memiliki kekuatan untuk melawan. Perempuan yang jahat adalah perempuan yang suka bertindak kasar kepada laki-laki. Perempuan yang tidak setia adalah perempuan yang suka menduakan pasangannya. Perempuan materialistis adalah perempuan yang hanya suka pada kekayaan pasangannya. Perempuan sombong adalah perempuan yang angkuh tidak peduli kepada sekelilingnya. Ketiga, strategi Dewa menstigmatisasi perempuan. Dalam lirik lagu Dewa, strategi yang digunakan musisi adalah dengan pemilihan gaya bahasa, perulangan bunyi atau rima, serta pemilihan tema yang mengandung stigmatisasi perempuan. Dalam pemilihan gaya bahasa, Dewa menggunakan diksi konotatif, diksi denotatif dan bahasa figuratif untuk mencerminkan stigmatisasi perempuan. Pengulangan bunyi atau rima digunakan Dewa untuk memberikan keindahan dan penekanan makna pada lirik lagunya. Pemilihan tema dilakukan Dewa untuk menggambarkan tentang stigmatisasi perempuan. Berdasarkan ketiga hasil tersebut, dapat disimpulkan bahwa lirik lagu Dewa mengandung stigmatisasi yang dapat merugikan perempuan nantinya. Penelitian ini diharapkan dapat memberikan manfaat kepada peneliti selanjutnya, penggemar lagu, serta para pencipta lagu lirik lagu.

Penerapan model pembelajaran kooperatif STAD untuk meningkatkan motivasi dan prestasi belajar fisika siswa kelas VIII-B SMPN 1 Malang tahun pelajaran 2008/2009 / Hanik Umi Utari

 

ABSTRAK Utari, Hanik Umi. 2009. Penerapan Model Pembelajaran Kooperatif STAD untuk Meningkatkan Motivasi dan Prestasi Belajar Fisika Siswa Kelas VIII-B SMP Negeri 1 Malang Tahun Pelajaran 2008/2009. Laporan Penelitian Tindakan Kelas, Program Sertifikasi Guru dalam Jabatan Melalui Jalur Pendidikan Profesi Guru IPA-SMP. FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Sumaryono, (II) Drs. H. Edi Supriana, M.Si. Kata kunci: Motivasi Belajar, Prestasi Belajar, STAD Berdasarkan observasi data lapangan dan wawancara dengan guru mitra di SMPN 1 Malang, diperoleh informasi bahwa dalam pembelajaran Fisika sebagian siswa aktif dan sebagian kurang antusias mengikuti kegiatan pembelajaran yang disampaikan oleh guru. Motivasi belajar dan prestasi belajar siswa masih bisa dioptimalkan. Tujuan penelitian ini adalah meningkatkan motivasi dan prestasi belajar Fisika melalui penerapan model pembelajaran kooperatif STAD pada materi Cahaya pada siswa kelas VIII-B SMP Negeri 1 Malang. Penelitian ini menggunakan pendekatan kualitatif dengan jenis Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam dua siklus. Penelitian ini dilak- sanakan pada bulan Maret sampai dengan bulan Juli 2009. Data penelitian berupa motivasi belajar siswa diperoleh melalui angket dan observasi, sedangkan prestasi belajar siswa diperoleh melalui tes akhir siklus. Dari penelitian ini dapat disimpulkan bahwa penggunaan model pembelajaran kooperatif STAD dapat meningkatkan motivasi dan prestasi belajar Fisika pada materi Cahaya siswa kelas VIII-B SMP Negeri 1 Malang tahun pela- jaran 2008/2009. Dari hasil observasi motivasi belajar selama berlangsungnya proses pembelajaran pada siklus pertama dan kedua diperoleh data: (1) aspek frekuensi pertanyaan yang diajukan siswa meningkat dari 67,44% menjadi 74,93%, (2) aspek kualitas pertanyaan yang diajukan siswa meningkat dari 68,21% meningkat menjadi 73,56%, (3) aspek kerjasama antar siswa dalam menyelesaikan tugas meningkat dari 74,22% menjadi 78,88%, (4) aspek peningkatan sumber belajar yang dimanfaatkan oleh siswa meningkat dari 72,49% menjadi 78,65%. Berdasarkan hasil angket yang diisi siswa di setiap akhir siklus diperoleh data bahwa pada siklus pertama siswa yang bermotivasi belajar rendah sebesar 23,8%, siswa yang bermotivasi belajar sedang sebesar 57,2% dan siswa yang bermotivasi belajar tinggi sebesar 19%. Pada siklus kedua terjadi perubahan yang cukup signifikan, yakni terjadi pengurangan jumlah siswa yang bermotivasi belajar fisika rendah dari 10 orang menjadi 5 orang (berkurang 50%), jumlah siswa yang bermotivasi belajar Fisika sedang berkurang dari 24 menjadi 20 orang (turun 16%) dan jumlah siswa yang bermotivasi belajar Fisika tinggi meningkat dari 8 menjadi 17 orang (naik 53%) Dari hasil analisis evaluasi belajar akhir siklus, prosentase siswa yang me- menuhi KKM 71,43%) pada siklus pertama meningkat menjadi 85,71% pada siklus kedua.

A contrastive analysis of english and Indonesian syntactic structures
oleh Muhadjiron Amier

 

Panorama reading strategy and second language content-area reading comprehension skill of students across cognitive styles and gender / Ika Fitriani

 

ABSTRAK Fitriani, Ika. 2015. Strategi PANORAMAterhadap Pemahaman Siswa dalam Membaca Konten Berbahasa Inggris ditinjau dari Gaya Kognitif dan Gender.Magister Tesis,Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Gunadi Harry Sulistyo, M.A., (II) Dr. Mirjam Anugerahwati, M.A. Kata Kunci:PANORAMA, membaca konten, gaya kognitif, gender Penelitian ini merupakan penelitian eksperimental kuasi dengan desain faktorial 2x2x2 yang bertujuan untuk menginvestigasi efek variabel bebasdari strategi membaca bernama PANORAMA yang terdiri atas Purpose, Adaptability, Need to pose questions, Overview, Read and Relate, Annotate, Memorize, danAssess,dibandingkan dengan strategi menerjemahkan dan membaca nyaring (yang kemudian disebut sebagai TRA)dalam memahami bacaan konten berbahasa Inggrisditinjau dari gaya kognitif dan gender siswa. Group Embedded Figure Test (GEFT), tes membaca berbentuk soal objektif, dan kuesioner digunakan sebagai instrumen dalam proses pengumpulan data. Subjek dari penelitian ini adalah kelas VIII-B dan VIII-C di SMPN 1 Batu.Diakhir proses eksperimen, dua kelompok diberipost-testyang hasilnya digunakan sebagai dasar dalam uji hipotesis. Jika nilai p hitung kurang dari .05 berarti kelompok eksperimen secara signifikan berbeda dengan kelompok kontrol. Setelah proses perhitungan statistik, diketahui bahwaperbedaan kelas eksperimenyangdiajar dengan menggunakan PANORAMA dan kelas kontrol yang yang diajar dengan menggunakan TRA tidak signifikan dengan nilai hitung.901,perbedaan siswa dengan gaya kognitif FD dan FI dalam hal membaca pemahaman konten juga tidak signifikan dengan nilai hitung .387, perbedaan tingkat membaca pemahaman dengan memperhatikan variabel gender (pria dan wanita) juga menunjukkan nilai yang tidak signifikan yaitudengan nilai hitung .100, serta tidak ada interaksi antar variabel (strategi membaca, gaya kognitif, dan gender) sebagaimana ditunjukkan oleh nilai hitung yaitu .347. Hasil yang tidak signifikan antara dua kelompok disebabkan oleh beberapa hal, antara lain: langkah-langkah pengajaran membaca yang mirip antara kelompok eksperimental dengan kelompok kontrol yaitu dengan menggunakan tahap pre-reading, whilst-reading, dan post-reading. Tahap menanya dalam pre-reading juga mampu memfasilitasi siswa FD untuk mengaktivasi pengetahuan awal yang berperan besar dalam memahami teks. Kegiatan pembelajaran yang didesain secara berkelompok selama proses eksperimen juga memberikan keuntungan bagi siswa FD karena mereka akan mendapatkan hasil belajar yang lebih optimal jika bekerja dalam kelompok dibandingkan dengan kerja individu. Selanjutnya, gender juga tidak mempengaruhi kemampuan siswa dalam membacapemahaman, namun kualitas proses pembelajaran yang berperan dalam mempengaruhi pencapaian tujuan pembelajaran. Pada proses analisis selanjutnyapada pengaruh masing-masing faktor, ditemukan bahwa diantara ketiga variabel bebas (strategi membaca, gaya kognitif, dan gender), gaya kognitif paling mendominasi dibandingkan dengan dua variabel bebas lainnya dengan nilai persentase 17,56%. Diketahui pula bahwa kombinasi faktor antara PANORAMA-wanita dan PANORAMA-FI merupakan kombinasi yang paling tinggi dominasinya dibandingkan dengan kombinasi antar faktor lain, yaitu dengan nilai 48% dan 23%. Selanjutnya, walaupun temuan menyatakan perbedaan yang tidak signifikan, berdasarkan hasil dari kuesioner siswa,ditemukan bahwa PANORAMA mendapatrespon positif dengan nilai keseluruhankuesioner 89.64. Oleh karena itu, dapat disimpulkan bahwaPANORAMAdapat dijadikan sebagai salah satu alternatif strategi membaca untuk membantu siswa memahami bacaan konten berbahasa Inggris, mengasosiasikan apa yang dibaca siswadengan pengetahuan awal, mengurangi kebosanan selama proses pembelajaran, meningkatkan rasa percaya diri siswa, memberikan pengalaman belajar yang bervariasi, serta menciptakan pembelajaran yang lebih hidup dan bermakna.

Pengaruh karakteristik perusahaan terhadap volume pengungkapan sosial pada laporan tahunan perusahaan : studi pada Perusahaan High Profile yang terdaftar di PT. Bursa Efek Jakarta : oleh Dwi Susilo Anggraini

 

A proposed syllabus for the English courses in Pesantren Mahasiswa Al Hikam Malang / by Tirmidi

 

Penerapan metode inkuiri untuk meningkatkan kemampuan komunikasi matematis siswa kelas VIII B SMP Negeri 2 Sampung / Wilis Sindhu Kiswara

 

Kiswara, Wilis Sindhu. 2014. Penerapan Metode Inkuiri untuk Meningkatkan Kemampuan Komunikasi Matematis Siswa Kelas VIII SMP Negeri 2 Sampung. Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Dr. Subanji, M.Si. Kata Kunci: Metode Inkuiri, Komunikasi Matematis, Teorema Pythagoras.          Yang dimaksud kemampuan komunikasi matematis dalam penelitian adalah kemampuan yang seharusnya dikuasai oleh siswa yang meliputi hal-hal sebagai berikut: (a) menjelaskan ide dan situasi secara tulisan, (b) menyatakan gambar atau diagram ke dalam ide-ide matematika,(c) menyatakan situasi ke dalam model matematika/ gambar. Dari informasi yang diperoleh, baik dari pengamatan yang dilakukan peneliti maupun dari wawancara kepada guru, maka dapat diketahui bahwa tingkat kemampuan komunikasi matematis siswa kelas VIII B SMP Negeri 2 Sampung masih relatif rendah.     Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan proses pembelajaran dengan menggunakan metode inkuiri yang dapat meningkatkan kemampuan komunikasi matematis siswa kelas VIII B SMP Negeri 2 Sampung. Penelitian ini merupakan penelitian tindakan kelas (PTK) dengan subjek siswa kelas VIII B SMP Negeri 2 Sampung berjumlah 27 siswa.     Pada saat pelaksanaan pembelajaran, kegiatan awal, guru memberikan apersepsi untuk mengingatkan siswa tentang materi dasar yang akan digunakan kembali dalam pembelajaran mengenai Teorema Pythagoras. Selain itu, guru juga memberikan motivasi kepada siswa tentang kegunaan Teorema Pythagoras dalam kehidupan sehari-hari. Pada kegiatan inti ini dilakukan kegiatan pembelajaran yang mengacu sesuai dengan komponen-komponen metode inkuiri yang digunakan dalam penelitian ini yaitu: (a) mengkondisikan berpikir matematis dengan memberikan masalah. (b) mendorong siswa untuk menemukan (inquiri) (c) memberikan Scaffolding. (d) menguji gagasan melalui kelompok. (e) mengembangkan pengetahuan siswa untuk berkomunikasi matematis. Sebagai kegiatan akhir, guru membimbing siswa untuk membuat kesimpulan tentang materi yang telah dilakukan dalam pembelajaran.     Jadi pembelajaran dengan metode inkuiri yang dapat meningkatkan kemampuan komunikasi matematis siswa adalah pada tahapan mengkondisikan berpikir matematis dengan memberikan masalah, yang dilakukan siswa adalah Siswa mulai memberikan dugaan dan pembenaran tanpa dorongan guru. Selama diskusi kelas, siswa memulai argumentasi antar siswa tanpa mediasi guru. Pada tahapan mendorong siswa untuk menemukan (inquiri), yang dilakukan adalah Siswa mulai menunjukkan dan memperbaiki kesalahan mereka sendiri dan yang dibuat oleh guru. siswa spontan berkonsultasi yang ada pada buku teks dan beberapa contoh untuk memperjelas pemahaman mereka. Pada tahapan memberikan Scaffolding yang dilakukan adalah Siswa secara spontan memberikan klarifikasi, elaborasi, kritik, dan pembenaran. Siswa mengambil jawaban untuk menunjukkan langkah-langkah strategis dan menghubungkan ke pengetahuan sebelumnya. Pada tahapan menguji gagasan melalui kelompok yang dilakukan adalah Siswa membentuk kelompok informal untuk memantau kemajuan mereka, mencari umpan balik pada ide-ide, dan menjelaskan ide satu sama lain. Dan yang terakhir pada tahapan mengembangkan pengetahuan siswa untuk berkomunikasi matematis yang dilakukan adalah Siswa mulai berdebat mengenai kesesuaian masing-masing dan manfaatnya relatif berbeda dari yang biasanya.     Data penelitian menunjukkan bahwa Hasil penerapan pembelajaran dengan metode inkuiri dapat meningkatkan kemampuan komunikasi matematis siswa. Dari hasil tes pada siklus 1 menunjukkan bahwa 18 siswa berada pada kategori minimal baik atau 66,6% siswa pada kategori minimal baik. Oleh karena itu penelitian dilanjutkan pada siklus ke dua. Pada siklus 2 berdasarkan hasil tes, kemampuan komunikasi siswa berada pada kategori baik yaitu 21 siswa berada pada kategori minimal baik, atau sebesar 77,7% siswa pada kategori minimal baik. Dari data tersebut diketahui bahwa ada peningkatan kemampuan komunikasi matematis siswa kelas VIII B SMP Negeri 2 Sampung dari siklus 1 ke siklus 2.

Upaya peningkatan kemampuan siswa menulis laporan hasil wawancara melalui pedoman wawancara di kelas V SDN Wedoro 1 Kecamatan Pandaan Kabupaten Pasuruan / Wensislaus Labok

 

Kata Kunci: kemampuan, menulis, pedoman, laporan, SD Keterampilan menulis itu sulit, tetapi peranannya dalam kehidupan manusia sangat penting dalam masyarakat sepanjang zaman. Kegiatan menulis dapat ditemukan dalam aktivitas manusia setiap hari, seperti menulis surat, laporan, buku, artikel, dan sebagainya. Dapat dikatakan, bahwa kehidupan manusia hampir tidak bisa dipisahkan dari kegiatan menulis. Menulis laporan hasil wawancara yang digunakan dalam penelitian ini melalui pedoman wawancara, karena kemampuan menulis siswa dalam pembelajaran bahasa Indonesia di SDN Wedoro I masih rendah. Tujuan dalam penelitian ini untuk (1) mendeskripsikan aktivitas siswa kelas V SDN Wedoro 1 kecamatan Pandaan dalam menulis laporan hasil wawancara melalui pedoman wawancara pada pembelajaran Bahasa Indonesia, (2) mendeskripsikan kemampuan siswa dalam menulis laporan hasil wawancara di kelas V SDN Wedoro 1 Kecamatan Pandaan Kabupaten Pasuruan, setelah pedoman wawancara diterapkan pada materi pembelajaran Bahasa Indonesia. Penelitian ini dilakukan dalam dua siklus di SDN Wedoro I kecamatan Pandaan kabupaten Pasuruan. Siklus I dilaksanakan pada hari Selasa, tanggal 26 Mei 2010 dan dilaksanakan siklus II pada hari Kamis, tanggal 3 Juni 2010. Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (Classroom Action Research) dan mengacu pada rancangan penelitian desain PTK model Kemmis dan Taggart. Data yang telah terkumpul akan dianalisis secara deskriptif, baik deskriptif kualitatif maupun deskriptif kuantitatif. Hasil evaluasi kemampuan menulis dalam penelitian ini adalah Kemampuan menulis siswa yang diperoleh pada pra tindakan, secara klasikal adalah 59,78%. Sedangkan pada siklus I kemampuan menulis siswa secara klasikal meningkat menjadi 6,60%. Pada siklus II kemampuan menulis siswa secara klasikal meningkat menjadi 8,60%. Penggunaan pedoman wawancara dalam penelitian ini, dapat meningkatkan aktivitas dan kemampuan siswa kelas V SDN Wedoro I dalam menulis laporan hasil wawancara.

Asosiasi echinodermata dan lamun di Teluk Gilimanuk Taman Nasional Bali Barat / Anita Setyawati

 

Setyawati, Anita. 2014. Asosiasi Echinodermata dan Lamun di Teluk Gilimanuk Taman Nasional Bali Barat. Skripsi. Jurusan Biologi FMIPA Universitas Negeri Malang. Pembimbing (I) Dr.Ibrohim, M.Si, (II) Drs. Agus Dharmawan, M.Si. Kata kunci: asosiasi, Echinodermata, lamun, Teluk Gilimanuk     Teluk Gilimanuk merupakan kawasan yang ditumbuhi lamun dan masuk dalam zona tradisional Taman Nasional Bali Barat. Salah satu hewan yang hidup di sekitar padang lamun ialah Echinodermata. Aktifitas yang dilakukan oleh masyarakat sekitar dapat menggangu lamun dan Echinodermata. Asosiasi spesies Echinodermata dan lamun dapat digunakan untuk melihat tingkat kesesuaian suatu habitat bagi keberadaan spesies yang hidup di ekosistem padang lamun. Tujuan penelitian ini untuk mengetahui asosiasi Echinodermata dan lamun di Teluk Gilimanuk Taman Nasional Bali Barat. Penelitian ini dilaksanakan pada bulan November-Desember 2013. Metode yang digunakan metode kuadrat yang diletakkan pada garis transek, dengan ukuran tiap kuadran 2x2 m. Asosiasi inter-spesies Echinodermata dan lamun diketahui dengan analisis cluster, sedangkan hubungan Echinodermata dan lamun dianalisis dengan korelasi. Hasil penelitian menunjukkan terdapat 12 spesies Echinodermata dan 5 spesies lamun. Analisis asosiasi inter-spesies Echinodermata dibagi menjadi 2 kelompok, yaitu kelompok dengan model berjenjang dan kelompok kedua model berkelompok. Asosiasi inter-spesies lamun menunjukkan Thalassia heprichii, dan Enhalus acoroides merupakan spesies yang memiliki hubungan paling dekat. Asosiasi Echinodermata dan lamun menunjukkan hasil lamun dan Echinodermata tidak memiliki hubungan yang signifikan. Faktor abiotik yang diukur tidak berpengaruh secara nyata terhadap jumlah Echinodermata dan persen penutupan lamun.

Analisis pengaruh faktor sosial ekonomi terhadap pengeluaran konsumsi rumah tangga miskin (studi kasus di Kelurahan Tanjungrejo Kecamatan Sukun Kota Malang) / Oky Cahyaning Rahayu Sutoko

 

ABSTRAK Sutoko, Oky Cahyaning Rahayu. 2015. Analisis Pengaruh Faktor Sosial Ekonomi Terhadap Pengeluaran Konsumsi Rumah Tangga Miskin (Studi Kasus di Kelurahan Tanjungrejo Kecamatan Sukun Kota Malang). Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Farida Rahmawati, S.E., M.E, (II) Dr. Imam Mukhlis, S.E., M.Si. Kata kunci: jumlah pendapatan rumah tangga, jumlah anggota rumah tangga, tingkat pendidikan kepala rumah tangga, pengeluaran konsumsi rumah tangga Dalam aktivitas perekonomian suatu negara, konsumsi mempunyai peran penting di dalamnya serta mempunyai pengaruh yang sangat besar terhadap Produk Domestik Bruto (PDB). Konsumsi rumah tangga merupakan salah satu kegiatan ekonomi rumah tangga untuk memenuhi berbagai kebutuhan barang dan jasa. Oleh sebab itu, konsumsi sering digunakan sebagai salah satu indikator untuk mengukur tingkat kesejahteraan rumah tangga. Rumusan masalah dalam penelitian ini adalah (1) Bagaimana pengaruh jumlah pendapatan rumah tangga terhadap pengeluaran konsumsi rumah tangga miskin di Kelurahan Tanjungrejo? (2) Bagaimana pengaruh jumlah anggota rumah tangga terhadap pengeluaran konsumsi rumah tangga miskin di Kelurahan Tanjungrejo? (3) Bagaimana pengaruh tingkat pendidikan kepala rumah tangga terhadap pengeluaran konsumsi rumah tangga miskin di Kelurahan Tanjungrejo? (4) Bagaimana pengaruh jumlah pendapatan rumah tangga, jumlah anggota rumah tangga, dan tingkat pendidikan kepala rumah tangga secara simultan terhadap pengeluaran konsumsi rumah tangga miskin di Kelurahan Tanjungrejo? Penelitian ini menggunakan metode deskriptif pendekatan kuantitatif. Populasi dalam penelitian ini adalah seluruh rumah tangga miskin penerima Raskin di RW 13 Kelurahan Tanjungrejo. Metode yang digunakan dalam penarikan sampel adalah sampling jenuh atau sensus. Pengumpulan data dalam penelitian ini dengan cara wawancara langsung pada rumah tangga sampel menggunakan daftar kuesioner. Sedangkan analisa data dalam penelitian ini menggunakan metode regresi linier berganda. Hasil analisis data menunjukkan bahwa: (1) Jumlah pendapatan rumah tangga (X1) berpengaruh signifikan dan positif terhadap pengeluaran konsumsi rumah tangga (Y), (2) Jumlah anggota rumah tangga (X2) berpengaruh signifikan dan positif terhadap pengeluaran konsumsi rumah tangga (Y), (3) Tingkat pendidikan kepala rumah tangga (X3) berpengaruh positif dan tidak signifikan terhadap pengeluaran konsumsi rumah tangga (Y), (4) Secara simultan menjelaskan bahwa jumlah pendapatan rumah tangga (X1), jumlah anggota rumah tangga (X2), dan tingkat pendidikan kepala rumah tangga (X3) berpengaruh signifikan terhadap pengeluaran konsumsi rumah tangga (Y). Berdasarkan hasil penelitian tersebut, saran yang dapat diajukan dalam penelitian ini antara lain, bagi Pemerintah Kota Malang, khususnya Pemerintah Kelurahan Tanjungrejo diharapkan untuk melakukan langkah strategis guna meningkatkan kesejahteraan rumah tangga miskin dengan memperluas lapangan kerja yang sesuai dengan kemampuan rumah tangga melalui program kewirausahaan dan bagi peneliti selanjutnya diharapkan untuk melakukan penelitian lebih lanjut mengenai faktor-faktor yang mempengaruhi pengeluaran konsumsi rumah tangga miskin dengan menambahkan variabel lain yang lebih spesifik, selain itu juga perlu diadakan penelitian yang sama pada rumah tangga kaya.

Hubungan antara kondisi fisik tempat kerja dengan prestasi kerja pegawai
(penelitian pada pegawai Dinas Pendidikan Kabupaten Malang)
oleh Endah Widiastutik

 

Suatup restaski erjat idak dihasilkand engans endirinyao leh setiapp egawai, tetapi ditentukano leh m&cam-macamfa ktor yang mendukungp restasi_kerjaS. alah satunyaa dalah kondisi fisik tempat kerja yang baik. Dengan adanyak ondisi fisik kerja yang nyaman,b ersih, pencahayaany ang cukup serta ventilasi yang baik akan *.ni*U.rt-tun kegairahan kerja pegawai sehingga pegawai dapat menyelesaikan tugas/pekerjaaynu .,g dibebankan padanyad engan baik. Rumusan masalahd alam pJ*Utiun i"i uOuUfl (1) bagaimanakahk ondisi fisik tempatk erja pegawaiD inas iendidikanK abupatenM alang?,( 2) bagaimanakathin gkat prestasik erja pegawai Dinas Pendidikan Kabupaten Malang?, (3) apakah ada hubungan antara kondisi fisik tem' pakt erjad enganp reitasik erjap egawaDi inasP endidikanK abupatenM alang? trianfaat dari hasil penelitian ini bagi Dinas Pendidikan Kabupaten Malang adalahs ebagati ambahani nformasi mengenaih al-hal yang ada kaitannyad engan kondisif isik tempat kerja dan prestasik erja pegawai.R ancanganp enelitiany ang digunakaand atahd iskriptif korelasional- Teknik yung dip"rgunakand alam pengumpuland ata adalah: (1) teknik angket, (2) teknik *u*un"u.a, (3) teknik dokumentasi. Sedangkan penelitian ini terirasukp enelitianp opulasi,k arenaju mlah respondenku rangd ari I 00' Teknik analisis data yang digunakan dalam penelitian inr yaitu analisis prosentasdei gunakanu ntuk menganalisak ondisi frsik tempat kerja dan pretasik erja pegawai.S edangtcanu ntuk mengetahui ada tidaknya hubungan signifikan antara toidisi frsik tempat kerja dengan prestasi kerja digunakan teknik analisis korelasi tata jenjangS pearmadne ngans kalad atao rdinal. Hasil analisis menunjukkan bahwa (l) kondisi fisik tempat kerja Dinas PendidikaKna bupatenM alangpadat ingkatb aik (69,64o /,),( 2) kondisip restaski erja 'pheog6auwoagi*D inas Pendidikan KiUupaten Malang pada tingkat ting$, (3) terdapat yang sigrrifikan antara kondisi fisik tempat keqia dengan prestasi kerja p"gu*ii Oi"alpe"aiAikan Kabupaten Malang yang ditunjukkan oleh nilai koefisien i.oi.t*i rho hitung 0,9880 lebitr besar dari rho tabel 0,266 pada N : 56 dan taraf sisffikan 5 %. ut

Pengaruh keefektifan manajemen kelas terhadap partisipasi siswa dalam pembelajaran di SMPN se-kecamatan Talun Kabupaten Blitar / Nisaul Ummah

 

ABSTRAK Ummah, Nisaul. 2016. Pengaruh Keefektifan Manajemen Kelas terhadap Partisipasi Siswa dalam Pembelajaran di SMPN se-Kecamatan Talun Kabupaten Blitar. Skripsi, Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan. Dosen Pembimbing: (I) Drs. H. Burhanuddin, M.Ed, Ph.D, (II) Teguh Triwiyanto, S.Pd, M.Pd Kata kunci: manajemen kelas, partisipasi siswa Manajemen Mengelola kelas merupakan salah satu tugas guru yang perlu diperhatikan, karena penting bagi penciptaan situasi pendukung suasana pembelajaran. Suasana tersebut diharapkan mampu mendorong partisipasi siswa, sehingga siswa mampu mengikuti proses pembelajaran yang diberikan oleh guru secara optimal. Partisipasi siswa dalam pembelajaran, yaitu meliputi bertanya hal yang belum jelas, mencatat, mendengar, berfikir, membaca, dan segala kegiatan yang dilakukan yang dapat menunjang prestasi belajar. Keefektifan manajemen kelas diharapkan mampu memengaruhi siswa untuk aktif berpartisipasi dalam aktivitas pembelajaran. Tujuan penelitian ini: (1) Mengukur sejauh mana keefektifan manajemen kelas di SMPN se-Kecamatan Talun, (2) Sejauh mana partisipasi siswa dalam pembelajaran SMPN se-Kecamatan Talun Kabupaten Blitar, (3) Menjelaskan sejauh mana pengaruh keefektifan manajemen kelas terhadap tingkat partisipasi siswa dalam proses pembelajaran di SMPN se-Kecamatan Talun Kabupaten Blitar. Penelitian ini merupakan penelitian kuantitatif dan metode penelitian ini berupa survei. Populasi dalam penelitian ini siswa kelas VIII SMPN se-Kecamatan Talun Kabupaten Blitar. Penentuan sampel dengan teknik simple random sampling. Berdasarkan teknik tersebut, diperoleh sampel SMPN 1 Talun sebanyak 70 siswa dan SMPN 2 Talun sebanyak 65 siswa. Teknik pengumpulan data menggunakan angket tertutup. Uji reliabilitas menggunakan Alpha Cronbach yang menunjukkan indeks reliabilitas 0,923 untuk manajemen kelas dan 0,727 untuk partisipasi siswa. Sebelum dilakukan analisis data, terlebih dahulu dilakukan uji normalitas dan uji homogenitas yang menunjukkan, bahwa data berdistribusi normal dan homogen. Hasil penelitian menunjukkan adanya pengaruh keefektifan manajemen kelas terhadap partisipasi siswa dalam pembelajaran di SMPN se-Kecamatan Talun Kabupaten Blitar. Hasil tersebut dapat ditunjukkan melalui uji hipotesis dengan uji t-Test dan dapat diketahui hasil perhitungan didapatkan nilai Thitung sebesar 0,379 dan Ttabel sebesar 1,656, nilai ttabel diperoleh dari df = 135 - 2 (variabel) - 1. Karena nilai Thitung< Ttabel, maka kesimpulan yang didapat yaitu terdapat pengaruh keefektifan manajemen kelas terhadap partisipasi siswa dalam pembelajaran di SMPN se-Kecamatan Talun Kabupaten Blitar. Implikasi penelitian ini, yaitu: (1) Pendekatan manajemen kelas sudah baik, akan tetapi perlu ditingkatkan lagi agar menjadi lebih baik dan lebih maksimal, (2) Perlu melatih guru dalam mendalami manajemen kelas untuk meningkatkan partisipasi siswa dalam proses pembelajaran, dan (3) Perlu adanya inovasi-inovasi tentang pelaksanaan manajemen kelas untuk membangkitkan kinerja guru dalam proses belajar-mengajar. Demikian saran penelitian ini yaitu (1) Kepala Dinas Pendidikan Kabupaten Blitar, sebaiknya membuat kebijakan baru untuk memberikan pelatihan secara berkala tentang manajemen kelas yang baik untuk proses pembelajaran siswa di kelas. Selain itu, Kepala Dinas membina kepala sekolah tentang bagaimana melakukan manajemen kelas yang baik agar dapat membimbing guru secara langsung. (2) Kepala SMPN se-Kecamatan Talun Kabupaten Blitar, sebaiknya lebih sering melakukan kunjungan kelas untuk memantau langsung bagaimana manajemen kelas yang dilakukan guru. Memberikan kesempatan seminar atau workshop kepada guru agar dapat memahami dan mendalami manajemen kelas yang baik secara lebih mendalam. (3) Mahasiswa Jurusan Administrasi Pendidikan, sebaiknya mendalami manajemen kelas dengan maksimal agar dapat menciptakan inovasi manajemen kelas yang ideal untuk siswa dan mudah untuk dilaksanakan oleh guru pada saat proses pembelajaran. (4) Peneliti Lain sebaiknya melanjutkan penelitian tentang pengaruh manajemen kelas dengan bidang lainnya yang lebih relevan.

Isolasi, identifikasi, dan uji aktivitas senyawa flavonoid dari biji pepaya (Carica papaya L.) sebagai inhibitor lipase pankreas / Pancasari Wijiutami

 

ABSTRAK Wijiutami, P. 2016. Isolasi, Identifikasi, dan Uji Aktivitas Flavonoid dari Biji Pepaya (Carica papaya L.)Sebagai Inhibitor Lipase Pankreas. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H.Subandi, M.Si., (II) Tatas H.P. Brotosudarmo, Ph.D Kata kunci : Biji pepaya, Flavonoid, Orlistat, Inhibitor lipase pankreas Obesitas merupakan salah satu masalah global karena dapat memicu berbagai penyakit seperti, jantung koroner, diabetes, arterosklerosis, dan sebagainya. Salah satu penyebab obesitas adalah karena konsumsi lemak berlebih. Absorbsi lemak ke dalam tubuh memerlukan enzim lipase pankreas. Oleh sebab itu untuk mengurangi absorbsi lemak di dalam tubuh digunakan obat anti obesitas yaitu, Orlistat yang bekerja sebagai inhibitor lipase pankreas.Penelitian sebelumnya menunjukkan bahwa sari biji pepaya terbukti mampu menghambat lipase pankreas dengan daya inhibisi yang lebih besar dari Orlistat pada berat yang sama, akan tetapi belum diketahui jenis senyawa aktif dalam biji pepaya tersebut, oleh karena biji pepaya banyak mengandung flavonoid, sementara beberapa senyawa flavonoid mampu menghambat lipase pankreas maka penelitian ini bertujuan untuk mengisolasi dan mengidentifikasi senyawa flavonoid di dalam biji pepaya yang aktif sebagai inhibitor lipase pankreas. Penelitian ini bersifat deskriptif laboratoris yang dilakukan dalam 6 tahap yaitu: 1) penyiapan sampel serbuk biji pepaya (pengeringan dan penghalusan), 2) ekstraksi menggunakan pelarut etanol-air dengan metode maserasi, 3) pemisahan senyawa golongan flavonoid dengan Kromatografi Lapis Tipis (KLT), 4) uji fitokimia senyawa flavonoid, 5) uji aktivitas isolat flavonoid sebagai inhibitor lipase pankreas, serta 6) spektroskopi UV-VIS dan FT-IR untuk memprediksi struktur isolat flavonoid. Daya inhibisi terhadap lipase pankreas ditentukan dengan metode titrimetri menggunakan pankreatin lipase sebagai sumber enzim, minyak zaitun sebagai substrat, dan Orlistat sebagai inhibitor pembanding. Uji fitokimia dilakukan menggunakan H2SO4 pekat untuk menunjukkan keberadaan senyawa flavonoid di dalam biji pepaya¬. Hasil penelitian menunjukkan bahwa ada dua jenis senyawa flavonoid dari ekstrak etanol biji pepaya yang aktif sebagai inhibitor lipase pankreas.Kedua isolat flavonoidmempunyai daya inhibisi terhadap lipase pankreas masing-masing 132 kali dan 12 kali lebih kuat dibandingkan Orlistat pada massa yang sama. Analisis spektrum UV-VIS dan IR menunjukkan bahwa kedua isolat diduga mempunyai struktur yang mirip dengan 2 senyawaflavanol yaitu senyawaepicatechin dan catechin.

Hubungan persepsi pemberian insentif dan motivasi kerja pada karyawan Koperasi Agro Niaga (KAN) Jabung / oleh Samsidah

 

Efek ekstrak etanol daun tahi kotok (Tagetes erecta L.) terhadap penghambatan aktivitas makan belalang hijau (Oxya chinensis Thunb) pada tanaman padi (Oryza sativa L.) / Tiara Dwi Nurmalita

 

ABSTRAK Nurmalita, Tiara Dwi. 2016. Efek Ekstrak Etanol Daun Tahi Kotok (Tagetes erecta L.) terhadap Penghambatan Aktivitas Makan Belalang Hijau (Oxya chinensis Thunb) pada Tanaman Padi (Oryza sativa L.).Skripsi, JurusanBiologi, FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: (I) Dr. FatchurRohman, M.Si, (II) Sofia EryRahayu, S.Pd.,M.Si. Kata Kunci:Ekstraketanol,daunTahiKotok (TageteserectaL.), penghambatanaktivitasmakan, BelalangHijau (OxyachinensisThunberg). BelalangHijau (OxyachinensisThunberg) merupakansalahsatuhama yang menyerangtanamanpadi (Oryza sativa L.).Salah satubahanalamyang dapatdigunakansebagaipengendalihamaBelalangHijau (O.chinensis) yaitutumbuhanTahiKotok (TageteserectaL.).Tujuanpenelitianiniyaitu mengujiekstraketanol daun Tahi Kotok (T. erecta) terhadap penghambatan aktivitas makan Belalang Hijau (O. chinensis) pada padi (Oryza sativa L.), menentukan konsentrasi ekstrak etanol daun Tahi Kotok (T. erecta) yang efektifterhadap penghambatan aktivitas makan Belalang Hijau (O. chinensis) pada padi (O. sativa), danmenentukanbesarpersentasipenghambatanaktivitasmakanBelalangHijau (O.chinensis) padapadi (O. sativa)setelahdidedahkandenganekstraketanol daun Tahi Kotok (T. erecta). JenispenelitianeksperimentaldengandesainPenelitianmenggunakanRancanganAcakKelompok.Variabelbebasberupapemberiankonsentrasiekstrak etanoldaun Tahi Kotok (T. erecta) dengan konsentrasi 0%, 5%, 10%, 15% dan 20%.Sedangkanvariabelterikatberupaluas daun padi yang dimakan oleh Belalang Hijau dengan satuan mm2.Setiapperlakuandiulangsebanyak 5 kali.ObyekpenelitianyaituBelalangHijau (O. chinensis) sebanyak 125 ekor.EkstrakdaunT. erectadioleskanpadadaunpadi yang berumur 25—30 hari.Penghambatanaktivitasmakandiamatisetelah 24 jam pendedahanekstraketanoldaunTahiKotokpadadaunpadi. HambatanaktivitasmakanO. chinensisdilakukandengancaramenghitungluasdaunpadi yang dimakanO. chinensispadakertas millimeter blok.Data yang didapatberupaluasdaunpadi yang dimakanolehO. chinensiskemudiandianalisisdengan ANAVA non faktorialuntukmelihatefekekstraketanol daun Tahi Kotok (T. erecta) terhadap penghambatan aktivitas makan Belalang Hijau (O. chinensis) pada padi (Oryza sativa L.).PersentasehambatanaktivitasmakanO. chinensisdianalisissecaradeskriptifdenganmenggunakanrumusdariAbdelgaliel& El-Aswad (2005). HasilpenelitianmenunjukkanbahwaekstraketanoldaunTahiKotok (T. erecta) memilikiefekpenghambatanaktivitasmakanBelalangHijau (O. chinensis).KonsentrasiekstraketanoldaunT. erecta5% hingga 20% tidakberbedasecarasignifikandalammenghambataktivitasmakanO. chinensis.Konsentrasi yang efektifsebagaipenghambataktivitas makan Belalang Hijau (O. chinensis) pada yaitukonsentrasi 5%.PersentasepenghambatanaktivitasmakanO. chinensistertinggipadakonsentrasi 20% sebesar 93,32%, danterendahpada 5% denganpersentasehambatanmakansebesar 83,90%.

Pelaksanaan teknik-teknik supervisi pengajaran oleh kepala sekolah dasar negeri pada desa terpencil di Kecamatan Salahutu Kabupaten Maluku Tengah / oleh Hasan Umarella

 

Kritik formalistik terhadap karya lukis Bara Widjaya yang berjudul mengusung hari depan dan menangkap dari belakang / Elok Santi Jesica

 

ABSTRAK Jesica, Elok Santi. 2015. Kritik Formalistik Terhadap Karya Lukis Bara Widjaya Yang Berjudul Mengusung Hari Depan dan Menangkap dari Belakang. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Drs. Triyono Widodo, M. Sn, (II) Drs. Eko Budi Winarno. Kata Kunci: karya lukis, kritik formalistik Karya lukis yang berjudul ”Mengusung Hari Depan” (2013) dan “Menangkap dari Belakang” (2009) merupakan karya dari Bara Widjaya yang memiliki perbedaan karakter dalam pemilihan bentuk, warna dan susunan. Hal tersebut membuatnya memiliki daya tarik dan menimbulkan keinginan untuk mendalami dari aspek pemvisualan objek, komposisi, penafsiran dan karakter pemilihan media estetik. Berkaitan dengan hal tersebut dilaksanakan penelitian yang mengkaji visual dari karya lukis “Mengusung Hari Depan” dan “Menangkap dari Belakang”. Tujuan dari pelaksanaan penelitian ini adalah untuk memaparkan pertimbangan penilaian formalisme mengenai karya lukis Bara Widjaya yang berjudul “Mengusung Hari Depan” dan “Menangkap dari Belakang” berdasarkan tahapan kritik formalistik yang mencakup deskripsi, analisis formal, interpretasi, dan evaluasi. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif pendekatan kritik formalistik dengan instrumen berupa lembar wawancara, lembar observasi, dan peneliti. Pengumpulan data primer dilakukan dengan observasi yang didukung dengan wawancara dan dokumentasi. Data dari penelitian ini berupa data objektif (deskripsi dan analisis formal) dan data afektif (interpretasi). Kegiatan analisis data dilakukan dengan pendeskripsian, kemudian analisa formal dan interpretasi karya. Pengecekan keabsahan temuan dilakukan dengan cara triangulasi data dengan cara menghubungkan hasil paparan data dengan objek yang diteliti dan teori yang relevan. Berdasarkan penelitian yang telah dilaksanakan diperoleh hasil bahwa (1) lukisan “Mengusung Hari Depan” condong pada kesan “rasa ketimur-timuran”, sedangkan lukisan “Menangkap dari Belakang” condong pada kesan “rasa kebarat-baratan” (2) karya seni lukis “Menangkap dari Belakang” dominan menggunakan warna dengan intensitas tinggi, sedangkan karya “Mengusung Hari Depan” dominan menggunakan warna dengan value rendah (3) Lukisan “Mengusung Hari Depan” memaparkan sebuah gagasan mengenai harapan sedangkan lukisan “Menangkap dari Belakang” condong pada pengungkapan kegelisahan seniman mengenai suatu peristiwa yang sedang aktual pada masa lukisan tersebut diciptakan (4) Perbedaan pemilihan karakter media estetik dilakukan untuk mendukung gagasan yang ingin diungkapkan. Hasil penelitian ini diharapkan dapat dijadikan salah satu bahan refleksi oleh seniman terhadap karya lukisnya yang berjudul “Mengusung Hari Depan” dan “Menangkap Dari Belakang”. Bagi peneliti yang akan melakukan kajian pada seniman yang sama dan karya yang sama disarankan untuk mengkaji dengan pendekatan holistik dan atau semiotik sehingga menambah kekayaan informasi.

Implementasi pembelajaran kewirausahaan di SMK Negeri 1 Banyuwangi / Sehani Asri Miningsih

 

Kata kunci : pembelajaran kewirausahaan Arah kebijakan pemerintah memberikan pembelajaran kewirausahaan adalah agar peserta didik dapat meningkatkan dan mengembangkan kecakapan hidup serta dapat mengaktualisasikan diri dalam perilaku wirausaha. Kompetensi kewirausahaan bertujuan agar peserta didik memiliki kemampuan sebagai berikut: (a) Memahami dunia usaha dalam kehidupan sehari-hari (b) Berwirausaha dalam bidangnya, (c) Menerapkan perilaku kerja prestatif, (d) Mengaktualisasikan sikap dan perilaku wirausaha. Standard kompetensi yang harus dikuasai peserta didik adalah dapat mengaktualisasikan sikap dan perilaku wirausaha, menerapkan jiwa kepemimpinan, merencanakan usaha kecil dan mengelola usaha kecil. Pembelajaran kewirausahaan memerlukan perencanaan dan pelaksanaan yang serius agar mencapai tujuan. Oleh karena itu peneliti meneliti implementasi pembelajaran kewirausahaan dengan melihat persepsi guru, RPP dan pelaksanaan proses pembelajaran, agar dapat memberikan rekomendasi perbaikan. Penelitian ini merupakan penelitian kualitatif, dengan tujuan agar dapat memperoleh pemahaman dan interpretasi mendalam tentang makna dari fenomena yang ada di lapangan. Sedangkan sifat atau kategori dalam penelitian ini merupakan penelitian evaluasi menggunakan metodologi studi kasus (case studies). Dalam penelitian ini beberapa tahapan proses pengumpulan data yaitu: (a) Survey/ observasi awal, (b) Penyebaran kuesioner, (c) Wawancara (d) Dokumentasi dan (e) Pengamatan. Persepsi guru terhadap pembelajaran kewirausahaan dengan latar belakang yang berbeda bervariasi, akan tetapi memiliki makna yang sama, pemahaman tentang pembelajaran kewirausahaan pada dimensi proses pengetahuan mengenal, memahami dan menerapkan. Dimensi pengetahuan dalam pembelajaran mengarah pada dimensi pengetahuan faktual, konseptual dan prosedural. Demikian pula implementasi dalam RPP. Pelaksanaan pembelajaran di kelas dilaksanakan sesuai dengan RPP meskipun masih terdapat tujuan pembelajaran yang belum tercapai dan kegiatan yang tidak terlaksana serta alokasi waktu yang tidak tepat. Implementasi pembelajaran dilakukan sesuai dengan arahan kebijakan pemerintah, persepsi guru, dan RPP. Tujuan pembelajaran belum dapat diimplementasikan secara menyeluruh dalam pembelajaran di kelas. Oleh karena itu pembelajaran kewirausahaan tidak hanya dilakukan di dalam kelas, tapi juga dilaksanakan dalam bentuk praktik di unit produksi di sekolah, penjualan produk di masyarakat dan usaha mandiri. Dengan demikian pembelajaran kewirausahaan dapat mencapai tujuan pembelajaran sesuai standar kompetensi dan kompetensi dasar yang telah ditetapkan pada domain kognitif, afektif dan psikomotor.

Pengembangan model pembelajaran tematik berbasis membaca, menulis, dan berhitung kelas III sekolah dasar / Mohammad Ilyas

 

Kata Kunci: Pembelajaran Tematik, Membaca, Menulis, Berhitung. Pembelajaran tematik berbasis membaca, menulis, dan berhitung merupakan tuntutan sekaligus sebagai solusi yang tepat untuk mengatasi permasalahan yang sedang dihadapi siswa kelas-kelas awal/khususnya kelas III sekolah dasar. Pola pikir siswa kelas III masih cenderung melihat/memandang segala sesuatu sebagai satu keutuhan. Namun, cara belajarnya sudah dipolakan terpisah-pisah. Ketidaksesuaian antara karakteristik berpikir siswa dengan cara belajarnya cenderung mengakibatkan kemampuan berpikirnya kurang dapat berkembang secara maksimal yang akhirnya dapat menyebabkan kegagalan studinya. Pembelajaran tematik berbasis membaca, menulis, dan berhitung terbukti sejalan dengan karakteristik berpikir siswa. Melalui pembelajaran tematik berbasis membaca, menulis, dan berhitung, siswa dapat memahami berbagai konsep mata pelajaran sebagai satu keutuhan makna dalam teks/tema. Sejalan dengan masalah tersebut, tujuan penelitian pengembangan ini adalah mengembangkan model pembelajaran tematik melalui kegiatan membaca, menulis, dan berhitung untuk kelas III sekolah dasar. Fokus pengembangan adalah (1) bahan pembelajaran tematik yang dilengkapi dengan (2) perencanaan pembelajaran (silabus dan RPP), (3) petunjuk guru. Untuk memcapai tujuan tersebut digunakan desain model Reflective, Recursive Design and Development (R2D2). Penelitian ini dilakukan dengan tiga tahap, yaitu tahap pendefinisian, tahap desain dan pengembangan, tahap deseminasi. Uji produk penelitian pengembangan ini dilakukan dengan dua cara, yaitu uji coba produk dengan validasi teoretik dan validasi empirik, dan uji eksperimentasi. Validasi teoretik melibatkan para ahli dan praktisi. Para ahli terdiri atas: ahli teknologi pembelajaran, ahli pembelajaran tematik dan pembelajaran Bahasa Indonesia sekolah dasar, ahli pembelajaran bahasa, Ahli kesekolahdasaran, ahli pembelajaran Matematika sekolah dasar, ahli pembelajaran IPA, ahli pembelajaran IPS sekolah dasar, ahli pembelajaran PKn. Para praktisi yang dilibatkan terdiri atas para guru kelas III sekolah dasar dan siswa kelas III sekolah dasar. Validasi empirik dilakukan secara berulang sampai ditemukan produk yang memadai. Uji eksperimentasi produk dilakukan dengan teknik praeksperimen. Data penelitian ini terdiri atas dua macam, yaitu data kualitatif dan data kuantitatif. Pengumpulan data menggunakan teknik (1) dokumentasi, (2) observasi, dan (3) tes/tugas. Data kualitatif terdiri atas: dokumen, catatan lapangan, dan saran/petunjuk para ahli. Data kualitatif tersebut dianalisis dengan teknik analisis domain dengan prinsip kritis, kreatif, dan reflektif. Data kuantitatif terdiri atas: data uji validitas dan reliabilitas butir soal, data uji kelompok terbatas, data uji lapangan, dan data uji efektivitas. Data kuantitatip tersebut dianalisis dengan metode statistik deskriptif untuk mengetahui persentase jawaban siswa, para ahli, dan guru. Data uji validitas dan reliabilitas butir soal terdiri atas: data butir soal uraian dan data butir soal pilihan ganda. Data butir soal uraian dianalisis dengan korelasi product moment dengan angka kasar melalui program SPSS 16.00 for windows. Data butir soal pilihan ganda dianalisis melalui program ‘Anates’ versi 4.0.2.Oktober 2003. Data uji lapangan dan uji efektivitas bahan pembelajaran dihitung dengan uji-t sampel berpasangan melalui program SPSS 16.00 for windows. Hasil pengembangan ini adalah perangkat pembelajaran tematik untuk kelas III sekolah dasar dan deskripsi efektifitasnya. Perangkat pembelajaran tematik tersebut meliputi (1) Bahan Pembelajaran Tematik Berbasis Membaca, Menulis, dan Berhitung; (2) Perencanaa Pembelajaran yang terdiri dari silabus dan RPP; (3) Petunjuk Guru (4) Alat penilaian. Bahan Pembelajaran Tematik Berbasis Membaca, Menulis, dan Berhitung efektif untuk meningkatkan hasil belajar siswa kelas III sekolah dasar. Bahan pembelajaran yang dikembangkan terdiri atas bahan bacaan dan bahan pembelajaran menulis. Bahan bacaan terdiri atas: teks, alat tes. Hasil uji coba menunjukkan bahwa bahan pembelajaran yang dikembangkan layak untuk siswa kalas III sekolah dasar. Teks yang dikembangkan layak untuk bahan bacaan siswa. Alat tes pemahaman isi teks juga layak untuk siswa. Hasil validasi para ahli dan praktisi menunjukkan layak untuk siswa. Hasil uji lapangan menunjukkan efektif untuk pembelajaran siswa. Hasil eksperimen juga menunjukkan efektif untuk meningkatkan hasil belajar siswa. Hasil validasi silabus oleh para ahli menunjukkan layak. Hasil validasi guru kelas juga menyatakan mudah dipahami dan mudah dilaksanakan dalam pembelajaran kelas III sekolah dasar. Hasil validasi rencana pelaksanaan pembelajaran oleh para ahli menunjukkan layak dan guru kelas menyatakan mudah dipahami dan mudah dilaksanakan dalam pembelajaran kelas III sekolah dasar. Hasil validasi petunjuk guru pembelajaran tematik BMMB oleh para ahli menunjukkan layak dan guru kelas menyatakan mudah dipahami dan mudah dilaksanakan dalam pembelajaran kelas III sekolah dasar. Hasil eksperimen menunjukkan bahwa produk pengembangan ini efektif untuk meningkatkan hasil belajar siswa. Dari hasil analisis statistik keenam model menunjukkan terdapat perbedaan yang signifikan antara skor prates dengan skor postes. Dengan demikian dapat disimpulkan bahwa model pembelajaran tematik berbasis membaca, menulis, dan berhitung efektif digunakan dalam pembelajaran siswa kelas III sekolah dasar.

Pengaruh bentuk pertanyaan bacaan terhadap peningkatan hasil belajar membaca pemahaman bahasa Inggris siswa sekolah menengah umum tingkat atas (SMA) / oleh Abdul Hamid Abbas

 

Diagnosis kesulitan siswa dalam menyelesaikan soal pola bilangan dan pemberian scaffolding / Tatik Octiarsih Kartika Puji Rahayu

 

ABSTRAK Rahayu, Tatik Octiarsih Kartika Puji. 2015. Diagnosis Kesulitan Siswa dalam Menyelesaikan Soal Pola Bilangan dan Pemberian Scaffolding. Tesis, Jurusan Pendidikan Matematika Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. H. Abdur Rahman As’ari, M.Pd., M.A., (II) Dr. Sisworo, S.Pd., M.Si. Kata kunci: Diagnosis kesulitan, Scaffolding Tujuan penelitian ini adalah untuk mendeskripsikan kesulitan yang dialami siswa dalam menyelesaikan soal pola bilangan dan pemberian scaffolding-nya. Sifat dari penelitian ini adalah deskriptif-kualitatif. Subjek dalam penelitian ini adalah 4 orang siswa. Pemilihan subjek didasarkan pada kesalahan siswa dalam menyelesaikan soal diagnostik. Soal diagnostik yang diberikan dalam penelitian ini adalah dua masalah yang berkaitan dengan pola bilangan. Proses diagnosis yang dilakukan mengacu pada langkah-langkah penyelesaian masalah oleh Polya, yaitu memahami masalah, merencanakan penyelesaian, melaksanakan rencana, dan memeriksa kembali. Pemberian scaffolding dalam penelitian ini mengacu pada level environmental provisions, level explaining, reviewing, dan restructuring, serta level developing conceptual thinking yang dikemukakan oleh Anghileri (2006). Berdasarkan penelitian yang telah dilakukan diperoleh hasil bahwa dalam menyelesaikan soal pola bilangan siswa mengalami beberapa kesulitan. Kesulitan tersebut diantaranya adalah kesulitan dalam menyatakan apa yang diketahui dan ditanyakan, kesulitan dalam mengkaitkan konsep matematika yang telah dipelajari, kesulitan dalam proses penentuan rumus fungsi suku ke-n, serta kesulitan dalam mengkomunikasikan jawaban. Scaffolding yang diberikan untuk mengatasi kesulitan siswa tersebut mengacu pada level 2 dan 3 yang dikemukakan Anghileri (2006) yaitu explaining, reviewing, dan restructuring, serta developing conceptual thinking. Untuk itu peneliti menyarankan kepada guru untuk melakukan diagnosis terhadap kesulitan yang dialami siswa dan memberikan solusi untuk mengatasi hal tersebut. Salah satu solusi yang dapat dilakukan oleh guru adalah dengan scaffolding. Selain itu, guru hendaknya memberikan lebih banyak latihan soal kepada siswa berkaitan dengan materi pola bilangan.

Hubungan antara sikap mahasiswa terhadap matakuliah PBM di Jurusan pendidikan Teknik Mesin FPTK IKIP MALANG dan motivasi menjadi guru STM
oleh Rudy Purwono Setyo Anggono

 

Implementing snowball throwing teaching technique to enhance the fifth graders' vocabulary mastery of SDN Jombang 3 Jombang / Sakhi Herwiana

 

ABSTRAK Herwiana, Sakhi. 2015. Menerapkan Teknik Mengajar Snowball Throwing untuk Meningkatkan Penguasaan Kosa Kata Siswa Kelas Lima di SDN Jombang 3 Jombang. Tesis. Program Studi Pendidikan Bahasa Inggris, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Dr. Sri Rachmajanti, Dip TESL., M.Pd., (II) Dr. Enny Irawati, M.Pd. Kata Kunci: kosa kata, snowball throwing, pembelajar muda. Penelitian ini dilaksanakan untuk mengetahui bagaimana penggunaan teknik mengajar snowball throwing dapat diterapkan untuk meningkatkan penguasaan kosa kata pada siswa kelas 5 di SDN Jombang 3 Jombang. Desain penelitian ini menggunakan penelitian tindakan kelas dimana peneliti dan guru Bahasa Inggris bekerjasama dalam penelitian. Peneliti bertindak sebagai guru dan guru Bahasa Inggris sebagai pengamat. Penelitian ini dilaksanakan dalam satu siklus dengan menggunakan prosedur sebagai berikut: perencanaan, penerapan, pengamatan dan refleksi. Ada 5 pertemuan dalam satu siklus yaitu 4 pertemuan untuk penerapan teknik mengajar snowball throwing dan satu pertemuan untuk pelaksanaan tes kosa kata. Data penelitian diambil dari beberapa intrumen yaitu: tes kosa kata, angket siswa, lembar observasi dan catatan lapangan. Hasil temuan menunjukkan bahwa teknik pengajaran snowball throwing dapat meningkatkan penguasaan kosa kata pada anak. Hal ini dapat dilihat dari peningkatan hasil tes, keterlibatan siswa dalam kegiatan pembelajaran dan respon siswa. Hasil nilai rata-rata dari tes kosa kata pada siklus pertama adalah 93.6 dan sembilan puluh delapan persen(98%) siswa telah mencapai kriteria sukses. Sebelum penerapan, hanya tiga puluh empat (34%) siswa yang dapat mencapai KKM yaitu 68. Berdasarkan hasil angket siswa dan lembar observasi, semua murid terlibat aktif dalam pelaksanaan snowball throwing. Mereka menunjukkan sikap senang dan tertarik dalam belajar Bahasa Inggris dengan menggunakan teknik ini. Dalam mengajar, guru menggunakan tiga tahapan dalam kegiatan utama di Rencana Pelaksanaan Pembelajaran (RPP). Di awal kegiatan, guru memberikan beberapa pertanyaan yang berhubungan dengan lagu audio-visual yang diberikan untuk mengarahkan pengetahuan dasar siswa. Kemudian, guru memberikan penjelasan dan pengucapan kata-kata berdasarkan gambar yang diikuti oleh siswa. Guru juga memberikan contoh penggunaan kata-kata dalam kalimat sederhana. Pada kegiatan inti, guru memberikan contoh bagaimana cara bermain snowball throwing. Kemudian, siswa mempraktekkan snowball throwing dengan berkelompok. Ketika siswa sedang melaksanakan teknik tersebut, guru mengamati jawaban siswa. Siswa diperbolehkan untuk bertanya kepada guru jika menemukan kesulitan, jadi peran guru adalah membimbing dan membantu para siswa. Di akhir kegiatan, siswa diberi kuis dan mereka mengerjakannya secara individu. Kesimpulannya, penggunaan teknik mengajar snowball throwing dapat meningkatkan kemampuan siswa untuk mengingat kosa kata. Teknik ini juga mendorong siswa menjadi aktif di dalam kelas. Mereka menunjukkan kerjasama yang baik dalam kelompok. Strategi ini dianjurkan untuk guru Bahasa Inggris sebagai salah satu strategi alternatif dalam mengajar untuk meningkatkan kemampuan siswa dalam mengingat kosa kata dengan cara yang menyenangkan. Selain itu, teknik ini dapat digunakan untuk peneliti selanjutnya, mereka bisa menggunakan penelitian ini sebagai referensi yang sesuai dalam melaksanakan penelitian untuk meningkatkan kemampuan siswa dalam mengingat kosa kata dengan teknik snowball throwing di sekolah dasar. Selain itu, disarankan juga agar peneliti lainnya untuk menggunakan penelitian yang sama, untuk mengajar pembelajar muda dengan tingkatan siswa yang berbeda. Peneliti lain boleh meningkatkan dan mengkombinasikan teknik yang sesuai dengan siswa. Untuk pembuat kebijakan dan kurikulum pendidikan, mereka bisa menganjurkan teknik mengajar yang sesuai dengan siswa sekolah dasar dalam membuat rencana pengajaran dan buku Bahasa Inggris agar guru Bahasa Inggris mengetahui teknik mengajar yang sesuai dengan pembelajar muda. Selain manfaat, ada beberapa kendala dalam melaksanakan penelitian. Pertama adalah guru harus mempertimbangkan berapa banyak kosa kata yang akan digunakan dalam aktifitas. Semakin banyak kosa kata yang digunakan maka akan semakin banyak waktu yang diperlukan. Kedua, jumlah siswa dalam kelompok akan membawa dampak dalam keberhasilan pelaksanaan teknik ini. Akan lebih baik jika siswa bekerjasama tidak lebih dari sepuluh siswa dalam satu kelompok.

Pengembangan media animasi pembelajaran pada mata pelajaran bahasa Jerman materi pokok penggunanaan kasus askusatif dan nominatif kelas XI SMA Negeri 1 Bantur / Dwi Lala Santi

 

Kata kunci: pengembangan, media, artikel Dalam suatu proses pembelajaran di sekolah, media merupakan salah satu komponen sumber belajar yang turut menentukan keberhasilan penyelenggaraan pembelajaran. Media sebagai bagian integral sistem pembelajaran maka kedudukannya tidak dapat dipisahkan. Atau dengan kata lain, kegiatan pembelajaran tidak akan berlangsung dengan baik tanpa media pembelajaran yang sesuai. Penelitian ini bertujuan untuk menghasilkan media pembelajaran yang dapat memberikan solusi bagi siswa dalam mempelajari materi bahasa Jerman khususnya, pada materi pokok penggunaan Artikel Akusatif dan Nominatif. Kegiatan pengembangan ini menggunakan rancangan penelitian pengembangan dan kegiatan validasi pada ahli media, ahli materi, dan siswa. Hasil dari penelitian pengembangan ini adalah media dapat digunakan dalam pembelajaran dengan sedikit revisi. Menurut ahli media, media sudah valid dengan prosentase sebesar 93,75%. Ahli materi berpendapat bahwa media valid dengan prosentase sebesar 92,42%. Siswa juga berpendapat sama, yakni media valid dengan prosentase sebesar 82,50%. Selain itu nilai rata-rata siswa pada lembar latihan sebesar 89,05 dari 19 siswa. Hal ini menunjukkan media pembelajaran cukup memberikan dampak yang positif terhadap peningkatan belajar siswa dalam memahami materi, maka dapat disimpulkan bahwa media animasi pembelajaran ini sangat efektif digunakan dalam pembelajaran siswa. Berdasarkan penelitian pengembangan yang telah dilakukan, pengembang menyarankan dalam pemanfaatan lebih lanjut dapat mengembangkan media pembelajaran menjadi lebih baik lagi, tepat guna sehingga, media yang dikembangkan dapat dimanfaatkan sesuai dengan kebutuhan.

Perancangan film animasi 3 dimensi cerita Garuda dan Amerta dengan latar kebudayaan Indonesia / Geyandra Nuhisa Tantra

 

Tantra, Geyandra Nuhisa. 2014, Perancangan Film Animasi 3 Dimensi Cerita Garuda dan Amerta Dengan Latar Kebudayaan Indonesia. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Rudi Irawanto, S.Pd, M.Sn (II) Gunawan Susilo, S.Sn, M.Sn Kata Kunci: Film animasi, Garuda dan Amerta, Kebudayaan Indonesia.          Banyaknya film animasi asing yang masuk dan tayang di Indonesia dengan membawa kebudayaan asing membuat nilai-nilai kebudayaan lokal semakin tergeser dan hilang tergantikan oleh nilai-nilai budaya asing. Selain itu minimnya animasi dengan konten lokal membuat budaya khas Indonesia semakin terlupakan. Tujuan perancangan film animasi 3 Dimensi “Garuda dan Amerta” ini adalah memperkenalkan kembali wujud-wujud kebudayaan lokal Indonesia serta menanamkan nilai-nilai kearifan lokal yang dimiliki bangsa Indonesia seperti nilai keberanian, kasih sayang, dan penghormatan terhadap orang tua. Film ini juga mengenalkan tokoh Garuda sesuai dengan cerita asli agar masyarakat mengetahui cerita Garuda secara benar.     Perancangan film ini menggunakan model perancangan dari Sadjiman Ebdi Sanyoto yang kemudian disesuaikan agar memperoleh model perancangan yang sesuai untuk perancangan film animasi “Garuda dan Amerta”. Analisa data menggunakan data kualitatif berupa deskripsi operasional variabel dalam perancangan antara lain animasi, kebudayaan Indonesia, dan Garuda. Sintesis yang dihasilkan adalah membuat film animasi dengan cerita Garuda dengan latar kebudayaan Indonesia.     Perancangan yang dihasilkan adalah film animasi dengan citra 3 dimensi dengan durasi kurang lebih 20 menit yang disajikan dalam format layar widescreen HDV 720 (1280x720 pixel). Cerita yang disampaikan adalah cerita Garuda yang berjuang untuk mendapat air Amerta yang dimiliki para dewa agar dapat membebaskan ibunya, Winata, dari perbudakan Kadru untuk memelihara para naga. Film ini juga dilengkapi dengan berbagai media promosi dan merchandise antara lain poster, backdrop horisontal, banner vertikal, brosur, kartu nama, gantungan kunci, pin, stiker, dan mug.

Macquarie university school of education media use in the conduct of conversation in the teaching of english as a foreign language / by Murdibjono

 

Sistem kendali ruang belajar berbasis smartphone dengan operating system android / Sudianto

 

ABSTRAK Sudianto. 2015. Sistem Kendali Ruang Belajar Berbasis Smartphone Dengan Operating System Android. Pembimbing (1) Dr. Eng. Siti Sendari, S.T., M.T. Pembimbing (2) Didik Dwi Prasetya, S.T., M.T. Kata Kunci: Sistem Kendali, Ruang Belajar, Mikrokontroler, Android, Bluetooth Pada umumnya kendali perangkat elektronik masih banyak dilakukan secara manual. Salah satunya yaitu mematikan atau menghidupkan lampu pada ruang belajar harus menuju lokasi untuk menekan saklar. Pada ruang belajar juga masih minim pengaturan perangkat elektronik untuk mengatur kondisi ruang belajar agar ruang belajar menjadi nyaman. Untuk mengatasi hal itu, dapat memanfaatkan peran teknologi smartphone Android sebagai kendali jarak jauh layaknya home automation. Tujuan dari pengembangan ini adalah merancang dan membuat sistem kendali ruang belajar berbasis smartphone dengan operating system Android, Smartphone dapat mengendalikan perangkat elektronik pada ruang belajar secara jarak jauh tanpa menggunakan kabel. Perangkat elektronik pada ruang belajar tersebut meliputi lampu, kipas angin, dan jendela. Model pengembangan yang digunakan untuk mengembangkan sistem kendali ruang belajar mengadaptasi metode pengembangan waterfall dalam Sommerville (2011) yang meliputi: (1) Penentuan dan analisis spesifikasi, (2) Desain sistem dan perangkat, (3) Implementasi dan uji coba unit, (4) Integrasi dan uji coba sistem, dan (5) Operasi dan pemeliharaan. Produk yang dihasilkan dari sistem kendali ruang belajar ini, terdiri dari software dan hardware. Untuk pengujian pada sistem kendali dilakukan pengujian secara per blok dan fungsionalitas. Subjek dari uji fungsionalitas meliputi ahli rekayasa perangkat lunak, dan ahli kendali perangkat keras. Berdasarkan hasil uji coba fungsionalitas terhadap aplikasi Android oleh masing-masing subjek coba diperoleh (1) Ahli rekayasa perangkat lunak 100% (2) Ahli kendali perangkat keras 100%. Dari hasil tersebut, dapat disimpulkan sistem kendali ruang belajar yang dikembangkan guna mempermudah untuk mengakses perangkat elektronik pada ruang belajar dinyatakan baik dan sesuai.

Usaha sintesis "1.3-Dihidroksi-2-(2-Piridil)-4,5-DimetiliImidazolina" / oleh Via Pertina Wati

 

A study of some aspects of management and the behaviour of dairy cows uncer certain tropical conditions in Java / by Garnadi Prawirosudirdjo

 

Kemampuan ketrampilan menulis karangan melalui pendekatan kontekstual (CTL) siswa kelas V SD Kartika IV-6 Kota Malang / Budi Indrawan

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |