Efektifitas penerapan Peraturan Pemerintah No. 46 Tahun 2013 terhadap penerimaan pajak penghasilan badan di Kantor Pelayanan Pajak (KPP) Batu / Tiara Rahma Nastiti

 

ABSTRAK Nastiti, Tiara Rahma. 2015. Efektifitas Penerepan Peraturan Pemerintah No. 46 Tahun 2013 Terhadap Penerimaan Pajak Penghasilan Badan di Kantor Pelayanan Pajak (KPP) Pratama Batu. Tugas Akhir. Program Studi Diploma Akuntansi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Dosen Pembimbing Sulastri S.Pd, MSA. Kata kunci:Peraturan Pemerintah No. 46 Tahun 2013, peningkatan penerimaan pajak. Kontribusi penerimaan pajak dari Pajak Penghasilan Badan pada kelas penerimaan rendah sangat kecil yaitu 5% dari total penerimaan pajak. Oleh karena itu upaya yang dilakukan Pemerintah adalah menerbitkan Peraturan Pemerintah No. 46 Tahun 2013 mengenai pajak penghasilan atas penghasilan usaha yang diterima atau yang diperoleh Wajib Pajak yang memiliki peredaran bruto kurang dari 4,8 milyar dalam setahun, dikenakan 1% dari peredaran brutonya. Teknik pengumpulan data dalam penulisan Tugas Akhir ini adalah observasi, interview, dokumentasi dan metode pustaka. Tugas Akhir ini bertujuan untuk: (1) Untuk mengetahui penerapan Peraturan Pemerintah No. 46 Tahun 2013 di KPP Pratama Batu (2) Untuk mengetahui tingkat efektifitas Peraturan Pemerintah No. 46 Tahun 2013 di Kantor Pelayanan Pajak Pratama Batu. Metode pemecahan masalah yang digunakan adalah dengan cara mengumpulkan data mengenai prosedur pelaksanaan dan menjabarkan data hasil pelaksanaan Peraturan Pemerintah No. 46 Tahun 2013 di KPP Pratama Batu.Data pada penelitian ini meninjau keefektifitasan PP 46 tahun 2013 sebelum dan sesudah diterapkan. Upaya pengenalan PP 46 tahun 2013 adalah sosialisasi, pengenalan melalui media elektronik dan media cetak, penyebaran leaflet. Dari ketiga upaya tersebut, terdapat peningkatan penerimaan pajak selama penerapan PP 46 tahun 2013 dilaksanakan. Realisasi penerimaan pajak sesuai dengan PP no 46 Tahun 2013 sudah melampaui target yang telah ditetapkan. Hal ini karena Kota Batu merupakan Kota Pariwisata sehingga sangat mendukung adanya pengaruh penerapan PP no 46 tahun 2013 dengan semakin bertambahnya penerimaan pajak dari awal penerapan.

Masalah pengajaran apresiasi sastra di SMP Negeri Kodya Malang (khususnya kelas III) / oleh Mistur Haris Sutikno

 

Hubungan masalah drop out dengan kondisi lingkungan geografi SD Gedangan Kecamatan Campurdarat kabupaten Tulungagung / oleh Wahono

 

Modeling, compositing dan editing film animasi tentang "dampak negatif teknologi komunikasi terhadap remaja" / Mawadatul Setiawan

 

ABSTRAK Setiawan, Mawadatul, 2015.ModelingFilm Animasi 3Dimensi TentangDampak Teknologi Komunikasi terhadap Remaja. Tugas Akhir, Jurusan Seni dan Desain, Fakultas Sastra, Universitas NegeriMalang. Pembimbing: (1) Andy Pramono S.Kom, M.T, (II) Mitra Istiar Wardhana, S.Kom, M.T Kata Kunci:Modeling3D, Teknologi, Komunikasi, Remaja, Film. Modeling Film Animasi 3 Dimensi Dampak Teknologi Komunikasi terhadap Remaja ini ditujukan untuk membentuk kesadaran akan bagaimana masyarakat harus mulai memperhatikan tentang bagaiman hubungan antar manusia yang lain agar memperkecil kesenjangan sosial yang sekarang terjadi di masyarakat. Proses visualisasi film animasi 3 dimensi dampak teknologi komunikasi terhadap remaja ini mempunyai 3 tahap perancangan, yaitu pra produksi, produksi, dan pasca produksi. Sedangkan model perancangan yang digunakan adalah model prosedural yang bersifat deskriptif, yaitu menggariskan langkah-langkah yang harus diikuti untuk menghasilkan produk. Perancangan ini menghasilkan sebuah model 3d untuk animasi 3 dimensi yang menceritakan seorang anak yang sibuk dengan handphone dan acuh terhadap lingkungan sekitar. Dan juga menghasilkan beberapa media pendukung untuk memperkenalkan hasil dari perancangan iniseperti cover dvd, dan cd label yang di desain sesuai dengan hasil dari perancangan visual animasi.

Pelaksanaan sistim administratif pada Kecamatan Turen Kabupaten Malang / oleh Soepardi

 

Hubungan aktualisasi diri dengan kepercayaan diri pada siswa yang mengikuti kegiatan ekstrakurikuler di SMA Darul Ulum 1 unggulan BPP Rejoso-Peterongan Jombang / Irwan Prasetyo

 

Kata kunci: aktualisasi diri, kepercayaan diri, remaja, ekstrakurikuler. Aktualisasi diri merupakan kemampuan individu untuk menggali dan mengembangkan segenap potensi yang dimiliki untuk menjadi diri sendiri dan untuk meningkatkan kualitas hidupnya. Kepercayaan diri merupakan perasaan puas dan yakin akan kemampuan yang dimiliki dan berusaha mengembangkan penilaian positif terhadap diri sendiri dan lingkungan. Kercayaan diri merupakan aspek kepribadian manusia yang berfungsi penting untuk mengaktualisasikan potensi yang dimilikinya. Penelitian ini bertujuan untuk: (1) mengetahui aktualisasi diri siswa yang mengikuti ekstrakurikuler, (2) mengetahui kepercayaan diri siswa yang mengikuti ekstrakurikuler, (3) mengetahui apakah ada hubungan antara aktualisasi diri dengan kepercayaan diri pada siswa yang mengikuti ekstrakurikuler. Subyek penelitian adalah siswa SMA Darul Ulum 1 Unggulan BPP Rejoso-Peterongan Jombang yang mengikuti kegiatan ektrakurikuler, sebanyak 70 siswa sebagai sampel penelitian. Data penelitian diperoleh dengan menggunakan dua skala yaitu Skala Aktualisasi Diri dan Skala Kepercayaan Diri. Tehnik analisis data menggunakan Analisis Diskriptif dan Uji Korelasional Product Moment. Hasil Penelitian menunjukkan bahwa 32 siswa (45,7%) memiliki aktualisasi diri tinggi, 38 siswa (54,3%) memiliki aktualisasi diri sedang dan tidak ada siswa yang memiliki aktualisasi dengan klasifikasi rendah. Serta 15 siswa (21,4%) memiliki kepercayaan diri tinggi, 55 siswa (78,6%) memiliki kepercayaan diri sedang, dan tidak ada yang memiliki kepercayaan diri rendah. Hasil penelitian korelasional Product Moment didapatkan nilai rxy = 0,646 dengan taraf probability sebesar 0,000 (sig < 0,05). Hal ini menunjukkan adanya korelasi positif antara aktualisasi diri dengan kepercayaan diri, yaitu semakin tinggi skor aktualisasi diri siswa maka akan semakin tinggi skor kepercayaan diri siswa. Berdasarkan penelitian tersebut peneliti menyarankan kepada beberapa pihak yaitu: 1) Bagi Sekolah Agar mencari informasi mengenai siswa serta memberikan penguatan-penguatan positif misalnya memberikan beasiswa untuk setiap prestasi yang didapatka, bagi siswa yang memiliki aktualisasi diri dan kepercayaan diri yang rendah bisa menjadi tinggi serta menyusun strategi pembelajaran yang efektif untuk siswa. 2) Bagi Siswa Agar remaja mampu berusaha mengenali diri, lebih mencintai dirinya, memahami dirinya, mulai menyusun tujuan hidup yang yang ingin dicapai. 3) Bagi Orang tua agar mampu motivator dan mencintai anaknya tanpa syarat dan tanpa mebanding-bandingkan dengan orang lain. 4)Bagi Peneliti Selanjutnya diharapkan diharapkan dapat mengadakan penelitian pada subjek yang lebih luas dan menggunakan instrumen pengumpulan data yang lebih beragam.

Pentingnya pelajaran menggambar reklame di SMP klas II / oleh Hanik Robiatin

 

Uji antara hasil belajar menggunakan model pembelajaran inkuiri terbimbing dengan hasil belajar menggunakan model pembelajaran direct instruction pada mata pelajaran Sensor dan Aktuator ditinjau dari segi motivasi tinggi dan motivasi rendah di SMK PGRI 3 Malang / Siti K

 

ABSTRAK Zahro, SitiKholifatuz. 2015. Uji Beda antara Hasil Belajar Menggunakan Model Pembelajaran Inkuiri Terbimbing dengan Hasil Belajar Menggunakan Model Pembelajaran Direct Intructionpada Mata Pelajaran Sensor dan Aktuator Ditinjau dari Segi Motivasi Tinggi dan motivasi Rendah di SMK PGRI 3 Malang. Skripsi. Program StudiPendidikanTeknikElektro. JurusanTeknikElektro. FakultasTeknik. UniversitasNegeri Malang.Pembimbing (I) Drs. Fx. Budi Raharjo, M.Pd, (II) Drs. Hari Putranto. Kata Kunci :InkuiriTerbimbing, Direct Instruction, Hasil Belajar, Motivasi Untuk mencapai kompetensi mengoperasikan sistem sensor pada mata pelajaran sensor dan aktuator ada dua cara yaitu: dengancarasiswadibimbinglangkah per langkahdenganmenerapkan model pembelajarandirect instructiondansiswadibimbinguntukmenemukanpenyelesaianmasalah yang diberikandenganmenerapkan model pembelajaraninkuiriterbimbing. Tujuanpenelitianiniadalahuntuk(1) mengetahuaiadanyaperbedaanantara hasil belajar model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction ditinjau dari segi motivasitinggi;(2) mengetahuaiadanyaperbedaanantara hasil belajar model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction ditinjau dari segi motivasirendah;dan(3) mengetahui adanya perbedaan hasil belajar menggunakan model pembelajaran Inkuiri Terbimbing dengan hasil belajar menggunakan model pembelajaran Direct Instruction. PenelitianinimenggunakanjenispenelitianExperiment dengandesainpenelitianpretest-posttest control group. Populasidalampenelitianiniadalahseluruhsiswakelas X SMK PGRI 3 Malang jurusanElektronika Industritahunajaran 2014/2015.Sampeldalampenelitianiniadalahdarisiswakelas X SMK PGRI 3 Malang, kelas X EI-A sebagaikelaseksperimen yang diberikanperlakuanmodel pembelajaranInkuiriTerbimbingdankelas X EI-B sebagaikelaskontrol yang diberikanperlakuan model pembelajaranDirect Instruction. Dalam penelitian ini sampeldiambilsecaraacak. Pengujianhipotesismenggunakanindependent sample t-test. Hasildalampenelitianiniadalah: (1) terdapat perbedaan antara model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction dari segi motivasi tinggi pada mata pelajaran sensor dan aktuator; (2) terdapat perbedaan antara model pembelajaran Inkuiri Terbimbing dengan model pembelajaran Direct Instruction dari segi motivasi rendah pada mata pelajaran sensor dan aktuator; (3) terdapat perbedaan antara hasil belajar siswa yang menggunakan model pembelajaran Inkuiri Terbimbing dengan hasil belajar siswa yang menggunakan model pembelajaran Direct Instructionpada mata pelajaran sensor dan aktuator.

Pengaruh persepsi konsumen tentang pesan iklan televisi terhadap keputusan pembelian kartu perdana simpati (studi pada mahasiswa sastra Jurusan Seni dan Desain Universitas Negeri Malang) / Adi Setiawan

 

Kata kunci: Pesan iklan, keputusan pembelian Dalam memperkenalkan produk baru sebuah perusahaan akan membuat sebuah iklan yang dapat menarik perhatian masyarakat dan membuat produk tersebut dapat diterima dengan mudah oleh masyarakat. Persaingan yang semakin ketat di dunia pertelekomunikasian sekarang ini sangat ketat dan kompetitif ini membuat pelaku pasar lebih berpacu dan terus bersaing untuk dapat bertahan di dunia bisnisnya. Perusahaan provider telekomunikasi terbesar di Indonesia Telkomsel mengeluarkan produk barunya yang bertema Simpati 5000. Produk ini ditujukan untuk kaum pelajar, maka iklan tersebut dikemas dengan sedemikian rupa agar dapat dengan mudah membuat masyarakat membeli produk tersebut. Tujuan penelitian ini adalah untuk (1) mengetahui pesan iklan kartu perdana simpati terbaru terhadap keputusan pembelian konsumen, (2) mengetahui pengaruh persepsi konsumen terhadap iklan kartu perdana simpati terbaru dalam keputusan pembelian konsumen secara parsial dan simultan. Penelitian ini merupakan penelitian penjelasan atau explanatory research, yaitu penelitian yang menjelaskan hubungan kausal atau hubungan sebab akibat antara variabel-variabel melalui pengujian hipotesa pada data yang sama. Sedangkan berdasarkan tingkat eksplanasi atau penjelasan, jenis penelitian yang digunakan adalah penelitian yang digunakan adalah penelitian asosiatif, yaitu penelitian yang bertujuan untuk mengetahui hubungan atau pengaruh antara dua variabel atau lebih. Populasi yang dipilih adalah seluruh mahasiswa Sastra jurusan Seni dan Desain pengguna kartu Simpati yang ada di Universitas Negeri Malang yang jumlahnya tidak dapat diketahui dengan pasti. Teknik pengambilan sampel penelitian ini menggunakan teknik simple random sampling dengan menggunakan rumus penentuan sampel dari Daniel dan Terrel sehingga didapat sampel sebanyak 100 responden. Analisis data menggunakan regresi berganda dengan bantuan SPSS for Windows Release 16.0 dengan taraf signifikansi 5%. Setelah melalui proses pengolahan data diketahui hasil penelitian menyatakan bahwa sebesar 63% keputusan pembelian kartu perdana simpati dipengaruhi atau dapat dijelaskan secara simultan oelh variabel isi pesan, struktur pesan, format pesan dan sumber pesan, Hasil penelitian ini adalah : (1) Pengaruh iklan (isi pesan, struktur pesan, format pesan, dan sumber pesan) kartu perdana Simpati terbaru kurang berpengaruh dikarenakan model pesan yang kurang mendukung dalam penyampaian isi pesan kartu Simpati terbaru. (2) Pengaruh iklan kartu perdana Simpati yang berpengaruh secara simultan adalah isi pesan dan sumber pesan sedangkan struktur pesan dan format pesan tidak berpengaruh. (3) Dari segi kualitas iklan Simpati yang terbaru cukup baik namun masih banyak kekurangan di dalam iklan tersebut seperti kualitas model iklan yang ditampilkan kurang membuat masyarakat tertarik meskipun model pesan tersebut sedang naik daun. Berdasarkan hasil penelitian ini, saran yang dapat disampakan penulis adalah sebagai berikut : (1) Sebaiknya iklan Simpati 5000 lebih diperbaiki lagi dalam segi struktur pesan, sumber pesan dan format pesannya agar masyarakat mudah memahami dan tertarik dengan iklan Simpati seperti penyampaian iklan yang menarik dan mudah dipahami oleh masyarakat. (2) Dalam menampilkan iklan Simpati 5000 sebaiknya menyisipkan lebih banyak lagi pesan moral kepada masyarakat, tidak hanya menekankan pada hiburan dan promosinya saja melainkan dari segi moral juga harus ditambah. (3) Dalam isi pesan iklan Simpati 5000 sudah baik sehingga masyarakat mudah paham dan mengerti serta tetap mendapatkan kepercayaan dari masyarakat akan produk Simpati. Kebanyakan iklan kartu selular sekarang ini banyak yang membohongi masyarakat sehingga kepercayaan akan iklan juga menurun, apabila tidak dikemas dengan baik maka iklan tersebut mudah dilupakan dan produk tersebut akan ditinggalkan oleh masyarakat.

Penerapan model pembelajaran project based learning untuk meningkatkan keaktifan dan hasil belajar Teknik Mikroprosesor di SMK Muhammadiyah 7 Gondanglegi Malang / Alvin Zuhair

 

ABSTRAK Zuhair, Alvin. 2015. Penerapan Model Project Base Learning UntukMeningkatanKeaktifandanHasilBelajarTeknikMikroposesor Di SMK Muhammadiyah 7 Gondanglegi Malang. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Dr. H. Tri Atmadji Sutikno, M.Pd. (II) Drs. Puger Honggowiyono, M.T Kata Kunci: Project Base Learning, Keaktifan, HasilBelajar Pembelajaran berbasis proyek (PjBL) dilakukan untuk memperdalam pengetahuan dan keterampilan yang diperoleh dengan cara membuat karya atau proyek yang terkait dengan materi ajar dan kompetensi yang diharapkan dimiliki oleh peserta didik.Penelitian tindakan kelas merupakan penelitian yang bersifat reparatif. Jadipenelitiantindakankelasadalahstudisistematisterhadappraktikpembelajarandikelasdengantujuanuntukmemperbaikiataumeningkatkankeaktifanataukualitas proses pembelajarandanhasilbelajarsiswadengantindakantertentu Penelitian ini merupakanpenelitiankualitatif. Penggunaan metode Project Base Learning ini bertujuan untuk meningkatkan keaktifan dan hasil belajar siswakelas X Otrotonik pada mata diklat teknik mikroposesor di SMK Muhammadiyah 7 Gondanglegi Malang yang mempunyai nilai rata- rata dibawah standar kkm. Instrumen penelitian yang digunakan dalam penelitian ini adalahlembarobservasi, lembarpenilaian,dan angket. Hasil dari penelitian ini menunjukkan bahwa Prosetase hasil pengamatan keaktifan belajar siswa pada siklus pertama siklus sebesar 81,5% dan menigkat pada siklus kedua dengan prosentase sebesar 95,4%,selanjutnya siklus ketiga mengalami kenaikan menjadi 100 %. ProsentaseHasilbelajarsiswajugamengalamikenaikansecaraberkalabaik ituhasilbelajarranah pengetahuan, sikap, dan keterampilan. Kesimpulan dari penelitian ini adalah secara umum penerapan metode pembelajaran Project Base Learning untuk meningkatkan keaktifan dan hasil belajar siswa kelas X otrotonik di SMK muhammadiyah 7 Gondanglegi Malang pada mata diklat teknik mikroposesor telah berjalan dengan baik danmenunjukanpeningkatandanhasilbelajaryang baik pula. Saran dari penelitian ini adalah pada proses belajar mengajar di kelas guru harus selalu berinteraksi dengan siswa, karena dengan komunikasi yang baik dapat terjadi timbal balik antara guru dengan siswa. Siswa bisa lebih terbuka kepada guru ketika menghadapi kesulitan dalam proses belajar mengajar. Sehingga siswa dapat lebih aktif selama pembelajaran berlangsung

Pengendalian biaya dan waktu pada pelaksanaan Proyek Pembangunan Gedung Kuliah Bersama (Gedung B) Universitas Islam Malang dengan metode nilai hasil / Beni Prima

 

ABSTRAK Prima,Beni. 2015. Pengendalian Biaya dan Waktu pada Pelaksanaan Proyek Pembangunan Gedung Kuliah Bersama atau Gedung B Universitas Islam Malang dengan Metode Nilai Hasil. Pembimbing: (1) Drs. Made Wena, M.Pd.,M.T, (II) Drs. Ir. Sudomo, M.MT. Kata Kunci: metode nilai hasil, pengendalian biaya, pengendalian waktu, Malang Metode Nilai hasil merupakan suatu metode pengendalian biaya dan waktu yang dapat digunakan untuk memberikan informasi mengenai status kinerja proyek pada suatu periode pelaporan, memberikan informasi prediksi biaya yang dibutuhkan, memberikan informasi prediksi waktu untuk penyelesaian seluruh pekerjaan berdasarkan indikator kinerja saat pelaporan, biaya aktual yang telah diserap suatu pekerjaan, informasi variansi biaya dan jadwal yang mencerminkan adanya under run (lebih cepat dan lebih murah) atau over run (lebih lambat dan lebih mahal). Penelitian ini dilaksanakan dengan tujuan untuk menganalisis beberapa hal yang mencakup ACWP (Actual Cost Work Performanced), BCWP (Budgeted Cost Work Performanced), BCWS (Budgeted Cost Work Schedule). Penelitian ini menggunakan rancangan penelitian kuantitatif. Data penelitian yang berupa progres pelaksanaan proyek selama pelaporan. Pengumpulan data dilakukan dengan melakukan observasi dan dokumentasi secara langsung dengan kontraktor yang bersangkutan dan mengumpulkan data laporan pengawasan dari konsultan pengawas proyek. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, tahap analisis data, serta tahap pembahasan data. Berdasarkan hasil analisis data yang dilakukan, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, biaya pelaksanaan proyek (EAC) yang didapatkan adalah sebesar Rp. 9.028.681.000,00dibanding dengan nilai kontrak sebesar Rp. 8.837.501.000,00. Kedua, waktu penyelesaian proyek mengalami keterlambatan selama 21 hari kalender setelah adanya adendum sehingga total keseluruhan pelaksanaan yang awalnya 272 hari kalender menjadi 293 hari kalender. Ketiga, berdasarkan simpulan pertama dapat diketahui bahwa kontraktor pelaksana mengalami kerugian sebesar Rp. 191.181.000,00.

Pengaruh dana pihak ketiga dan penawaran kredit terhadap fungsi intermediasi keuangan perbankan (studi kasus pada bank yang listing di BEI tahun 2007-2009) / Dewi Rositasari

 

Kata Kunci : Dana Pihak Ketiga, Penawaran Kredit dan Intermediasi Penelitian ini dilatarbelakangi dengan pemikiran bahwa bank masih belum optimal melakukan fungsi intermediasi keuangannya. Jumlah dana masyarakat yang berhasil dikumpulkan oleh perbankan tidak seluruhnya dapat disalurkan ke bentuk kredit Oleh karena itu pihak bank mengelola dana tersebut untuk disalurkan sesuai dengan permintaan dari masyarakat. Penelitian ini bertujuan untuk mengetahui pengaruh dana pihak ketiga (X1) dan penawaran kredit (X2) terhadap fungsi intermediasi keuangan perbankan (Y). Jenis penelitian ini adalah penelitian kuantitatif yaitu metode penelitian yang berlandaskan pada filsafat positivisme, digunakan untuk meneliti pada populasi atau sampel tertentu dan analisis data bersifat kuantitatif dengan tujuan untuk menguji hipotesis yang telah ditetapkan. Sampel yang digunakan dalam penelitian ini berjumlah 18 bank dari 30 bank sebagai populasi penelitian. Metode pengumpulan data yang digunakan dalam penelitian ini adalah metode dokumentasi yang merupakan metode dengan cara mengumpulkan dokumendokumen yang berupa catatan-catatan, grafik, gambar, dan lain sebagainya yang digunakan untuk memperoleh data yang berkaitan dengan gambaran umum perusahaan. Data tersebut meliputi laporan keuangan yang dipublikasikan oleh masing-masing bank dan data yang dipublikasikan oleh Bank Indonesia selama periode 2007-2009. Analisis data menggunakan uji asumsi klasik yaitu uji normalitas, uji multikolinieritas, uji heterokedastisitas dan uji autokorelasi serta menggunakan analisis regresi linier berganda dengan uji regresi secara parsial (uji t) dan uji regresi secara simultan (uji F). Pengolahan data yang dilakukan peneliti dibantu dengan program SPSS 17 For Windows. Hasil Penelitian ini dapat disimpulkan bahwa dana pihak ketiga secara parsial tidak berpengaruh terhadap intermediasi keuangan perbankan dengan tingkat signifikansi variabel dana pihak ketiga sebesar 0,291 > 0,05 sehingga Ha ditolak dan Ho diterima, sedangkan penawaran kredit secara parsial berpengaruh terhadap intermediasi keuangan perbankan dengan tingkat signifikansi 0,039 < 0,05 sehingga Ho ditolak dan Ha diterima. Tetapi secara simultan kedua variabel tersebut yaitu dana pihak ketiga dan penawaran kredit berpengaruh terhadap intermediasi keuangan perbankan dengan tingkat signifikansi 0,012 < 0,05 sehingga Ho ditolak dan Ha diterima. Berdasarkan kesimpulan diatas, penulis dapat mengimplikasikan bahwa untuk meningkatkan fungsi intermediasi keuangannya, maka bank dapat menambah penawaran kredit meskipun harus mengubah struktur modal. Apabila penambahan kredit tidak diimbangi dengan kenaikan penawaran kredit yang dilakukan oleh pihak bank, maka intermediasi keuangan perbankan tidak dapat berjalan dengan baik.

Mengajarkan matematika di sekolah dasar dengan block logic / oleh Agni Danaryanti

 

Analisis kebutuhan ruang parkir pada pasar tradisional Kota Malang / Firda Pradika Darmayanti

 

ABSTRAK Darmayanti, Firda, Pradika. 2014. Analisis Kebutuhan Ruang Parkir Pada Pasar Tradisional Kota Malang. Skripsi, Program Studi S1 Pendidikan Teknik Bangunan, Jurusan Teknik Sipil, Fakultas Teknik Universitas Negeri Malang. Pembimbing (I) Pranoto, S.T., M.T., (II) Drs. Boedi Rahardjo, M. Pd, M.T. Kata Kunci: Kebutuhan ruang parkir, Pasar Tradisional. Pasar tradisional merupakan fasilitas umum yang mempunyai daya tarik cukup besar bagi masyarakat karena erat kaitannya dengan proses pemenuhan kebutuhan harian, di mana kegiatan tersebut akan menimbulkan tarikan perjalanan yang menyebabkan pemusatan pengunjung. Maka salah satu permasalahan yang muncul adalah perparkiran. Semakin banyak pengunjung yang datang, maka semakin besar kebutuhan ruang parkir. Tujuan dari penelitian ini adalah mengetahui karakteristik parkir yang meliputi volume parkir, akumulasi parkir, durasi parkir, angka pergantian parkir (parking turn over) dan indeks parkir, dan mengetahui kebutuhan satuan ruang parkir (SRP)kendaraan bermotor pada pasar tradisional kota Malang. Hasil penelitian menunjukkan bahwa karakteristik parkir: 1) Volume parkir tertinggipasar Bunulrejo: mobil 92 kend dan sepeda motor 886 kend, pasar Madyopuro: mobil 188 kenddan sepeda motor 992 kend, pasar Merjosari: mobil 182 kend dan sepeda motor 1744 kend. 2) Akumulasi maksimum pasar Bunulrejo: mobil 19 kend pukul 07.00-08.00 WIB dan sepeda motor 311 kend pukul 06.00-07.00 WIB, pasar Madyopuro: mobil 85 kend pukul 06.00-07.00 WIB dan sepeda motor 424 kendpukul 06.00-07.00 WIB, pasar Merjosari: mobil 71 kendpukul 07.00-08.00 WIB dan sepeda motor 732 kend pukul 06.00-07.00 WIB.3) Durasi rata-rata 30-60 menit. 4) Angka pergantian parkir tertinggi mobil 4,60 kend/SRP dan sepeda motor pada pasar 3,18 kend/SRP. 5) Indeks parkir mobil ≤ 100% dan sepeda motor ≥ 100%. Kebutuhan satuan ruang parkir berdasarkan LAT adalah parkir mobil pasar Bunulrejo 0,46 SRP/100 M2, Madyopuro 1,62 SRP/100 M2 dan Merjosari 0,91/100 M2 . Parkir sepeda motor pasar Bunulrejo 7,54 SRP/100 M2, Madyopuro 8,09 SRP /100 M2 dan Merjosari 9,33 SRP/100 M2. Sedangkan berdasarkan LAE/100M2: parkir mobil pasar Bunulrejo 0,51 SRP/100 M2, Madyopuro 1,84 SRP/100 M2 dan Merjosari 1,00 SRP/100 M2. Parkir sepeda motor pasar Bunulrejo 8,27 SRP/100 M2, Madyopuro 9,17 SRP/100 M2 dan Merjosari 10,36 SRP/100 M2. Kebutuhan lahan parkir pada pasar Bunulrejo untuk mobil minimal2,7% dan maksimal 5,7%, sepeda motor minimal 6,8% dan maksimal11,3%. Pasar Madyopuro untuk mobil minimal 12,4% dan maksimal 20,2%, sepeda motor minimal 7,9% dan maksimal12,2%. Pasar Merjosari untuk mobil minimal 6,7% dan maksimal 11,4%, sepeda motor minimal 9,0% dan maksimal 13,9%. Berdasarkan hasil penelitian tersebut saran yang dapat diberikan adalah petugas parkir lebih aktif dalam merapikan kendaraan, pembuatan marka parkir, dan dipisahkan tempat parkir antara pedagang dan pembeli, dan diperlakukan tarif progresif.

Mengajarkan statistika di SMP kelas I dengan menggunakan metode kartu kerja / oleh Helmi Riefai

 

Pengaruh curing menggunakan air laut terhadap kuat tekan beton dari berbagai merek semen yang dipasarkan di Kota Malang / Oktavianus Putra Mini.

 

ABSTRAK Putra, Oktavianus. 2015. PengaruhCuring Menggunakan Air LautTerhadapKuatTekanBeton Dari BerbagaiMerk Semen Yang Dipasarkan Di Kota Malang. Skripsi, Program Studi S1 PendidikanTeknikBangunan, FakultasTeknik, UniversitasNegeri Malang. Pembimbing : (I) Drs. Sonny Wedhanto, M.T. (II) Ir. Edi Santoso, M.T Kata Kunci :KuatTekanBeton, Curing Air Laut Keterbatasan air tawardilokasiproyekmemaksapenggunaan air lautuntukbeberapapekerjaanbetontidakdapatdielakkan,diantaranyauntukperawatan (curing) betonpascapengecoran.Penelitianinidilakukanuntukmengetahuipengaruhcuring menggunakanair lautterhadapkuattekanbeton. Sampelmenggunakansilinderbetonukuranstandar, dibuatdariberbagaimerk semen yang dipasarkan di Kota Malang.Jumlahsampelsebanyaklimabuahuntukmasing-masingmerek semen.Durasicuring 7, 14, dan 28 hari. Hasilpenelitian, kekuatantekanbetonmengalamipenurunan.Menggunakansemen TigaRoda:betonumur 14 harimengalamipenurunan25,9% darikuattekanumur 7 hari;danumur 28 harimengalamipenurunan10,31%dariumur 14 hari. Menggunakan semen Holcim:umur 14 harimengalamikenaikan20,31% darikuattekanumur 7 hari; danumur 28 harimengalamipenurunan7,87% dariumur 14 hari.Menggunakan semen Gresik:umur 14 harimengalamipenurunan 2,75% dariumur 7 hari;danumur28 harimengalamipenurunan 30,68% dariumur 14 hari.

Mengajarkan gerak peluru di SMA kelas I dengan metode demonstrasi / oleh Asim

 

Tinjauan segi pokok bahasan metode pengajaran seni rupa dalam kurikulun SPG / oleh Lily Indrawati

 

Pengaruh penggunaan LKS terhadap prestasi belajar trigonometri siswa kelas II Madrasah Aliyah Khairuddin Gondanglegi Kabupaten Malang
oleh Nur Azizah

 

Kenyataan di lapangan menunjukan bahwa LKS telah banyak digunakan hampir semua SMA dan Mata pelajaran. Hal ini dapat dipahami sebagai suatu penerimaan terhadap CBSA. Sementara di pihak lain, laporan mengenai keberhasilan penggunaan LKS pada mata pelajaran matematika telah ada. Atas dasar kenyataan tadi, akhirnya diadakan penelitian ini.

Hubungan dukungan teman sebaya dan konformitas kelompok dengan perilaku merokok pada remaja di Kota Blitar / Ikma Ni'ma Qoni'

 

ABSTRAK Qoni’. Ikma Ni’ma. 2016. Hubungan Dukungan Teman Sebaya dan Konformitas Kelompok dengan Perilaku Merokok pada Remaja di Kota Blitar. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (I) Dr. Imanuel Hitipeuw, M.A (II) Diantini Ida Viatrie. S.Psi., M.Si Kata kunci: dukungan teman sebaya, konformitas kelompok, perilaku merokok. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan (1) dukungan teman sebaya, (2) konformitas kelompok, (3) perilaku merokok, (4) mengetahui hubungan dukungan teman sebaya dengan perilaku merokok, (5) mengetahui hubungan konformitas kelompok dengan perilaku merokok (6) mengetahui hubungan dukungan teman sebaya dan konformitas kelompok dengan perilaku merokok. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan deskriptif dan korelasional. Subjek penelitian berjumlah 57 remaja pada usia 16-18 tahun yang merokok dan masih dalam masa pendidikan di Kota Blitar. Pengambilan subjek menggunakan teknik purposive incidental sampling. Instrumen yang digunakan dalam penelitian ini adalah skala dukungan teman sebaya, skala konformitas kelompok, dan skala perilaku merokok. Analisis data menggunakan teknik deskripsi untuk mengetahui gambaran dukungan teman sebaya, konformitas kelompok, dan perilaku merokok. Uji hipotesis menggunakan analisis korelasi product moment untuk mengetahui hubungan dukungan teman sebaya dengan perilaku merokok, dan hubungan konformitas kelompok dengan perilaku merokok. Untuk menganalisis hubungan dukungan teman sebaya dan konformitas kelompok dengan perilaku merokok pada remaja digunakan teknik analisis korelasi berganda. Hasil penelitian menunjukkan bahwa: (1) remaja perokok memiliki dukungan teman sebaya yang tinggi, (2) remaja perokok memiliki konformitas kelompok yang tinggi, (3) perilaku merokok pada remaja di Kota Blitar termasuk kategori tinggi, (4) terdapat hubungan positif antara dukungan teman sebaya dan perilaku merokok,(5) terdapat hubungan positif antara konformitas kelompok dan perilaku merokok, (6) terdapat hubungan antara dukungan teman sebaya dan konformitas kelompok dengan perilaku merokok pada remaja di Kota Blitar. Saran yang dikemukakan (1) remaja di Kota Blitar diharapkan dapat dengan selektif dalam memilih kelompok pergaulan, (2) orangtua diharapkan mampu menjadi teman sekaligus pembimbing yang baik dalam membantu remaja menemukan jati diri, (3) pemerintah Kota Blitar diharapkan mampu membuat kegiatan positif yang mengikut sertakan remaja, (4) peneliti selanjutnya diharapkan agar memperbaiki instrumen, kualitas aitem, dan memperdalam mengenal subjek dengan informasi identitas subjek, mempertimbangkan variabel-variabel lain yang lebih mempengaruhi perilaku merokok pada remaja.

Mengajarkan geometri di SMP dengan metode kartu kerja
oleh Yessy Yosephina Louise Schonherr

 

Pengajaran ilmu pengetahuan alam di sekolah dasar kelas VI / oleh Sularno

 

Analisis motif Batik Manggur Kota Probolinggo / Rian Permadi

 

ABSTRAK Permadi, Rian. 2015. Analisis Motif Batik ManggurKota Probolinggo. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra,Universitas Negeri Malang, Pembimbing: (1) Dra. Hj. Purwatiningsih, M.Pd., (II) Fenny Rochbeind, S.Pd, M.Sn. Kata Kunci: Batik Manggur Kota Probolinggo, Analisis Motif Indonesia kaya akan warisan yang sudah mendunia, salahsatunya yaitu batik yang harus selalu dijaga kelestariannya. SepertihalnyaBatik Mangguryang dianggap sebagai batik khas Kota Probolinggo, perluadanyapelestarianuntukmenjagakekhasan batik tersebut. Oleh karena itu, perlu pembahasan mendalam denganmenganalisis motif Batik Manggur. Penelitian ini dilaksanakan dengan tujuan menganalisis motif dari Batik ManggurKhasKota Probolinggo.Penelitianinimenggunakanrancanganpenelitiankualitatifdenganmetodedeskriptif. Pengumpulan data dilakukandenganmenggunakanteknikobservasi, wawancara dan dokumentasi secaralangsungterhadapIbuSitiMalikha. Analisis data dilakukandengan tahap reduksi data, penyajian data, dan penarikan kesimpulan.Pengecekankeabsahantemuandilakukandengancaramenghubungkan data hasilobservasidenganlandasanteori. Berdasarkan hasil penelitian tersebut, diperoleh simpulan hasil penelitian. Mengenai motif, ada lima motif yang dianggap mewakili Batik Manggur. Diantaranya yaitu motif Batik Daun Mangga Manggur, Motif Batik Melati Manggur, Motif Batik Manggur Seribu Taman, Motif Sulur Manggur, Motif Batik Bunga Sepatu Manggur yang kelima motif tersebut terbentukdarigarisnyata geometrik dangarisnyata non geometrik. Kelima motif ini rata-rata menggunakan ornamen buah mangga dan buah anggur serta terdapat penggunaan isen-isen yang berupa cecek-cecek, cecekpitu, galarandansisik. Pada pewarnaanbatik terdapatduajenisyaitupewarnaanalamiyang menghasilkanwarnagelapdanpewarnaansintetisataumenggunakanbahankimia yang menghasilkanwarnacerah.Kelima motif batik juga mengalami perubahan bentuk dari bentuk aslinya, yaitu ide asal motif batik melalui proses stilasi dan transformasi namun perubahan tersebut tidak meninggalkan keaslian dan karakteristik bentuk itu sendiri. Hasil penelitian ini diharapkan bisa menjadi sebuahwawasanbudayadandapatdijadikanbahanpembelajarankesenian disekolahsepertibahanpembelajaran motif/ragamhias. Untukindustri “Batik Manggur” inidiharapkanbisa mengembangkan lagi motif-motif yang bersumber dari potensi dan kekayaan Kota Probolinggo, agar batik yang dihasilkan memiliki banyak variasi motif. Selain itu melalui hasil kerajinan membatik dapat mempromosikan Probolinggo secara nasional maupun internasional.  

Pengajaran matriks untuk menyelesaikan sistim persamaan linier di SMA / oleh I.G.K. Susila

 

Analisis ukiran di sentra "Meberl Ukir Antik" Piranha Malang / Lia Khoirun Nisa'

 

ABSTRAK Nisa’. LiaKhoirun. 2015. AnalisisUkiran di Sentra “MebelUkirAntik” Piranha Malang. Skripsi, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Dra. Ida SitiHerawati Abdullah, M. Pd, (II) Drs. AAG. RaiArimbawa, M.Sn. Kata Kunci: Motif hiasukiran, PrinsipOrganisasiEstetik, MebelUkirAntik Ukiranadalahhiasanatauornamen yang terbentukdariteknikpemahatanukirterhadappermukaan media kerasataulunaksehinggamenghasilkanhiasanbervolumecekungdancembungkarenasusunan-susunanbidangdangaris yang dihiasidariteknikpengukirantersebut. Motif ukiransangatberanekaragamcoraknya, setiapdaerahmemilikicirikhastersendiri, begitujugasetiapmebelmempunyaikekhasantersendiridilihatdaricorakmotifnya. Penelitianinidilaksanakandengantujuan: (1) Mendeskripsikan motif ukiran; (2) Mendeskripsikanprinsiporganisasiestetik“MebelUkirAntik”. Lokasipenelitianiniberalamatkandi Jl. Piranha Atas no 79, Rt 06 Rw 01 Kelurahan Tunjung SekarBlimbing Malang.Penelitianinimenggunakanpenelitiandeskriptifkualitatif. Instrumenpenelitianmenggunakaninstrumen formatobservasidanwawancara. Pengumpulan data dilakukandenganmenggunakanteknikobservasipadakelimaprodukkaryayaituukiranmejakursi, asbaknaga, pigurabarongan, tiangbenderanaga, dangagangpintu. Subyekpenelitiandilakukandenganwawancarakepada Ahmad KasimdanKrisbianto. Analisis data dilakukandengantahapreduksi, penyajian, dankesimpulan. Pengecekankeabsahantemuanmenggunakantrianggulasisumberdanmetode. Penelitianinidiperolehhasil (1) Motif ukiran yang terdapat di “MebelUkirAntik”inimempunyai motif hiasgeometris, organis, danfiguratif. Motif hiasgeometristerdiridarimotif hias meander,pilin, jlamrang,lereng, danbuah. Motif hiasorganisterdiridarimotif hiaspatra, lung, sulur,ikal/ukel,trubusan, sulur-suluran,endong, dancula. Motif hiasfiguratifterdiridari barong/kalapadaukiranpigura, danbentuknaga.Bagian-bagian motifpadaukiranterdiridari motif utama, motif pendukung, danisiandalamukiran. Motif utamaterdiridari motif hiasbunga, kala/mukanaga,lereng,lambang, danukel/ikal. Motif pendukungterdiridarimotif hiaspatra, lung, sulur, sirip, danpilin. Isiandalamukiranterdiridarimotif hiasukel/ikal, jlamrang, buah, dansuluran. (2) Prinsiporganisasiestetikukiranberupaprinsipkeselarasan yang dicapaidenganperulanganbentuk motif hiasnya; prinsipkeseimbangan yang cenderungpadakeseimbangan formal/simetris; prinsipkesebandingan yang dicapaidenganpenyesuaianukuran motif utamadan motif pendukungpadaukiran; prinsipritme/iramadicapaidenganperulanganbentuk motif hiasukiran yang berbedaukuran; danprinsipemphasis/pusatperhatianterciptadariteksturdan motif utamaukiransertatitikpusatperhatiandanfokustertentu yang terdapatpadaukiran. Berdasarkanhasilpenelitianinidiharapkanukiraninibisamenjadisebuahpengetahuan yang bermanfaatdandapatdijadikanbahanpembelajarankesenian di sekolah. Apabilapeneliti lain inginmelakukanpenelitiansejenisdenganobjekatausubjek yang berbeda, skripsiinibisadigunakansebagaireferensidanperbandingan yang nantinyadapatdikembangkanlagimenjadilebihbaik.

Montage sebagai salah satu bentuk kegiatan pengajaran seni rupa di SMA Negeri III Malang / oleh Bagus Brahmananto

 

Tinjauan tentang pengajaran biologi di kelas III pada beberapa SMP Negeri Kabupaten Tulungagung
oleh Marsinah

 

Pengenalan motip-motip batik serta nilai-nilainya bagi anak SMA kelas II / oleh Supriadi

 

Pengembangan sistem informasi administrasi perpustakaan berbasis web di SMP Ar-Rohmah Boarding School, Dau Malang / Ali Azyumardi Azra

 

ABSTRAK Azyumardi Azra, Ali. 2015.Pengembangan SistemInformasi Administrasi Perpustakaan Berbasis Web Di SMP AR-Rohmah Boarding School, Dau Malang. Proposal Skripsi. Program Studi Pendidikan Teknik Informatika, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I)M. Zainal Arifin S.Si, M.Kom. (II) M. JauharulFuady S.T., M.T. Kata Kunci : sistem informasi, administrasi, perpustakaan,sekolah, web. Sistem informasi administrasi perpustakaan adalah suatu sistem yang memuat informasi-informasi tentang segala transaksi administrasi perpustakaan sekolah. Sistem informasi ini dirancang untuk digunakan pada sekolah-sekolah yang sudah maju dan memiliki syarat penggunaan sistem informasi. Sistem informasi ini dapat digunakan oleh operator, admin, siswa sekolah yang bersangkutan. Masing-masing siswa yang terdaftar memiliki akun untuk dirinya sendiri dan bersifat pribadi. Penelitian dan pengembangan ini dilaksanakan karena proses administrasi perpustakaan di SMP Ar-Rohmah Boarding School Dau Malang mengalami permasalahan. Permasalahan tersebut antara lain banyak buku hilang, data transaksi yang hilang karena ditulis dengan kertas, dan pencatatan administrasi perpustakaan yang tidak rutin. Penelitian dan Pengembangan ini dilaksanakan dengan tujuan untuk mengembangkan suatu sistem informasi yang awalnya dilakukan dengan pencatatan transaksi perpustakaan seperti peminjaman dan pengembalian buku secara tertulis pada sebuah kertas menjadi laporan administrasi perpustakaan sekolah pada sebuah web sistem informasi dengan penambahan fitur-fitur tambahan di dalamnya, sehingga manajemen administrasi perpustakaan sekolah yang bersangkutan dapat menjadi lebih mudah, efisien,efektif dan rutin dalam pencatatan administrasi perpustakaan. Metode penelitian yang digunakan adalah metode penelitian dan pengembangan atau Research and Development (R&D).Menurut Sugiono (2012:297), metode penelitian dan pengembangan adalah metode penelitian yang digunakan untuk menghasilkan produk tertentu dan menguji keefektifan produk tersebut. Dalam hal prosedur penelitian pengembangan, Sommerville (Dalam jurnal oleh Sigit Prayitno Trihandoko,2012) mengungkapkan bahwa siklus R &D tersusun dalam beberapa langkah penelitian dan pengembangan yang disebut model Pengembangan waterfall. Model pengembangan produk yang digunakan adalah model waterfall. Pengembangan dilakukan melalui 5 tahapan, yaitu analisa kebutuhan, desain sistem dan antarmuka perangkat lunak,implementasi dan pengujian kode program, integrasi dan pengujian produk, penerapan dan perawatan produk. Produk dari penelitian ini berupa sistem informasi berbasis web dan menggunakan basis data untuk menyimpan informasi. Hasil dari penelitian dan pengembangan ini adalah sebuah sistem informasi administrasi perpustakaan yang berbasis web dengan penambahan fitur-fitur baru di dalamnya untuk Sekolah Menengah Pertama (SMP)Ar-Rohmah Boarding School Dau Malang.  

Tinjauan pelaksanaan praktikum biologi di SMP Kawedanan Kepanjen dalam hubungannya dengan kurikulum biologi SMP tahun 1975
oleh Chusnul Chotimah

 

Mengajarkan matrik di SMA kelas I dengan sistim instruksionil / oleh Dwiyono Sukorahardjo

 

Pembahasan pemakaian kata panggilan penghormatan dalam Bahasa Indonesia / oleh Sri Chumasiah

 

Studi tentang pengaruh suhu terhadap kegiatan respirasi kecambah
oleh Ni Ketut Ruspiati

 

Penerapan model pembelajaran kooperatif numbered heads together (NHT) dengan pendekatan contextual teaching and learning (CTL) untuk meningkatkan aktivitas dan hasil belajar biologi siswa kelas X SMA Negeri 6 Malang / Enik Cholifah

 

ABSTRAK Cholifah, Enik. 2010. Penerapan Model Pembelajaran Kooperatif Numbered Heads Together (NHT) dengan pendekatan Contextual Teaching and Learning (CTL) untuk Meningkatkan Aktivitas Belajar dan Hasil Belajar Biologi Siswa Kelas X SMA Negeri 6 Malang. Skripsi, Jurusan Biologi Program Studi Pendidikan Biologi FMIPA Universitas Negeri Malang. Pembimbing (I) Dr. H. Soedjono Basoeki, M.Pd, (II) Sitoresmi Prabaningtyas, S.Si., M.Si Kata kunci: contextual teaching and learning, numbered heads together, aktivitas belajar, hasil belajar Biologi. Berdasarkan hasil observasi di SMAN 6 Malang peneliti menemukan beberapa hal antara lain metode yang sering diterapkan di kelas X-6 adalah ceramah dan diskusi secara klasikal. Aktivitas belajar yang dilakukan siswa kurang, siswa kurang aktif dalam belajar, kurang memperhatikan pendapat teman, dan terdapat beberapa siswa yang sering mendominasi, sehingga menyebabkan siswa kurang paham terhadap materi pelajaran dan berpengaruh terhadap hasil belajar yang relatif lebih rendah dari Kriteria Ketuntasan Minimum (KKM) yaitu 70. Cara mengatasi masalah tersebut perlu dilakukan penelitian tentang penerapan pembelajaran yang dapat meningkatkan aktivitas dan hasil belajar siswa, salah satunya dengan penerapan model pembelajaran kooperatif Numbered Heads Together dengan pendekatan Contextual Teaching and Learning. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) yang terdiri dari dua siklus, pada siklus I terdiri dari lima pertemuan, dan siklus II terdiri dari empat pertemuan. Setiap siklus terdiri dari tahap perencanaan (planning), tahap pelaksanaan tindakan (action), tahap observasi (observation), dan tahap refleksi (reflection). PTK ini bertujuan untuk meningkatkan aktivitas dan hasil belajar siswa kelas X SMAN 6 Malang. Subyek penelitian yang digunakan dalam penelitian ini yaitu siswa kelas X-6 SMAN 6 Malang semester I tahun ajaran 2009/2010. Hasil penelitian menunjukkan bahwa terjadi peningkatan persentase aktivitas belajar siswa dari siklus I sebesar 59,5% dengan taraf keberhasilan cukup, ke siklus II meningkat menjadi 67,3 % dengan taraf keberhasilan baik. Peningkatan hasil belajar kognitif siswa diketahui dari ketuntasan belajar klasikal, dari siklus I sebesar 47,1 % dengan rata-rata nilai siswa sebesar 61,8 ke siklus II meningkat menjadi 73,5 % dengan rata-rata nilai siswa 75. Berdasarkan hasil penelitian dapat disimpulkan bahwa model pembelajaran kooperatif Numbered Heads Together dengan pendekatan Contextual Teaching and Learning dapat meningkatkan aktivitas dan hasil belajar siswa kelas X-6 SMAN 6 Malang. Saran dari penelitian ini adalah sebaiknya dalam penerapan model pembelajaran kooperatif Numbered Heads Together dengan pendekatan Contextual Teaching and Learning melakukan secara berkesinambungan dan teratur sehingga mampu mempercepat adaptasi/ penyesuaian siswa terhadap kondisi belajar. Penelitian ini dapat dijadikan alternatif oleh guru/peneliti yang lain untuk melaksanakan penelitian yang serupa pada materi dan sekolah yang berbeda sehingga dapat dijadikan pembanding bagi penelitian sebelumnya.

Tokoh Dewi Drupadi sebagai inspirasi dalam penciptaan karya seni lukis gaya pribadi / Damar Tisna Hidayadi Sastra

 

ABSTRAK Sastra, DamarTisnaHidayadi. 2015.TokohDewiDrupadiSebagaiInspirasiDalamPenciptaanKaryaSeni Lukis Gaya Pribadi. Skripsi, JurusanSeni Dan Desain, Fakultas Sastra, UniversitasNegeri Malang. Pembimbing: (I) Dr. Hariyanto, M.Hum, (II) Fenny Rochbeind, S. Pd,M. Sn Kata Kunci:DewiDrupadi, penciptaan, seni lukis,gayapribadi, inspirasi. Dewi Drupadi memiliki nama lengkap Dewi Wara Drupadi, yangberarti Dewi adalah sebutan untuk seorang wanita, Wara artinya yang terpilih atau utama, danDrupadi diartikan sebagai anak Drupada.Walaupun bukan tergolong sebagai tokoh utama dalam peperangan antara Pandawa dengan Kurawa yang menimbulkan peristiwa Bharatayuda, namun keberadaanya Dewi Drupadi menduduki urutan penting bagi kemenangan pihak Pandawa. Pada penciptaan ini, penulis mengambil ide atau gagasan berkarya dariTokohWayang Orang, yaituDewiDrupadi.Ide atau gagasan tersebut diwujudkan dalam karya seni lukis gayapribadi. Gaya pribadidipiliholehpenuliskarenamemilikiciri-ciriatautanda yang membedakandengan karyasenilukis yang diciptakan orang lain padaumumnya. Proses dalam penciptaan karya seni lukis gayapribadi ini bermula dari perancangan konsep yang didalamnya terdapat ide atau gagasan, tema, dan objek yang akan diciptakan yaitu objek representasional (figurmanusia). Setelah itu menentukan karakteristik karya, kemudian menentukan teknik serta alat dan bahan yang akan digunakan. Jika semuanya sudah terpenuhi untuk langkah selanjutnya adalah proses visualisasi yaitu membuat sketsa diatas kertas lalu memindahkannya ke atas kertascanson. Kemudian proses pewarnaan dengan menggunakan teknik arsir dengan bahan pensil warna. Setelah itu proses detail karya untukpenegasan objek sertabentukdan yang terakhir adalah proses melapisi karya dengan pelapis pylox. Penulis menampilkan 6karyaseni lukisgayapribadidengan media estetikberupagaris danwarna,simbolisasidarikonsep.Menggunakan karakteristik (gayapribadi) karya berupa objekselalufigurmanusia, garissemu lengkung, pemilihanwarna terang, gradasi warna,danirama. Berdasarkanhasilpenciptaanini diharapkandapatmemberikanpengalaman baru kepada pencipta maupun orang lain dalam mempelajari karya seni lukis gayapribadi. Mulai dari perancangan konsep, hingga proses visualisasi karya, dan diskripsi karya berdasarkan sudut pandang pribadi penulis maupun sudut pandang orang lain. Bagi masyarakat sebagai pengapresiasi dan pembaca, akan menambah pengetahuan dan pengalaman apresiasi, serta bisa menjadi wacana bagi masyarakatuntuklebihmengenalKebudayaan Indonesia. Bagi pendidikanmemperkenalkan kebudayaan wayang orang, kususnya tokoh Dewi Drupadi melalui karya seni lukis sebagai bahan pembelajaran.

Materi dan energi sebagai bahan pelajaran ilmu kimia di SMA kelas I / oleh Latifah

 

Studi penerimaan masyarakat Malang terhadap gence ruan khas Kalimantan Timur / Prastiawan Wicaksono

 

Kata kunci: penerimaan, masyarakat Malang, Gence Ruan khas Kalimantan Timur Berdasarkan dari kemiripan selera makan masyarakat Malang dan masyarakat Kalimantan Timur maka peneliti berkepentingan untuk mengenalkan Gence Ruan khas Kalimantan Timur kepada masyarakat luas terutama masyarakat Malang. Penelitian ini dilakukan untuk mengetahui penerimaan masyarakat Malang terhadap warna, aroma, tekstur dan rasa pada Gence Ruan khas Kalimantan Timur. Metode penelitian yang digunakan adalah deskriptif. Hasilnya menunjukkan bahwa penerimaan masyarakat Malang terhadap warna Gence Ruan khas Kalimanta Timur adalah 76,2% kategori suka, terhadap aroma Gence Ruan khas Kalimantan Timur 75,6% kategori suka, terhadap tekstur Gence Ruan khas Kalimantan Timur 77,9% kategori suka, dan terhadap rasa Gence Ruan khas Kalimantan Timur 78,1% kategori suka. Dengan demikian dapat disimpulkan Dengan bahwa masakan daerah dari Kalimantan Timur yaitu Gence Ruan khas Kalimantan Timur dapat diterima oleh masyarakat Malang. Berdasarkan hasil penelitian ini, dapat disarankan untuk dilakukan penelitian lebih lanjut mengenai prospek usaha Gence Ruan khas Kalimantan Timur di Malang.

Pengujian distribusi campuran beta binomial : studi kasus kelulusan matakuliah semester I dan II FMIPA UM / oleh Maufirah

 

Multiple depot vehicle routimh problem with backhauls menggunakan algoritma clark and wright dengan 2-OPT dan penerapannya

 

Kata Kunci : Vehicle Routing Problem(VRP),Multiple Depot Vehicle Routing Problem With Backhauls(MDVRPB), Algoritma Clark and Wright, 2-Opt. Permasalahan penyediaan barang atau jasa dari depot (pusat distribusi) ke customer yang letaknya tersebar di berbagai tempat atau lokasi merupakan salah satu contoh dari permasalahan distribusi. Letak customer yang tersebar di berbagai tempat seringkali menyebabkan kendaraan menempuh jarak yang jauh, sehingga hal tersebut kurang efisien. Salah satu konsep pada teori graph yang dapat diterapkan untuk menyelesaikan masalah ini yaitu VRP, sedangkan salah satu pengembangan dari permasalahan VRP yaitu MDVRPB yang merupakan pengembangan dari VRP dengan penambahan kendala dengan kondisi depot sebagai pusat distribusi barang terdapat lebih dari satu dan customer dapat melakukan permintaan berupa pengiriman barang atau berupa pengambilan barang. Permasalahan MDVRPB yang dibahas diselesaikan dengan menggunakan Algoritma Clark and Wright dengan 2-Opt digambarkan dengan suatu graph. Gambar graph tersebut dianggap sebagai peta yang menjelaskan kemungkinan jalur yang dapat dilewati dengan setiap titik mewakili depot dan customer, setiap sisi menunjukkan jalan yang menghubungkan antar titik dan setiap bobot pada sisi mewakili jarak antara kedua titik tersebut. Algoritma Clark and Wright yang digunakan yaitu berbasis saving. Secara umum, nilai saving didefinisikan sebagai ( ) ( ) ( ) ( ), dimana ( ) adalah jarak dari depot ke customer dan ( ) adalah jarak dari customer ke customer . Pembentukan rute kendaraan dimulai dari customer dan yang memiliki nilai saving terbesar. Setelah diperoleh rute maka akan ada perbaikan tiap rute dengan menggunakan algoritma 2-Opt.Sedangkan penentuan depot yang melayani customer berdasarkan pada perbandingan nilai jarak customer pada depot dan nilai saving terkecil yang mungkin terbentuk pada keseluruhan depot. Berdasarkan empat contoh yang telah dibahas diketahui bahwa Algoritma Clark and Wright dengan 2-Opt yang digunakan menghasilkan jarak tempuh dan rute kendaraan yang minimum karena terdapat perbaikan rute sehingga menghasilkan rute yang optimal.

Pengembangan media pembelajaran tentang menggambar ragam hias berdasarkan pendekatan saintifik berbasis adobe flash CS5 di SMPN 18 Malang / Ucik Nur Hidayati

 

ABSTRAK Hidayati, Ucik Nur. 2015. Pengembangan Media Pembelajaran tentang Menggambar Ragam Hias Berdasarkan Pendekatan Saintifik Berbasis Adobe Flash CS5 Untuk Siswa SMP. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (1) Dra. Hj. Purwatiningsih, M.Pd (2) Drs. AAG Arimbawa, M.Sn. Kata Kunci: Media Pembelajaran, Saintifik, Adobe Flash CS5. Pada Kurikulum 2013 penerapan pembelajarannya lebih mengutamakan pada teknologi. Dalam pembelajaran faktor yang sangat mempengaruhi yaitu Kegiatan Belajar Mengajar (KBM) di sekolah, khususnya model dan media yang digunakan dan diterapkan oleh guru. Pemanfaatan media pembelajaran berbasis Adobe Flash CS5 dapat menjadi alternatif dalam meningkatkan prestasi belajar siswa untuk mengatasi permasalahan kejenuhan dalam proses pembelajaran. Media pembelajaran multimedia berbasis Adobe Flash CS5 merupakan salah satu sarana yang dapat digunakan agar siswa tidak merasa jenuh dalam mengikuti proses pembelajaran dan diharapkan siswa dapat termotivasi untuk mendalami pelajaran tersebut. Penggunaan media pembelajaran berbasis Adobe Flash CS5 dikemas dalam bentuk CD interaktif, juga diharapkan dapat mempermudah siswa dalam memahami materi pembelajaran. Tujuan yang ingin dicapai dalam penelitian dan pengembangan ini adalah untuk menghasilkan media pembelajaran multimedia berbasis Adobe Flash CS5 kelas VII di SMPN 18 Malang.Selain itu, penelitian dan pengembangan ini juga ditujukan untuk menguji kelayakan produk yang telah dihasilkan. Media pembelajaran yang dikemas dengan menarik ini diharapkan dapat mendukung proses pembelajaran seni budaya di SMPN 18 Malang. Model pengembangan produk media pembelajaran ini menggunakan modifikasi dari langkah-langkah penelitian dan pengembangan yang dikemukakan oleh Borg & Gall yang terdiri dari analisis kebutuhan, perencanaan, pengembangan produk, validasi ahli, revisi I, uji coba lapangan terbatas, revisi II, dan produk akhir. Jenis data pada penelitian ini menggunakan data kuantitatif dan data kualitatif. Data kuantitatif berupa saran, tanggapan, dan kritik dari validator yang digunakan sebagai pertimbangan dalam melakukan revisi terhadap media pembelajaran yang dikembangkan. Validasi isi produk dilakukan dengan menggunakan angket yang dilengkapi dengan skala penilaian berdasarkan skala Likert. Berdasarkan data yang diperoleh dari hasil validasi ahli media yaitu Bapak Joko Samudra S.Kom diperoleh presentase sebesar 97,08%%, ahli materi oleh Ibu Ike Ratnawati diperoleh presentase sebesar 89,58%, uji coba pengguna guru yaitu Bapak Wiwit Handoyo diperoleh presentase 92,96%, uji coba pengguna sebanyak 15 siswa di SMPN 18 Malang diperoleh presentase sebesar 88,90%, dan secara keseluruhan dari perhitungan diperoleh sebesar 92,13%. Dari hasil analisis data tersebut, dapat disimpulkan bahwa media pembelajaran berbasis Adobe Flash CS5 dinyatakan valid dan dapat digunakan dalam proses pembelajaran materi menggambar ragam hias di SMPN 18 Malang.

Studi tentang evaluasi pendidikan dalam pengajaran ilmu hayat di SMP se Kodya Malang
oleh Hari Marsudi Pramono

 

Permainan tradisional jaranan sebagai sumber ide penciptaan karya seni lukis semi abstrak / Rudy Julian Fransiska

 

ABSTRAK Fransiska, Rudy J. 2015. Permainan Tradisional Jaranan Sebagai Sumber Ide Dalam Penciptaan Karya Seni Lukis Semi Abstrak. Skripsi. Program Studi Pendidikan Seni Rupa Jurusan Seni dan Desain Fakultas Sastra Universitas Negeri Malang. Pembimbing : (1) Dra. Lilik Indrawati, M.Pd. (2) Fenny Rochbeind, S. Pd, M. Sn. Kata Kunci : Permainan Tradisional, Jaranan, Penciptaan, Karya Seni Lukis, Semi Abstrak. Permainan tradisional jaranan merupakan suatu permainan yang telah ada sejak jaman dahulu, di mana permainan ini ada hampir diseluruh daerah di wilayah Jawa. Jaranan berasal dari nama hewan tunggangan kuda, dalam bahasa jawa jaran yang artinya adalah kuda. Permainan ini bisa dibuat dari bambu atau pelepah daun pisang yang dibentuk menyerupai kuda. Jaranan dapat dimainkan oleh anak laki-laki maupun perempuan. Pada jaman dahulu jaranan sangat sering dimainkan oleh anak-anak, karena permainan ini merupakan permainan yang menyenangkan dan cara membuatnyapun juga cukup mudah. Namun pada saat ini, permainan jaranan justru hampir tidak pernah lagi terlihat dimainkan oleh anak-anak. Berdasarkan suatu permasalahan ini penulis menjadikanya sumber ide atau gagasan dalam penciptaan karya seni lukis. Dalam penciptaan karya seni lukis ini dimulai dari pengumpulan ide atau gagasan yang terangkum menjadi sebuah konsep yang di dalamnya terdapat tema, objek, karakteristik karya, alat dan bahan yang akan digunakan dalam penciptaan ini. Langkah selanjutnya adalah proses visualisasi, yang diawali dari membuat sketsa di atas kertas kemudian memindahkannya ke dalam kanvas. Tahapan yang terpenting dalam penciptaan ini adalah penggunaan teknik sapuan kuas basah menggunakan kuas besar yang disapukan dengan ekspresif untuk mengungkapkan gejolak yang timbul di dalam batin penulis dalam pembuatan latar belakang. Selanjutnya adalah penggunaan teknik dussel untuk membentuk objek-objek yang dimunculkan dalam lukisan, serta penggunaan teknik ini mampu memberikan efek pudar sehingga suatu imaji yang ingin dimunculkan penulis dapat tercapai. Dalam penciptaan ini penulis menampilkan 6 buah karya seni lukis dengan media estetik berupa titik, garis, bentuk, warna, serta tekstur sebagai visualisasi ekspresi dari konsep yang ingin dimunculkan penulis. Karakteristik karya dalam penciptaan ini menggunakan figur manusia yang bentuknya telah mengalami proses deformasi atau penyederhanaan, sehingga wujud dari bentuk manusia ini terkesan pudar atau tidak dapat terlihat dengan jelas. Karakteristik yang lainya terlihat dari goresan yang ekspresif dan dominan warna. Penciptaan ini diharapkan mampu memberikan pengalaman baru kepada pencipta maupun orang yang mengapresiasi karya seni lukis ini. Dengan diangkatnya tema Permainan tradisional jaranan ini dapat digunakan sebagai sarana mendidik dan mengajarkan tentang nilai-nilai pentingnya mencintai dan menjaga warisan budaya lokal.

Tinjauan geografis perkembangan dan peranan Desa Dinojo pinggiran barat Kota Malang / oleh Artianto

 

Pengembangan media pembelajaran seni budaya sub bidang seni tari materi pola lantai menggunakan "game adventure" di SMP Negeri 1 Malang / Ani Rahayuningsih

 

Fungsi Sungai Song bagi penduduk Desa Karanganom Kecamatan Kauman Kabupaten Tulungagung / oleh Djumiati

 

Tinjauan pelajaran menggambar di kelas V PGAN 6 tahun Putri Malang (Menggambar sebagai bekal mengajar dan menggambar sebagai bekal pribadi) / oleh M. Satar

 

Penerapan model pembelajaran two stay two stray (dua tinggal dua tamu) dalam rangka meningkatkan keaktifan belajar siswa pada mata pelajaran geografi siswa kelas X.9 SMA Negeri 1 Kepanjen tahun ajaran 2009/2010 / Nurul Huda

 

Kata Kunci: pembelajaran Two Stay Two Stray, keaktifan belajar siswa Berdasarkan observasi awal yang dilakukan pada tanggal 3 September 2009, yang dilakukan pada siswa kelas X.9 SMA Negeri 1 Kepanjen dapat diketahui bahwa proses belajar mengajar masih didominasi oleh guru meski sudah menggunakan media LCD untuk menampilkan slide-slide materi yang diajarkan. Guru yang bersangkutan masih menggunakan metode ceramah dan tanya jawab, ini merupakan salah satu faktor yang mengindikasikan sebagian besar siswa kurang aktif dalam mengikuti proses belajar mengajar. Mayoritas siswa hanya diam dan melihat tayangan slide materi pada layar, dan bila guru memberikan kesempatan untuk bertanya tentang materi yang belum jelas siswa juga kurang berani dan tetap diam. Pada observasi awal ini juga diperoleh data tentang nilai ulangan harian 1 pada kompetensi dasar 1. Sebanyak 11 orang siswa dari 31 jumlah total siswa atau sekitar 35%, harus mengikuti remidi untuk bisa mencapai nilai ketuntasan minimal 75. Rumusan masalah dalam penelitian ini mengkaji tentang penerapan pembelajaran model Two Stay Two Stray dapat meningkatkan keaktifan belajar siswa kelas X.9 SMA Negeri 1 Kepanjen dalam pelajaran geografi. Tujuan penelitian ini dilakukan untuk mengetahui penerapan pembelajaran model Two Stay Two Stray dalam meningkatkan keaktifan belajar siswa kelas X.9 SMA Negeri 1 Kepanjen pada mata pelajaran geografi. Penelitian ini termasuk penelitian tindakan kelas (classroom action research) yang terdiri dari dua siklus, dan tiap siklusnya dilaksanakan pada satu kali pertemuan. Teknik pengumpulan data keaktifan belajar siswa menggunakan lembar observasi. Hasil penelitian menunjukkan bahwa keaktifan belajar siswa meningkat dari siklus I ke siklus II. Pada siklus I keaktifan belajar siswa secara klasikal masih rendah hanya mencapai 45,16% atau 14 siswa yang aktif. Pada siklus II ada peningkatan yang signifikan pada keaktifan belajar siswa secara klasikal yaitu mencapai 90.32 atau 28 siswa yang aktif. Hasil keaktifan belajar siswa secara klasikal juga di uji menggunakan t-test dan hasilnya diperoleh, thitung > ttabel (24,265 > 2,571) dan pvalue Berdasarkan hasil penelitian tersebut, maka sarannya sebagai berikut: < signifikansi (0,000 < 0,05) yang berarti ada peningkatan secara signifikan dari penerapan model pembelajaran Two Stay Two Stray terhadap keaktifan belajar siswa secara klasikal dari siklus I ke siklus II. (1) bagi guru bidang studi Geografi di SMA Negeri 1 Kepanjen disarankan untuk menjadikan Two Stay Two Stray (TSTS) sebagai salah satu model pembelajaran alternatif, agar dapat meningkatkan keaktifan belajar siswa yang pada akhirnya akan berdampak pula pada meningkatnya prestasi belajar siswa, (2) dalam ii menerapkan model pembelajaran TSTS diperlukan manajemen waktu yang baik terutama pada tiap tahapan, agar penerapan model ini bisa berjalan lancar, (3) bagi penelitian selanjutnya, diharapkan penelitian ini dapat dikembangkan untuk materi selain menganalisis dinamika dan kecenderungan perubahan litosfer dan pedosfer serta dampaknya terhadap kehidupan di muka bumi. Selain itu diharapkan adanya variasi dan penggunaan media, agar siswa lebih tertarik dan termotivasi dalam kegiatan pembelajaran, (4) bagi penelitian selanjutnya, diharapkan untuk lebih memotivasi siswa dalam aspek writing activities, karena aspek ini merupakan aspek yang paling kecil perolehan prosentasenya pada penelitian ini.

Pelaksanaan transmigrasi di Daerah Tingkat II Kabupaten Madiun / oleh Titik Suyanti

 

Pembelajaran tari bendera pada anak tunarungu berat kelas VII di SLB Bhakti Luhur Malang / Florentina Savira Kartika Kencana

 

ABSTRAK Kencana, Florentina Savira Kartika. 2015. Pembelajaran Tari Bendera pada Anak Tunarungu Berat Kelas VII di SLB Bhakti Luhur Malang. Skripsi, Program Studi Pendidikan Seni Tari dan Musik, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Ida Siti Herawati M. Pd. Kata Kunci: Pembelajaran, Seni tari, Tunarungu, SLB Bhakti Luhur Malang Pembelajaran adalah suatu kegiatan yang dilakukan guru sedemikian rupa sehingga tingkah laku siswa berubah kearah yang lebih baik. Pembelajaran Seni Tari bagi Anak Berkebutuhan Khusus seharusnya berupaya untuk membantu siswa dalam meningkatkan potensi dirinya terhadap lingkungan secara maksimal. Guru seni tari memberikan materi yang diajarkan pada kelas VII di SLB Bhakti Lihur Malang yaitu “Tari Bendera”. Di dalam proses pembelajaran terdapat unsur perencanaan, pelaksanaan, dan evaluasi pembelajaran yang harus dilakukan. Serta adanya faktor pendukung dan penghambat dalam proses pembelajaran. Penelitian ini dilaksanakan dengan tujuan untuk (1) mengetahui pelaksanaan pembelajaran “Tari Bendera” pada pelajaran Seni Budaya bidang seni tari di SLB Bhakti Luhur Malang. (2) Mengidentifikasi faktor-faktor pendukung dan penghambat pelaksanaan pembelajaran seni tari di SLB Bhakti Luhur Malang. Penelitian ini menggunakan jenis penelitian deskriptif kualitatif. Teknik pengumpulan data dalam penelitian ini menggunakan metode observasi, wawancara, dan dokumentasi. Kegiatan analisis data dimulai dengan tahap pengumpulan data, tahap reduksi data, tahap penyajian data, serta tahap penarikan simpulan dan verifikasi. Pengecekan keabsahan temuan menggunakan triangulasi sumber dan triangulasi metode. Hasil penelitian menunjukkan bahwa: (1) Pembelajaran seni meliputi perencanaan, pelaksanaan, dan evaluasi. Perangkat mengajar yang dibuat oleh guru seni tari adalah rencana pembelajaran berupa materi tari yang akan di berikan satu semester. Pelaksanaan Proses Belajar Mengajar (PBM), dalam pembelajaran ini guru menggunakan metode demonstrasi, metode drill, dan metode kerja cipta terarah. Penilaian hasil pembelajaran, mencakup 2 aspek yaitu aspek afektif dan psikomotorik. Penilaian berdasarkan dari proses pembelajaran dan hasil pembelajaran yang telah dilakukan.(2) Faktor pendukung dalam pelaksanaan pembelajaran seni tari di SLB Bhakti Luhur Malang ini adalah: perhatian kepala sekolah pada pembelajaran seni tari, guru seni tari yang berlatar belakang dari Pendidikan Seni Tari, dan antusias siswa dalam mengikuti pelajaran. Adapun faktor penghambat adalah keterbatasan kemampuan guru seni tari dalam memahami ABK. Dari hasil penelitian ini dapat disarankan untuk Instansi Pendidikan yang terkait, agar mengupayakan guru pengajar seni tari diharapkan lebih mengerti tentang kekhususan tunarungu, sehingga pembelajaran seni tari bisa tercapai dengan maksimal.

Tinjauan hukum adat di Kecamatan Maron Kabupaten Probololinggo
oleh Henoch Soekarman

 

Pengajaran mutholaah di P.G.A.N. 6 tahun Malang / oleh Zahroh

 

Implemenating picture series to improve tenth grade studentss ability in writing narrative texts at MABI Program of MAN 3 Malang / Fifin Naili Rizkiyah

 

Kata kunci: gambar berseri, kemampuan menulis. Kemampuan menulis siswa kelas X program MABI (Madrasah Aliyah Bertaraf Internasional) MAN 3 Malang tidak memuaskan. Mayoritas siswa memiliki masalah dalam penggunaan bahasa, pemilihan kata, dan organisasi. Siswa sering mengeluhkan betapa sulitnya menulis dalam bahasa asing dan menuangkan ide-ide dari pikiran ke dalam bentuk tulisan. Alhasil, kurang dari 50% siswa mendapatkan nilai di bawah 3 antara rentangan nilai 1-4. Gambar berseri diusulkan sebagai strategi alternatif untuk mengatasi masalah siswa dalam menulis. Gambar berseri adalah serial gambar yang menunjukkan beberapa kejadian atau aksi dalam bentuk serupa yang saling berkaitan. Penelitian ini dimaksudkan untuk menemukan apakah penerapan gambar berseri ini dapat meningkatkan kemampuan menulis teks narasi siswa kelas X MABI MAN 3 Malang. Dalam penelitian ini peneliti berharap bahwasanya 100% siswa mendapatkan nilai 3 dari rentangan nilai 1-4 dalam penggunaan bahasa, pemilihan kata, dan organisasi. Desain penelitian ini adalah penelitian tindakan kelas kolaboratif yang terdiri dari dua siklus, dengan siklus pertama terdiri dari dua pertemuan dan siklus ke dua terdiri dari 4 pertemuan. Satu siklus terdiri dari empat tahapan yang dinamai: perencanaan aksi, pelaksanaan rencana, pengamatan aksi dan refleksi pengamatan. Subjek dalam penelitian ini adalah 21 siswa kelas X MABI MAN 3 Malang, tahun ajaran 2009/2010. Adapun instrumen-instrumen yang digunakan yaitu tabel observasi, catatan pengamat, kuesioner, rubrik penilaian dan hasil tulisan siswa. Data dari observasi, rubrik penilaian dan kuesioner dianalisa dan hasilnya disajikan dalam bentuk tabel dan deskripsi, sedangkan data dari catatan pengamat serta hasil tulisan siswa dianalisa dan dilaporkan dalam bentuk deskripsi. Hasil penelitian ini menunjukkan bahwa gambar berseri dapat meningkatkan kemampuan menulis teks narasi siswa secara efektif. Seluruh siswa telah mencapai nilai minimal 3. Lebih lagi, mayoritas siswa memberi respon positif terhadap penerapan gambar berseri ini, terbukti 70% dari seluruh siswa menunjukkan ketertarikan terhadap gambar berseri ini. Mereka menyatakan bahwa gambar berseri menarik, mudah dipahami, lebih dari itu, gambar berseri sangat membantu mereka menyusun paragraph serta mengembangkan ide-ide dalam menulis teks narasi. Kesimpulannya, gambar berseri dapat diterapkan untuk meningkatkan kemampuan menulis teks narasi siswa kelas X MABI MAN 3 Malang. Gambar berseri sangat membantu dalam mengembangkan ide-ide dan kreatifitas siswa. Para siswa menikmati kegiatan menulis dengan menggunakan gambar berseri karena menarik, menyenangkan dan tidak membosankan. Disarankan supaya guru menggunakan gambar berseri dalam mengajar menulis karena ini terbukti dapat mengatasi masalah siswa dalam menulis. Serta disarankan supaya peneliti- peneliti lain mengadakan penelitian terkait dengan penerapan gambar berseri dalam skill dan genre yang berbeda. iiiv i

Al-mufid fil adabi arabi yang berguna dalam sastera Arab
oleh Moh. Misom Achmadi Ze

 

Persepsi siswa kelas XI IPA SMA Negeri 1 Malang terhadap seni tari dalam pembelajaran seni budaya materi Tari Pejuang / Pancarannie Bekti Pertiwi Putri

 

ABSTRAK Putri, Pancarannie Bekti Pertiwi. 2015. Persepsi Siswa Kelas XI IPA SMA Negeri 1 Malang Terhadap Seni Tari dalam Pembelajaran Seni Budaya Materi Tari Pejuang. Skripsi. Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Tjitjik Sri Wardhani, M.Pd, (II) Tutut Pristiati, S.Sn. Kata kunci: persepsi, seni tari, pembelajaran Seni Budaya. Kompetensi sikap, pengetahuan, dan ketrampilan seni tari pada kurikulum 2013 dalam pembelajaran Seni Budaya materi tari Pejuang yang harus dicapai oleh siswa kelas XI IPA SMA Negeri 1 Malang belum tampak dikarenakan sikap dan perhatian yang kurang, perbedaan latar belakang siswa yang mempunyai bakat menari atau tidak, keikutsertaan siswa dalam kegiatan di luar jam pelajaran seni tari, usaha guru, dan dorongan orang tua. Hal tersebut tidak terlepas dari proses menilai suatu obyek atau peristiwa yang dialami siswa saat pembelajaran seni tari, maka muncul persepsi atau tanggapan yang diserap oleh panca indera siswa. Untuk itu perlu mengkaji bagaimana persepsi siswa dan faktor yang mempengaruhi persepsi siswa kelas XI IPA SMA Negeri 1 Malang terhadap seni tari dalam pembelajaran Seni Budaya materi tari Pejuang. Tujuan penelitian adalah untuk mendeskripsikan persepsi siswa kelas XI IPA SMA Negeri 1 Malang terhadap seni tari dalam pembelajaran Seni Budaya materi tari Pejuang dan faktor yang mempengaruhi persepsi siswa kelas XI IPA SMA Negeri 1 Malang terhadap seni tari dalam pembelajaran Seni Budaya materi tari Pejuang. Metode penelitian menggunakan deskriptif kuantitatif. Populasi terdiri dari siswa kelas XI IPA di SMA Negeri 1 Malang berjumlah 255 siswa dan sampel sebanyak 156 siswa. Teknik pengambilan sampel menggunakan simple random sampling. Instrumen penelitian dengan teknik angket. Data dianalisis dengan teknik perhitungan prosentase. Hasil penelitian menunjukkan bahwa (1) persepsi siswa kelas XI IPA SMA Negeri 1 Malang yaitu menarik atau tidaknya, penting atau tidaknya, manfaat mempelajari tari Pejuang, pemahaman materi tari Pejuang, dan penguasaan ketrampilan atau praktek tari. (2) Faktor yang mempengaruhi persepsi siswa kelas XI IPA SMA Negeri 1 Malang yaitu keingintahuan, usaha siswa untuk bisa, kedisiplinan, usaha guru, sarana dan prasarana, serta dorongan dari orang tua. Saran penelitian kepada guru Seni Budaya bidang seni tari maka perlu memperbaiki strategi pembelajaran supaya kualitas pembelajaran seni tari dan hasil belajar siswa menjadi lebih baik. Kepada peneliti lain perlu melakukan tindak lanjut dari penelitian ini dengan memperluas variabel.

Pengembangan e-modul mata pelajaran sains kelas V materi daur air dan peristiwa alam di MI Al-Azhaar Kecamatan Bandung Tulungagung / Nurin Rahmawati

 

Kata Kunci: Pengembangan, E-modul, Sains. Kecanggihan komputer saat ini memberikan alternatif media pembelajaran yang dapat memperlancar proses belajar mengajar di sekolah. Pemanfaatan komputer ini dalam bentuk komputer interaktif dimana e-modul yang ada saat ini masih dalam bentuk modul cetak. Berdasarkan observasi di MI Al Azhaar Bandung Tulungagung saat ini proses pembelajaran di kelas khususnya mata pelajaran Sains masih belum menggunakan media komputer, walaupun telah tersedia ruang komputer yang memadai dan siswa yang telah menguasai penggunaan komputer. Selain itu, proses belajar masih belum bervariasi hanya guru menjelaskan, mengerjakan latihan, dan tanya jawab sehingga siswa yang berbeda-beda terabaikan. Untuk itu diperlukan media pembelajaran yang memanfaatkan komputer yang telah tersedia dan memperhatikan karakteristik siswa yang berbeda-beda yaitu dengan pengembangan e-modul yang di desain berbentuk komputer interaktif. Tujuan pengembangan e-modul mata pelajaran Sains kelas V untuk memberikan alternatif pembelajaran dengan proses belajar mandiri sehingga siswa dapat mengalami kemajuan belajar sesuai dengan kemampuannya serta dapat mengukur kemampuan belajar yang telah diperoleh. Agar proses pembelajaran lebih menarik, variatif dan dapat lebih memotivasi siswa dalam belajar mata pelajaran Sains sehingga tujuan pembelajaran dapat tercapai. Subjek uji coba dari pengembangan e-modul adalah siswa kelas VA MI Al Azhaar Kecamatan Bandung Tulungagung. Jenis data yang digunakan jenis data kualitatif dan kuantitatif. Data kualitatif digunakan untuk mengetahui tingkat kevalidan e-modul dengan acuan pendapat ahli media, ahli materi, dan audiens/siswa menggunakan angket. Sedangkan data kuantitatif digunakan untuk mengetahui tingkat kelayakan e-modul digunakan dalam pembelajaran dengan menggunakan tes setelah belajar menggunakan e-modul. Data-data tersebut diolah untuk dianalisis, diinterpretasi, dan disimpulkan tingkat kevalidan dan efektivitasnya. Hasil penelitian pengembangan ini berupa CD e-modul mata pelajaran Sains kelas V materi “daur air dan peristiwa alam”. Berdasarkan hasil uji coba dapat dikemukakan sebagai berikut: uji coba ahli media di dapat persentase 83,75% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi valid, uji coba ahli materi didapat persentase 83,33% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi valid, uji coba siswa perseorangan didapat persentase 90% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi valid, uji coba siswa kelompok kecil didapat persentase 85% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi valid, serta uji coba siswa lapangan (klasikal) di dapat persentase 81,98% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi valid. Sedangkan hasil belajar dibandingkan dengan SKM pada mata pelajaran Sains. Uji coba peorangan, menunjukkan bahwa semua siswa berhasil memenuhi SKM, uji coba kelompok kecil, menunjukkan bahwa 1 siswa belum berhasil memenuhi SKM dan 9 siswa telah memnuhi SKM, serta uji coba lapangan/klasikal, menunjukkan bahwa 1 siswa belum berhasil memenuhi SKM dan 23 siswa telah berhasil memenuhi SKM. Kesimpulan pengembangan e-modul mata pelajaran Sains kelas V materi daur air dan peristiwa alam valid dan efektif untuk dimanfaatkan sebagai media alternatif untuk pembelajaran di sekolah dasar khususnya kelas V. Saran dari pengembang sebagai berikut: (1) bagi Guru, hendaknya memanfaatkan e-modul mata pelajaran Sains kelas V ini sebagai media pembelajaran namun guru juga harus memperhatikan persiapan peralatan sebelum proses pembeajaran di mulai, membaca petunjuk pemanfaatan dengan cermat, dan juga selalu membimbing siswa agar proses pembelajaran tetap lancar dan kondusif. (2) sekolah, dapat dijadikan sumber belajar dan memiliki perangkat komputer yang memadai, (3) siswa, dengan menggunakan e-modul dapat belajar secara mandiri dengan jadwal yang dipelajari agar lebih menguasai materi, (4) pengembang selanjutnya diharapkan menambahkan tayangan video dan audio untuk lebih melengkapi e-modul.

Perancangan buku cerita bergambar interaktif tentang kebersihan untuk anak usia dini / Arizal Nur Hartanto

 

ABSTRAK Nur Hartanto, Arizal. 2015. Perancangan Buku Cerita Bergambar Interaktif Tentang Kebersihan Untuk Anak Usia Dini, Skripsi Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain Fakultas Sastra. Universitas Negeri Malang. Pembimbing (I) Drs. Sumarwahyudi, M Sn (II) Mohamad Sigit, S.Sn. Kata Kunci: Buku cergam, komunikasi, budaya sehat Pada usia dini, anak cenderung suka bermain tanpa pedulikan tentang kebersihan lingkungan sekitar. Padahal pada usia ini, anak sangat rentan terkena berbagai macam penyakit. Maka dari itu pengenalan budaya bersih sejak dini sangat penting diajarkan pada anak sejak dini. Terlebih anak usia dini merupakan usia yang sangat penting bagi perkembangan anak sehingga disebut golden age. Dimana anak akan mudah menyerap berbagai materi yang diberikan. Tujuan mengenalkan budaya bersih pada anak sejak dini agar anak menjadi terbiasa menjaga kebersihan diri sendiri maupun lingkungan sekitar dalam kehidupan sehari-hari. Perancangan ini menggunakan model perancangan prosedural. Langkah langkah pada model perancangan ini adalah merumuskan masalah, menentukan tujuan, indentivikasi data, analisa data, sintesis, menentukan konsep perancangan, perancangan produk, desain final. Data berasal dari berbagai sumber. Teknik visualisasi menggunakan Adobe Illustrator Cs3. Hasil visualisasi berupa cerita interaktif dengan karakter yang menggunakan ilustrasi kartun 2 dimensi. Hasil perancangan adalah buku cerita bergambar interaktif 20 halaman tentang pengenalan budaya bersih kepada anak usia dini (4-6 tahun). Buku cerita bergambar interaktif memiliki dimensi 14,8 cm x 14,8 cm dengan model board book. Cover buku menggunakan penjilitan langung yang menyatu dengan halaman isi buku. Dari Perancangan ini masih perlu adanya pengembangan tindak lanjut karena tanpa melalui proses uji coba dan validasi produk dan masih banyak kekurangan yang perlu disempurnakan lagi.

Hubungan pemanfaatan suber belajar, gaya belajar dan minat belajar dengan prestasi belajar mata diklat sepeda motor siswa kelas X program keahlian mekanik otomotif SMK Muhammadiyah I Kepanjen / Andika Anggi Saputra

 

Kata Kunci: Sumber Belajar, Gaya Belajar, Minat Belajar, Prestasi Belajar Prestasi belajar sampai saat ini menjadi indikator untuk menilai tingkat keberhasilan siswa dalam proses belajar. Pemanfaatan sumber belajar yang optimal mempengaruhi prestasi belajar. Prestasi belajar yang baik dapat mencerminkan gaya belajar yang baik karena dengan mengetahui dan memahami gaya belajar yang terbaik bagi dirinya akan membantu siswa dalam belajar sehingga prestasi yang dihasilkan akan maksimal. Di samping gaya belajar dan pemanfaatan sumber belajar minat belajar juga mempunyai peranan penting terhadap prestasi belajar siswa. Penelitian ini bertujuan untuk mengetahui hubungan pemanfaatan sumber belajar, gaya belajar dan minat belajar dengan prestasi belajar mata diklat sepeda motor siswa kelas X program keahlian mekanik otomotif SMK Muhammadiyah I Kepanjen baik secara parsial maupun secara simultan. Penelitian ini merupakan penelitian deskriptif korelasional. Populasi penelitian ini adalah siswa kelas X SMK Muhammadiyah I Kepanjen dengan jumlah total 240 siswa, sedangkan sampel yang digunakan sebanyak 48 siswa. Data diperoleh dengan menyebarkan angket dan dokumentasi berupa nilai raport responden. Hasil penelitian ini menunjukkan bahwa: 1) Pemanfaatan sumber belajar mata diklat sepeda motor siswa kelas X program keahlian mekanik otomotif SMK Muhammadiyah I Kepanjen tinggi. 2) Gaya belajar mata diklat sepeda motor siswa kelas X program keahlian mekanik otomotif SMK Muhammadiyah I Kepanjen sedang. 3) Minat belajar mata diklat sepeda motor siswa kelas X program keahlian mekanik otomotif SMK Muhammadiyah I Kepanjen sangat tinggi. 4) Prestasi belajar mata diklat sepeda motor siswa kelas X program keahlian mekanik otomotif SMK Muhammadiyah I Kepanjen tinggi. 5)Ada hubungan yang signifikan antara pemanfaatan sumber belajar dengan prestasi belajar siswa di SMK Muhammadiyah I Kepanjen karena nilai signifikan 0,598, 6) ada hubungan yang signifikan antara gaya belajar dengan prestasi belajar siswa di SMK Muhammadiyah I Kepanjen karena nilai signifikan 0,644. 7) Ada hubungan yang signifikan minat belajar dengan prestasi belajar siswa di SMK Muhammadiyah I Kepanjen karena nilai signifikan 0,641. Dan 8) Ada hubungan yang signifikan antara pemanfaatan sumber belajar, gaya belajar dan minat belajar dengan prestasi belajar mata diklat sepeda motor siswa kelas x program keahlian mekanik otomotif SMK Muhammadiyah 1 Kepanjen.

Tinjauan membaca teknis di kelas II SMP Negeri III Tulungagung
oleh Rusmadi

 

Redesain website Kecamatan Singosari sebagai media sistem informasi / Mohammad Ony Faizal

 

ABSTRAK Faizal, Ony Mohammad. 2015.Redesain WebsiteKecamatan Singosari Sebagai Sistem Informasi.Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Rudi Irawanto,S.Pd, M.Sn (II) Gunawan Susilo, S.Sn, M.Sn Kata kunci : Website, Sistem, Informasi, Kecamatan Singosari RedesainwebsiteKecamatan Singosari sebagai media informasi ini merupakan sebuah perancangan sebagai sarana informasi untuk memfasilitasi informasi yang dibutuhkan agar pembangunan dapat merata di Kecamatan Singosari, sesuai dengan Permendagri No 114 Tahun 2014 tentang pembangunan daerah. Model perancangan yang digunakan adalah model perancangan prosedural, yaitu perancangan yang bersifat deskriptif dimana menggariskan langkah-langkah yang harus diikuti dalam menghasilkan sebuah produk. langkah untuk merancang media pendukung visual alternatif lainnya menggunakan teknik pengumpulan data observasi, wawancara, dokumentasi. Perancangan ini menghasilkan media dalam bentuk website informasi yang menampilkan berbagai macam potensi yang dimiliki Kecamatan Singosari.Hasil perancangan ini diharapkan dapat menjadi tolak ukur dalam melakukan perancangan berikutnya, baik bagi mahasiswa, desainer pemula, pengajar dan lain sebagainya.

Pemberantasan salvinia auriculata aublet dengan beberapa jenis herbisida
oleh Sarwono Adi Seputro

 

Perancangan iklan layanan masyarakat tentang dampak mengonsumsi kopi bagi kesehatan / Agung Dwi Cahyono

 

ABSTRAK Cahyono, Agung, Dwi. 2015. PerancanganIklanLayananMasyarakatTentangDampakMengonsumsi Kopi BagiKesehatan. Skripsi, Program StudiDesainKomunikasi Visual, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Drs. Pujiyanto, M.Sn, (II) MitraIstiarWardhana, S. Kom, M.T. Kata Kunci:Perancangan, IklanLayananMasyarakat, Animasi, Kopi. Kopi merupakansalahsatuminuman yang banyakdigemari.Kopi dikonsumsiolehberbagaikalanganusia, peminum kopi terbanyakhinggasaatinimasihditempatiolehusia 25-39.Saatini kopi jugamenjadisalahsatugayahidup, pembedakelassosialmaupunidentitasindividuataukelompok.Mengonsumsi kopi secaraberlebihandapatmenimbulkanefekburuksertamerugikankesehatantubuh,namun kopi mempunyaidampakbaikbagikesehatanjikadikonsumsisecarabaikdantidakberlebihan.Banyaknyapenggemar kopi yang ada di masyarakattidakdiimbangidenganpemahamantentangdampakapasaja yang dapatditimbulkandariminuman kopi bagikesehatan. Tujuandariperancanganiniadalahmembuatsebuahiklanlayananmasyarakat yang menarikdanbermanfaatbagimasyarakatumum.Diharapkanperancanganiklanlayananmasyarakatinidapatmenambahwawasan agarmasyarakatsadartentangapasajadampakyang dapatditimbulkandarimengonsumsi kopi bagikesehatan. Model perancanganinimerupakan model perancangandeskriptifdiawalidaripenulisanlatarbelakang, perumusanmasalah, danpengidentifikasiantujuanperancangan, dilanjutkandenganpengumpulan data yang terdiridariobservasi, dokumentasi, kepustakaan, danwawancara, kemudiandilanjutkandengananalisisdata, danakhirnyamenjadikonsepdariperancangan. Perancanganiklanlayananmasyarakatinimenghasilkan media utamaberupaanimasitigadimensidanMotion Graphics yang dikemasdalambentuk CD dan media alternatifyang digunakansebagai media pendukungyaituberupa media cetak.  

Pengaruh citra terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian (Studi pada konsumen persada swalayan Malang) / Hervy Kurnianingtiyas

 

Kata kunci: Citra Toko, Keterlibatan Konsumen, Keputusan Pembelian. Berkembangnya bisnis eceran atau ritel di Indonesia beberapa tahun terakhir ini cukup tinggi. Banyaknya perusahaan yang terjun pada bisnis eceran, tidak lepas dari banyaknya tuntutan konsumen untuk memenuhi kebutuhannya sehingga persaingan yang terjadi semakin ketat yang pada akhirnya perusahaan yang memiliki citra yang baik yang akan mampu mempengaruhi keputusan pembelian konsumen. Citra toko biasanya diukur dengan menanyakan kepada konsumen seberapa baik dan seberapa penting berbagai macam dari operasional suatu toko eceran bagi mereka. Dimensi citra toko yang bisa dipelajari diantaranya barang dagangan, layanan yang diberikan, fasilitas fisik, promosi, kenyamaan dan suasana toko. Persada Swalayan sebagai salah satu Swalayan yang terkenal di kota Malang yang mempunyai strategi yang tepat untuk mempertahankan keberadaannya, salah satunya dengan cara menerapkan strategi citra toko yang positif. Karena citra toko sangat menentukan kelangsungan dan keberhasilan sebuah toko tersebut. Sebuah toko yang berorientasi pada keinginan, permintaan dan kebutuhan konsumen, memiliki potensi besar untuk berhasil. Tujuan penelitian ini adalah untuk menjelaskan bagaimana keadaan citra toko dan keterlibatan konsumen dalam pengambilan keputusan pembelian serta bagaimana pengaruh variabel citra toko terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian. Populasi dalam penelitian ini adalah konsumen yang melakukan kegiatan pembelian di Persada Swalayan. Dalam penelitian ini menggunakan 100 sampel yang penentuan jumlah minimalnya ditentukan berdasarkan rumus Slovin. Sampel tersebut diambil dengan menggunakan teknik simple random sampling. Penelitian ini terdiri atas dua variabel, yaitu variabel bebas (X) dan variabel terikat (Y). Variabel bebas dalam penelitian ini adalah citra toko yang mempunyai sub variabel 1) pelayanan, 2) harga, 3) suasana, 4) promosi toko, sedangkan variabel terikatnya adalah keterlibatan konsumen dalam pengambilan keputusan pembelian. Analisis data menggunakan regresi linier berganda (multiple regression) dengan program SPSS for Windows seri 16.0. Hasil dari penelitian adalah sebagai berikut: (1) Pelayanan mempunyai pengaruh positif terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian dengan nilai B = 0,181, nilai t_(hitung )= 2,223 dan nilai signifikan = 0,029. (2) Harga mempunyai pengaruh positif terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian dengan nilai B = 0,143, nilai t_hitung= 1,998 dan nilai signifikan = 0,049. (3) Suasana mempunyai pengaruh positif terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian dengan nilai B = 0,483, nilai t_hitung= 6,428 dan nilai signifikan = 0,000. (4) Promosi toko mempunyai pengaruh positif terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian dengan nilai B = 0,189, nilai t_hitung= 2,242 dan nilai signifikan = 0,027. (5) Secara simultan variabel citra toko yang terdiri pelayanan, harga, suasana, dan promosi toko memiliki pengaruh positif terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian dengan nilai F_hitung sebesar 62,905 dengan tingkat signifikan 0,000 hal ini berarti terdapat pengaruh yang signifikan. Peneliti memberikan saran Variabel citra toko (pelayanan, harga, suasana, promosi toko) hendaknya selalu dievaluasi dan lebih ditingkatkan agar tetap mampu mempertahankan konsumen serta dapat menarik konsumen baru. Perlu adanya pengembangan SDM untuk para karyawan, agar SDM yang ada lebih potensial dalam menghadapi persaingan dan tantangan jaman yang selalu berubah.

Pelaksanaan metode out door studi pengajaran geografi yang di terapkan di SD Pembangunan Sukorejo/lodoyo / oleh M. Purnama

 

Mengajarkan pengertian usaha dana tenaga di SMA / oleh Ani Atmaningsih

 

Makna ganda dan cara mengajarkannya di kelas III SMP Negeri V Malang
oleh Misiati Hardiyanti

 

Perancangan film animasi 3 dimensi kisah perjalanan Mahapatih Gajah Mada di Madakaripura / Muhammad Nuruddin J.

 

ABSTRAK Janky, Muhammad Nuruddin 2015. “Perancangan Film Animasi 3 Dimensi Tentang Perjalanan Mahapatih Gajah Mada di Madakaripura”. Skripsi, Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra. Universitas Negeri Malang. Pembimbing (I) Drs. Sarjono, M.Sn. (II) H.J. Hendrawan, S.Sn, MDs. Kata kunci : Perancangan, Film Animasi, Gajah Mada di Madakaripura Gajah Mada dalam catatan sejarah adalah seorang panglima perang dan tokoh yang berpengaruh pada masa kerajaan majapahit. Karena jasa Gajah Mada lah kerajaan majapahit bisa menguasai hampir seluruh wilayah nusantara seperti Sumatera, pulau Bintan, Singapura, Semenanjung Malaya, Bali, Lombok, Kalimantan, serta di wilayah timur seperti Logajah, Gurun, Sukun, Taliwung, Sapi, Gunungapi, Seram dan lainnya. Cerita perjalanan Gajah mada di air terjun Madakaripura merupakan kisah yang terabaikan. Gajah mada di Madakaripura begitu penting karena sebelum menjabat sebagai patih, sang Gajah mada berguru dan bertapa di air terjun Madakaripura. Adapun tujuan perancangan film animasi 3 dimensi yaitu menginformasikan sejarah, mengajarkan moral kepada manusia serta budaya Jawa yang kental. Perancangan film animasi ini menggunakan gabungan model perancangan Sadjiman Ebdi Sanyoto dengan Model perancangan film animasi Issac Kerlow. Model perancangan milik Sadjiman ini berisi tentang konsep perancangan komunikasi visual. Model perancangan ini dilakukan secara berurutan dan sistematis dengan tahapan latar belakang, pengumpulan data, analisis, sintesis, konsep desain, proses desain dan desain akhir. Kemudian pada tahap proses desain ini menggunakan model perancangan Issac Kerlow dengan alur pre-production, production dan post-production . Desain dan karakter dalam film animasi ini memiliki visual yang semi realis dengan pewarnaan kartun sehingga lebih sederhana dan menarik. Alur dalam cerita ini menggunakan alur maju – mundur atau flashback dengan tujuan memperkuat cerita didalamnya. Media pendukung untuk mengenalkan film animasi ini adalah berupa poster, X banner dan merchandise

Perancangan video promosi kuliner Kota Malang berbasis web series melalui media online / Ilham Riza Zamzamy

 

ABSTRAK Zamzamy, IlhamRiza. 2015. PerancanganVideo PromosiKuliner Kota Malang Berbasis Web Series MelaluiMedia Online.Skripsi.JurusanSeniDesain, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Moch. Abdul Rohman, M.Sn, (II) JokoSamodraS.Kom, M.T. Kata Kunci: Perancangan, web series, kuliner Kota Malang, media online Web seriesadalahbentuktontonan internet, danmerupakanserangkaian video denganskenario, umumnyaberbentukbeberapa episode, dirilis di internet ataujugateleponseluler. Media online yang menerapkanacaraberbasis web series belumbanyak di Indonesia. Saatini media sosiallebihbanyakmenyajikaninformasidanselukbelukkulinerterbatasdalambentukfoto-fotodanartikel. Hal inimembuat media web series tentangkuliner di kota Malang sangatlayakuntukdikembangkan. Media visual yang bergeraklebihmenarikdibandingkangambarduadimensi yang tidakbergerak.Web series jugalebihinformatifjikadibandingkandenganberitafotobiasa.Tampilan yang demikianmembantupengguna internet untuklebihatentifterhadapkontenberita.Mengembangkan web series denganbekerjasamadengan media online sangatberpotensiuntukmemperkenalkan, mempromosikan, danmeningkatkanbaikkualitas web series itusendirimaupunkulinerkota Malang sebagaikontendari web series ini. Dengandemikiantujuandariskripsiperancanganiniadalahmenghasilkan web series yang berorientasimempromosikandanmeningkatkandayasaingwisatakuliner yang ada di Malang. Proses desainmenggunakanmetodekomprehensifdenganpendekatanproduksi film atau video berdasarkanhasilobservasi data profiltempat-tempatkulinerdansampelaudiens. Konsep visual yang diterapkanpadadesain final adalahkonsep yang miripdengan web series Jalan-JalanMen di malesbanget.com yang menampilkan video-video web series yang menyajikanprofiltempat-tempatkuliner di Malang, contoh-contohpemrosesankuliner, dantestimoniaudiens. Perancanganinimenghasilkan media promosiberupa web series yang berjumlahtigaseridengandurasimaksimalduapuluhmenit, beserta media pendukungnyayaitu: poster, x-bnner, kaos, e-poster, daniklan online. Strategikomunikasidari web series mengaplikasikan e-marketing via sosial media.Web series dapatdiuploadsecarareguler.

Mengajarkan kalor jenis zat di SMA kelas II IPA dengan pendekatan inquiry / oleh Kadim Masjkoer

 

Perancangan video tutorial pertahanan seni beladiri Merpati Putih bagi kehidupan masyarakat / Rendra Bagus Pratama

 

ABSTRAK Rendra, Bagus, Pratama. 2015. Perancangan Video Tutorial Pertahanan Seni Beladiri Merpati Putih. Skripsi, Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra. Universitas Negeri Malang. Pembimbing: (I) Drs. Sumarwahyudi, M.Sn. (II) H. Hendrawan, M.Sn. Kata Kunci: Perancangan, VideoTutorial Pertahanan Seni Beladiri Merpati Putih. Tindak kejahatan dalam kehidupan masyarakat sering kerap terjadi salah satu contohnya perampokan, pencurian, pelecehan seksual, dan lain-lain. Dengan permasalahan tersebut maka dibutuhkan sebuah solusi yang dapat membantu permasalahan masayarakat tersebut. Perancangan video tutorial pertahanan seni beladiri Merpati Putih adalah video tutorial yang memberikan intruksi latihan pertahanan seni beladiri yang dapat dipelajari oleh masyarakat atau pengguna sebagai latihan dasar dalam pertahanan seni beladiri. Dalam video tutorial ini diberikan teknik-teknik dasar dalam pertanhanan dalam menghadapi serangan lawan, agar masyarakat dapat mempertahankan diri saat mendapat tindak kejahatan dari musuh. Dalam perancangan tersebut, dibutuhkannya metode perancangan. Perancangan ini menggunakan metode kulaitatif oleh Prof. Dr. Sugiyono Ardjaka (2013:309) yaitu meliputi macam teknik pengumpulan data, observasi, wawancara, dokumentasi, dan tringgulasi gabungan. Teknik perancangan video tutorial ini yaitu melalui beberapa proses tahap perancangan yaitu, Pra produksi, produksi, dan pasca produksi. Dalam tahap ini perancang mulai membuat konsep, naskah, produksi pengambilan gambar (shooting), pengambilan suara (dubbing) sampai akhir produksi akhir yaitu editing video dan suara. Hasil akhir yaitu video tutorial yang dikemas secara ringkas berdurasi 10 menit. Isi dari video tutorial ini yaitu teknik-teknik dasar dalam pertahanan seni beladiri yang ditampilkan secara singkat dan jelas agar para pengguna atau masyarakat dapat menggunakannya dan dapat mempelajari dengan mudah. Video tutorial ini dirancang guna mmemenuhi kebutuhan masyarakat. Video tersebut dibuat dengan isi video yang memiliki nilai-nilai yang positif, untuk pengguna dibawah umur diharapkan didampingi oleh orang dewasa atau orang tua.

Peningkatan kemampuan menyimak dan berbicara siswa kelas X.8 SMAN 1 Pagak dengan teknik puri hening (puzzle story and happy listening) berbasis cooperative learning / Yesicha Magdhalena

 

Kata Kunci: menyimak, berbicara, Puzzle Story Keterampilan menyimak dan berbicara merupakan keterampilan dasar yang dimiliki oleh setiap individu. Melalui teknik Puri Hening (Puzzle Story and Happy Listening) diharapkan keterampilan menyimak berbciara siswa dapat ditingkatkan. Penelitian ini bertujuan untuk mengetahui peningkatan kemampuan menyimak berbicara siswa dalam kegiatan bercerita dan mengidentifikasi unsur instrinsik dan ekstrinsik cerita yang diperdengarkan. Peningkatan kemampuan siswa dengan teknik Puri Hening (Puzzle Story and Happy Listening) dikembangkan untuk beberapa aspek, yang pertama adalah aspek identifikasi unsur instrinsik, kedua identifikasi unsur ekstrinsik ketiga aspek kebahasaan dan keempat aspek non kebahasaan. Penelitian ini menggunakan metode deskriptif kualitatif karena merupakan gambaran hasil penelitian. Subjek penelitian ini yaitu siswa kelas X.6 SMAN 1 Pagak yang berjumlah 33 orang. Sumber data pada penelitian ini adalah hasil observasi berdasarkan paparan pengamatan dan hasil wawancara peneliti dengan guru pamong dan hasil belajar siswa dalam menyimak berbicara dengan teknik Puri Hening (Puzzle Story and Happy Listening), serta hail observasi respon guru pamong dan siswa dalam pembelajaran menyimak berbicara dengan teknik Puri Hening. Penelitian ini dilaksanakan dalam dua siklus, masing-masing siklus dilakukan dalam dua kali pertemuan. Kegiatan yang dilakukan dalam masing-masing siklus antara lain (1) tahap pratindakan, (2) perencanaan tindakan, (3) pelaksanaan tindakan, (4) evaluasi tindakan dan (5) refleksi. Dalam masing-masing siklus penerapan pembelajaran menyimak berbicara dengan teknik Puri Hening mengalami peningkatan pada hasil pembelajaran menyimak berbicara. Hasil pembelajaran menyimak dengan menggunakan teknik Puri Hening menglamai peningkatan. Pada pretest kemampuan menyimak (mengidentikasi unsur instrinsik) rata kemampuan 59% setelah mengalami perbaikan menjadi 61% di siklus 1 dan 84% di siklus ke 2. kemampuan menyimak (mengidentifikasi unsur esktrinsik) rata-rata 36% setelah mengalami perbaikan menjadi 39% si siklus 1 dan 75 % di siklus ke 2. hasil kemampuan berbicara (aspek kebahasaan) rata-rata kemampuan 53% setelah mengalami perbaikan menjadi 71 % di siklus 1 dan rata-rata kemampuan 87% di siklus ke 2. Sedangkan hasil kemampuan berbicara (aspek nonkebahasaan) rata-rata kemampuannya 52% setelah mengalami perbaikan menjadi 72% di siklus 1 dan 93% di siklus ke 2. Maka dapat disimpulkan bahwa pembelajaran menyimak berbicara dengan teknik Puri Hening berhasil diterapkan dan dapat meningkatkan kemampuan siswa dalam menyimak berbicara dengan persentase hasil akhir pembelajaran lebih dari 60%. Respon siswa dalam pembelajaran menyimak berbicara dengan teknik Puri Hening cukup baik. Hal tersebut terbukti dengan persentase jawaban yang di atas rata-rata 50% menjawab bahwa teknik Puri Hening dapat meningkatkan kemampuan menyimak berbicara.

Pengajaran translasi di Sekolah Menengah Pertama dengan PPSI / oleh Endah Susilowati

 

Pembahasan Buku Gambela karya : HA. Yasin ditinjau dari segi gaya bahasa dan pendidikan / oleh Kiptiyah

 

Perancangan komik digital tentang gambaran neraka menurut Islam berbasis android / Abdur Rohman

 

ABSTRAK Rohman, Abdur. 2015. Perancangan Komik Digital Tentang Gambaran Neraka Menurut Islam Berbasis Android. Skripsi, Jurusan Desain Komunikasi Visual, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (1) Drs. Didiek Rahmanadji, (II) Andy Pramono, S.Kom, M.T. Kata Kunci : Komik Digital, Islam, Neraka, Android Sebagian besar umat manusia bila ditanya tentang gambaran neraka mereka akan takut serta merunduk dan menghadap Sang Pencipta untuk memohon ampunan. Sering kali dijumpai pada kehidupan nyata sebuah pengakuan diri yang menyatakan bahwa dirinya sangat takut dengan neraka namun pada kenyataannya justru berani melakukan amalan-amalan yang dapat menjerumuskan manusia ke dalam neraka. Mengimani akan keberadaan Allah SWT namun sikap dan tindakan justru bertentangan dengan perintah-Nya. Ketika pola pikir manusia telah terbujuk olah tipu daya dan rayu syaitan dengan melakukan syirik, meninggalkan shalat, durhaka kepada orang tua, zina, makan harta haram, minum minuman keras, memutus silaturahhim, bersumpah palsu, kikir dan Ghibah atau bergunjing. Secara global terdapat tiga golongan manusia di hari akhir, setiap golongan tersebut mempunyai deajat dan perbedaan yang saling mengunnguli. Golongan orang yang beriman, golongan orang kafir dan musyrik dan golongan orang-orang munafik (umat Muhammad SAW) yang suka berbuat maksiat dan melakukan dosa besar. Orang-orang beriman dan patuh terhadap perintah Allah akan diberikan surga sebaliknya manusia yang semasa hidupnya selalu berbuat maksiat dan belum sempat bertaubat semasa hidupnya maka akan mendapatkan sikasa yang amat pedih di neraka. Untuk menumbuhkan kembali sikap takut kepada Allah dan Neraka-Nya, maka dibuat komik digital Islami yang menceritakan tentang gambaran neraka menurut Al-Quran dan Hadist. Secara umum komik merupakan media hiburan, akan tetapi komik Islami memiliki muatan edukasi, seperti pada dekade 1950-1980an komik-komik Islami lazim di konsumsi oleh generasi muda. Tema komik Islami pada masa itu seputar kepahlawanan, syiar agama, petualangan, yang kerap menyisipkan pesan moral. Media Komik dapat digunakan sebagai media alternatif untuk menumbuhkan kembali sikap takut kepada Allah dan Neraka-Nya, Ini seperti kisah Wali Songo menggunakan dakwahnya melalui wayang dengan memasukkan nilai-nilai Islam didalamnya sebagai pendekatan dalam bentuk budaya.

Sebuah tinjauan terminal cinta terakhir" buku ke tiga novel trilogi Ashadi Siregar
oleh Endang Dwi Rahayu"

 

Studi tentang pengaruh berbagai jenis rangsang terhadap gerak cacing tanah
oleh Sri Wilyantari

 

Tinjauan demokrasi desa / oleh Sunardi

 

Penerapan prinsip team building untuk meningkatkan aktivitas belajar peserta didik dalam mata pelajaran seni budaya materi ragam hias pada kayu kelas VII A di SMP Negeri 9 Malang / Baiq Nining Khaerunnisa

 

ABSTRAK Khaerunnisa,BaiqNining. 2015. PenerapanPrinsipTeam BuildingUntukMeningkatkanAktivitasBelajarPesertaDidikDalamMatapelajaranSeniBudayaMateriRagamHiaspadaKayuKelas VII A Di SMP Negeri 9 Malang. Skripsi, JurusanSeni Dan Desain, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Dra. Hj. Purwatiningsih, M.Pd, (II) Fenny Rochbeind, S.PdM.Sn. Kata Kunci :PrinsipTeam Building, Aktivitas Belajar, SeniBudaya, RagamHiaspadaKayu. BerdasarkanhasilobservasipadapembelajaranSeniBudayabidangstudiSeniRupamateriRagamHiaspadaKayukelas VII A SMP Negeri 9 Malang, diketahuibahwaaktivitas belajarpesertadidikmasihrendah. Hal inidilihatdarikurangnyainteraksi, komunikasidankepeduliansaatdiadakannyakegiatankelompok, sehinggahasilbelajardenganberkelompokmasihkurangmemuaskan. Penelitianinibertujuanuntukmendiskripsikanpeningkatanaktivitas belajarpesertadidikkelas VII A SMP Negeri 9 Malang melaluipenerapanprinsipTeam Building. Penelitian yang digunakanadalah PTK (penelitiantindakankelas), denganjumlah 32 pesertadidik.Pelaksanaandilakukandalam 2 siklusyaituSiklus I danSiklus II.Prosedurpenelitianmeliputi 4 tahapyaitu (1 )perencanaan (2) tindakan(3) pengamatan(4) refleksi.Untukmengukuraktivitas belajar pesertadidikdenganmenggunakanbeberapainstrumen (1) lembarobservasiaktivitaspesertadidik, (2) lembarobservasiaktivitaskelompok, (3) lembarpedomanwawancara(4) lembarhasiltugaskelompok. HasilPenelitianmenunjukkanpadasiklus I (1) persentaseaktivitaspesertadidikmencapai 92% baik, (2) persentaseaktivitaskelompokmencapai 86,67% cukupbaik, (3) persentasepenilaianhasiltugaskelompoktelahmencapai SKM, 5 kelompokmencapai 62,5% sangatbaikdan 3 kelompokmencapai 37,5% baik, (4) hasilwawancaramenyatakan 6 dari 10 pesertadidikmenyatakanadanyaaktivitas belajar yang baik.Padasiklus II (1) persentaseaktivitaspesertadidikmencapai 97% baik, (2) persentaseaktivitaskelompokmencapai 95,56% baik, (3) persentasepenilaianhasiltugaskelompoktelahmencapai SKM, 7 kelompokmencapai 87,5% sangatbaikdan 1 kelompokmencapai 12,5% baik, (4) hasilwawancaramenyatakan 9 dari 10 pesertadidikmenyatakanadanyaaktivitas belajar yang baik. Saran dalampenelitianiniadalah, (1) bagi guru SeniBudayadapatmenjadikanprinsipTeam BuildinginisebagaisalahsatustrategipembelajarandalampembelajaranSeniBudaya, (2) bagipesertadidik, dapatlebihmeningkatkankerjasamadanprestasibelajarsecaramaksimal, (3) bagimahasiswapendidikanSeniRupa, dapatdigunakansebagaibahanmasukanuntukPenelitianTindakanKelastentangpemilihanstrategipembelajaran, (4) bagiUniversitasNegeri Malang, digunakansebagaibahanreferensitentangPenelitianTindakanKelaspadamatapelajaranSeniBudaya, (5) bagipenelitilain, diharapkanuntukmelakukanpenelitianlanjutanterhadappeningkatankualitasbelajardengantemuan lain yang sejenis.

Implementing problem-based learning to improve the speaking ability of the eleventh grade students of SMAN 1 Gondang Mojokerto / Sholahuddin Athoillah

 

Key words: speaking ability, group discussion, problem-based learning. The objective of the study was to describe the use of problem-based learning in improving the speaking ability of the eleventh grade students of SMAN I Gondang Mojokerto. The preliminary study showed that students got difficulties to speak in English. It was found that the major problems of students speaking were in their unconfidence to speak in English. Consequently, the classroom situation remained passive so that the teacher was forced to work harder to motivate the students to speak up. Moreover, the class was dominated by only some students. Finally, an activity like group discussion or other activities which needed to do by more than one student would be difficult to apply. The most crucial problem was the possibility of having underestimation of students’ capability in speaking English. Underestimation happens when a student actually deserved to get better score while in fact, he gets lower score. For this purpose, the researcher, then, formulated the research problem as how the students’ speaking ability could be improved through problem-based learning technique. This study employed collaborative classroom action research. The subjects of this research were students of XI IA-I class of SMAN I Gondang Mojokerto who were studying in the second semester. This study only focused on improving students’ speaking ability in group discussion. On the basis of preliminary study, it was found that group discussion activities could not run well since many students remained passive and there were only some students were active that sometimes dominated the discussion. Group discussion was actually aimed at giving chance for students to increase their ability with other students in one circumstance (their own group). In many cases, the discussion run with one or two students speaking while the other members tent to keep silent and became dependant to the others.This study was conducted in one cycle consisting of two meetings. The procedures of the action included planning, implementing, observing, and reflecting. To collect the data, the researcher used observation sheet for observing both teaching-learning process and students speaking ability, field notes and camera. The finding of the research showed that problem-based learning was effective to be employed in improving the students’ speaking ability. The result showed that the criteria of success had been achieved, that more than 70% of all the students who were present during the research were categorized good (got minimum score 3). At the second meeting, it was found that 17.5% (7 students) were categorized fair, 62.5% (25 students) were categorized good, , 20% (20 students) were categorized very good, and 2,5% (1 student) was categorized excellent. By the minimum score of 3, it can be concluded that the criteria ii ii achieved 85% from the criteria 70%. Moreover, in terms of students’ motivation, it was found that students at the second meeting showed improvement as seen by more students responding the teacher’s questions. Furthermore, the group discussion at the second meeting was also effective for students to share their ideas in problem-solving by using English. At last, there are three aspects that should be paid attention in order to implement the improved model problem-based learning to improve the students’ speaking ability in group discussion; the instructional activities, materials, and teacher’s role during the learning process. For the writer, it is expected that the writer will implement the technique in his teaching under the same problem of speaking ability by considering the students’ level of comprehension and students’ speaking ability. For the English teachers, it is recommended that they can consider the use of problem-based learning for speaking activities especially in group discussion. Moreover, they will be more active during the teaching and learning. For the school, it is expected that the technique will be considered to be implemented in speaking class by using problem-based learning for a better students’ achievement in the future. For future researchers, the writer suggests to conduct a research focusing among other things on students’ writing skill.

Sembonyo upacara adat tradisionil dan pengaruhnya terhadap masyarakat di Pantai Popoh Kabupaten Tulungagung
oleh Haryono Adipurnomo

 

Pembelajaran membaca pemahaman kelas IV Sekolah Dasar Negeri Kota Malang semester II tahun ajaran 2009/2010 / Auliatin Amin Fardia

 

Kata kunci: Pembelajaran membaca pemahaman, membaca pemahaman. Kualitas hasil belajar bahasa Indonesia siswa kelas IV, khususnya pada keterampilan membaca pemahaman masih tergolong sangat rendah. Hal ini diperkuat dengan hasil data tes PIRLS (Progress in International Reading Literacy Study) adalah studi internasional dalam bidang membaca pada anak-anak di seluruh dunia yang disponsori oleh The International Association for The Evaluation Achievement (IEA) yang dilakukan pada siswa kelas IV tahun 2006, yang diikuti oleh 45 negara, Indonesia berada pada urutan ke empat dari bawah. Salah satu yang menjadi sorotan tentang fenomena rendahnya kualitas membaca pemahaman ini yaitu guru. Oleh sebab itu, dalam pembelajaran guru memegang peranan penting dalam membimbing, mengembangkan serta meningkatkan keterampilan siswa dalam membaca. Secara umum penelitian ini bertujuan mengkaji tentang pelaksanaan pembelajaran membaca pemahaman kelas IV SDN Kota Malang. Secara khusus penelitian ini bertujuan mendeskripsikan perencanaan, pelaksanaan, dan evaluasi pembelajaran membaca pemahaman yang dibuat dan dilakukan oleh guru. Penelitian ini tergolong penelitian deskriptif kualitatif. Sumber data dalam penelitian ini adalah pelaksanaan pembelajaran membaca kelas IV SDN Kota Malang dengan subjek penelitian adalah guru bidang studi bahasa Indonesia dan siswa kelas IV Sekolah Dasar. Pengumpulan data dilakukan oleh peneliti dibantu dengan catatan lapangan yang diperoleh melalui kegiatan observasi, wawancara, studi dokumentasi dan angket yang kemudian dianalisis melalui reduksi data, penyajian data, dan verifikasi. Hasil penelitian menunjukkan bahwa perencanaan pembelajaran yang disusun oleh kedua guru di SDN P 2 dan di SDN W 1 kurang lengkap dan kurang tepat. Komponen perencanaan yang kurang lengkap mencakup indikator dan tujuan pembelajaran membaca pemahaman yang dirumuskan guru kurang menjabarkan kompetensi dasar yang dicapai, materi yang dipilih guru kurang lengkap. Kurang tepatnya komponen yang disusun oleh guru mencakup penyusunan alat evaluasi yang kurang memenuhi kriteria penilaian membaca yang baik. Pada tahap pelaksanaan, secara umum pembelajaran yang dilakukan oleh kedua telah mengarah pada pembelajaran membaca, akan tetapi secara khusus langkah pembelajaran membaca pemahaman yang dimulai pada tahap prabaca, saat baca, dan pascabaca masih belum dilakukan secara maksimal dan terpadu di kelas, hal ini dikarenakan guru kurang memiliki kekreatifan untuk menggunakan strategi membaca pemahaman dengan berbagai aktivitas yang bervariasi dalam setiap tahapnya dan kurang mampu menggunakan strategi atau metode yang mampu menumbuhkan siswa lebih aktif di kelas. Lemahnya guru dalam membelajarkan membaca pemahaman, disebabkan oleh beberapa faktor (1) faktor latar belakang pendidikan guru dan (2) sikap guru dalam membelajarkan ii membaca pemahaman. Pada tahap evaluasi pembelajaran membaca pemahaman yang dilakukan oleh kedua guru dipandang kurang berhasil secara maksimal, hal ini dikarenakan alat evaluasi yang digunakan oleh guru kurang memenuhi kriteria penilaian membaca yang baik. Berdasarkan hasil penelitian ini, guru dipandang masih lemah dalam menyusun perencanaan pembelajaran membaca pemahaman (RPP), sehingga disarankan kepada guru (1) mempelajari dengan teliti cara menyusun RPP membaca pemahaman yang lengkap dan tepat berdasarkan teori yang berlaku, (2) mengikuti workshop, lokakarya, diklat, atau seminar tentang pengembangan RPP, (3) memperdalam ilmu atau teori tentang membaca, khususnya membaca pemahaman. Pada tahap pelaksanaan, guru masih tampak lemah dalam hal menumbuhkan siswa aktif dalam kelas dan aktivitas yang dilakukan oleh guru pada tahap prabaca, saat baca, pascabaca terlihat kurang bervariasi dan kurang sesuai dengan teori, sehingga disarankan kepada guru (1) menggunakan metode atau strategi yang mampu menumbuhkan keaktifan siswa di kelas, misalnya metode inquiry atau kooperatif, (2) menggunakan strategi yang lebih bervariasi dalam kegiatan prabaca, saat baca, atau pasca baca, misalnya menggunakan strategi KWL atau DRTA, (3) melatih siswa membaca dalam hati dengan menggunakan teknik yang bervariasi, misalnya teknik skimming. Penelitian ini bisa dimanfaatkan sebagai referensi penelitian selanjutnya, misalnya penelitian pengembangan bahan ajar membaca dan penelitian tindakan kelas untuk menciptakan strategi-strategi membaca pemahaman yang baru. Dengan harapan, melalui penelitian-penelitian tersebut mampu meningkatkan kualitas membaca pemahaman siswa. Bagi peneliti selanjutnya yang ingin meneliti kasus-kasus sejenis mengenai pembelajaran membaca pemahaman diharapkan memiliki waktu yang relatif lama dalam melaksanakan penelitian, agar segala informasi tentang pembelajaran dapat diperoleh peneliti secara mendetail.

Analisis reyog Ponorogo: kajian bentuk visual topeng ornamen mahkota dan makna simbolik Klana Sewandana di Ponorogo / Baskara Yuda Prawira

 

ABSTRAK Prawira, Baskara Yuda. 2015. Analisis Reyog Ponorogo Kajian Bentuk Visual Topeng Ornamen Mahkota Dan Makna Simbolik Klana Sewandana Di Ponorogo. Skripsi, Jurusan Seni dan Desain, Program Studi Pendidikan Seni Rupa, Fakultas Sastra, Universitas Negeri Malang, Pembimbing : (I) Dr. Hariyanto, M.Hum (II) Drs. Eko Budi Winarno Kata Kunci : Topeng, mahkota, visual, ornamen, makna simbolik, Klana Sewandana Klana Sewandana adalah pemeran raja dalam pementasan tari Reyog Ponorogo. Peneliti memilih topeng Klana Sewandana ini karena ingin memperkenalkan budaya Reyog Ponorogo khususnya bentuk visual topeng dan ornamen mahkota, serta makna simbolik Klana Sewandana. Maka dari itu diperlukan sebuah penelitian guna membahas tentang keunikan dari topeng Klana Sewandana tersebut. Landasan teori (1) analisis, (2) visualisasai, (3) ornamen, (4) makna simbolik, (5) topeng, (6) reyog, (7) klana sewandana. Penelitian ini menggunakan jenis rancangan penelitian deskriptif kualitatif. Data penelitian ini diperoleh dari wawancara ke beberapa narasumber dan observasi. Untuk menguji kredibilitas data dengan triangulasi data jenis sumber. Tahapan-tahapan penelitian diantaranya adalah rancangan penelitian, observasi ke lapangan, analisis data, penulisan laporan. Penelitian ini membahas tentang (1) bentuk visual topeng dan ornamen mahkota Klana Sewandana pada tarian Reyog Ponorogo di Ponorogo, dan (2) makna simbolik dari visual topeng dan ornamen mahkota Klana Sewandana pada tarian Reyog Ponorogo di Ponorogo. Dari hasil penelitian tersebut, maka diperoleh beberapa kesimpulan sebagai berikut, Penjelasan visual wajah terdapat alis blarak sineret, mata kedelen, hidung bentulan, kumis jlamprang, mulut delima pecah. Dalam ornamen mahkota terdapat nyamat menyerupai bunga tunggal dengan tiga daun, karawistha bentuk setengah lingkaran, jamang dengan bentuk segitiga bertumpuk, garuda mungkur dengan bentuk kepala garuda, sumping dengan bentuk bunga dan daun yang memanjang. Makna simbolik dari topeng tersebut diantaranya alis blarak sineret kekuatan keras, mata kedelen berwatak perwira, tangkas, dan pemberani, hidung bentulan gagah berani, kumis jlamprang sosok berwibawa, mulut delima pecah kesatria. Dalam ornamen mahkota terdapat nyamat memiliki makna trinitas dalam agama Hindu, karawistha simbol pengendali pikirna positif dan penggambaran dari Sang Hyang Widhi, jamang simbol tempat persemayaman para dewa, garuda mungkur makhluk suci kendaraan Dewa Wisnu, sumping simbol berani mati. Kesimpulannya pada topeng Klana Sewandana ini terbagi menjadi dua bagian yaitu visual topeng dan ornamen mahkota, serta makna simbolik dari kedua bagian tersebut. Penelitian ini diharapkan bagi peneliti, pembaca, pendidikan, dan sektor pariwisata lebih mengenal karaktersitik visual topeng, ornamen mahkota dan makna simbolik dari tokoh Klana Sewandana, selain itu menambah wawasan dan melestarikan kesenian budaya daerah setempat.

Penerapan metode role playing untuk meningkatkan empati pada siswa kelas IV MI Yaspuri Malang / Nutfah A.M. Arif

 

Kata Kunci: Penerapan, Metode Role Playing, Empati. Dewasa ini fenomena kekerasan sudah menjadi suatu tradisi yang melekat dalam masyarakat Indonesia. Tak seharipun media massa melewatkan pemberitaan tentang kekerasan, kekejaman, atau kejahatan. Kekerasan memang meningkat, baik dalam jumlah, jenis, maupun kualitasnya. Lebih dari itu, pelaku maupun korban makin beragam, baik ditinjau dari jenis kelamin, latar belakang, maupun tingkatan usia. Hampir setiap persoalan di negeri ini diselesaikan dengan kekerasan dan kekerasan sudah menjadi budaya yang tertanam kuat dalam masyarakat dan sangat di sayangkan budaya kekerasan ini sampai merambah kedunia pendidikan dan yang menjadi aktor dari kekerasan tersebut adalah para siswa sendiri. Bahkan kekerasan tidak hanya terjadi di jenjang pendidikan tinggi akan tetapi sudah merambah sampai pendidikan yang paling rendah seperti sekolah dasar. Hal ini memberikan potret suram bagi dunia pendidikan. Siswa sekolah dasar (SD) adalah kelompok usia anak-anak yang sedang mengalami perubahan dan perkembangan diri dalam segala aspek. Salah satu perkembangan diri yang dialami mereka adalah pekembangan sosioemosional. Empati merupakan satu konstruk yang membantu perkembangan sosioemosinal anak. Dengan empati anak dapat memahami, merasakan, menghayati orang lain karena dalam proses empati ini berlangsung proses pengertian dan perasaan yang dinyatakan bentuk hubungang antar pribadi. Dengan kemampuan empati yang dimiliki oleh anak membantu mereka untuk mencegah perilaku yang mengarah pada kekerasan. Berdasarkan hal ini, sekolah dapat mencegah kekerasan yang terjadi disekolah dengan meningkatkan empati pada diri siswa. Salah satu metode yang paling efektif untuk meningkatkan empati siswa yaitu metode Role Playing. Role playing merupakan salah satu metode pembelajaran yang diarahkan pada upaya pemecahan masalah-masalah yang berkaitan dengan hubungan antarmanusia (interpersonal relationship), terutama yang menyangkut kehidupan peserta didik. Pengalaman belajar yang diperolehya dari metode ini meliputi, kemampuan kerja sama, komunikatif, dan menigterpretasikan suatu kejadian. Penerapan metode Role playing dimaksudkan untuk memperoleh gambaran bagaimanakah metode Role playing berpengaruh untuk meningkatkan empati siswa. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK). Dalam penelitian ini ditemukan gambaran dari metode Role Playing. Gambaran metode Role Playing yang ditemukan dalam penelitian ini adalah sebagai berikut: (1) proses belajar siswa mengalami peningkatan dari siklus I sampai sikus III hal ini di lihat dari tahapan metode yang di terapkan yaitu warm up, memilih partisipan, bermain peran, diskusi dan evaluasi serta berbagi pengalaman dan kesimpulan, (2) respon siswa terhadap metode Role playing menunjukkan respon yang sangat positif dengan nilai rata-rata 86,7 %, (3) sikap empati siswa menunjukkan katergori tinggi dengan nilai rata-rata 68,16 %. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa Penerapan metode Role playing dapat meningkatkan proses belajar dan empati siswa dan ditunjukkan dengan respon sangat positif siswa terhadap metode pembelajaran.

Tinjauan hikayat panji semirang oleh S Sastrowinoto sebagai bacaan remaja / oleh Amir Sujanti

 

Kecenderungan objek, warna dan tema pada gambar anak di TK Dharma Wanita Pamotan Kec. Dampit Kab. Malang / Maulina Ismayanti

 

ABSTRAK Ismayanti, Maulina. 2015. Kecenderungan Objek, Warna, Dan Tema Pada Gambar Anak Di TK Dharma Wanita Pamotan Kec. Dampit Kab. Malang. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Ida Siti Herawati, M.Pd, (II) Drs. Didiek Rahmanadji, M.Pd. Kata Kunci: gambar anak, objek, warna, tema Perkembangan anak usia dini memiliki aspek kreativitas. Pada masa ini merupakan periode masa emas, yang dimana anak harus didorong untuk mengembangkan prakarsa, daya kreatif dan hal-hal produktif dalam bidang yang disenangi. Pendidikan anak usia dini khususnya pendidikan formal diselenggarakan pada lembaga pendidikan Taman Kanak-Kanak. Tujuan penelitian ini untuk mendeskripsikan objek, warna dan tema yang digambar oleh anak laki-laki dan anak perempuan. Diharapkan melalui penelitian ini dapat menambah wacana dan referensi tentang kecenderungan objek, warna, dan tema pada gambar anak. Penelitian ini menggunakan pendekatan kuantitatif deskriptif. Teknik pengambilan sampel secara sampling jenuh. Subjek penelitian merupakan kelas B sebanyak 44 siswa. Teknik pengumpulan data dalam penelitian ini menggunakan metode observasi dan metode dokumentasi. Analisis hasil penelitian menggunakan statistika deskriptif. Lembaga yang berperan disini merupakan lembaga Taman Kanak-Kanak Dharma Wanita Pamotan. Hasil penelitian ini menunjukkan (1) kecenderungan objek utama yang digambar anak laki-laki yaitu kategori lingkungan sekitar (objek rumah dan papan seluncur) dan lingkungan alam (objek gunung, laut, pelangi, awan, dan pantai) (34%), sedangkan objek utama yang digambar anak perempuan yaitu kategori lingkungan alam dengan objek laut, hewan, pohon, bunga, buah, dan gunung (58%). (2) Kecenderungan objek pendukung yang digambar anak laki-laki yaitu kategori lingkungan alam dengan objek matahari, awan, pohon, hewan, pelangi, tanah/landasan, laut, bunga, gunung, rumput, buah, dan pantai (80%), sedangkan objek pendukung yang digambar anak perempuan yaitu kategori lingkungan sekitar dengan objek pot bunga, jalan/tanah, tembok pagar, manusia, balon, kursi dan meja, bola (70%). (3) Kecenderungan warna objek utama yang digambar anak laki-laki yaitu warna biru (44%), sedangkan warna yang digambar anak perempuan yaitu warna coklat (41%). (4) Kecenderungan warna objek pendukung yang digambar siswa laki-laki yaitu warna biru, coklat, dan kuning (52%), sedangkan warna yang digambar anak perempuan menggunakan warna hijau (76%). (5) Kecenderungan tema yang digambar anak laki-laki yaitu tema lingkungan sekitar (41%), sedangkan tema yang digambar anak perempuan yaitu tema pemandangan alam (47%). Saran bagi guru di TK Dharma Wanita Pamotan hendaknya lebih memahami dan mendalami objek, warna, dan tema gambar anak laki-laki dan perempuan sehingga lebih memahami sejauh mana potensi anak pada tingkatan umur. Bagi orangtua hendaknya memberi bimbingan, arahan dan fasilitas kepada anaknya dalam berkarya seni. Diharapkan adanya penelitian yang sejenis di jenjang yang lebih tinggi seperti di SD, SMP, SMA, dan SLB.

Peran humas dalam membangun persepsi mahasiswa untuk memperoleh informasi dan mendapatkan layanan akademik (studi pada mahasiswa S1 Universitas Negeri Malang) / Evita Maya Susanti

 

Kata kunci: strategi hubungan masyarakat (public relations), persepsi mahasiswa. Dalam bidang pendidikan khususnya pendidikan di Perguruan Tinggi juga mengalami persaingan yang ketat. Berbagai Universitas di Malang khususnya berlomba-lomba memberikan pendidikan yang baik kepada mahasiswanya dengan fasilitas yang memadai, SDM yang handal, sistem manajemen yang baik dan citra perusahaan yang baik. Dari citra perusahaan yang baik maka dapat menimbulkan persepsi positif di kalangan mahasiswa S1 khususnya. Oleh karena itu, Universitas Negeri Malang sebagai salah satu Perguruan Tinggi Negeri di Malang berusaha memberikan pendidikan yang baik kepada para mahasiswanya agar dalam langkah ke depan dapat mencapai kesuksesan. Di mana hal ini akan terwujud apabila didukung dengan adanya strategi hubungan masyarakat (public relations) dalam mempublikasikan/memberikan informasi dan layanan akademik yang ada di Universitas Negeri Malang dengan berbagai kemudahan. Untuk itu Universitas Negeri Malang perlu menerapkan dan meningkatkan strategi hubungan masyarakat (public relations). Strategi-strategi yang diterapkan Universitas Negeri Malang di antaranya publication, event, news, community involvement dan identity media yang diharapkan dapat menimbulkan persepsi positif di kalangan mahasiswa S1 yang ada di Universitas Negeri Malang. Penelitian ini bertujuan untuk mengetahui peran hubungan masyarakat (public relations) dalam membangun persepsi mahasiswa S1 dalam memperoleh informasi dan mendapatkan layanan akademik di Universitas Negeri Malang. Penelitian ini mempunyai dua variabel yaitu variabel bebas (X) dan variabel terikat (Y). Variabel bebas dalam penelitian ini adalah strategi hubungan masyarakat (public relations) (X) dengan sub variabelnya publication (X1), event (X2), news (X3), community involvement (X4) dan identity media (X5). Sedangkan variabel terikat dalam penelitian ini adalah persepsi mahasiswa (Y). Populasi dalam penelitian ini adalah mahasiswa S1 Universitas Negeri Malang yang jumlahnya sebesar 19.151. Sampel dalam penelitian ini adalah sebesar 99 orang mahasiswa. Teknik pengambilan sampel adalah proportionate stratified random sampling, di mana teknik ini digunakan bila populasi mempunyai anggota/unsur yang tidak homogen dan berstrata secara proporsional. Jenis penelitian ini adalah deskriptif dengan menggunakan pendekatan kuantitatif. Metode pengumpulan data adalah dengan penyebaran angket/kuesioner, dokumentasi dan wawancara. Skala yang digunakan adalah skala Likert dengan lima pilihan jawaban. Analisis data yang digunakan adalah analisis regresi berganda (multiple regression) dengan uji hipotesis yang menggunakan uji t dan uji F, serta uji asumsi klasik. Hasil penelitian membuktikan bahwa: (1) nilai β1 = 0,194; nilai t = 2,336 dengan taraf signifikansi nilai t = 0,022 ≤ t = 0,05, (2) nilai β2 = 0,297; nilai t = 3,079 dengan taraf signifikansi nilai t = 0,003 ≤ t = 0,05, (3) nilai β3 = 0,188; nilai t = 2,180 dengan taraf signifikansi nilai t = 0,032 ≤ t = 0,05, (4) nilai β4 = 0,194; nilai t = 2,683 dengan taraf signifikansi nilai t = 0,009 ≤ t = 0,05, (5) nilai β5 = 0,199; nilai t = 2,466 dengan taraf signifikansi nilai t = 0,015 ≤ t = 0,05, (6) nilai F = 22,725; nilai signifikansi F = 0,000 dan Rsquare = 0,550 hal ini berarti bahwa ada pengaruh yang positif dan signifikan secara simultan antara publication, event, news, community involvement dan identity media dalam membangun persepsi mahasiswa S1 untuk memperoleh informasi dan mendapatkan layanan akademik di Universitas Negeri Malang, (7) Event merupakan variabel yang dominan mempengaruhi persepsi mahasiswa S1 untuk memperoleh informasi dan mendapatkan layanan akademik di Universitas Negeri Malang, hal ini dapat dilihat dari nilai β2 > β1, β3, β4, β5 yaitu sebesar 3,079. Berdasarkan hasil penelitian ini dapat disarankan: (1) Sebaiknya pihak humas Universitas Negeri Malang memberikan media tambahan dalam mempublikasikan tentang informasi dan layanan akademik yang ada di Universitas Negeri Malang salah satunya melalui media billboards yang dipasang di tempat-tempat ramai yang dapat dijangkau dan dilihat semua orang; (2) Event yang diadakan humas Universitas Negeri Malang lebih ditingkatkan lagi misalnya: mensponsori acara-acara kesenian, kebudayaan dan amal; (3) Dalam hal tanggapan keluhan mahasiswa, sudah cukup baik akan tetapi masih ada beberapa karyawan yang kurang ramah dalam memberikan informasi dan layanan akademik sehingga pihak humas Universitas Negeri Malang agar lebih memperhatikan hal tersebut karena ada beberapa mahasiswa yang mengeluh bahwa layanan yang diberikan karyawan di TU FIP, FS, FMIPA, FE, FT, FIK, FIS dan RR sebagian masih kurang ramah; (4) Public Relations Officer Universitas Negeri Malang agar lebih meningkatkan kegiatan-kegiatan sosial lainnya seperti: pemeriksaan kesehatan gratis kepada masyarakat yang tidak mampu, rehabilitasi remaja nakal, pemeliharaan kaum lanjut usia, pemeliharaan anak-anak jalanan, pemeliharaan lingkungan hidup dan khitanan massal; dan (5) Untuk identity media khususnya dalam masalah bangunan, pihak Universitas Negeri Malang lebih memperhatikan terhadap bangunan-bangunan yang tidak layak supaya dapat dikelola dan diperbaiki menjadi tempat atau sarana yang dibutuhkan di universitas serta ada beberapa bangunan yang dalam proses pembangunan masih kurang baik. Sehingga proses renovasi perlu dilakukan agar dapat memberikan rasa kenyamanan pada mahasiswa maupun pihak universitas yang menikmati fasilitas bangunan tersebut.

Perancangan desain kemasan produk kopi luwak Semeru Tirtoyudo Malang untuk membangun brand image / Sitha Alma Nindhita

 

ABSTRAK Nindhita, Sitha Alma. 2015.Membangun image melalui perancangan desain kemasan kopi luwak Semeru Tirtoyudo Malang. Skripsi Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra. Universitas Negeri Malang. Pembimbing: (I) Dr. Moeljadi Pranata, M.Pd (II) Mohammad Sigit, S.Sn Kata Kunci: Brand image, perancangan, desain kemasan, kopi luwak, Malang Untuk menghadapi persaingan yang ketat, produsen kopi tidak bisa hanya dengan mengandalkan kualitas produk saja tetapi produsen juga membutuhkan strategi-strategi lain agar pemasaran dan citra produk terhadap masyarakat tinggi. Salah satunya adalah dengan mengandalkan desain kemasan. Desain kemasan tidak hanya sekedar sebagai pembungkus produk namun juga memiliki fungsi lain sebagai media promosi. Tujuan perancangan ini adalah mengembangkan desain kopi luwak Semertu Tirtoyudo Malang guna meningkatkan image positif dalam masyarakat. Perancangan ini menggunakan model perancangan prosedural. Langkah-langkah pada model perancangan ini adalah merumuskan masalah, menentukan tujuan, menganalisis target pengguna, merumuskan perencanaan media, pengumpulan data, dan eksekusi desain. Data berasal dari berbagai sumber. Teknik visualisasi menggunakan Adobe Photoshop CS6. Hasil perancangan adalah desain kemasan produk kopi luwak Semeru yang berfungsi sebagai media pembangun image yang ditujukan khususnya untuk para penggemar kopi dan masyarakat umum. Meliputi desain kemasan primer yaitu kemasan stick sachet, kemasan sekunder meliputi kemasan travelling, kemasan 100 gram dan kemasan 250 gram, sedangkan kemasan tersier meliputi kemasan oleh-oleh, kemasan gift dan kemasan box kirim. Perubahan kemasan, logo dan label dari produk kopi luwak Semeru ini tentunya tidak bisa menjadi tolak ukur utama atas kesuksesan dari kopi luwak Semeru. Perubahan tersebut tetap harus diiringi dengan usaha lainnya dalam mencapai tujuan utama yaitu menciptakan image dalam masyarakat.

Pelaksanaan kedaulatan rakyat di Indonesia / oleh M. V. Sutinah

 

Pengaruh faktor geografi terhadap pertanian daerah Ketjamatan Ponggok / oleh Katipan

 

Pengembangan layanan dasar BK bertema manajemen stres berbasis web / Weni Kurnia Rahmawati

 

Kata Kunci: Layanan Dasar, Bimbingan dan Konseling, Manajemen Stres, Web. Bimbingan dan Konseling sebagai suatu proses pemberian bantuan kepada individu (siswa), dilaksanakan melalui berbagai macam layanan, salah satu layanan dasar. Salah satu cara untuk membuat proses pemberian layanan bimbingan menarik dan tidak membosankan adalah dengan media pembelajaran komputer berbasis web. Di SMAN 10 Malang pemberian layanan dalam bimbingan dan konseling lebih banyak terfokus secara tatap muka dan belum memiliki media berbasis web. Layanan dasar memiliki topik yang bermacam-macam, salah satunya layanan dasar manajemen stres. Manajemen stres merupakan suatu kemampuan yang dimiliki individu untuk mengurangi stres dan mencari cara untuk bisa mengelola stres. Tujuan dari penelitian ini adalah untuk menghasilkan sebuah produk layanan dasar BK bertema manajemen stres berbasis web yang bisa digunakan oleh siswa maupun konselor di sekolah. Metode penelitian pengembangan ini menggunakan Borg and Gall. Model Borg and Gall meliputi tahapan: 1) melakukan penilaian kebutuhan (need assesment), 2) analisis data dan penetapan prioritas kebutuhan, 3) merumuskan tujuan umum dan tujuan khusus, 4) menyusun isi materi bertema manajemen stres, 5) penilaian produk oleh ahli media dan materi, 6) revisi produk dari hasil uji ahli, 7) hasil revisi produk, 8) diskusi calon pengguna produk yang terdiri atas 10 orang siswa kelas X-1 SMAN 10 Malang), 9) revisi produk calon pengguna, 10) produk akhir. Instrumen yang digunakan dalam penelitian ini angket untuk penilaian kebutuhan, penilaian kelayakan item soal pengukuran stres, uji ahli media dan materi serta uji kelompok kecil. Produk berupa aplikasi website yang diakses melalui online dengan alamat www.manajemenstressweni.fienixcode.com. Produk perangkat lunak ini dirancang dengan menggunakan software joomla. Produk ini berisi tentang menu utama yang terdiri dari pendahuluan tentang latar belakang sebelum memasuki materi inti, petunjuk pemanfaatan, latar belakang penulis, daftar rujukan, buku tamu yang berisi saran atau kritikan, forum diskusi untuk bertukar pendapat antar teman dan konselor. Selain itu juga terdapat menu anggota yang berisi detail profil user yang mengakses, pengukuran stres, materi dan kuis manajemen stres. Menu laporan yang berisi tentang perkembangan pengukuran stres dan laporan perkembangan kuis manajemen stres. Sebelum intrumen pengukuran stres digunakan dalam web terlebih dahulu diuji kevalidan yang dilaksanakan oleh 25 siswa kelas X-1 dengan hasil valid dengan skor rata-rata valid 0.57292. Uji ahli media yaitu satu dosen TEP dan asisten dosen TEP, dengan hasil validasi dari ahli media I mendapatkan skor rata-rata 3,5 dengan interpretasi sangat sesuai. Sedangkan dari validasi ahli media II mendapatkan skor rata-rata 3,4 dengan interpretasi sangat sesuai. Jadi total skor rata-rata keseluruhan dari ahli media I dan II adalah 3,45 yang berarti sangat sesuai. Ahli materi yaitu salah satu dosen BK dan konselor SMAN 10 Malang, dengan hasil validasi dari ahli materi I mendapatkan skor rata-rata 3,2 dengan interpretasi sangat berguna. Sedangkan dari validasi ahli materi II mendapatkan skor rata-rata 3,7 dengan interpretasi sangat berguna. Jadi total skor rata-rata secara keseluruhan dari ahli media I dan II adalah 3,45 yang berarti sangat berguna. Jadi berdasarkan hasil penilaian ahli media dan ahli materi, dapat disimpulkan bahwa web yang disusun berklasifikasi sangat berguna dan dapat digunakan oleh siswa. Sedangkan hasil penilaian calon pengguna (uji kelompok kecil) menghasilkan jumlah skor 3,5 yang berarti sangat berguna/akurat. Berdasarkan hasil penilaian ahli media, ahli materi, dan uji kelompok kecil dapat disimpulkan bahwa produk yang dihasilkan dalam pengembangan ini yaitu web telah memenuhi kevalidan dan layak digunakan oleh siswa. Saran dari kepada pihak sekolah khususnya konselor hendaknya memanfaatkan software online untuk mengetahui keefektifan produk yang dihasilkan sehingga pemberian layanan bimbingan lebih maksimal.

Pendekatan inquiry dalam mengajarkan hukum termodinamika di SMA kelas I IPA / oleh Tri Wulansari

 

Tanaman palawija dalam penghidupan rakyat Desa Sragi Kecamatan Singojuruh / oleh Akhmad Syaifi

 

Tinjauan geografis hubungan potensi hinterland terhadap pendidikan di Daerah Lawang / oleh M Djalil S A H

 

Perancangan smaco's journey prospectus book sebagai optimasi school branding / Alexander Randika Pratama

 

ABSTRAK Pratama, Alexander Randika. 2015. Perancangan Smaco’s Journey Prospectus Book sebagai Optimasi School Branding. Skripsi Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra. Universitas Negeri Malang. Pembimbing: (I) Moch. Abdul Rohman, S.Sn, M.Sn (II) Andreas Syah Pahlevi, S.Sn, M.Sn Kata Kunci: Perancangan, Buku Prospektus, Optimasi, School Branding SMAK Cor Jesu merupakan salah satu sekolah swasta tertua yang ada di kota Malang. Diawali dengan Sekolah Pendidikan Guru Santo Agustinus yang dibentuk pada tanggal 21 Juli 1903. Lalu pada 15 Juli 1951,SPG Santo Agustinus tidak dibuka lagi dan digantikan dengan SMAK Cor Jesu. Sejak saat itupun SMAK Cor Jesu resmi berdiri sebagai sebuah institusi pendidikan menengah ke atas di Kota Malang. Namun seiring waktu, tak dapat dipungkiri lagi, bahwa persaingan di dunia sekolah saat ini semakin ketat terutama dalam penjaringan siswa saat akan masuk sekolah. Suatu perancangan media komunikasi visual untuk SMAK Cor Jesu, diperlukan untuk dapat mengenalkan tidak hanya berfungsi sebagai media rekam jejak sekolah tetapi juga dapat menjadi media promosi sekolah. Dalam hal ini, bisa diwujudkan dengan pembuatan media berupa buku prospektus. Perancangan ini menggunakan model perancangan prosedural. Langkah-langkah pada model perancangan ini adalah merumuskan masalah, menentukan tujuan, menganalisis target pengguna, merumuskan perencanaan media, pengumpulan data, dan eksekusi desain. Data berasal dari berbagai sumber. Teknik visualisasi digital menggunakan Adobe Photoshop CS3. Hasil perancangan adalah buku prospektus full color 84 halaman tentang profil SMAK Cor Jesu berikut potensi-potensi yang dimilikinya yang ditujukan untuk audiens yakni masyarakat umum usia 15-50 tahun. Buku prospektu memiliki dimensi persegi. Desain layout dalam prospektus ini menggunakan desain layout minimalis dan cenderung simetris. Hal ini merupakan USP (Unique Selling Preposition) dari perancangan produk yang dibuat. Dari perancangan ini masih perlu adanya pengembangan tindak lanjut karena tanpa melalui proses uji coba dan validasi produk dan masih banyak kekurangan yang perlu disempurnakan lagi.

Pengaruh ilmu ukur tiga dimensi di SMA kelas I IPA dengan metode kartu kerja / oleh Priyono

 

Algoritma Ant Colony Optimization (ACO) dalam optimalisasi rute pada vehicle routing problem with time window / Dian Fitrotin Septiashri

 

ABSTRAK Septiashri, Dian Fitrotin. 2015. Algoritma Ant Colony Optimization pada Vehicle Routing Problem with Time Window (VRPTW). Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (I): Prof. Drs. Purwanto, Ph.D. Pembimbing (II): Darmawan Satyananda, S.T, M.T Kata Kunci : Graph, Vehicle Routing Problem (VRP), Algoritma Ant Colony Optimization, Vehicle Routing Problem with Time Window (VRPTW), Pheromone, Borland Delphi 7.0. Dalam teori graph permasalahan optimasi rute kendaraan dikenal dengan Vehicle Routing Problem (VRP). VRP merupakan permasalahan optimasi mengenai sejumlah customer (pelanggan) pada lokasi tertentu dan harus dilayani oleh suatu depot (perusahaan) dengan sejumlah kendaraan dengan kapasitas yang terbatas. Vehicle Routing Problem with Time Window (VRPTW) merupakan masalah kombinatorial yang kompleks dalam masalah optimalisasi. Permasalahan VRPTW adalah bagaimana suatu depot distribusi barang, dengan sejumlah kendaraan berkapasitas tertentu melayani sejumlah customer pada lokasi yang terpisah, dengan permintaan dan batasan time window tertentu. Tujuan VRPTW adalah meminimalkan total biaya perjalanan, tanpa mengabaikan batasan kapasitas kendaraan dan time window depot. Algoritma Ant Colony Optimization terinspirasi dari perilaku semut, yaitu perjalanan semut dalam mencari makan. Semut mempunyai zat khusus yang disebut pheromone yang digunakan untuk memberikan jejak pada jalan dilewati, sehingga memungkinkan semut lain untuk mengikuti jalan tersebut. Terdapat tiga langkah pada algoritma Ant Colony Optimization yaitu langkah inisialisasi awal jarak pheromone, update pheromone lokal dan update pheromone global. Dari ketiga langkah tersebut terdapat iterasi yaitu perbaikan pheromone agar menghasilkan solusi terbaik dari rute yang terbentuk oleh semut. Penulisan skripsi ini bertujuan untuk menyelesaikan permasalahan VRPTW dengan menggunakan Algoritma Ant Colony Optimization. Selanjutnya, agar mudah dalam menyelesaikan permasalahan VRPTW dengan menggunakan Algoritma Ant Colony Optimization, maka direpresentasikan dalam program komputer menggunakan Borland Delphi 7.0.

Peranan Bimas terhadap pendidikan para petani dalam rangka meningkatkan produksi pangan di Desa Dukuhdimoro Kecamatan Mojoagung
oleh Lilik Sukartatik

 

Desain kemasan keripik singkong 'cahaya' sebagai upaya peningkatan minat pembeli / Diniarti Sinthafitra Julinda

 

ABSTRAK Julinda, Sinthafitra, Diniarti. 2015. Desain Kemasan Keripik Singkong ‘Cahaya’ Sebagai Upaya Peningkatan Minat Pembeli. Skripsi Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra. Universitas Negeri Malang. Pembimbing” (I) Drs. Sarjono, M.Sn (II) Andreas Syah Pahlevi, S.Sn, M.Sn. Kata Kunci: Desain Kemasan, Peningkatan Keripik singkong ‘Cahaya’ didirikan pada tahun 1997 oleh seorang ibu rumah tannga bernama ibu Erni. Berdirinya usaha keripik singkong ini membuka lahan pekerjaan baru bagi sebagian masyarakat di daerah Sambigede. Jumlah pekerja hanya terdiri dari 2 orang saja pada saat baru dibangun dan terus bertambah hingga saat ini. Penjualan keripik singkong ‘cahaya’ telah menyebar ke Surabaya, Sidoarjo, dan Gresik. Keripik singkong ‘cahaya memiliki dua varian rasa yaitu, original dan balado. pengemasannya juga terdiri dari 2 yaitu, ukuran seperempat kilogram dan setengah kilogram dengan kemasan yang terbuat dari plastik transparan. Kemasan ini terlihat sederhana dan perlu adanya desain kemasan yang lebih menarik agar semakin meningkatkan minat pembeli. Tujuan dari pendesainan kemasan keripik singkong ‘cahaya’ ini adalah agar terciptanya kemasan yang lebih menarik dan memiliki nilai jual tinggi. Dengan memiliki nilai jual yang lebih tinggi, maka diharapkan adanya peningkatan minat pembeli.

Hubungan timbal balik antara siput air dan tanaman air sebagai bahan praktikum / oleh Titiek Soemarlien

 

Penerapan metode level set dalam menyelesaikan masalah pencairan es dengan menggunakan metode numerik total variation diminishing Runge-Kutta dan Essentually Non-Oscillatory (ENO) / Zulaikha

 

ABSTRAK Zulaikha. 2014. Penerapan Metode Level Set Dalam Menyelesaikan Masalah Pencairan Es Dengan Menggunakan Metode Numerik Total Variation Diminishing Runge-Kutta Dan Essentially Non-Oscillatory. Skripsi, Jurusan Matematika FMIPA Universitas Negeri Malang, Pembimbing: Dr. Makbul Muksar, M. Si. Kata kunci: Masalah Pencairan Es, TVD Runge-Kutta, ENO, Crank Nicholson Masalah pencairan es merupakan salah satu bagian dari masalah batas berjalanyang lebih dikenal dengan masalah Stefan. Permasalahan ini dapat diselesaikan dengan menggunakan metode level set. Metode level set adalahsuatu skema eksplisit Finite Difference untuk menyelesaikan persamaan panas setiap jangka waktu. Keunggulan dari metode level set adalah dapat melakukan perhitungan numerik yang melibatkan kurva dan permukaan pada bidang Cartesian tetap tanpa harus memparameterisasi objek-objek tersebut. Metode numerik pada level setyang dapat digunakan untuk masalah pencairan esadalah Total Variation Diminishing Runge-Kuttauntuk waktu (t)dan Essentially Non-Oscillatory (ENO)untuk posisi (x). Dan metode numerik yang digunakan untuk perhitungan evolusi suhunya (T) adalah Crank-Nicholson. Dalam menyelesaikan masalah pencairan es, digunakan algoritma penulisan program numerik yang diperoleh dari skema numerik untuk persamaan pencairan es dan metode level set. Selanjutnya, diperolehhasil perbandingan simulasi program numerik untuk konstanta diskritisasi: panjang balok es (l), suhu yang diberikan pada es (TA), suhu awal es (TG), dan waktu maksimal(t_maks).

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 |