Pemaknaan siswa terhadap iklim pembelajaran tematik di kelas IV B Sekolah Dasar Negeri Percobaan 1 Malang / Wahyu Widodo

 

ABSTRAK Widodo, Wahyu. 2015. Pemaknaan Siswa terhadap Iklim Pembelajaran Tematik di Kelas IV B Sekolah Dasar Negeri Percobaan I Malang. Tesis, Program Studi Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Sa’dun Akbar, M.Pd., (II) Dr. Muakibatul Hasanah, M.Pd. Kata Kunci: pemaknaan siswa, pembelajaran tematik, iklim pembelajaran tematik Berdasarkan studi pendahuluan ditemukan fakta bahwa SDN Percobaan 1 Malang telah menyelenggarakan pembelajaran tematik sejak tahun pelajaran 2013/2014. Pembelajaran tematik diterapkan dengan melakukan penataan kurikulum, penataan lingkungan fisik, dan lingkungan sosial pembelajaran. Penelitian ini bertujuan untuk mendeskripsikan pemaknaan siswa terhadap pelaksanaan pembelajaran tematik, mendeskripsikan pemaknaan siswa terhadap lingkungan fisik pembelajaran, dan mendeskripsikan pemaknaan siswa terhadap lingkungan sosial pembelajaran. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi fenomenologi. Dalam penelitian ini peneliti bertindak sebagai instrumen kunci. Data yang digunakan dalam penelitian ini berupa kata-kata dan tindakan. Sumber data dalam penelitian ini siswa kelas IV B. Penelitian ini menggunakan lima teknik pengumpulan data, yaitu: survey, observasi, wawancara, life history, dan telaah dokumen. Tahapan analisis data dalam penelitian ini yaitu: pertama, membaca data untuk memahami keseluruhan. Kedua, menentukan bagian-bagian untuk menetapkan unit-unit bermakna. Ketiga, transformasi unit-unit bermakna ke dalam ekspresi-ekspresi sensitif psikologis. Keempat, menentukan struktur. Penelitian ini menggunakan pengecekan keabsahan data dengan triangulasi data dan member check. Berdasarkan paparan hasil analisis data dan temuan penelitian serta pembahasan disimpulkan bahwa pemaknaan siswa terhadap iklim pembelajaran tematik diwujudkan dalam bentuk, pertama, ungkapan pikiran, perasaan, dan sikap terhadap pembelajaran tematik yang berkenaan dengan materi pembelajaran tematik, tema pembelajaran, pelaksanaan pembelajaran tematik, dan penerapan asesmen autentik. Kedua, ungkapan pikiran, perasaan, dan sikap terhadap penataan lingkungan fisik pembelajaran yang berkenaan dengan penataan ruang kelas (kebersihan, pencahayaan, suhu ruang, penataan tempat duduk) dan kalimat poster. Ketiga, ungkapan perasaan dan sikap terhadap penataan lingkungan sosial pembelajaran yang berkenaan dengan tata tertib kelas, interaksi siswa-siswa, interaksi siswa-guru, dan interaksi siswa-orang tua. Pemaknaan siswa tersebut menunjukkan bahwa iklim pembelajaran tematik yang dihayati siswa yaitu pembelajaran yang bermakna, nyaman, dan menyenangkan. Pertama, iklim pembelajaran tematik yang bermakna dihayati siswa berdasarkan pengorganisasian tema, muatan, dan materi pembelajaran yang padu; penyusunan bahan ajar yang praktis dan menarik; penggunaan pendekatan saintifik; penggunaan kalimat poster yang sederhana; keterampilan mengajar guru; dan penerapan asesmen autentik. Kedua, iklim pembelajaran tematik yang nyaman dihayati siswa berdasarkan kelas yang bersih; pencahayaan kelas yang baik; suhu ruang yang nyaman (berkisar 25º-28ºC); penataan dan ergonomi tempat duduk; penggunaan musik instrumental; tingkat kebisingan kelas yang rendah; tata tertib kelas; dan penataan komunitas belajar (siswa-guru-orang tua) yang mendukung proses pembelajaran. Ketiga, iklim pembelajaran tematik yang menyenangkan dihayati siswa berdasarkan penggunaan pendekatan saintifik, pembelajaran dengan selingan humor, dan metode belajar kelompok. Berdasarkan hasil penelitian disarankan bagi: pertama, guru. Hasil penelitian ini dapat menjadi bahan rujukan untuk mewujudkan iklim pembelajaran tematik yang bermakna, nyaman, dan menyenangkan. Kedua, peneliti. Hasil penelitian ini dapat menjadi bahan rujukan untuk penelitian selanjutnya. Ketiga, praktisi kependidikan. Hasil penelitian ini dapat menjadi rujukan untuk memberikan fasilitas kepada lembaga penyelenggara pendidikan dasar dalam rangka mewujudkan pembelajaran tematik yang bermakna, nyaman, dan menyenangkan bagi siswa

Perencanaan konstruksi
R. Soetrisno

 

Pemanfaatan situs Candi Kidal sebagai sumber belajar untuk meningkatkan aktivitas dan hasil belajar IPS (studi pada siswa kelas VII A SMP Islam Al Hikmah Tajinan / Tulastiasih

 

ABSTRAK Tulastriasih, 2013.PemanfaatansitusCandiKidalsebagaiSumberBelajaruntukMeningkatkanAktivitasdanHasilBelajar IPS SiswaKelas VII A SMP Islam Al HikmahTajinan.Tesis. JurusanPendidikanDasarKonsentrasiIlmuPengetahuanSosial, PascasarjanaUniversitasNegri Malang. Pembimbing (I) Prof. Dr. Hariyono, M. Pd. (2) Prof. Dr. I NyomanSudanaDegeng, M. Pd. Kata Kunci:kunjungansitus, sumberbelajar, aktivitas, hasilbelajar, pembelajaran IPS. Selamaini, situssejarahjarangdimanfaatkan.sebagaisumberbelajar. Hal inijugaterjadipadasitusCandiKidal, yang terletak di DesaTegalrejo, KecamatanTumpang, Kabupaten Malang. Candiinijarangdimanfaatkansebagaisumberbelajarbagisekolah-sekolah yang berada di sekitarnya. PadahalsitusbersejarahmerupakancontohnyatabagisiswauntukbisabelajardalamdanmengenalkarakterbudayaBangsa Indonesia secaralangsungselainsumberbelajarbukuteks, apalagipembelajarantemaMasa Hindu-Buddha selaluadadisetiapkurikulumpembelajaran IPS SMP. PenelitianinibertujuanmemanfaatkansitusCandiKidalsebagaisumberbelajaruntukmeningkatkanaktivitasdanhasilbelajar IPS di kelas VII A SMP Islam Al HikmahTajinan. Rumusanmasalahdalampenelitianiniadalah (1) apakahpemanfaatansitusCandiKidalsebagaisumberbelajardapatmeningkatkanaktivitassiswa, (2) apakahpemanfaatansitusCandiKidalsebagaisumberbelajardapatmeningkatkanhasilbelajar IPS.PenelitianinimenggunakanmetodePenelitiankualitatifdenganjenisPenelitianTindakanKelasdengansubyeksiswa-siswikelas VII ASMP Islam Al HikmahTajinan. Rancanganpenelitianmeliputi 4 tahapyaitu : (1) Perencanaan, (2) Pelaksanaantindakan, (3) Refleksi, (4) Evaluasi.Pelaksanaantindakankelasinimenggunakan 2 siklusmasing-masing 3 pertemuan. Pertemuan 1 dan 2 siswauntukmempelajaritemaMasa Hindu-Buddha melaluimateridandiskusikelompok di kelassedangkanpertemuan ke-3 dilakukandenganmelakukankunjungansituskeCandiKidal. MelaluiPenelitianTindakanKelassiswadiajakuntukmelakukanpengamatanlangsungdanmenggaliinformasikepadamasyarakatsekitarsitussecaraberkelompok. Hasilpenelitianmenunjukkanpeningkatanaktivitasdalambelajar yang ditandaidenganmeningkatnyakegiatan(1) mendengarkanataumemperhatikanpenjelasan guru, (2) mengajukanpertanyaan, (3) menjawabpertanyaan, (4) mengidentifikasi, (5) menjawabpertanyaansecaraberkelompok, (6) mempresentasikanjawabankelompok, (7) menyimpulkan.Hal itudapatditunjukkandalampelaksanaanaktivitassiswayang meningkattiapsiklus. Padasiklus I rata-rata prosentaseaktivitassiswamencapai 77,55% dengankriteriabaik. Padasiklus II mengalamipeningkatandengan rata-rata mencapai 97,95%dengankriteriasangatbaik. Dari angketresponsiswa , siswasangatpositifdengan model pembelajaran yang memanfaatkansitusCandiKidalsebagaisumberbelajarkarenasiswamerasasenangdanterdoronguntuklebihmudahmenguasaimateriIlmuPengetahuanSosialmateriMasa Hindu Buddha.Denganadanyasikappositiftersebutmakaterbuktidapatmeningkatkanhasilbelajar. Hasilanalisispost test 1 danpost test 2 disetiapakhirsiklusmenunjukkanpeningkatanhasilbelajar yang signifikan. Rata-rata dariskortessiswasebelumpemanfaatansitusCandiKidalsebagaisumberbelajaradalah 74,48, setelahkunjungansitussiklus 1 mencapai 75,59, danpadakunjungansitussiklus 2 mencapai 79,76. Berdasarkanhasilpenelitian yang telahdilakukantersebut, makapenelitimenyarankan;1)Hendaknya guru matapelajaran IPS menggunakanmetodepembelajarankunjungansitus yang memanfaatkansitusCandiKidalpadamateritemaMasa Hindu –Buddha sertamelakukanperencanaan yang matang agar dapatmengelolakelasdanwaktudenganbaikuntukhasillebihmaksimal.2 )agar terjadikerjasama yang baikantarsiswadalamkelompok yang mendukungaktivitassiswadanhasilbelajarsiswaperluadanyapenggabungandenganmetodepembelajaranyang lain yang bersifatkooperatif. 3)Hendaknyapihaksekolahagar memberikanfasilitasdandukungankepada guru untukmelaksanakanmetodekunjungansitus demi peningkatandanpengembanganpembelajaran di sekolah yang lebihvariatif, khususnyakeCandiKidalpadamatapelajaran IPS. 4)Bagipenelitiselanjutnyadisarankan agarmelakukanpenelitiankunjungansitusmenggabungkandenganmetodepembelajaran lain agar lebihmenarikdanmenyenangkanserta. hasilpenelitianininantinyadapatdijadikanreferensiuntukpenelitiansejenis.

Perencanaan konstruksi beton, perencanaan gedung sekolah dan kantor tiga lantai
oleh Djoko Setiono

 

Hubungan antara kecerdasan emosional dan keterampilan komunikasi interpersonal dengan penyesuaian diri siswa SMA negeri se Kabupaten Tulungagung / Bayu Sanjaya

 

Kata Kunci : Kecerdasan Emosional, Keterampilan Komunikasi Interpersonal, Penyesuaian diri Sekelompok Siswi SMA di Tulungagung menamakan diri sebagai “Geng Nyik-nyik” melakukan tindak kekerasan terhadap siswi lain adalah suatu fenomena kesulitan-kesulitan remaja dalam penyesuiaan terhadap dirinya maupun lingkungannya. Kesulitan penyesuaian diri yang dialami oleh remaja pada umumnya dipengaruhi oleh beberapa faktor, di antarannya adalah tingkat kecerdasan emosional dan keterampilan komunikasi interpersonal. Penelitian ini bertujuan untuk mengetahui : (1) deskripsi kecerdasan emosional, (2) keterampilan komunikasi interpersonal, (3) deskripsi penyesuaian diri siswa SMA Negeri se-Kabupaten tulungagung, (4) hubungan secara parsial antara kecerdasan emosional dan keterampilan komunikasi interpersonal dengan penyesuaian diri siswa SMA Negeri di kabupaten Tulungagung, (5) hubungan secara simultan antara kecerdasan emosional dan keterampilan komunikasi interpersonal dengan penyesuaian diri siswa SMA Negeri di kabupaten Tulungagung. Rancangan penelitian ini adalah deskriptif koresional. Populasi penelitian adalah siswa SMA Negeri se-Kabupaten Tulungagung. Sampel penelitian sebanyak 117 siswa ditentukan dengan teknik Cluster Random Sampling. Instrumen yang digunakan yaitu angket (kuisioner) kecerdasan emosional, angket keterampilan komunikasi interpersonal, dan angket peyesuaian diri dengan jawaban berskala likert. Teknik analisis data yang digunakan analisis deskriptif, korelasi inferensial (dengan formula regresi ganda). Dari hasil penelitian dapat disimpulkan bahwa : (1) banyak siswa yang memiliki kecerdasan emosional tingkat sedang, (2) Sangat banyak siswa yang memiliki tingkat ketrampilan komunikasi interpersonal tingkat sedang, (3) cukup banyak siswa yang memiliki penyesuaian diri baik dan sebanding dengan jumlah siswa yang memiliki pernyesuaian diri cukup baik, (4) ada hubungan yang signifikan secara simultan antara kecerdasan emosional dan keterampilan komunikasi interpersonal dengan penyesuaian diri siswa SMA Negeri se-Kabupaten, (5) ada hubungan yang signifikan secara parsial antara kecerdasan emosional dan keterampilan komunikasi interpersonal dengan penyesuaian diri siswa SMA Negeri se-Kabupaten Tulungagung Berdasarkan kesimpulan diatas, maka (1) disarankan kepada pihak instansi terkait atau SMA Negeri di kabupaten Tulungagung agar memandang masalah kenakalan siswa sebagaimana fenomena “geng nyik-nyik” sebagai rendahnya kemampuan penyesuaian diri siswa, dan masalah ini dapat diatasi dengan cara meningkatkan kecerdasan emosi dan keterampilan komunikasi interpersonal siswa, (2) disarankan kepada konselor agar melakukan upaya untuk membimbing dan memotivasi siswa atau remaja yang kesulitan melakukan penyesuaian diri dengan lingkungan sosial dengan cara meningkatkan kecerdasan emosi dan keterampilan komunikasi interpersonal siswa, (3) disarankan kepada peneliti selanjutnya agar mengembangkan penelitian ini dengan cara menambah variabel-variabel bebas misalnya menambah variabel pola asuh, kecerdasan intelektual dan menggunakan metode penelitian yang lainnya, seperti metode kualitatif ataupun metode eksperimental.

Pengaruh strategi pembelajaran inkuiri terbimbing pada materi hidrolisis terhadap motivasi belajar dan kemampuan berpikir tingkat tinggi siswa kelas XI SMA Negeri 6 Malang / Inma Yunita Setyorini

 

ABSTRAK Setyorini, Inma Yunita. 2015. Pengaruh Strategi Pembelajaran Inkuiri Terbimbing pada Materi Hidrolisis terhadap Motivasi Belajar dan Kemampuan Berpikir Tingkat Tinggi Siswa Kelas XI SMA Negeri 6 Malang. Tesis, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Subandi, M.Si. (II) Dr. Aman Santoso, M.Si. Kata Kunci:Inkuiri terbimbing, Hidrolisis, Motivasi belajar, Kemampuan berpikir tingkat tinggi Ilmu kimia mempunyai banyak konsep yang bersifat abstrak dan umumnya sulit untuk dipahami oleh siswa. Ilmu kimia tidak hanya memiliki konsep-konsep yang rumit, tetapi juga membutuhkan keterampilan matematika untuk menyelesaikan soal-soal. Materi yang dianggap sulit oleh siswa, salah satunya adalah hidrolisis. Materi hidrolisis selain bersifat konseptual, juga bersifat algoritmik, yang memerlukan kemampuan berpikir tingkat tinggi untuk memahaminya. Kemampuan berpikir tingkat tinggi siswa akan dapat dicapai melalui penerapan strategi pembelajaran inkuiri terbimbing. Tahap pembuatan hipotesis dalam langkah-langkah pembelajaran ikuiri terbimbing dapat didukung oleh kemampuan logika deduktif siswa. Oleh sebab itu, akan diteliti pengaruh strategi pembelajaran inkuiri terbimbing pada materi hidrolisis terhadap motivasi belajar dan kemampuan berpikir tingkat tinggi aspek pemahaman konseptual dan algoritmik, serta kemampuan logika deduktif. Rancangan penelitian yang digunakan adalah rancangan eksperimental semu. Populasi penelitian adalah siswa kelas XI IPA SMAN 6 Malang yang terdiri dari 4 kelas. Sampel penelitian diambil dengan teknik cluster random sampling dan terpilih kelas XI IPA 3 sebagai kelas eksperimen dan kelas XI IPA 1 sebagai kelas kontrol, yang telah diuji kesetaraannya. Kelas eksperimen dibelajarkan dengan strategi inkuiri terbimbing, sedangkan kelas kontrol dibelajarkan dengan strategi ekspositori. Instrumen perlakuan terdiri dari: silabus, RPP, handout, LKS, dan kuis, sedangkan instrumen pengukuran terdiri dari: angket motivasi, soal tes pemahaman konseptual dan algoritmik, serta soal kemampuan logika deduktif, yang telah divalidasi dengan tingkat validitas masing-masing sebesar 96, 97, dan 98%, dan nilai reliabilitas masing-masing sebesar 0,929; 0,900; dan 0,810. Perbedaan motivasi belajar, pemahaman konseptual dan algoritmik, serta kemampuan logika deduktif kedua kelas diuji dengan uji MANOVA. Hasil penelitian pada pembelajaran materi hidrolisis di kelas XI SMAN 6 Malang menunjukkan bahwa: (1) ada perbedaan motivasi belajar antara siswa yang dibelajarkan dengan strategi pembelajaran inkuiri terbimbing dengan siswa yang dibelajarkan dengan strategi pembelajaran ekspositori. Motivasi belajar siswa yang dibelajarkan dengan strategi inkuiri terbimbing (x ̅=137,6) lebih tinggi daripada siswa yang dibelajarkan dengan strategi pembelajaran ekspositori(x ̅=125,9); (2) ada perbedaan kemampuan berpikir tingkat tinggi antara siswa yang dibelajarkan dengan strategi inkuiri terbimbing dengan siswa yang dibelajarkan dengan strategi pembelajaran ekspositori. Pemahaman konseptual dan pemahaman algoritmik siswa yang dibelajarkan dengan strategi inkuiri terbimbing (x ̅=9,5 dan x ̅=7,1) lebih tinggi daripada siswa yang dibelajarkan dengan strategi pembelajaran ekspositori (x ̅=8,9 dan x ̅=6,7). Kemampuan logika deduktif siswa yang dibelajarkan dengan strategi pembelajaran inkuiri terbimbing (x ̅=9,8) lebih tinggi daripada siswa yang dibelajarkan dengan strategi pembelajaran ekspositori (x ̅=8,7).

Perhitungan konstruksi beton bertulang perencanaan gedung pertokoan dan pertemuan
oleh Sunarko

 

Pengembangan model penilaian formatif berbantuan komputer menggunakan soal isomorfik untuk meningkatkan penguasaan konsep fisika siswa SMP / Indri Trisusiyanti

 

ABSTRAK Trisusiyanti, Indri. 2015. Pengembangan Model Penilaian Formatif Berbantuan Komputer Menggunakan Soal Isomorfik untuk Meningkatkan Penguasaan Konsep Fisika Siswa SMP. Tesis. Program Studi Pendidikan Fisika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Sentot Kusairi, M.Si., (II) Dr. Muhardjito, M.S. Kata Kunci: penilaian formatif, komputer, soal isomorfik, penguasaan konsep Penilaian formatif berkaitan erat dengan aktivitas guru dan siswa dalam kegiatan belajar mengajar. Penilaian formatif digunakan untuk membantu siswa belajar. Apabila penilaian formatif dilakukan, guru dapat memberikan materi sesuai dengan kebutuhan siswa, sehingga proses belajar siswa menjadi lebih intensif. Dengan terselenggaranya penilaian formatif, siswa mendapat informasi perkembangan pengetahuannya. Penilaian formatif cenderung kurang terlaksana dengan baik. Pemberian penilaian formatif tidak jarang terabaikan dan pemberian penilaian sumatif menjadi fokus utama dalam pembelajaran. Tujuan penelitian dan pengembangan ini adalah mengembangkan model penilaian formatif berbantuan komputer yang dapat mengaktifkan interaksi siswa dan guru. Penelitian ini menggunakan model penelitian dan pengembangan. Prosedur yang digunakan mengadaptasi Prosedur Borg & Gall. Pengembangan ini diawali dengan perancangan produk. Produk diuji kelayakannya oleh 2 validator, yaitu validator ahli penilaian dan ahli media dan validator ahli materi. Data penilaian kelayakan berupa data kuantitatif menggunakan skala Likert dan data kualitatif berupa komentar/saran validator. Produk diimplementasikan kepada siswa kelas VIII di SMPK Kolese Santo Yusup 2 Malang sebanyak 2 kelas, sebagai kelas eksperimen dan kelas kontrol. Data penelitian berupa data kuantitatif diperoleh dengan pembandingan data postes kelas eksperimen dan kelas kontrol. Pengujian efektifitas produk yaitu dengan menganalisis data postes. Produk pengembangan berupa multimedia interaktif, yang kemudian dijalankan siswa secara online. Produk ini mengandung latihan soal yang berisi soal-soal isomorfik, laporan pekerjaan siswa, penjelasan visual sebagai materi remedial, dan fasilitas pengiriman data ke alamat email guru. Apabila siswa belajar dengan menggunakan produk ini, siswa dapat menguji kemampuan penguasaan konsep secara mandiri. Produk ini juga memberikan fasilitas untuk guru berupa pengiriman data pekerjaan siswa, sehingga guru dapat mendeteksi kemampuan dan kelemahan siswa. Penggunaan produk pengembangan ini dalam pembelajaran dinilai cukup oleh validator, karena produk ini memiliki kekurangan dalam ranah konstruksi dan ranah materi. Penerapan produk sebagai uji efektifitas menunjukkan hasil kurang efektif. Nilai rerata postes kelas eksperimen ≈ 68, sedangkan nilai rerata postes kelas kontrol ≈ 58. Nilai rerata postes kelas eksperimen lebih tinggi daripada nilai rerata postes kelas kontrol, sehingga membuktikan bahwa produk dapat meningkatkan penguasaan konsep fisika siswa, tetapi terdapat beberapa kendala yang menyebabkan nilai postes kelas eksperimen sama dengan nilai ketuntasan.

Perencanaan konstruksi beton bangunan pertokoan
oleh Yogi Crisrumpoko

 

Transfer of learning pada pendidikan informal / R. Anggia Listyaningrum

 

ABSTRAK Listyaningrum, R. Anggia. 2015. Transfer of LearningpadaPendidikan Informal (StudiKasusPewarisanKearifanLokalPijatBayiSecaraTurunTemurun di KecamatanBendoKabupatenMagetan).Tesis. Program StudiPendidikanLuarSekolah, Program PascasarjanaUniversitasNegeri Malang. Pembimbing (I) Prof. Dr. Supriyono, M.Pd, (2) Dr. Hardika, M.Pd. Kata Kunci: Transfer of Learning, Pendidikan Informal, KearifanLokal. Keterampilanpijatbayitradisionalmerupakansalahsatucontohkearifanlokaldalamlingkupkeluargayang sudahmulailangkakeberadaannya.Karenamasihbanyakmasyarakat yang membutuhkanjasadariketerampilanini, makasangatpentinguntukdilestarikan.Untukmengetahuicarapelestariannya, perluditemukanbagaimanatransfer of learningdalampendidikan informal yang dilakukankeluargapemijatbayipadapenerusnya.Olehkarenaitupenelitimemfokuskanpenelitianpada“bagaimanatransfer of learningdalampendidikan informal padakasuspewarisankearifanlokalpijatbayisecaraturuntemurun?”. Pendekatanpenelitian yang digunakanadalahpendekatankualitatifdenganjeniskualitatifstudikasus.Teknikpenggalian data yang digunakandalampenelitianiniadalahwawancaradanobservasi.Analisis data yang digunakanadalahanalisistemadenganmenggunakanlangkahreduksi data, display data, danpenarikankesimpulan.Hasilanalisismenunjukkanbahwaterdapat 4 tahapandalampewarisanketerampilanpijatbayitradisional, yaitutahap (1)“nginthil”(identifikasi), (2) “njajal” (praktek di bawahpengawasan, (3) “nerusno” (praktekmandiri), (3) “ngembangno” (mengembangkan). Penelitianinimenunjukkanbahwaterdapatsuatu proses belajar yang bersifat informal padapewarisanketerampilanpijatbayitradisionalsecaraturuntemurun yang dijalaniolehgenerasipeneruspemijatbayi yang direkrutberdasarkanhubungankeluarga. Proses belajardalampewarisanketerampilanpijatbayitradisionaldilakukanmelaluipendidikan informal dalamkeluargadenganpentahapan-pentahapan. Transfer of learningpadapentahapannyaada yang terjadidengankesengajaansalahsatupihakbaikleluhur yang mewariskanketerampilanmaupundaripihakgenerasipenerus, selainitujugaada yang terjaditanpakesengajaandarikeduapihakataubiasadisebutdenganbatic/ insidental.Komponenpembelajarannyatidakterstrukturnamuntersiratdalampentahapannya. Saran penelitianiniadalah (1) pengembangpraktek PLS hendaknyamemberikanintervensiterhadappendidikan informal padaketerampilanpijatbayidenganmemberikanmotivasipada para pemijatbayi agar merubahpolarekruitmenpeneruspemijatbayi, yaitutidakhanyapadagenerasibiologisnamunjugapadagenerasisecara social. (2) sumberbelajar (pemijatbayi) hendaknyamulaimengidentifikasiketurunanataukerabatnya yang dapatdiwarisiketerampilanpijatbayi yang dimilikinya agar keterampilaninitidakpunah, danuntukwargabelajarpijatbayiselainmempersiapkandirinyadenganmemenuhikriteriaawalsebagaipemijatbayi, dapatjugamelakukanprosedursepertihasiltemuanini yang dimulaidari proses “nginthil”danseterusnya. (3) penelitilanjut yang inginmengembangkanpenelitiansejenishendaknyamemperbanyakdanmempertajampenentuansubjekpenelitianuntukmemperkaya data sebagaiperbandingantemuan.

Konstruksi beton
perencanaan gedung perkuliahan tiga lantai dengan menggunakan metode ultimate strength design
oleh Agung Prabowo

 

Tampilan opac program Senayan versi Meranti di Perpustakaan Politeknik Negeri Malang / Eva Devita Emilia Siswanti

 

ABSTRAK Siswanti, Eva Devita Emilia. 2015. Tampilan OPAC Program Senayan Versi Meranti di Perpustakaan Politeknik Negeri Malang. tugas akhir, Jurusan Sastra Indonesia, Program Studi D3 Perpustakaan, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Roekhan, M.Pd. (II) Sokhibul Ansor, S.Sos., M.Hum. Kata Kunci: OPAC, otomasi perpustakaan, perpustakaan perguruan tinggi, teknologi informasi Perkembangan teknologi dan informasi (TI), membawa banyak dampak terhadap perkembangan dunia perpustakaan. Salah satunya adalah beralihnya penanganan kegiatan perpustakaan yang semula tradisional atau manual berubah menjadi perpustakaan yang modern atau perpustakaan terautomasi. Dengan adanya perpustakaan terautomasi diharapkan dapat membantu segala kegiatan dalam perpustakaan sehingga lebih efisien dan akurat. Penelitian ini dilaksanakan dengan tujuan mendeskripsikan tampilan fitur OPAC yang ada di UPT Perpustakaan Universitas Politeknik Negeri Malang, dan mendeskripsikan kesesuaian tampilan fitur OPAC Perpustakaan Universitas Polteknik Negeri Malang berdasarkan standar IFLA. Penelitian ini menggunakan metode penelitian deskriptif. Teknik pengumpulan data dengan cara dokumentasi. Sumber data yang digunakan berupa printscreen OPAC, dan penjelasan tampilan fitur OPAC di UPT Perpustakaan Politeknik Negeri Malang. Hasil penelitian diperoleh dari pengamataan terhadap OPAC UPT Perpustakaan Politeknik Negeri Malang, sebagai bukti, Pertama, tampilan OPAC di UPT Perpustakaan Politeknik Negeri Malang hanya ada satu bagian yaitu konten. Terdapat 6 menu navigasi yang ditampilkan OPAC. Urutan dari atas ke bawah yaitu beranda, informasi perpustakaan, bantuan, informasi untuk cek peminjaman, pilih bahasa, dan login masuk untuk pustakawan. Kedua, tampilan fitur OPAC UPT Perpustakaan Politeknik Negeri Malang belum bisa memenuhi kesesuaian prinsip dan rekomendasi IFLA. OPAC UPT Perpustakaan Politeknik Negeri Malang hanya memenuhi 12 indikator dari keseluruhan 37 indikator rekomendasi IFLA. Saran yang diberikan terkait pengembangan OPAC UPT Perpustakaan Politeknik Negeri Malang yaitu: (1) pustakawan sebaiknya mempelajari perkembangan ilmu perpustakaan baik nasional maupun internasional atau standar lain yang berhubungan dengan perpustakaan dan menerapkan pengetahuan tersebut di UPT Perpustakaan Politeknik Negeri Malang. Selain itu pustakawan harus bekerja sama dengan tenaga TI untuk lebih mengoptimalkan fungsi tampilan OPAC, agar mempermudah pemustaka dalam menggunakan layanan OPAC, dan (2) tenaga TI sebaiknya mengikuti pelatihan atau seminar mengenai pengembangan teknologi informasi selain itu tenaga TI semestinya ikut bergabung dengan komunitas SLiMS sehingga dapat mengetahui perkembangan dari SLiMS, karena rencana pengembangan konten digital perlu dilakukan dengan baik dan matang. Agar pemustaka dapat memahami cara dan alat yang digunakan untuk menelusur informasi yang ada di perpustakaan.

Pengembangan bahan ajar grammar one berbasis mobile learning di lembaga kursus Global English Pare - Kediri / Syahrul Mubaroq

 

ABSTRAK Mubaroq, Syahrul. 2015. Pengembangan Bahan Ajar Grammar One Berbasis Mobile Learning di Lembaga Kursus Global English Pare – Kediri. Tesis. Program Studi Teknologi Pembelajaran. Pascasarjana. Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Punaji Setyosari, M.Pd, M.Ed (2) Dr. Sulton, M.Pd. Kata Kunci: pengembangan, bahan ajar, grammar, mobile learning. Pengembangan ini berdasarkan permasalahan tentang belum adanya bahan ajar dalam program belajar Grammar One di lembaga kursus bahasa Inggris Global English di Pare-Kediri. Tujuan penelitian dan pengembangan ini adalah menghasilkan bahan ajar Grammar One berbasis mobile learning yang dapat digunakan sebagai pelengkap pembelajaran di kelas maupun sebagai sumber belajar secara individu. Model pengembangan yang digunakan dalam penelitian ini adalah model Lee & Owens dengan menggunakan tiga tahapan yaitu (1) analisis, (2) desain, dan (3)pengembangan. Hasil uji validasi dan uji coba produk pengembangan bahan ajar Grammar One berbasis mobile learning adalah: (1) hasil validasi ahli isi diperoleh persentase sebesar 95%,(2) hasil validasi ahli media diperoleh persentase sebesar 96%, (3) hasil validasi ahli desain diperoleh persentase sebesar 98%, (4)hasil uji coba perorangan diperoleh rata-rata persentase 82,6%, (5) hasil uji coba kelompok kecil didapat rata-rata persentase 85%,dan (6) hasil uji coba lapangan didapat rata-rata persentase 85%. Dari hasil analisis data tersebut dibandingkan dengan kriteria yang telah ditentukan dan diperoleh hasil bahwa produk pengembangan bahan ajar Grammar One berbasis mobile learning termasuk dalam kriteria sangat layak. Berdasarkan hasil penelitian, bahwa (1) pemanfaatan produk pengembangan bahan ajar Grammar One ini dapat digunakan dalam pembelajaran sebagai pelengkap pembelajaran di kelas maupun dapat dijadikan sumber belajar secara mandiri. Jika produk Grammar One digunakan sebagai pelengkap pembelajaran di kelas, maka produk diprogramkan untuk menjadi materi penguatan yang bersifat pengayaan dan remedial di dalam mengikuti kegiatan pembelajaran konvensional. Dan jika produk dimanfaatkan untuk pembelajaran secara individual maka sebaiknya bagi para pengguna diharapkan untuk mengasah pengetahuannya dengan latihan, setelah mempelajari materi yang terdapat dalam Grammar One diharapkan untuk mengaplikasikannya dalam bentuk writing maupun speaking, dan diskusikan dengan teman sejawat maupun tenaga pengajar. (2)Diseminasi: Produk pengembangan bahan ajar Grammar One berbasis mobile learning ini dikembangkan berdasarkan materi program belajar Grammar One yang terdapat di lembaga kursus bahasa Inggris Global English Pare-Kediri. Produk pengembangan ini dirancang sesuai dengan analisis kebutuhan, karakteristik pengguna, serta kondisi lingkungan belajar di Global English. (3)Pengembangan produk lebih lanjut adalah penggunaaan scroll atau swipe untuk mengakses ke halaman selanjutnya atau sebelumnya, dan diperlukannya materi lanjutan dari Grammar One.

Kajian implementasi konsep kompetensi dalam kurikulum tingkat satuan pendidikan (KTSP) pada perangkat perencanaan pembelajaran biologi di SMA Negeri 2 Batu / Nurlina Khomsah

 

Kata kunci: implementasi, konsep kompetensi, KTSP, perangkat perencanaan pembelajaran. SMA Negeri 2 Batu melakukan pengembangan perangkat perencanaan pembelajaran yang dijabarkan dalam Silabus dan Rencana Pelaksanaan Pembelajaran (RPP). Berdasarkan kedua perangkat pembelajaran yang telah disusun oleh guru tersebut, diharapkan dapat menampakkan konsep kompetensi yang merupakan kebulatan aspek kognitif, psikomotor atau afektif yang dapat didemonstrasikan, ditunjukkan atau ditampilkan oleh siswa sebagai hasil belajar. Tujuan penelitian ini adalah menjabarkan implementasi konsep kompetensi dalam KTSP pada Silabus dan RPP mata pelajaran biologi buatan guru di SMA Negeri 2 Batu. Penelitian ini termasuk dalam penelitian deskriptif. Metode pengumpulan data menggunakan wawancara dengan guru biologi SMA Negeri 2 Batu yang berjumlah 2 orang dan studi dokumentasi silabus dan RPP kelas X, XI dan XII tahun pelajaran 2009/ 2010 yang berhasil dikumpulkan oleh peneliti berjumlah 13 RPP. Analisis data terbagi dalam tiga tahap; (1) Reduksi data (2) Penyajian data (3) Penarikan kesimpulan. Data yang diambil dan disajikan dalam paparan ini hanya yang sesuai dengan fokus khusus penelitian ini yaitu komponen silabus dan RPP yang berkaitan dengan kompetensi yang hendak dikuasai. Komponen silabus dan RPP yang berkaitan dengan cara menguasai kompetensi, mengetahui pencapaian kompetensi dan komponen yang berkaitan dengan pendukung pencapaian kompetensi. Berdasarkan hasil penelitian dan pembahasan pada penelitian ini dapat disimpulkan bahwa, Implementasi konsep kompetensi pada Silabus Buatan guru SMA Negeri 2 Batu mencakup kebulatan aspek kognitif, afektif dan psikomotor sebesar 10%; mencakup satu aspek yaitu aspek kognitif sebesar 40; dan dua aspek kompetensi meliputi aspek kognitif dan psikomotor sebesar 50%. Implementasi konsep kompetensi pada Rencana Pelaksanaan Pembelajaran (RPP) Buatan guru SMA Negeri 2 Batu mencakup kebulatan aspek kognitif, afektif dan psikomotor sebesar 60%; mencakup satu aspek yaitu aspek kognitif sebesar 7%; dua aspek kompetensi meliputi aspek kognitif dan psikomotor sebesar 33%. Hasil penjabaran konsep kompetensi dalam setiap komponen RPP dikemukakan sebagai berikut.Persentase komponen penyusun tujuan pembelajaran menunjukkan sejumlah 14% tujuan pembelajaran yang memenuhi komponen audience (A), behavior (B), condition (B) dan degree (D), 82% tujuan pembelajaran hanya tersusun dari komponen audience (A), behavior (B) dan degree (D) serta sejumlah 4% tujuan pembelajaran hanya tersusun dari dua komponen saja yaitu audience (A) dan degree (D). Tujuan pembelajaran yang disusun oleh guru juga mencakup aspek kognitif, aspek afektif dan aspek psikomotor. Pada setiap kompetensi dasar ii juga terdiri atas jenis-jenis materi fakta, konsep dan prinsip. Metode pembelajaran yang digunakan oleh guru meliputi STAD, Picture and picture, TPS (Think, Pair and Share), inkuiri, konstruktivisme, student fasilitator and explaining dan problem posing. Kegiatan pembelajaran meliputi kegiatan awal, kegiatan inti dan kegiatan penutup dengan langkah-langkah pembelajaran sesuai dengan karakteristik metode pembelajaran yang digunakan. Sumber belajar yang digunakan oleh guru meliputi buku teks, alat dan bahan praktikum yang menunjang tercapainya tujuan pembelajaran. Penilaian penguasaan aspek kognitif meliputi tes tulis (pilihan ganda, uraian bebas), penilaian jawaban LKPD. Penilaian penguasaan aspek afektif dan psikomotor meliputi tes kinerja dalam praktikum dan kegiatan diskusi. Disarankan bagi guru disarankan agar melakukan analisis implementasi konsep kompetensi pada komponen-komponen penyusun silabus dan RPP. Apabila ditemukan adanya implementasi yang kurang sesuai dengan konsep kompetensi maka disarankan agar menyesuaikan dengan konsep kompetensi berdasarkan pedoman penyusunan KTSP. Melakukan penjabaran RPP harus mengacu pada komponen-komponen silabus yang telah disusun oleh guru sebelumnya sehingga aspek-aspek kompetensinya secara konsisten dapat dilihat pada kedua perangkat pembelajaran tersebut.

Perencanaan gear box
oleh Sitono Alhuda

 

Pengembangan formative feedback berbantuan komputer untuk membantu mahasiswa meningkatkan penguasaan konsep rotasi dan momentum sudut / Lalu Amnirullah

 

ABSTRAK Amnirullah, Lalu. 2015. PengembanganFormative FeebackBerbantuanKomputeruntukMembantuMahasiswaMeningkatkanPenguasaanKonsepRotasidan Momentum Sudut, TesisJurusanPendidikanFisika. Program PascasarjanaUniversitasNegeri Malang. Pembimbing (I) Dr. SentotKusairiM.Si (II) Dr. Muhardjito M.S. Kata kunci: formative feedbackberbantuankomputer, penguasaankonsep, rotasidan momentum sudut Asesmenformatifmerupakansalahsatuhalpentingdalampembelajaranfisika. Efektifitasasesmenformatifterletakpadaformativefeedback yang diberikan. Karenaberbagaikendala, formativefeedbackbelumsepenuhnyadilakukanolehdosen. Sebagaiakibatnya, baikpengajarmaupunmahasiswatidakmendapatkanumpanbalik yang diperlukandalam proses pembelajaran. Teknologikomputermenjadisalahsatusolusiuntukmempermudahformative feedback yang efektif. Tujuanpenelitianiniadalahmengembangkanformative feedbackberbantuankomputeruntukmembantumahasiswameningkatkanpenguasaankonseprotasidan momentum sudut. PenelitianinitermasukdalamPenelitiandanPengembangan (Research and Developement). Tahapanpenelitianterdiridaristudipendahuluan, pengembangandesain, danujicobaproduk. Ujicobaprodukdilaksanakandalambentukkuasieksperimen. Instrumen yang digunakanberupaangket, tesuraiandantespilihanganda. Kegiatanvalidasimeliputivalidasiprodukformative feedbackberbantuankomputerdanvalidasisoalpilihanganda. Validasidilaksanakanolehdosenahlimateridanasesmen. Data penelitianmeliputi data kuantitatifberupapenilaian validator dantanggapanmahasiswaterhadapprodukberdasarkanskala Likert, serta data kualitatifberupakomentardan saran yang diberikanoleh validator. Data kuantitafdianalisismenggunakanuji-t. Hasilanalisis data kuantitatif and kualitatifmenunjukkanbahwaprodukdalamkategoribaik. Secaraumumproduk yang dihasilkandikatakanlayakuntukdilakukanujilebihlanjut. Ujiefektivitasprodukmenunjukkanperbedaanantarakelompokkontroldaneksperimen. Hasiltersebutmenggambarkanefektifitasprodukformative feedbackberbantuankomputer yang telahdikembangkan.

Penerapan pembelajaran kooperatif model stad (Student teams-achievment division) untuk meningkatkan kualitas proses pembelajaran siswa pada mata diklat siklus akuntansi kelas X AK SMK PGRI 2 Malang / Raysa Resti Maharani

 

Kata kunci:Pembelajaran Kooperatif, STAD dan Kualitas Proses Pembelajaran. Pembelajaran kooperatif model STAD dilakukan untuk meningkatkan kualitas proses pembelajaran siswa, menjadikan siswa lebih aktif dalam berkomunikasi dan pembelajaran kooperatif model STAD merupakan variasi dalam pembelajaran agar pembelajaran tidak monoton dengan hanya menggunakan metode ceramah sehingga siswa tidak merasa bosan Penelitian dilakukan untuk mengetahui kualitas proses pembelajaran pada mata diklat siklus akuntansi pada pokok bahasan neraca saldo dan jurnal penyesuaian. Tujuan penelitian ini adalah: (1) untuk mengetahui kualitas proses pembelajaran setelah diadakan pembelajaran kooperatif model STAD pada mata diklat siklus akuntansi; (2) untuk mengetahui hasil belajar siswa setelah diadakan pembelajaran kooperatif model STAD pada mata diklat siklus akuntansi., (3) untuk mengetahui bagaimanakah tanggapan siswa terhadap proses pembelajaran metode kooperatif model pada mata diklat siklus akuntansi. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang dilakukan dalam dua siklus. Setiap siklus terdiri dari tahap-tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian adalah kelas X AK SMK PGRI 2 Malang. Pengumpulan data dilakukan dengan menggunakan tes, panduan observasi, format penilaian dan angket untuk siswa. Penelitian ini menggunakan dua siklus, dimana dalam setiap siklus meliputi empat tahap yaitu: perencanaan tindakan, pelaksanaan tindakan, observasi dan refleksi. Dalam tindakan siklus I proses adaptasi dan sosialisasi siswa sudah baik meskipun ada beberapa siswa yang masih enggan untuk mengemukakan pendapatnya. Pada tindakan siklus II keaktifan siswa sudah sangat baik dibandingkan dengan siklus I, banyak siswa yang sebelumnya tidak berani bertanya kini berani bertanya jika ada yang tidak dimengerti. Dari hasil penelitian disimpulkan bahwa (1) pembelajaran kooperatif model STAD sangat bermanfaat bagi siswa karena model tersebut telah terbukti dapat meningkatkan kualitas proses pembelajaran siswa, sehingga bagi guru mata diklat siklus akuntansi dan guru mata diklat lainnya dapat menggunakan metode pembelajaran kooperatif model STAD ini pada pokok bahasan lain yang memenuhi karakteristik yang sama dengan pokok bahasan neraca saldo dan jurnal penyesuaian. (2) prestasi atau hasil belajar siswa setelah diterapkan pembelajaran kooperatif model STAD mengalami peningkatan di mana diketahui pada tindakan siklus I nilai post test siswa meningkat dibanding nilai pre test mereka, namun kelas belum memenuhi syarat ketuntasan belajar karena yang tuntas belajar masih di bawah batas minimum presentase ketuntasan belajar kelas. Pada tindakan siklus II nilai post test siswa meningkat dibandingkan nilai pre test mereka. Diketahui bahwa dalam tindakan siklus II ini kelas telah memenuhi taraf ketuntasan belajar dimana presentase siswa yang tuntas belajar di atas batas minimum presentase ketuntasan belajar kelas. Dari penelitian penerapan pembelajaran kooperatif model STAD, saran yang dapat dikemukakan diantaranya: (1) bagi guru, guru hendaknya lebih meningkatkan motivasi siswa untuk berpikir lebih aktif dalam memecahkan suatu masalah, saling bekerjasama antar siswa dan memberikan bimbingan pada siswa untuk memecahkan suatu masalah.(2) bagi siswa, siswa hendaknya lebih meningkatkan kreatifitas mereka untuk berfikir lebih maju dan berani mengungkapkan pendapat. Selain itu siswa diharapkan dapat saling bekerjasama dalam suatu kelompok dan berusaha menghargai orang lain.(3) bagi peneliti selanjutnya, penulis mengharapkan penelitian ini dapat menjadi acuan bagi peneliti-peneliti selanjutnya dalam penulisan karya ilmiahnya.

Perencanaan mesin produksi, perencanaan motor otto dua langkah
oleh Suharmanto

 

Pengaruh integral learning terhadap strategi pemecahan masalah dan penguasaan konsep materi kalor bagi siswa SMA / M. Dewi Manikta Puspitasari

 

ABSTRAK Puspitasari, M.D.M. 2015. Pengaruh Integral Learning terhadap Strategi Pemecahan Masalah dan Penguasaan Konsep Materi Kalor bagi Siswa SMA. Tesis. Program Studi Pendidikan Fisika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Lia Yuliati, M.Pd., (II) Dr. Muhardjito, M.S. Kata kunci: Strategi pemecahan masalah, penguasaan konsep, integral learning Strategi pemecahan masalah merupakan proses kognitif yang terjadi selama memecahkan masalah dalam penguasaan. Tujuan penelitian ini adalah untuk mengetahui strategi pemecahan masalah dan penguasaan konsep materi kalor pada pembelajaran fisika dengan integral learning. Penelitian ini menggunakan embedded design. Subjek penelitian ini terdiri atas 30 siswa. Instrumen yang digunakan ialah tes penguasaan konsep, kuis dan wawancara. Tes penguasaan konsep terdiri atas 7 butir soal uraian untuk mengetahui strategi pemecahan masalah dan penguasaan konsep siswa sebelum dan sesudah materi diberikan. Kuis terdiri atas 2 butir soal uraian materi kalor yang dilaksanakan sebanyak tiga kali. Wawancara dilaksanakan setelah pelaksanaan postes. Teknik pengumpulan data penelitian ini menggunakan sequential data collection. Data kuantitatif diperoleh dari data nilai penguasaan konsep pada pretes dan postes. Data kualitatif diperoleh dari data strategi pemecahan masalah siswa pada pretes, kuis, postes. Teknik analisis data penelitian ini mengacu pada sequential data analysis. Analisis data kuantitatif dilakukan terlebih dahulu kemudian menganalisis data kualitatif untuk memperkuat data kuantitatif. Hasil penelitian menunjukkan bahwa strategi pemecahan masalah yang siswa lakukan dalam menyelesaikan masalah pada tujuh soal penguasaan konsep materi kalor sebelum penerapan integral learning adalah mapping mathematics to meaning, physical mechanism game, pictorial analysis, dan transliteration to mathematics. Setelah penerapan integral learning, siswa melakukan mapping mathematics to meaning, physical mechanism game, recursive plug and chug, dan transliteration to mathematics. Strategi pemecahan masalah untuk menyelesaikan masalah selama penerapan integral learning pada submateri hubungan kalor dengan suhu benda dan wujudnya dilakukan siswa dengan dengan mapping mathematics to meaning, physical mechanism game, dan recursive plug and chug. Mapping meaning to mathematics, mapping mathematics to meaning, physical mechanism game, dan transliteration to mathematics dilakukan siswa dalam menyelesaikan permasalah pada submateri azas Black. Siswa menyelesaikan masalah pada submateri perpindahan kalor dengan physical mechanism game dan transliteration to mathematics. Penguasaan konsep siswa pada materi kalor mengalami peningkatan dan perubahan setelah dilakukan perlakuan berupa integral learning.

Perencanaan pengembangan profesional guru (Embedded case study pada guru SMK Negeri 1 Kota Manado, SMK Negeri 1 Kota Manado, Dinas Pendidikan Kota manado di Propinsi Sulawesi Utara) / Jenny Evelin Palunsu

 

Kata kunci: perencanaan, pengembangan profesional, guru kejuruan Perencanaan adalah salah satu komponen dalam manajemen dalam suatu organsisasi, termasuk sekolah. Pengembangan profesional guru merupakan hal yang harus direncanakan dengan baik oleh sekolah mempertimbangkan berbagai aspek. Hasil penelitian menunjukkan bahwa pengembangan profesional guru kejuruan seharusnya direncanakan secara logis dan sistematis, mengacu pada kebutuhan kuantitas maupun kualitas guru. Perencanaan pengembangan profesional guru seharusnya dilakukan oleh sekolah agar fleksibel dalam mengelola SDMnya. Sekolah dan guru perlu bekerja kolaboratif dalam menetapkan jenis pengembangan yang sesuai kebutuhan. Waktu pengembangan profesional yang dibutuhkan guru dapat disediakan sekolah. Dana pengembangan profesional juga harus disediakan. Pengembangan profesional yang berkualitas (selain pendidikan lanjut) dapat mencapai 1,8% dari total anggaran pendidikan. Keberlanjutan program pengembangan harus direncanakan didasarkan pada kebutuhan dan masukan guru. Dengan didukung berbagai fakta di lapangan serta kajian di atas telah mendorong peneliti melakukan penelitian pada Sekolah Menengah Kejuruan dan Dinas Pendidikan di Kota Manado. Perseptor penelitian ini adalah guru kejuruan produktif dan pimpinan SMK Negeri 1 Manado serta dan pimpinan Dinas Pendidikan Kota Manado. Penelitian ini bertujuan: (1) mendeskripsikan pola perencanaan aktivitas; (2) mendeskripsikan pola perencanaan waktu; (3) mendeskripsikan pola perencanaan dana; (4) mendeskripsikan pola perencanaan keberlanjutan program; (5) mendeskripsikan pola keterlibatan guru dalam perencanaan pengembangan profesional guru menggunakan mixed method dengan rancangan embedded case study dominan kualitatif. Pendekatan kuantitatif digunakan untuk menjawab rumusan masalah yakni bagaimana persepsi perseptor terhadap perencanaan pengembangan profesional guru. Data dikumpulkan menggunakan angket kepada sampel sebanyak populasi sejumlah 47 guru kejuruan produktif dan 15 orang pimpinan pada SMK Negeri 1 Kota Manado, serta 6 orang pimpinan Dinas Pendidikan Kota Manado. Analisis data menggunakan statistik deskriptif univariate. Pendekatan kualitatif digunakan untuk menjawab fokus penelitian yaitu bagaimana perencanaan pengembangan profesional guru untuk aspek aktivitas, aspek waktu, aspek dana, aspek keberlanjutan program, dan aspek keterlibatan guru dalam perencanaan. Pada tahapan awal penelitian telah ditetapkan kasus dari penelitian menggunakan The Braunswikian Lens Model dengan 3 langkah awal dari Nine Step Formative Analysis. Teknik pengumpulan data kualitatif meliputi (1) wawancara mendalam; (2) studi dokumentasi. Informan dipilih menggunakan teknik purposif sampling. Data diperiksa kredibilitas menggunakan teknik trianggulasi, member check, dan peer discussion. Analisis data dilakukan untuk masing-masing perseptor menggunakan concurrent data analysis. Embedd/transformasi dilakukan untuk hasil analisis data kuantitatif ke dalam temuan analisis data kualitatif, kemudian dilakukan analisis lintas perseptor menggunakan cross-site analysis. Kesimpulan penelitian: (1) Perencanaan Aktivitas. Pola perencanaan aktivitas pengembangan guru masih menggunakan top down policy dan belum berbasis kebutuhan pengembangan guru. Guru membutuhkan rencana aktivitas pengembangan profesional yang disusun sesuai kebutuhan serta didasarkan hasil analisis kebutuhan jurusan. Rencana aktivitas pengembangan profesional harus merupakan hasil kerjasama antara Guru, Sekolah, Dinas Pendidikan dan pihak eksternal. Hasil perencanaan aktivitas disusun dan dicantumkan pada rencana sekolah maupun Dinas Pendidikan secara jelas dan detail. Aktivitas pengembangan yang direncanakan oleh pihak eksternal harus disesuaikan dengan kebutuhan guru dan sekolah serta standar dan target kurikulum sekolah. Aktivitas pengembangan seperti pengkajian kurikulum, penataran, pelatihan dan seminar yang direncanakan oleh pihak eksternal seperti P4TK, LPMP, Dinas Pendidikan, Universitas, dll. selalu merupakan hasil koordinasi dengan Sekolah dan Dinas Pendidikan. (2) Perencanaan waktu. Pola perencanaan waktu pengembangan profesional guru belum dimiliki oleh guru, sekolah maupun Dinas Pendidikan. Kebanyakan waktu pengembangan hanya berdasarkan pada ketersediaan dari pihak eksternal dan motivasi individual guru dalam melaksanakan pengembangan diri. Sekolah belum memiliki ketetapan-ketetapan jumlah waktu pengembangan profesi yang disusun secara memadai dan seimbang oleh Sekolah, Dinas Pendidikan maupun pihak eksternal. Dinas Pendidikan dapat menetapkan prosentase waktu bagi pengembangan profesional guru misalnya 20% dari waktu kerja guru dalam setahun untuk melakukan pengembangan profesional. (3) Perencanaan dana. Pola perencanaan dana pengembangan profesional guru belum sepenuhnya dimiliki oleh guru, sekolah maupun Dinas Pendidikan. Ada beberapa ketetapan yang telah dimiliki oleh sekolah, meskipun perencanaan dana seharusnya disusun oleh guru sendiri karena juga menggunakan dana sendiri, dana sekolah, dan Dinas Pendidikan maupun dana pihak eksternal. Dalam merencanakan pendanaan pengembangan profesional guru seharusnya merupakan kerja kolaboratif guru, sekolah, Dinas Pendidikan dan pihak eksternal. Ketetapan-ketetapan pendanaan bagi kebutuhan aktivitas pengembangan profesional guru dibuat sekolah dan dirancang secara bersama melibatkan semua elemen yang ada di sekolah. Ketetapan-ketetapan pendanaan untuk menentukan besaran satuan aktivitas per orang sesuai jarak, lama waktu kegiatan dan kebutuhan yang terkait. (4) Perencanaan keberlanjutan program. Pola keberlanjutan program pengembangan profesional guru belum sepenuhnya dimiliki guru, sekolah maupun Dinas Pendidikan. Rencana pengembangan profesional guru seharusnya disusun oleh guru sendiri baik untuk jangka pendek maupun jangka panjang. Sekolah dan Dinas Pendidikan serta pihak eksternal, dalam proses perencanaan pengembangan profesional guru, selalu harus mempertimbangkan kesinambungan dan keberlanjutan serta tindak lanjut setiap program. Sekolah (termasuk jurusan-jurusan) dan Dinas Pendidikan secara terus-menerus bekerjasama dengan pihak eksternal untuk program pengembangan profesional guru khususnya pengembangan kurikulum agar terjadi kesinambungan dan tidak tumpang tindih. (5) Keterlibatan guru dalam perencanaan. Pola keterlibatan guru dalam penetapan program pengembangan profesional guru di sekolah telah ada yakni secara secara langsung maupun tidak langsung. Tetapi dalam menyusun rencana, sekolah belum sepenuhnya melibatkan semua elemen sekolah termasuk kelompok guru karena guru lebih tahu kebutuhannya. Sekolah dapat menetapkan mekanisme keterlibatan setiap elemen sekolah dalam perencanaan terutama elemen guru. Saran penelitian antara lain: kepada semua guru kejuruan produktif, manajemen SMK Negeri 1 Manado dan SMK-SMK lainnya, Dinas Pendidikan Kota Manado dan Dinas Pendidikan Kabupaten/Kota lainnya; pengembang kebijakan pendidikan; PEMDA; DPRD; Kementerian Pendidikan Nasional untuk lebih mempertimbangkan secara komprehensif dalam melakukan perencanaan pengembangan guru. Sedangkan bagi peneliti lain dan program studi manajemen pendidikan disarankan untuk melakukan perbandingan-perbandingan pemahaman dan standar profesional satu negara dengan negara lain yang dapat dijadikan bahan studi komparasi penting pada bidang manajemen.

Perencanaan motor diesel 2 tak 16 silinder
tugas akhir pilihan
oleh Eko Saptono

 

Peningkatan kinerja pegawai dalam menyelengarakan pelatihan di Balai Diklat KB Nasional Malang / Agustina Dwi Anitawati

 

Kata kunci: kinerja pegawai, penyelenggaraan pelatihan Kinerja pegawai yang berkualitas merupakan salah satu upaya untuk mencapai tujuan organisasi. Pelatihan merupakan salah satu upaya yang dilakukan untuk meningkatkan kinerja pegawai. Penyelenggaraan pelatihan membutuhkan persiapan dan kerjasama tim penyelenggara secara optimal. Fungsi manajemen dalam penyelenggaraan pelatihan sangat diperlukan untuk menunjang ketercapaian tujuan dan hasil pelatihan yang diharapkan. Adapun fungsi-fungsi manajemen yang digunakan dalam penyelenggaraan pelatihan yaitu: perencanaan, pengorganisasian, pelaksanaan, dan evaluasi. Selain peserta, penyelenggaraan pelatihan juga bermanfaat bagi tim pengajar dan penyelenggara pelatihan. Penyelenggaraan pelatihan dimulai dari kegiatan perencanaan yang matang oleh penyelenggara, pengorganisasian tugas-tugas dan sumberdaya yang dibutuhkan , pelaksanaan proses belajar-mengajar sesuai dengan prosedur pelatihan yang telah dirancang, dan evaluasi yang dilakukan secara berkala selama pelatihan. Adapun tujuan dalam penelitian ini adalah untuk mengetahui kinerja pegawai dalam: (1) perencanaan pelatihan di Balai Diklat KB Nasional Malang, (2) pengorganisasian pelatihan di Balai Diklat KB Nasional Malang, (3) pelaksanaan pelatihan di Balai Diklat KB Nasional Malang, dan (4) evaluasi pelatihan di Balai Diklat KB Nasional Malang. Penelitian ini dilakukan di Balai Diklat KB Nasional Malang yang ada di bawah naungan BKKBN Propinsi JawaTimur. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif, jenis studi kasus. Penelitian ini menggambarkan kinerja pegawai balai diklat dalam menyelenggarakan pelatihan di Balai Diklat KB Nasional Malang. Adapun metode pengumpulan data yang digunakan untuk untuk menjawab fokus penelitian yaitu observasi partisipatif, wawancara mendalam, dan dokumentasi. Temuan penelitian yang telah dilakukan yaitu: (1) perencanaan pelatihan di Balai Diklat KB Nasional Malang dimulai dari kegiatan identifikasi kebutuhan dan komponen pelatihan yang dilanjutkan dengan pembuatan desain program pelatihan yang terdiri dari bagian edukatif dan administratif, (2) pengorganisasian pelatihan yang ada di Balai Diklat KB Nasional Malang termasuk dalam organisasi lini dan staf dan organisasi fungsional, (3) pelaksanaan pelatihan terdiri dari kegiatan awal pelatihan, PBM, dan akhir pelatihan dengan metode pembelajaran dalam PBM yang ada pada pelatihan di Balai Diklat KB Nasional ii Malang menggunakan 3 jenis strategi sesuai dengan materi pelatihan yaitu strategi akademik, laboratoris, dan kegiatan, (4) evaluasi pelatihan di Balai Diklat KB Nasional Malang mengacu pada evaluasi pelaksanaan dan evaluasi penyerapan materi. evaluasi pelaksanaan terdiri 3 (tiga) tahap dari evaluasi sebelum, selama, dan akhir pelatihan, kegiatan penilaian kerja pegawai balai diklat yang dilakukan oleh pimpinan dan rekan kerja dapat memotivasi pegawai untuk bekerja lebih baik dan menunjukkan organisasi ini berusaha mencapai sasaran yang terbaik pada bidangnya sebagai penyelenggara pelatihan. Berdasarkan hasil penelitian ini disarankan kepada: (1) Kepala Balai Diklat KB Nasional Malang diharapkan dapat melakukan pembinaan dan memperhatikan penempatan pegawai sesuai dengan jabatan dan keahliannya sehingga tidak terjadi kesimpangsiuran dalam pekerjaan, (2) Pegawai Balai Diklat KB Nasional Malang diharapkan membuat jadwal kegiatan sharing/ajang curhat agar setiap pelaksanaan semua komponen yang ada bisa hadir dalam kegiatan, (3) Pengelola Jurusan Administrasi Pendidikan berdasarkan hasil penelitian ini hendaknya menjadi tambahan referensi bagi penelitian dalam ruang lingkup pendidikan non formal seperti pelatihan yang saat ini lebih kecil dari pada referensi penelitian dalam lingkup pendidikan umum, dan (4) Peneliti lain agar dapat melanjutkan penelitian yang sejenis pada berbagai aspek lain dengan latar berbeda yang nantinya dapat bermanfaat untuk diteliti.

Perencanaan konstruksi beton III
pleh Noer Handayaningsih

 

Pengembangan bahan ajar cetak muatan lokal kelas XI MAN 3 Kediri / Zulfa Husnawati

 

ABSTRAK Husnawati, Zulfa. 2015. Pengembangan Bahan Ajar Cetak Muatan LokalKelas XIMAN3 Kediri. Tesis. Program Studi TeknologiPembelajaran, PascasarjanaUniversitas Negeri Malang. Pembimbing: (I) Dr. Sulton, M.Pd, (II)Dr. Sihkabuden, M.Pd Kata kunci: Pengembangan, Bahan Ajar Cetak, Muatan Lokal Pertanian merupakan mata pelajaran muatan lokal di MAN 3 Kediri dengan karakateristik mata pelajaran yang berisi teori dan praktek. Berdasarkan karakteristik mata pelajaran, praktis mata pelajaran pertanian memerlukan media yang sesuai dan berisi teori maupun panduan praktikum. Tidak adanya bahan ajar sebagai media yang digunakan dalam pembelajaran menjadikan pembelajaran muatan lokal pertanian MAN 3 Kediri menjadi kurang optimal dan berdampak pada tidak tercapainya tujuan pembelajaran.Untuk mengatasi permasalahan tersebut, maka perlu dikembangkan bahan ajar yang sesuai dengan karakteristik siswa dan mata pelajaran. Tujuan penelitian dan pengembangan ini adalahmenghasilkan bahan ajar cetak yang sistematis, menarik, dan layak digunakan dalam pembelajaran muatan lokal pertanian MAN 3 Kediri. Model penelitian dan pengembangan yang digunakan adalah model Dick et al. (2009). Prosedur pengembangan yang dilakukan hanya sampai pada tahap evaluasi formatif. Instrumen yang digunakan adalah angket, dokumentasi, observasi, dan wawancara. Pada evaluasi formatif angket digunakan untuk mengumpulkan data review ahli isi, ahli media, ahli desain dan uji coba pada pengguna baik siswa maupun guru yang meliputi uji coba perorangan, kelompok kecil, dan lapangan. Perolehan hasil reviewpara ahli meliputi: 1) ahli isi pada bahan ajar 87,5%, panduan guru 89,58%, dan panduan siswa 90,90%, 2) ahli media terhadap bahan ajar 97,9 %, panduan guru 98%, panduan siswa 97,2%, dan 3) ahli desain terhadap bahan ajar sebesar 94,23%, panduan guru 95,83%, dan panduan siswa 93,75%. Perolehan uji coba perorangan terhadap bahan ajar sebesar 89,58%, dan panduan siswa 87,5%.Berdasarkan review para ahli dan uji coba perorangan, produk pengembangan termasuk pada kualifikasi sangat layak, dan dapat digunakan tanpa revisi. Hasil uji coba kelompok kecil pada bahan ajar sebesar 80,55 % dan panduan siswa 80 %, berdasarkan perolehan tersebut, bahan ajar cetak termasuk pada kualifikasi sangat layak, dan panduan siswa termasuk pada kategori layakdigunakan dengan revis kecil. Hasil uji coba lapangan pada bahan ajar sebesar 79,89% dan panduan siswa 74,37%, berdasarkan perolehan tersebut produk pengembangan termasuk pada kualifikasi layak digunakan dengan revisi kecil. Tanggapan guru pada bahan ajar 87,7 % dan panduan guru 86,36% sehingga produk pengembangan termasuk pada kualifikasi sangat layak. Langkah dalam pemanfaatan bahan ajar secara klasikal yaitu: 1) mempelajari materi yang akan diajarkan, 2) memastikan kesesuaian strategi pembelajaran dengan alokasi waktu yang disediakan, 3)mempersiapkan perlengkapan praktikum, 4) melakukan rangkaian kegiatan pembelajaran, 5) mencatatmateri yang belum dipahami untuk dipelajari dan didiskusikan ulang.

Perencanaan konstruksi beton bangunan gedung opera
oleh Sigit Triwibowo

 

Penerapan metode pembelajaran ekonomi dengan pendekatan problem solving untuk meningkatkan kemampuan berpikir kritis dan berprestasi belajar siswa kelas X SMA Negeri 1 Bululawang Kabupaten Malang / Agus Heri Purwanto

 

Kata Kunci: problem solving, kemampuan berpikir kritis, prestasi belajar Perkembangan ilmu dan teknologi yang begitu pesat menuntut sumber daya manusia yang memiliki keahlian dan keterampilan yang sesuai dengan kebutuhan dan tuntutan zaman sekarang. Kualitas pendidikan tidak terlepas dari peran guru sebagai pendidik dan siswa sebagai peserta didik. untuk mewujudkan suatu pendidikan yang berkualitas, maka perlu diperhatikan metode dalam mengajar dan strategi pengajaran yang akan diterapkan oleh guru kepada siswa. Salah satu metode yang digunakan yaitu problem solving dimana metode ini diharapkan mampu melatih siswa dalam menghadapi dan menyelesaikan masalah yang diberikan.Kemampuan berpikir kritis dan prestasi belajar siswa kelas X.C SMA Negeri 1 Bululawang masih rendah, siswa masih terlihat kesulitan untuk mengaitkan materi yang diperoleh di sekolah dengan masalah yang ada di sekitar mereka. Dalam hal keantusiasan belajar, siswa masih menunggu guru datang ke kelas daripada berinisiatif untuk belajar sendiri, selama guru belum hadir jarang siswa yang berdiskusi dengan teman tentang materi yang akan diajarkan atau materi yang telah lalu, kebanyakan dari mereka ramai dan hanya bercanda. Adapun sumber belajar yang dimiliki siswa hanya terbatas pada buku paket yang ada di perpustakaan dan LKS. Hal ini mengakibatkan kurangnya prestasi yang didapat oleh siswa kelas X.C SMA Negeri 1 Bululawang. Tujuan dari penelitian ini adalah mengetahui penerapan metode pembelajaran problem solving pada siswa kelas X SMA Negeri 1 Bululawang, mengetahui metode pembelajaran problem solving dapat meningkatan kemampuan berpikir kritis siswa kelas X.C SMA Negeri 1 Bululawang dan mengetahui metode pembelajaran problem solving dapat meningkatan prestasi belajar siswa kelas X.C SMA Negeri 1 Bululawang.Subyek penelitian ini adalah siswa kelas X.C SMA Negeri 1 Bululawang dengan jumalah siswa sebanyak 40 siswa diantaranya 19 siswa laki-laki dan 21 siswa perempuan Penelitian ini dilakukan di SMA Negeri 1 Bululawang, dengan alamat jalan raya bululawang pada tanggal 27 April-11 Mei 2009. Jenis penelitian yang digunakan adalah penelitian tindakan kelas dengan menggunakan pendekatan deskriptif–kualitatif dengan metode pengumpulan data menggunakan sistem observasi dan wawancara. Hasil penelitian ini menunjukkan bahwa ada peningkatan kemampuan berpikir kritis dan prestasi belajar siswa selama pemberian tindakan. pada silus I rata-rata kemampuan berpikir kristis siswa adalah diantaranya: untuk aspek merumuskan masalah rata-rata skor kelompok untuk aspek ini meningkat 35.62%. Aspek yang kedua yaitu memberikan argumen dengan rata-rata skor kelompok meningkat sebesar 23.15%. Aspek yang ketiga adalah melakukan deduksi dengan rata-rata skor kelompok meningkat sebesar 25.28%. Aspek yang keempat adalah melakukan induksi dengan rata-rata skoor kelompok meningakat sebesar 29.50%. Aspek yang kelima adalah melakukan evaluasi dengan skor kelompok meningkat sebesar 20.23%. Dan aspek yang terakhir adalah memutuskan dan melaksanakan dengan perolehan skor rata-rata kelompok mengalami peningkatan sebesar 34.69%. Setelah dilakukan perbaikan pada siklus II menunjukkan bahwa siswa yang mencapai skor 75 atau lebih, sebanyak 35 siswa dari 40 siswa. Hal ini berarti ketuntasan belajarnya tercapai yaitu sebesar 85.74%, dan hasil ini mengalami kenaikan dibandingkan pada siklus I sebesar. Pada siklus II ini ditemukan bahwa kelompok 6 memperoleh skor rata-rata tertinggi bila dibandingkan dengan kelompok lainnya yaitu sebesar 86,67%. Berdasarkan hasil penelitian ini, dapat disarankan agar dilakukan penelitian lebih lanjut tentang penelitian tindakan kelas dengan metode problem solving, bagi guru yang berminat mererapkan pembelajaran dengan metode ini harap memperhatikan pengelolaan kelas, dan bagi peneliti selanjutnya sebaiknya mencari subyek penelitian/sekolah yang belum pernah dilakukan penelitian tindakan kelas, juga bagi peneliti selanjutnya diharapkan lebih banyak menggunakan waktu yang tersedia dan tidak hanya terpaku pada dua siklus.

Perencanaan roda gigi (design of gear bax)
disusun oleh Machmud

 

Studi kondisi sosial ekonomi dan kemiskinan di Desa Serabarat Kecamatan Bluto Kabupaten Sumenep / Prayogi Puja Antara

 

Kata Kunci: Studi, Sosial, Ekonomi, Kemiskinan Desa Serabarat merupakan salah satu desa yang terletak di sebelah barat Kecamatan Bluto. Luas lahan pertanian mencapai 287,5 ha dikerjakan oleh 75% dari penduduk desa. Jumlah penduduk mencapai 1.852 jiwa terbagi menjadi 624 KK. Jumlah masyarakat miskin atau masyarakat yang mendapatkan Bantuan Langsung Tunai (BLT) sebanyak 195 KK, jumlah ini merupakan yang terbesar apabila dibandingkan dengan desa lain di Kecamatan Bluto. Penelitian ini bertujuan untuk mendeskripsikan kondisi sosial ekonomi yang ditinjau dari aspek jumlah beban tanggungan keluarga, jenis pekerjaan, luas lahan garapan, dan tingkat pendidikan. Selanjutnya mendeskripsikan tentang tingkat kemiskinan yang ada di Desa Serabarat Kecamatan Bluto Kabupaten Sumenep. Metode yang digunakan dalam penelitian ini merupakan metode survey dengan melakukan wawancara langsung. Populasi dalam penelitian ini adalah seluruh masyarakat miskin atau masyarakat penerima BLT di Desa Serabarat. Analisis data penelitian ini menggunakan analisis deskriptif untuk mendeskripsikan kondisi sosial ekonomi dan kemiskinan yang terjadi di Desa Serabarat dengan menggunakan tabel persentase. Hasil penelitian ini menunjukkan bahwa kondisi sosial ekonomi yang ditinjau dari aspek: 1) jumlah beban tanggungan keluarga pada kategori <3 sebesar 25%, 3-5 73%, dan >5 2%; 2) berdasarkan jenis pekerjaan, responden yang bekerja sebagai petani adalah 29%, buruh tani 11%, kuli bangunan 43%, pedagang 16%, lainya 1%; 3) berdasarkan luas lahan garapan, responden yang tidak memiliki lahan garapan adalah 55%, 0,01-0,24 ha 21%, 0,25-0,5 ha 19%, >0,5% 5%; 4) tingkat pendidikan responden, yang tidak pernah sekolah adalah 39%, SD/Mi 56%, SLTP 5%. Tingkat kemiskinan dalam penelitian ini dibagi menjadi 3 (tiga) yaitu paling miskin, miskin sekali, miskin. Responden yang tergolong paling miskin adalah 7% miskin sekali 39%, dan miskin 54%.

Tugas konstruksi beton III gedung pertokoan dan pertemuan lantai III
disusun oleh Soegiyanto

 

Pengaruh model inkuiri terbimbing berbantuan jurnal belajar terhadap penguasaan konsep dan ketrampilan proses IPA kelas VII di SMP Negeri 2 Passi Kabupaten Bolaang Mongondow / Rahman Laoh

 

ABSTRAK Laoh,Rahman. 2015. Pengaruh Model Inkuiri Terbimbing berbantuan Jurnal Belajar terhadap Penguasaan Konsep dan Keterampilan Proses IPA Kelas VII Di SMP Negeri 2 Passi Kabupaten Bolaang Mongondow. Tesis, Program Pascasarjana, Program Studi Pendidikan Dasar IPA. Universitas Negeri Malang. Pembimbing (I) Dr. Ibrohim, M.Si, (II) Dra. Sri Rahayu, M.Ed, Ph.D Kata kunci : Model inkuiri Terbimbing, Jurnal Belajar, Penguasaan konsep, keterampilan proses IPA. Salah satu upaya pembenahan pendidikan di Indonesia adalah dengan dikembangkannya Kurikulum 2013 dimana kurikulum ini lebih menekankan pada pengembangan kompetensi pengetahuan, keterampilan dan sikap. Salah satu hal yang terdapat dalam kurikulum 2013 adalah bagaimana guru dapat mengembangkan strategi pembelajaran di dalam kelas. Beberapa strategi telah dilakukan namun penguasaan konsep dan keterampilan proses IPA masih tergolong rendah.Tujuan penelitian ini adalah untuk mengetahui perbedaan penguasaan konsep dan keterampilan proses IPA siswa pada pembelajaran dengan menggunakan model inkuiri terbimbing berbantuan jurnal belajar. Penelitian ini merupakan penelitian eksperimen semu di mana desain penelitiannya adalah postest only control group design. Teknik sampling yang digunakan adalah Cluster sampling. Sampel penelitian ini terdiri dari dua kelas dengan populasi kelas VII SMP Negeri 2 Passi, Kabupaten Bolaang Mongondow. Data penelitianiniadalahhasilpostestpenguasaankonsepdan data observasiketerampilan proses IPA. Hasil penelitian menunjukan bahwa ada perbedaan yang signifikan dalampenguasaan konsep dan keterampilan proses IPA pada pembelajaran dengan menggunakan model inkuiri terbimbing berbantuan jurnal belajar dibandingkan dengan pembelajaran model inkuiri terbimbing. Hasil uji –t untuk penguasaan konsep menunjukan nilai t hitung 2,256. Nilai ini lebih tinggi dari nilai dari taraf nyata α 0,05 dengan nilai 2,002. Demikian juga untuk uji-t pada keterampilan proses sains didapatkan nilai t hitung 2,548. Nilai tersebutlebih tinggi dari nilai taraf nyata α 0,05 dengan nilai 2,002.Berdasarkanhasiltemuandapatdisimpulkanpenguasaankonsepdanketerampilan proses IPA siswadenganpembelajaraninkuiriterbimbingberbantuanjurnalbelajarlebihtinggidibandingkandenganpembelajaran model inkuiriterbimbing, danhasilpenelitianinidapatdigunakandalam proses pembelajaran.

Kajian tentang kualitas mikrobiologi air minum berdasarkan lama penyimpanan dan pemakaian alat simpan yang berbeda ditinjau dari nilai MPN coliform / Binti Istianah

 

Kata kunci: air minum, lama penyimpanan, alat simpan, Nilai MPN Coliform. Air merupakan zat yang mutlak bagi setiap mahluk hidup, dan kebersihan air merupakan syarat utama bagi terjaminnya kesehatan. Manusia membutuhkan air yang bersih untuk kelangsungan hidupnya. Di lain pihak, air yang tersedia sering tidak memenuhi syarat baik kualitas maupun kuantitasnya. Sebelum dikonsumsi atau diminum, air sebaiknya dimasak terlebih dahulu, hal ini bertujuan untuk membunuh mikroorganisme yang ada dalam air. Menurut kebiasaan masyarakat air yang telah dimasak selanjutnya dimasukkan dalam alat simpan untuk mempermudah mengkonsumsi dan menyimpan air agar tahan lama. Beberapa macam alat simpan air minum yang biasa digunakan oleh masyarakat, ialah: wadah plastik, kendi dan ceret alumunium. Lama waktu penyimpanan air minum juga bervariasi. Bakteri kontaminan dapat mencemari air minum yang disimpan sehingga tidak layak dikonsumsi. Tujuan dari penelitian ini ialah; untuk mengetahui kualitas mkrobiologi air minum berdasarkan lama penyimpanan dan pemakaian tiga macam alat simpan air minum yang berbeda ditinjau dari Nilai MPN bakteri Coliform. Jenis penelitian ini ialah deskriptif observasional dengan 12 perlakuan dan 3 ulangan. Variabel bebas pada penelitian ini adalah lama penyimpanan air minum, yaitu 0 hari, 1 hari, 2 hari dan 3 hari; dan pemakaian 3 macam alat simpan air minum yang berbeda, yaitu wadah plastik, kendi dan ceret alumunium. Variabel terikat ialah kualitas mikrobiologi air minum berdasarkan Nilai MPN bakteri Coliform. Sampel air minum diperoleh dari air sumur yang berasal dari rumah di jalan Sumbersari Malang, yang telah direbus sampai mendidih, dibiarkan sampai dingin, lalu dimasukkan ke dalam alat simpan air minum. Penelitian dilaksanakan di Laboratorium Mikrobiologi Jurusan Biologi FMIPA Universitas Negeri Malang, mulai bulan Januari sampai April 2010. Data Nilai MPN (Most Probable Number) Coliform dianalisis secara deskriptif dan dirujukkan pada standar dari SK DIRJEN POM No.03726/B/SK/VII/89, yaitu batas maksimal nilai MPN Coliform air minum ialah < 3 sel/mL untuk penentuan kelayakan konsumsi. Hasil penelitian menunjukkan bahwa kualitas mikrobiologi air minum terbaik ialah air minum yang disimpan dalam wadah plastik dengan nilai MPN Coliform 4,7 sel/mL dengan batas penyimpanan maksimal 2 hari, diikuti dengan air minum yang disimpan dalam ceret alumunium dengan nilai MPN Coliform sebesar 6,4 sel/mL dengan batas penyimpanan maksimal 2 hari, dan yang paling buruk ialah air yang disimpan dalam kendi dengan nilai MPN Coliform terbesar, yaitu > 83,34 sel/mL dengan batas penyimpanan maksimal 1 hari.

Perhitungan konstruksi beton perencanaan bangunan perpustakaan
Marsiswanto

 

The mastery of vocabulary items outlined in the 1994 curriculum of the first year students at SMU Bhaktiyasa Singaraja-Bali / by Ni Komang Baruni

 

Rancang bangun sistem pengukuran dielektrik pada suhu rendah berbasis labview / Imam Mukti Hardriyatono

 

ABSTRAK Mukti. H, Imam. 2012. Rancang Bangun Sistem Pengukuran Dielektrik Pada suhu Rendah Berbasis LabView. Skripsi, Program Studi Fisika, Jurusan Fisika, Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing: (I) Nandang Mufti, S.Si, M.T., Ph.D, (II) Drs. Yudyanto, M.Si. Kata Kunci : Dielektrik, Suhu Rendah, LabView. Pada era modern sekarang ini perkembangan dunia penelitian fisika sangat pesat yaitu dengan dilakukannya pengujian-pengujian karakteristik materi yang kemudian mampu diaplikasikan dan memudahkan kehidupan manusia. Salah satunya adalah pengujian sifat dielektrik, pengujian ini sangat bermanfaat karena dapat mengetahui karakteristik suatu bahan yang memiliki daya hantar arus sangat kecil atau bahkan hampir tidak ada. Pengukuran dielektrisitas sangat diperlukan untuk untuk mengetahui karakteristik sifat bahan khususnya pada bahan semikonduktor yang memiliki fase berbeda pada rentang suhu yang berbeda. Rancang bangun sistem pengukuran dielektrik pada suhu rendah berbasis Labview dibuat untuk mempermudah pengukuran besaran fisis nilai dielektrik bahan. Rancang bangun sistem pengukuran ini menggunakan set up holder sample dari tembaga dan teflon serta menggunakan metode two probe. Sementara untuk mengukur kapasitansi menggunakan Motech MT4090. Sebagai parameter temperatur, dalam rancang bangun alat ini digunakan sensor suhu Kitley 6178b . Data hasil proses dari Kitley dan two probe point diproses dan ditampilkan sehingga membentuk grafik hubungan dielektrik dengan suhu. Kalibrasi menggunakan Sensor 51 K/J Themokopel dan datasheet. Hasil rancang bangun sistem pengukuran dielektrik dengan suhu rendah berbasis Labview menunjukkan hasil dengan bahan Si didapatkan nilai dielektrik sebesar 15 pada suhu 283 K dan nilai dielektrik 9 pada suhu 155 K.

Pengembangan buku digital berbasis penelitian analisis aktivitas fosforilasi protein membran sperma sapi untuk matakuliah bioteknologi S1 Biologi Universitas Negeri Malang / Dewi Sagita

 

ABSTRAK Sagita, Dewi. 2015. Pengembangan Buku Digital Berbasis Penelitian Analisis Aktivitas Fosforilasi Protein Membran Sperma Sapi untuk Matakuliah Bioteknologi S1 Biologi Universitas Negeri Malang. Tesis, Pascasarjana, Program Studi Pendidikan Biologi, Universitas Negeri Malang. Pembimbing: (1) Dr. Umie Lestari, M.Si., (2) Dr. Murni Sapta Sari, M. Si. Kata Kunci: buku digital, protein membran sperma sapi, aktivitas fosforilasi Pengembangan buku digital berbasis penelitian aktivitas fosforilasi protein membran sperma sapi, diharapkan dapat memberikan pengalaman belajar lebih dari sekedar mengetahui teori teknik dalam Bioteknologi, sehingga dapat mendorong mahasiswa untuk mengaplikasikan ilmu yang diperoleh. Penelitian ini bertujuan untuk mengembangkan buku digital teknik analisis fosforilasi protein membran sperma sapi untuk matakuliah Bioteknologi S1 jurusan Biologi UM yang telah tervalidasi dan untuk mengetahui aktivitas fosforilasi protein membran sperma sapi Bali dan sapi Madura. Pengembangan buku digital berbasis penelitian aktivitas fosforilasi protein membran sperma sapi ini, dirancang berdasarkan model pengembangan Borg (1981), tetapi model pengembangan pada penelitian ini hanya dilakukan sampai tahap kelima. Tahapan pengembangan pada penelitian ini adalah penelitian pendahuluan, perencanaan, pengembangan bentuk produk awal, uji coba lapangan tahap awal, revisi produk utama. Berdasarkan hasil analisis data dari validator ahli media yang telah dilakukan, diketahui bahwa tampilan bagian pembuka (cover) mendapatkan nilai 85.71%. Pada tampilan Bab I, mendapatkan nilai 95.83%. Pada tampilan Bab II, mendapatkan nilai 91.67%. Bab III mendapatkan penilaian sebesar 91.67% dan Bab IV mendapatkan penilaian 89.29%. Namun, pada aspek penilaian terakhir yakni aspek secara keseluruhan, mendapatkan nilai 60%. Validator media berpendapat bahwa buku digital yang dikembangkan kurang interaktif. Oleh karena itu, validator ahli media menyarankan agar dibuat beberapa hyperlink seperti pada daftar isi ataupun pada istilah-istilah yang berhubungan dengan materi di bab lain. Berdasarkan hasil analisis data dari validator ahli materi yang telah dilakukan, diketahui bahwa pada Bab I Pengenalan Bioteknologi mendapatkan nilai sebesar 95.83%. Bab II Membran Sel dan Bab III Sperma, mendapatkan nilai sebesar 91.67%. Bab IV Metode Standar dalam Bioteknologi mendapatkan nilai 100%. Berdasarkan hasil analisis data dari responden, diketahui bahwa pada aspek bahan penarik perhatian mendapatkan rata-rata penilaian sebesar 93.75%. Pada aspek penyajian materi, mendapatkan rata-rata penilaian 97.92%. Menurut responden, media ini memudahkan dan dapat meningkatkan motivasi belajar, yang dibuktikan dengan rata-rata penilaian pada aspek ini sebesar 97.92%. Buku digital ini dikembangkan berdasarkan hasil penelitian aktivitas fosforilasi protein membran sperma sapi Bali dan sapi Madura. Buku digital ini, diharapkan dapat mengembangkan kemampuan mahasiswa dalam menerapkan bioteknologi dalam kehidupan sehari, karena di dalam buku digital ini memuat penerapan teknik dalam bioteknologi untuk mengalisis kualitas sperma sapi secara molekuler. Analisis kualitas sperma sangat penting dilakukan untuk keberhasilan inseminasi buatan. Selama ini, kualitas sperma pada Balai Besar Inseminasi Buatan (BBIB) masih dilihat berdasarkan konsentrasi, motilitas progresif, viabilitas, dan abnormalitas sperma. Analisis secara molekuler untuk mengetahui kualitas sperma dapat dilakukan karena banyak jenis protein yang terlibat dalam fisiologis sperma. Berdasarkan penelitian aktifitas fosforilasi protein membran, jumlah ATP yang bereaksi ketika diinkubasi dengan protein membran sapi Bali dan sapi Madura 35kDa, menunjukkan hasil yang berbeda. Pada sapi Bali, jumlah ATP yang bereaksi sebesar 169.5 µg/ml dengan unit aktivitas protein membran 35 kDa sebesar 0.492017417 µmol/ml.menit. Sedangkan pada sapi Madura, jumlah ATP yang bereaksi sebesar 165.83 µg/ml dengan unit aktivitas protein membran 35 kDa sebesar 0.481373972 µmol/ml.menit. Hal tersebut menunjukkan bahwa setiap spesies dapat memiliki unit aktivitas protein yang berbeda meskipun dengan berat molekul yang sama. Pada akhir penelitian ini dihasilkan produk berupa buku digital berbasis penelitian penelitian aktivitas fosforilasi protein membran sperma sapi, yang dinyatakan layak dan dapat menjadi buku penunjang untuk matakuliah Bioteknologi.

Laporan perhitungan tugas pengairan
oleh Mudjari

 

Penerapan model siklus belajar 5E berbantuan concept map untuk meningkatkan kemampuan penguasaan konsep dan berpikir kritis siswa pada materi IPA kelas VIII SMP Negeri 6 Halmahera Barat / Nurlaila Djiad

 

ABSTRAK Djiad, Nurlaila. 2015. Penerapan Model siklus belajar 5E Berbantuan Concept Map untuk Meningkatkan Kemampuan Penguasaan Konsep dan Berpikir Kritis Siswa Pada Materi IPA Kelas VIII SMP Negeri 6 Halmahera Barat. Tesis. Program Studi Pendidikan Dasar Konsentrasi Pendidikan IPA SMP,Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Muhardjito, M.S (II) Dr. Susriyati Mahanal, M.Pd Kata Kunci: siklus belajar 5E,concept map, penguasaan konsep, berpikir kritis Penelitian ini merupakan penelitian tindakan kelas (PTK) yang tujuannya adalah mengetahui (1) bagaimana keterlaksanaan proses pembelajaran dengan model siklus belajar 5E berbatuan concept map, (2)penerapan siklus belajar 5E berbantuan concep mapdapat meningkatkan kemampuan penguasaan konsep dan berpikir kritsi siswa pada materi IPA dan (3) tanggapan siswa terhadap model siklus belajar 5E berbantuan concept map. Kemampuan penguasaan konsep IPA yang diukur mengacu pada taxsonomi Bloom yaitu penguasan konsep mencakup mengingat (C1), memahami (C2), mengaplikasikan (C3), menganalisis (C4), mengevaluasi (C5), dan mencipta (C6). Kemampuan berpikir kritis siswa diukur dengan indikator berpikir kritis meliputi, berpikir analitis (pengambilan keputusan), kemampuan bernalar dalam berpikir analisis induktif dan deduktif, mengunakan konsep dan prinsip untuk menjelaskan berbagai peristiwa dan menyelesaikan masalah baik secara kualitatif serta kuantitatif dilancutkan dengan pengecekan data melalui triangulasi data. Penelitian ini menggunakan model Kemmis dan McTaggart.Subjek yang diteliti adalah siswa kelas VIII SMP Negeri 6 Halmahera Barat dengan jumlah siswa 22.Penelitian dilaksanakan sebanyak 2 siklus, setiap siklus terdiri atas empat tahapan yaitu perencanaan, tindakan, pengamatan, dan refleksi. Instrumen yang digunakan dalam penelitian ini terdiri atas lembar observasi keterlaksanaan pembelajaran model siklus belajar 5Eberbantuan concept map, soal tes yang mengukur kemampuan penguasaan konsep dan berpikir kritis siswa. Analisis data yang digunakan adalah analisis data kuantitatif yang meliputi keterlaksanaa pembelajaran, tes akhir siklus untuk penguasaan konsep dan kemampuan berpikir kritis, penilaian concept map dan respon siswa terhadap model siklus belajar 5E berbantuan concept map pada materi IPAdan data kualitatif yang meliputireduksi data, penyajian data, penarikan kesimpulan dan catatan lapangan. Hasil penelitian menunjukkan bahwaketerlaksanaan pembelajaran berdasarkan hasil observasi guru telah menjalankan sintaks pembelajaran yang sesuai dengan rancangan dalam RPP,secara garis besar hasil observasi kegiatan siswa menunjukan bahwa siswa telah dapat mengikuti kegiatan pembelajaran dengan efektif atau baik dan sesuai dengan sintaks yang diharapkan.Penerapan pembelajaran model siklus belajar 5Eberbantuan concep mapdapat meningkatkan kemampuan penguasaan konsep dan berpikir kritis siswa SMP Negeri 6 Halmahera Barat. Proses pembelajaran yang terdiri dari 5 tahapan atau fasedengan menggunakan bantuan concept map setelah faseengagement yaitu pada faseexploration,fase explanation,fase elaborationdan faseevaluation.Persentase kemampuan penguasaan konsep siswa yang berhasil dicapai pada tes akhir siklus II adalah sebesar 67,32% mencapai lebih dari KKM dan kemampuan berpikir kritis sebesar 80% mencapai kategori kritis. Tanggapan siswa berdasarkan data angket respon siswapada pembelajaran IPA dengan penerapan model belajar siklus 5E berbantuan concept mapsangat positif.

Efektifitas program pemerintah dalam upaya penertiban kebersihan dan keindahan kota (tudi kasus: keberadaan gelandangan dan pengemis di Kota Malang) / Ricki Amanto

 

Kata Kunci : Efektifitas, Program, Pemerintah, Gelandangan, Pengemis Pemerintah daerah kota Malang, selalu berusaha untuk menciptakan keindahan dan kebersihan kota sebaik dan semaksimal mungkin, hal tersebut dilakukan untuk menciptakan nama baik dan eksistensi keindahan dan kebersihan wilayah kota. Banyak hal yang dilakukan oleh pemerintah daerah untuk mencanangkan program-program mengenai keindahan dan kebersihan kota, dalam hal ini pemerintah kota Malang khususnya yang menyandang predikat sebagai kota pendidikan, pariwisata, dan industri secara terus-menerus melakukan inovasi-inovasi dalam meningkatkan keindahan dan kebersihan kota, keberadaan gelandangan dan pengemis merupakan salah satu faktor yang dapat berpengaruh terhadap eksistensi kebersihan dan keindahan kota, hal tersebut disebabkan pola hidup mereka yang menyimpang dari norma-norma yang berlaku di masyarakat, hal tersebut dapat dilihat dari kharakteristik umum dan pribadi gelandangan dan pengemis, sehingga keberadaanya membuat resah pemerintah setempat dan masyarakat di sekitarnya karena mereka mendirikan bangunan dan rumah-rumah kumuh di bantaran kali, kolong jembatan, dan pemakaman umum, terminal, pasar dan tempat umum lainnya, sehingga dapat mengganggu eksistensi keindahan dan kebersihan kota. Adapun tujuan penelitian dalam skripsi ini adalah : (1) Untuk mendeskripsikan karakteristik gelandangan dan pengemis di kota Malang, (2) Untuk mendeskripsikan faktor-faktor yang melatar belakangi gelandangan dan pengemis untuk menekuni profesi tersebut, (3) Untuk mendeskripsikan kebijakan pemerintah kota Malang dalam menanggulangi keberadaan gelandangan dan pengemis,(4) Untuk mendeskripsikan efektifitas pelaksanaan program pemerintah kota Malang dalam menanggulangi dan memebina gelandangan dan pengemis. Penelitian tentang efektifitas program pemerintah kota Malang dalam upaya penertiban kebersihan dan keindahan kota, menggunakan pendekatan deskriptif kualitatif, yaitu pendekatan yang mengarah pada metode deskriptif, sehingga prosedur penelitian dalam metode ini menggunakan pengamatan terhadap gejala-gejala dan peristiwa dari kondisi aktual dimasa sekarang, dan teknik pengumpulan data dalam penelitian ini adalah (1) Observasi, (2) Wawancara, (3) Dokumentasi, sedangkan teknik analisis data dalam penelitian ini adalah : (1) Mengorganisasikan data, (2) Memberi kode, (3) Penyajian data, (4) Mencari penjelasan alternatif. Untuk pengecekan keabsahan data peneliti menggunakan teknik ketekunan pengamatan dan triangulasi. Adapun hasil penelitian dalam skripsi ini adalah mengenai kebijakan pemerintah kota dalam menangani gelandangan dan pengemis, telah dilakukan dengan berbagai cara, ii antara lain : pemerintah kota Malang mengeluarkan kebijakan berupa Perda No. 05 Tahun 2001 yang bertujuan untuk mengatur ketertiban dan kebersihan kota, tetapi perda tersebut tidak mengatur secara khusus mengenai keberadaan gelandangan dan pengemis, Perda tersebut masih bersifat umum, dengan alasan masalah gelandangan dan pengemis masih dapat teratasi dan belum memberikan ancaman dalam skala besar terhadap eksisitensi kebersihan dan keindahan kota, selain itu pemerintah kota Malang juga mengeluarkan Surat Keputusan Walikota Malang No. 367 Tahun 2005, tentang komite penanganan masalah kesejahteraan sosial, yaitu dengan cara memberikan pembinaan, rehabilitasi dan juga mereka dididik dan dibekali keterampilan-keterampilan khusus untuk membantu mereka dalam mencari penghasilan, namun dalam pelaksanaan program-program tersebut membutuhkan dana yang cukup besar, hal tersebut merupakan kendala utama dalam penanggulangan para gelandangan dan pengemis di kota Malang, sehingga pelaksaanan program-program tersebut tidak berjalan secara maksimal, untuk itu serangkaian program-program yang dijalankan oleh pemerintah daerah kota Malang dalam upaya penertiban gelandangan dan pengemis tidak berjalan secara efektif. Dengan tolak ukur bahwa target dan sasaran dari program-program tersebut tidak maksimal, hal tersebut terbukti dengan jumlah gelandangan dan pengemis dari tahun 2006 sampai dengan tahun 2009 terus mengalami perkembangan yaitu pada tahun 2006 berjumlah 277 orang; 2007 berjumlah 320 orang; tahun 2008 berjumlah 378 orang; tahun 2009 berjumlah 391 orang dan tahun 2010 berjumlah 431 orang. tidak adanya penurunan jumlah gelandangan dan pengemis secara signifikan, walapun program-program tersebut sudah di implementasikan. Peneliti menyarankan kepada pemerintah kota Malang agar membuat Perda khusus dalam menangani gelandangan dan pengemis, selain itu bagi petugas Satuan Polisi Pamong Praja diharapkan melakukan operasi secara rutin dan berkala agar target yang diinginkan dapat tercapai, dan bagi Disnakersos kota Malang diharapakan membuat program-program yang sesuai dengan karakteristik gelandangan dan pengemis di kota Malang, serta membentuk adanya kerjasama dengan pihak-pihak swasta dalam upaya menangani masalah keterbatasan dana dalam pembinaan terhadap keberadaan gelandangan dan pengemis.

Gear box
tugas akhir pilihan
Didik Budiono

 

Studi kasus pembelajaran biologi pada kelas XI Program Akselerasi di SMA Negeri 1 Malang / Hendi Yuniar Eka Pratiwi

 

ABSTRAK Pratiwi, Hendi Y.E. 2010. Studi Kasus Pembelajaran Biologi pada Kelas XI Kata kunci: Pembelajaran Biologi, Program Akselerasi Program percepatan belajar adalah program layanan pendidikan sesuai dengan potensi kecerdasan dan bakat istimewa yang dimiliki oleh siswa dengan memberikan kesempatan kepada siswa untuk dapat menyelesaikan program reguler dalam jangka waktu yang lebih singkat dibanding teman lainnya. Sejak program ini digulirkan sampai ketika Pemerintah memfasilitasi upaya kajian dan pengembangan lebih lanjut, penyelenggaraan program ini masih menuai banyak pro dan kontra. Akselerasi (percepatan belajar) harus didasari dengan paradigma bahwa siswa seharusnya berkembang secara alami, seperti halnya pembelajaran Biologi yang seharusnya dilaksanakan dengan metode untuk belajar sains yang tertuang dalam Permendiknas No 22 Tahun 2006 tentang Standar Isi untuk Satuan Pendidikan Dasar dan Menengah. Dengan demikian perlu adanya pengkajian lebih mendalam mengenai pembelajaran Biologi pada program akselerasi agar dapat berjalan baik dan memberikan keuntungan kepada siswa berkecerdasan dan berbakat istimewa. Penelitian ini bertujuan untuk mengetahui (1) Sistem penyelenggaraan program akselerasi yang dijalankan pada kelas XI program akselerasi di SMA Negeri 1 Malang, (2) Perencanaan pembelajaran Biologi pada kelas XI program akselerasi di SMA Negeri 1 Malang, (3) Pelaksanaan pembelajaran Biologi pada kelas XI program akselerasi di SMA Negeri 1 Malang, (4) Hasil belajar Biologi siswa kelas XI program akselerasi di SMA Negeri 1 Malang. Data penelitian ini diperoleh dari Ketua Program Akselerasi SMA Negeri 1 Malang, dokumen perangkat pembelajaran program akselerasi, proses belajar mengajar di kelas akselerasi, guru dan siswa akselerasi SMA Negeri 1 Malang yang dikumpulkan melalui metode wawancara, observasi, dokumentasi dan angket. Dari hasil penelitian diketahui bahwa (1) komponen yang mendukung sistem penyelenggaraan program akselerasi di SMA Negeri 1 Malang membentuk program akselerasi di SMA Negeri 1 Malang lebih mengarah pada kelas unggulan yang terjadi percepatan secara klasikal (percepatan kelas), (2) silabus program akselerasi kelas XI SMA Negeri 1 Malang hanya menerapkan 11 karakteristik pembelajaran Biologi yang tertuang dalam Permendiknas No 22 Tahun 2006 Tentang Standar Isi untuk Pendidikan Dasar dan Menengah dengan persentase penerapan kurang dari 40% dan termasuk dalam kategori rendah. Pembelajaran yang direncanakan dalam silabus berorientasi pada buku teks (textbook-oriented) dalam upaya menyelesaikan bahan pembelajaran dalam waktu yang singkat sehingga kurang memberikan pengalaman atau praktik yang memungkinkan terjadinya belajar bagi siswa akselerasi. RPP program akselerasi kelas XI SMA ii Negeri 1 Malang sudah menerapkan 12 karakteristik pembelajaran Biologi yang tertuang dalam Permendiknas No 22 Tahun 2006 Tentang Standar Isi untuk Pendidikan Dasar dan Menengah. Sebanyak 10 karakteristik pembelajaran Biologi di antaranya perlu ditingkatkan penerapannya karena termasuk dalam kategori penerapan rendah (kurang dari 40%) dengan pembelajaran Biologi yang berorientasi pada buku teks (textbook-oriented), (3) Pelaksanaan pembelajaran Biologi pada semester ganjil kelas XI program akselerasi di SMA Negeri 1 Malang hanya menerapkan delapan karakteristik pembelajaran Biologi yang tertuang dalam Permendiknas No 22 Tahun 2006 Tentang Standar Isi untuk Pendidikan Dasar dan Menengah dengan tiga karakteristik pembelajaran Biologi di antaranya termasuk dalam kategori penerapan yang rendah, empat karakteristik pembelajaran Biologi lain termasuk kategori penerapan yang kurang dan satu karakteristik pembelajaran Biologi termasuk kategori penerapan cukup. Guru lebih banyak sebagai pusat informasi (teacher centered) sehingga aktivitas siswa di dalam kelas berkurang karena siswa lebih banyak mendengarkan penjelasan guru untuk memperoleh materi dari media power point yang bersumber dari buku teks, (4) hasil belajar kognitif yang diharapkan dimiliki oleh siswa akselerasi paling banyak ialah belajar informasi melalui kemampuan mengingat (C1). Program akselerasi di SMA Negeri 1 Malang belum menerapkan pendekatan belajar tuntas (mastery learning approach).

Perencanaan gear box
disusun oleh Imam Ghozali

 

Peningkatan kemampuan menulis laporan pengamatan melalui model jigsaw pada kelas V SDN Sumberanyar 1 Kecamatan Nguling Kabupaten Pasuruan / Yede Labetubun

 

Kata Kunci : Kemampuan, Menulis Laporan, Pengamatan, Model Jigsaw, SD Sekolah sebagai lembaga pendidikan bertujuan membentuk sumber daya manusia yang berkualitas. Dengan pembelajaran bahasa Indonesia di Sekolah Dasar (SD) tentu akan meningkatkan kemampuan siswa pada aspek menulis yang dikhususkan dalam menulis laporan pengamatan karena dalam kehidupan sehari-hari sebagian besar manusia melakukan komunikasi atau melaporkan suatu kejadian menggunakan bahasa tulis. Bahasa tulis juga merupakan sarana penghubung secara formal dalam suatu instansi maupun lembaga (pendidikan) karena bahasa tulis mudah dimengerti dan lebih jelas isi dan pemaparannya, sehingga betapa pentingnya kita untuk mempelajari bahasa tulis khususnya dalam menulis laporan pengamatan. Untuk meningkatkan kemampuan siswa dalam menulis laporan pengamatan, model yang tepat merupakan alternatif terbaik sehingga seorang siswa mampu mengeluarkan semua potensi dalam dirinya, kerap kali siswa cenderung lebih banyak menampilkan idenya secara lisan dari pada tulisan. Oleh karena itu tujuan dari penelitian ini adalah melakukan Peningkatan kemampuan menulis laporan pengamatan melalui model Jigsaw dikelas V SDN Sumberanyar I kecamatan Nguling kabupaten Pasuruan. Rencana penelitian dengan menggunakan, jenis penelitian tindakan kelas (PTK). Subjek penelitian adalah siswa kelas V SDN Sumberanyar I kecamatan Nguling kabupaten Pasuruan yang berjumlah 22 siswa. Teknik pengumpulan data menggunakan observasi, tes, wawancara, dan dokumentasi selama proses pembelajaran. Penelitian ini dilaksanakan sebanyak dua siklus melalui tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Hasil yang diperoleh pada siklus I dan II memiliki peningkatan yang sangat menonjol dari hasil belajar siswa. Dinilai pada proses pembelajaran pada pra tindakan, tindakan siklus I dan tindakan siklus II dengan nilai rata-rata kelas sebagai berikut. Nilai Pra tindakan 53,18 nilai tindakan siklus I adalah 56,2, dan nilai tindakan siklus II ialah 69,16. Hasil penelitian menunjukan adanya peningkatan hasil belajar siswa dengan penerapan model Jigsaw dalam pembelajaran bahasa Indonesia dengan materi mengungkapkan pikiran, perasaan, informasi, dan fakta secara tertulis dalam bentuk ringkasan, laporan, dan puisi bebas pada tindakan siklus I dan siklus II mengalami peningkatan 12,96%. Berdasarkan hasil penelitian dapat disimpulkan bahwa penggunaan model Jigsaw dapat meningkatkan kemampuan menulis laporan pengamatan pada siswa kelas V SDN Sumberanyar I kecamatan Nguling kabupaten Pasuruan. Oleh karena itu disarankan bagi guru dan pihak sekolah agar menggunakan model Jigsaw untuk meningkatkan kemampuan menulis laporangan pengamatan di Sekolah Dasar (SD).

Perencanaan gear box
disusun olehGandung Supriyadi

 

Perencanaan konstruksi beton gedung perkuliahan
oleh Mochammad Lazim

 

Pengaruh tingkat kesejahteraan guru, komitmen terhadap profesi, keaktifan dalam MGMP dan persepsi iklim akademik sekolah terhadap kreativitas guru ekonomi di SMA se Kota Malang / Lailatul Rofiah

 

ABSTRAK Rofiah, Lailatul. 2015. Pengaruh Tingkat Kesejahteraan Guru, Komitmen terhadap Profesi, Keaktifan dalam MGMP, dan Persepsi Iklim Akademik Sekolah terhadap Kreativitas Guru Ekonomi SMA se-Kota Malang. TesisJurusan Pendidikan EkonomiPascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Hari Wahyono, M.Pd, (2) Prof. Dr. Wahyoedi. M. Pd., M. E Kata Kunci: Tingkat Kesejahteraan, Komitmen, Keaktifan MGMP, Persepsi Iklim Akademik Sekolah, Kreativitas Guru Guru adalah aktor utama dalam meningkatkan kualitas atau mutu pendidikan. Guru yang profesional adalah guru yang berkomitmen tinggi terhadap pekerjaannya sebagai pendidik. Melalui komitmen yang tinggi maka guru akan lebih tanggung jawab terhadap tugas dan pekerjaanya dan juga akan meningkatkan kualitas diri yang lebih kreatif. Kualitas diri yang kreatif bagi seorang guru dapat diperoleh dari keaktifan dalam mengikuti MGMP. Kenyaman guru terhadap lingkungannya dan juga tingkat kesejahteraan yang diberikan sekolah juga memberikan peranan penting untuk meningkatkan kreatifitas guru. Dengan demikian tidak hanya peran guru itu sendiri untuk meningkatkan kreatifitas tetapi juga dibutuhkan peran sekolah maupun kepala sekolah untuk mendukung dalam peningkatan kreatifitas seorang guru. Penelitian ini bertujuan untuk menjelasan: (1) pengaruh tingkat kesejahteraan guru terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (2) pengaruh komitmen terhadap profesi terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (3) pengaruh keaktifan dalam MGMP terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (4) pengaruh persepsi iklim akademik sekolah terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (5) pengaruh tingkat kesejahteraan guru, komitmen terhadap profesi, keaktifan dalam MGMP, dan persepsi iklim akademik sekolah terhadap kreatifitas guru ekonomi di SMA se-Kota Malang. Penelitian ini dirancang sebagai penelitian eksplanatori. Populasi dalam penelitian sebanyak 105 guru ekonomi. Sampel dipilih dengan menggunakan teknik random sampling. Data dikumpulkan dengan instrumen berupa kuesioner. Teknik analisis data yang digunakan adalah analisis regresi linier berganda. Hasil penelitian dapat dipaparkan sebagai berikut: (1) tingkat kesejahteraan guru berpengaruh positif yang signifikan terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (2) komitmen terhadap profesi berpengaruh negatif yang signifikan terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (3) keaktifan dalam MGMPberpengaruh negatif yang signifikan terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (4) persepsi iklim akademik sekolahberpengaruh positif yang signifikan terhadap kreatifitas guru ekonomi di SMA se-Kota Malang, (5) tingkat kesejahteraan guru, komitmen terhadap profesi, keaktifan dalam MGMP, dan persepsi iklim akademik sekolahbersama-sama berpengaruh secara signifikan terhadap kreatifitas guru ekonomi di SMA se-Kota Malang. Terkait dengan penelitian ini maka disarankan agar: dinas pendidikan memperhatikan tingkat kesejahteraan guru, mengontrol dan mengevaluasi kegiatan MGMP ekonomi,guru sebaiknya mengembangkan pengetahuan dan potensi dirinya untuk meningkatkan kreatifitasnya dan juga kepala sekolah sebaiknya membuat birokrasi sekolah yang tidak terlalu kaku.

Penggunaan media powerpoint dalam peningkatan prestasi belajar siswa pada pelajaran muatan lokal tata busana di SMP Maarif NU Pandaan (studi pada siswa kelas VIII) / Wahyuning Kurnia Rizki

 

Kata Kunci: Penggunaan Media PowerPoint, prestasi belajar siswa Berdasarkan observasi awal dan wawancara yang dilakukan pada tanggal 19 Agustus 2009 dengan guru Tata Busana SMP Maarif NU Pandaan kelas VIII diketahui bahwa sebagian besar proses pembelajaran masih didominasi guru dan siswa masih pasif. Selain itu guru cenderung menggunakan metode demonstrasi, ceramah dan penjelasan berupa gambar sederhana di papan tulis serta keterangan yang bersifat verbal, sehingga pada waktu proses belajar kebanyakan mereka merasa bosan dan berbicara dengan teman sebangkunya, dan tidak memperhatikan penjelasan dari guru, sehingga menyebabkan prestasi belajarnya sangat rendah. Standar Ketuntasan Minimum (SKM) yang ada di SMP Maarif NU Pandaan pada palajaran Tata Busana yaitu 77. Berdasarkan nilai rapor semester ganjil tahun ajaran 2009/2010, hasil nilai pelajaran Tata Busana 49 % dibawah SKM, 51 % siswa ingin lebih ditingkatkan lagi. Penelitian ini dilaksanakan di SMP Maarif NU Pandaan, dengan subjek siswa kelas VIII-F yang berjumlah 25 siswa. Penelitian ini termasuk penelitian tindakan kelas (classroom action research) yang terdiri dari dua siklus, siklus 1 terdiri dari satu pertemuan, sedangkan siklus 2 terdiri dari dua pertemuan . Teknik pengumpulan data keaktifan dan prestasi belajar siswa menggunakan lembar observasi belajar siswa. Tujuan penelitian ini adalah untuk meningkatkan prestasi belajar siswa dengan menerapkan pembelajaran dengan menggunakan media slide program Microsoft PowerPoint. Hasil penelitian menunjukkan bahwa prestasi belajar siswa meningkat 36% dari siklus 1 ke siklus 2. Pada siklus 1 prestasi belajar siswa mencapai 60% atau 15 siswa yang tuntas, sedangkan 32 % atau 10 siswa belum tuntas. Pada siklus 2 prestasi belajar meningkat menjadi 88 % atau 22 siswa yang tuntas, dan 12 % atau 3 siswa belum tuntas, dengan demikian dapat disimpulkan bahwa model pembelajaran dengan menggunakan media slide program Microsoft PowerPoint dapat meningkatkan prestasi belajar siswa kelas VIII-F SMP Maarif NU Pandaan. Berdasarkan hasil penelitian tersebut, maka sarannya sebagai berikut: (1) Bagi guru Tata Busana hendaknya menerapkan model pembelajaran dengan media slide program Microsoft PowerPoint pada materi yang sesuai dengan variasi yang lain agar siswa tidak merasa bosan dan jenuh dalam kegiatan pembelajaran. (2) Bagi penelitian selanjutnya, penelitian ini dapat dikembangkan untuk materi selain pembuatan pola rok celana dan pola celana panjang, selain itu diharapkan adanya variasi model pembelajaran agar siswa lebih tertarik dan termotivasi dalam kegiatan pembelajaran.

Perencanaan irigasi
tugas
oleh Saiful Abadi

 

Hubungan Kompetensi personal, kompetensi sosial, fasilitas praktikum, terhadap motivasi guru dan prestasi belajar siswa SMK Keahlian TIPTL di Kediri / Arisandi

 

ABSTRAK Arisandi. 2015. Hubungan Kompetensi Personal, Kompetensi Sosial, Fasilitas Praktikum, terhadap Motivasi Guru dan Prestasi Belajar Siswa SMK Keahlian TIPTL di Kediri. Tesis, Program Studi Pendidikan Kejuruan, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Tuwoso, M.P., (II) Dr. Tri Atmadji S., M.Pd. Kata Kunci: kompetensi personal, kompetensi sosial, fasilitas praktikum, motivasi guru, dan prestasi belajar. Salah satu kunci utama dalam proses pembelajaran adalah guru. Pengembangan proses dan kualitas pendidikan erat kaitannya dengan kinerja guru yang berhubungan erat dengan motivasi guru. Motivasi guru sangat erat kaitannya dengan kompetensi personal dan sosial. Selain faktor guru, untuk dapat menciptakan lulusan yang terampil sesuai dengan keahliannya, SMK sebagai pencetak tenaga kerja terampil siap kerja dan bahkan menciptakan lapangan kerja sendiri memerlukan sarana dan prasarana pendukung. Tujuan penelitian ini adalah mengetahui hubungan kompetensi perso¬nal, kompetensi sosial, fasilitas praktikum terhadap motivasi guru dan prestasi belajar siswa SMK keahlian TIPTL di Kediri. Penelitian ini menggunakan metode penelitian kuantitatif. Populasi yang digunakan adalah semua guru mata pelajaran keahlian TIPTL yang berjumlah 164 guru. Teknik sampel yang digunakan adalah Proportionate Random Sampling. Berdasarkan perhitungan diperoleh sampel sejumlah 128 guru. Data yang digunakan pada penelitian ini diperoleh dari instrumen penelitian berupa angket. Teknik analisis data yang digunakan adalah dengan menggunakan teknik analisis jalur. Hasil penelitian ini diperoleh presentase kriteria kategori baik sebagai berikut: (1) kompetensi personal 56,25 %; (2) kompetensi sosial 84,37 %; (3) fasilitas praktikum 53,90 %; dan (4) motivasi guru 77,34%. Prestasi belajar siswa diperoleh presentase dengan kriteria kategori sangat baik sebesar 60,16 %. Hasil berupa uji hipotesis sebagai berikut: (1) ada hubungan positif dan signifikan antara kompetensi personal terhadap motivasi guru; (2) ada hubungan positif dan signifikan antara kompetensi sosial terhadap motivasi guru; (3) ada hubungan positif dan signifikan antara fasilitas praktikum terhadap motivasi guru; (4) ada hubungan positif dan signifikan antara kompetensi personal terhadap prestasi belajar siswa; (5) tidak ada hubungan positif dan signifikan antara kompetensi sosial terhadap prestasi belajar siswa; (6) ada hubungan positif dan signifikan antara fasilitas praktikum terhadap prestasi belajar siswa; (7) ada hubungan positif dan signifikan antara motivasi guru terhadap prestasi belajar siswa; (8) ada hubungan positif dan signifikan antara kompetensi personal, sosial, fasilitas praktikum, terhadap motivasi guru, dan prestasi belajar siswa SMK keahlian TIPTL di Kediri. Dari hasil yang diperoleh, guru diharapkan memiliki kompetensi personal, sosial dan motivasi tinggi serta sekolah dapat memberikan fasilitas praktikum yang sesuai dan memadai agar tujuan pembelajaran tercapai.

Perencanaan konstruksi II jembatan baja dinding penuh
direncanakan oleh Irwahjudi Jutriputra

 

Pengembangan buku teks geografi model Addison-Wesley pada materi litosfer / Sukri Dwi Ningsih

 

ABSTRAK Ningsih, Sukri Dwi. 2015. Pengembangan Buku Teks Geografi Model Addison-Wesley pada Materi Litosfer. Tesis. Program Studi Pendidikan Geografi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Edy Purwanto, M.Pd., (II) Dr. Budijanto, M.Sos. Kata Kunci: Buku Teks Geografi Model Addison-Wesley, Litosfer. Buku teks memiliki peranan penting dalam pembelajaran di sekolah. Pada kenyataannya buku teks yang digunakan di sekolah masih banyak memiliki kualitas bahasa, isi/materi, dan desain/penyajian yang rendah. Hal ini dapat dibuktikan dari hasil analisis buku teks geografi kelas X semester II penerbit Masmedia materi litosfer yang ditemukan banyak kesalahan. Kesalahan tersebut antara lain: (1) bahasa, meliputi: tanda baca, kosa kata, kalimat, dan paragraf; (2) substansi, meliputi: konsep dan fakta/data; serta (3) gambar yang tidak sesuai dengan materi. Oleh karena itu dibutuhkan pengembangan buku teks untuk menghasilkan produk yang berkualitas. Tujuan dalam penelitian ini untuk mengembangkan buku teks geografi kelas X semester II materi litosfer dengan menggunakan model pengembangan buku Addison-Wesley. Buku yang dikembangkan berasal dari penerbit Masmedia yang ditulis oleh Muhammad Syaifudin Khabibur Rahman dan Triwijayanti. Produk yang dihasilkan dapat dimanfaatkan sebagai sumber belajar geografi bagi siswa SMA kelas X semester II. Pengembangan buku mengacu pada model buku Addison-Wesley. Buku tersebut berjudul Earth Science dan ditulis oleh Robert E. Fariel, dkk. Prosedur pengembangan menggunakan model Dick and Carey. Model ini memiliki sepuluh tahap, namun disederhanakan menjadi lima tahap. Lima tahap tersebut, yaitu: (1) analisis kebutuhan dengan mengidentifikasi SK, KD, dan indikator; (2) analisis materi; (3) penulisan dan pengembangan buku teks; (4) validasi dan uji coba; serta (5) revisi dan produk akhir. Uji coba dilaksanakan di SMA Kemala Bhayangkari 3 Porong. Instrumen pengumpulan data berupa angket tanggapan siswa dan soal tes. Teknik analisis data yang digunakan deskriptif kuantitatif. Hasil penelitian menunjukkan bahwa buku teks hasil pengembangan layak digunakan siswa dalam pembelajaran. Hal tersebut diketahui dari data hasil validasi ahli isi/materi, bahasa, dan desain/penyajian, serta uji coba lapangan. Persentase hasil uji coba secara keseluruhan mencapai 84,61%. Berdasarkan data tersebut, buku teks termasuk dalam kategori efisien. Selain itu, kelayakan buku teks juga ditunjukkan oleh hasil revisi yang telah dilakukan. Revisi berdasarkan hasil validasi ahli, meliputi: konsep isi/materi, ketepatan dan kejelasan penulisan, serta kesesuaian penyajian gambar. Revisi berdasarkan hasil uji coba lapangan, meliputi: penulisan istilah sulit dalam glosarium, ketepatan ejaan, serta kejelasan judul dan keterangan gambar. Produk buku teks materi litosfer masih memiliki beberapa kelemahan. Salah satu kelemahannya yakni pada materi tsunami tidak dilengkapi dengan proses terjadinya. Berdasarkan kelemahan tersebut, maka disarankan agar dalam penggunaan buku teks dikombinasikan dengan media berupa video agar siswa lebih mudah memahami materi.

Pengaruh kualitas layanan terhadap kepuasan konsumen pada koperasi siswa di SMAN VII Malang / Nurdianto Indra Prasetia

 

Kata Kunci : Kualitas Layanan, Kepuasan Konsumen (siswa) Dengan semakin berkembangnya perubahan lingkungan eksternal. Pasar yang semakin berubah, keinginan konsumen berubah, dan didukung dengan teknologi dan pelayanan yang cepat berubah pula, mengharuskan bagi pelaku jasa untuk perlu menyesuaikan diri dengan perubahan tersebut. Koperasi siswa merupakan penunjang perekonomian sekolah walaupun dalam ruang lingkup yang kecil, maka dari itulah koperasi siswa harus mempunyai kualitas layanan yang baik, karena kualitas memiliki hubungan yang erat dengan kepuasan konsumen. Kualitas memberikan suatu dorongan kepada konsumen untuk menjalin ikatan yang hubungan yang kuat dengan koperasi. Dengan ikatan yang seperti itu memungkingkan koperasi untuk memahami dengan baik terhadap harapan dan kebutuhan konsumen. Koperasi siswa dapat meningkatkan kualitasnya dengan cara memaksimalkan pengalaman menyenangkan konsumen dan meminimumkan atau meniadakan pengalaman konsumen yang kurang menyenangkan. Sehingga dapat menciptakan loyalitas konsumen pada koperasi yang telah memberikan pelayanan memuaskan. Tujuan dari penelitian ini adalah untuk menganalisis pengaruh kualitas layanan terhadap kepuasan konsumen pada koperasi siswa SMAN VII Malang secara parsial maupun simultan. Pendekatan yang digunakan dalam rancangan penelitian ini adalah deskriptif korelatif, dimana dalam rancangan tersebut akan dapat diketahui apakah ada pengaruh antara kualitas layanan dengan kepuasan konsumen (siswa). Diharapkan penelitian ini dapat berguna bagi perkembangan dan kemajuan koperasi siswa di SMAN VII Malang. Variable yang digunakan dalam penelitian ini ada dua yaitu variabel bebas yaitu kualitas layanan dengan sub variabel bukti fisik, keandalan, daya tanggap, jaminan dan empati. Sedangkan variabel terikatnya yaitu kepuasan konsumen (siswa). Populasi penelitian ini adalah seluruh siswa di SMAN VII Malang 14 Agustus 2009 sampai dengan 5 september 2009. Tehnik pengambilan sample peneliti menggunakan accidental sampling dengan menggunakan rumus slovin didapat dengan jumlah 89 responden. Analisis data penelitian yang dipakai adalah analisis regresi linier berganda dengan menggunakan uji t dan uji F dalam menguji hipotesisnya peneliti menggunakan bantuan penghitungan SPSS 15. Temuan dari penelitian ini menunjukkan bahwa : (1). Ada pengaruh yang signifikan pada keandalan dan daya tanggap dengan kepuasan konsumen di Koperasi siswa SMAN VII Malang, Ini dikarenakan ketiga variabel diatas mempunyai tingkat signifikansi lebih kecil dari 0.05 (2). Tidak ada pengaruh yang signifikan terhadap bukti langsung, jaminan dan empati dengan kepuasan konsumen koperasi siswa SMAN VII Malang, Ini dikarenakan ketiga variabel diatas mempunyai tingkat signifikansi lebih besar dari 0.05 (3). pada dimensi kualitas layanan mempunyai pengaruh terhadap kepuasan konsumen sebesar 58% sedangkan 42% lainnya dipengaruhi oleh variabel lain yang tidak diteliti. (4). Variabel yang paling dominan dalam mempengaruhi kepuasan konsumen di Koperasi SMAN VII Malang adalah daya tanggap, Ini dikarenakan ketiga variabel diatas mempunyai tingkat signifikansi lebih kecil dari 0.001. Berdasarkan hasil penelitian ini, dapat diambil kesimpulan bahwa kualitas layanan merupakan faktor yang penting dalam pemenuhan kebutuhan konsumen akan jasa karena dapat memberikan suatu persepsi yang baik bagi sebuah koperasi dan saran yang dapat diberikan dalam meningkatkan kualitas layanan pada Koperasi siswa SMAN VII Malang adalah : (1). perlu adanya peningkatan kualitas bukti fisik untuk meningkatkan kepuasan konsumen, yaitu dengan banyaknya konsumen hendaknya koperasi memiliki tempat yang luas sehingga memudahkan ruang gerak konsumen dalam melakukan transaksi dan mencari barang dibeli, serta memperhatikan kerapian karyawan misalnya karyawan dapat memakai seragam, serta penambahan kelengkapan fasilitas koperasi seperti tempat duduk yang nyaman bagi karyawan maupun konsumen dan juga memperhatikan kebersihan koperasi dengan adanya tempat pembuangan sampah. (2). perlu adanya peningkatan kualitas jaminan untuk meningkatkan kepuasan konsumen, yaitu hendaknya koperasi perlu memberikan jaminan bagi konsumen apabila terdapat barang yang dibeli telah rusak, memberikan kepercayaan terhadap karyawan maupun konsumen dalam membeli barang, koperasi memberikan kemudahan terhadap konsumen dalam mendapat jaminan, dan juga memperhatikan barang yang dijual tidak kadaluarsa agar dapat menjamin kesehatan dan menjaga agar konsumen merasa puas. (3). perlu adanya peningkatan kualitas empati untuk meningkatkan kepuasan konsumen Koperasi hendaknya perlu menyediakan kotak saran untuk konsumen agar dapat mendengar harapan dan keingginan konsumen selama mereka melakukan transaksi di koperasi. Serta kiranya menerapkan prinsip-prinsip penting dalam berkomunikasi, dengan komunikasi yang baik antara karyawan dan konsumen akan memunculkan keterbukaan dan memberi kesempatan untuk belajar dari kesalahan sehingga memahami perkembangan yang terjadi.

Laporan perencanaan konstruksi beton
perencanaan konstruksi bangunan pertokoan
oleh Eddy Widjanarko

 

Pengembangan bahan ajar sosiologi yang bermuatan konteks lingkungan sosial untuk siswa SMA kelas I Dili, Timor Leste / Sebastiao Pereira

 

ABSTRAK Pereira, Sebastião. 2015. Pengembangan Bahan Ajar Sosiologi yang Bermuatan Konteks Lingkungan Sosial untuk Siswa SMA Kelas I Dili, Timor Leste. Disertasi, Program Studi Teknologi Pembelajaran, Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. I Nyoman Sudana Degeng, M.Pd, (2) Prof. Dr. Punadji Setyosari, M.Pd., M.Ed, dan (3) Prof. Dr. Imam Suyitno, M.Pd. Kata kunci: bahan ajar, konteks lingkungan sosial Pelajaran sosiologi merupakan salah satu matapelajaran yang diprogramkan bagi siswa Sekolah Menengah Atas (SMA) Dili, Timor Leste. Buku ajar yang digunakan berasal dari buku-buku untuk siswa Indonesia, dan akhir-akhir ini menggunakan bahan ajar yang berasal dari Negara Portugal. Proses pembelajaran yang dilakukan masih sangat konvensional, belum ada aktivitas kelas yang lebih inovatif. Hal ini terjadi karena belum ada buku ajar yang lebih inovatif sebagai pegangan bagi guru matapelajaran sosiologi. Karena itu, penelitian ini bertujuan (1) menghasilkan bahan ajar sosiologi bermuatan konteks lingkungan sosial untuk siswa SMA Kelas I Dili, Timor Leste, dan (2) mengkaji kelayakan produk bahan ajar sosiologi bermuatan konteks lingkungan sosial untuk siswa SMA Kelas I Dili, Timor Leste. Penelitian ini menggunakan metode penelitian dan pengembangan (research and development/R&D). Subjek uji coba atau sampel untuk uji coba adalah guru sosiologi dan siswa SMA Kelas I Cristal dan SMA Kelas I Negeri 4 September Dili Timor Leste. Data penelitian untuk pengembangan produk bahan ajar ini adalah data kualitatif. Instrumen pengumpulan data dalam penelitian ini meliputi lembar catatan dan panduan observasi, ikhtisar dokumen, dan angket. Sesuai dengan instrumen yang digunakan, teknik pengumpulan data dilakuan melalui observasi, wawancara, studi dokumen, dan pengisian angket. Data dianalisis secara deskriptif baik dalam bentuk paparan kualitatif maupun dalam bentuk perhitungan kuantitatif dan diklasifikasikan berdasarkan jenis dan komponen produk yang dikembangkan. Dalam analisis data penggunaan perhitungan dan analisis statistik sejalan produk yang akan dikembangkan, yakni dengan menggunakan uji t. Berdasarkan hasil analisis uji lapangan, produk bahan ajar sosiologi yang sudah dikembangkan mampu meningkatkan rerata skor siswa, yakni dari rerata skor sebelumnya 68,2667 menjadi 76,0333. Namun, penggunaan produk tersebut juga memperbesar perbedaan kompetensi antar siswa. Hal ini tampak pada simpangan baku skor tersebut, yakni dari 6,77690 menjadi 8,05363. Dengan demikian, produk bahan ajar tersebut memiliki manfaat untuk meningkatkan efisiensi pembelajaran sosiologi bagi siswa kelas I SMA Dili Timor Leste, sekaligus juga mampu membedakan siswa yang berkemampuan tinggi dan berkemampuan rendah. Berdasarkan hasil uji t, dapat diketahui bahwa penggunaan produk bahan ajar sosiologi mampu meningkatkan rerata skor sebanyak 7,76667 dan memiliki taraf signifikansi perbedaan 4,042. Karena itu, dapat disimpulkan bahwa produk bahan ajar sosiologi yang dikembangkan dengan menggunakan prosedur Dick dan Carey layak digunakan dalam praktik pembelajaran sosiologi dan perlu didiseminasikan serta dikembangkan secara lebih lanjut.

Perencanaan torak motor diesel empat langkah
oleh Arif Fatcul

 

Hasil belajar kognitif dan keterampilan proses sains siswa kelas XI SMAN 6 Malang pada pembelajaran laju reaksi secara inkuiri terbimbing kooperatif dan inkuiri terbimbing mandiri / Rista Rahmaniyah Yansi

 

ABSTRAK Yansi, Rista Rahmaniyah. 2015. Hasil Belajar Kognitif dan Keterampilan Proses Sains Siswa Kelas XI SMAN 6 Malang pada Pembelajaran Laju Reaksi Secara Inkuiri Terbimbing Kooperatif dan Inkuiri Terbimbing Mandiri. Tesis. Jurusan Pendidikan Kimia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dra. Srini M. Iskandar, M.Sc., Ph.D., (II) Dr. H. Sutrisno, M.Si. Kata Kunci: Inkuiri terbimbing kooperatif, keterampilan proses sains, laju reaksi. Pembelajaran kimia harus memperhatikan karakteristik ilmu kimia sebagai produk dan proses. Pembelajaran yang memperhatikan karakteristik kimia sebagai proses, dilakukan dengan cara mengembangkan keterampilan-keterampilan siswa sebagai penemu atau memberikan kesempatan kepada siswa untuk belajar kimia sebagaimana kimiawan belajar. Penelitian ini dilaksanakan untuk mengetahui hasil belajar kognitif dan keterampilan proses sains siswa dengan menggunakan inkuiri terbimbing kooperatif dan inkuiri terbimbing mandiri. Rancangan penelitian yang digunakan adalah kuasi eksperimen. Penelitian ini menggunakan dua kelas, yaitu kelas XI MIA 1 sebanyak 30 siswa dan XI MIA 4 sebanyak 32 siswa. Instrumen penelitian terdiri dari rencana pelaksanaan pembelajaran (RPP), seperangkat tes hasil belajar kognitif, dan seperangkat tes keterampilan proses sains. Teknik analisis data yang digunakan adalah kausal komparatif. Data penelitian ini adalah hasil belajar kognitif dan keterampilan proses sains. Hasil penelitian menunjukkan bahwa: (1) Hasil belajar kognitif secara inkuiri terbimbing kooperatif lebih tinggi (75,2) daripada inkuiri terbimbing mandiri (69,2). (2) Keterampilan proses sains secara inkuiri terbimbing kooperatif lebih rendah daripada inkuiri terbimbing mandiri. (3) Keterampilan proses sains siswa kelas inkuiri terbimbing kooperatif yang tergolong baik meliputi aspek mengobservasi (81,3%), mengklasifikasi (81,3%), menemukan hubungan (89,1%), merumuskan hipotesis (98,4%), merancang eksperimen (92,2%), dan menginterpretasikan data (95,3%). Keterampilan proses sains siswa kelas inkuiri terbimbing kooperatif yang tergolong cukup, meliputi aspek menyimpulkan (66,6%) dan menentukan variabel (37,5%), sedangkan yang tergolong kurang adalah aspek mengukur (1,6%). Keterampilan proses sains siswa kelas inkuiri terbimbing mandiri yang tergolong baik meliputi aspek mengobservasi (95%), mengklasifikasi (91,7%), menyimpulkan (84,2%), merumuskan hipotesis (95%), merancang eksperimen (91,7%), dan menginterpretasikan data (98,3%). Keterampilan proses sains siswa kelas inkuiri terbimbing mandiri yang tergolong cukup, meliputi aspek menemukan hubungan (63,3%) dan menentukan variabel (45%), sedangkan yang tergolong kurang adalah aspek mengukur (13,3%).

Perencanaan konstruksi beton bangunan perpustakaan dengan metode ultimate
oleh Dwi Kukuh Wahono Adi

 

Perencanaan seperangkat roda gigi
tugas akhir pilihan
oleh Geger Subiyantoro

 

Pengembangan paket layanan informasi pendidikan lanjutan bagi siswa Sekolah Menengah Pertama (SMP) / Toby Emmanuel Weldy

 

ABSTRAK Weldy, Toby Emmanuel.2015. Pengembangan Paket Layanan Informasi Pendidikan Lanjutan Bagi Siswa Sekolah Menengah Pertama. Tesis Program Studi Bimbingan dan Konseling Universitas Negeri Malang. Pembimbing: (I) Dr. Dany M. Handarini, M.A. (2) Dr. M. Ramli, M.A. Kata Kunci: Paket Layanan Informasi, Pendidikan Lanjutan Siswa lulusan SMP diperhadapkan pada beberapa pillihan karier. Salah satunya melanjutkan pendidikan ke Sekolah Menengah Kejuruan. Informasi yang memadai bagi para calon lulusan Sekolah Menengah Pertama sangat dibutuhkan, oleh karena itu guru pembimbing atau konselor perlu mempersiapkan para siswanya untuk dapat memilih pilihan yang tepat, sesuai dengan kemampuan siswanya. Pemilihan media dalam pemberian informasi juga menentukan tersampaikannya informasi tersebut. Tujuan penelitian ini adalah untuk menghasilkan paket layanan informasi pendidikan lanjutan bagi siswa SMP, sebagai salah satu sarana yang dapat digunakan konselor dalam memberikan layanan bimbingan dan konseling yang memandirikan di sekolah. Rancangan dalam penelitian ini menggunakan model pengembangan. Model yang dikembangkan mengacu pada model Research and Development (R&D) dari Borg and Gall (1983),dengan langkah-langkah sebagai berikut : (1) penelitian dan pengumpulan informasi, (2) perencanaan, (3) pengembangan produk, (4) uji lapangan awal, (5) revisi produk utama, (6) uji lapangan lanjut, (7) revisi produksi operasional, (8) uji lapangan operasional, (9) uji lapangan akhir, (10) diseminasi dan implementasi. Dalam penelitian ini langkah-langkah di atas hanya sampai pada revisi produk utama. Hasil penelitian ini berupa paket layanan informasi pendidikan lanjutan yang ditujukan bagi siswa SMP. Paket layanan informasi pendidikan lanjutan ini dimaksudkan untuk membantu konselor dalam memberikan informasi tentang Sekolah Menengah Kejuruan khususnya bidang keahlian seni pertunjukan. Paket layanan informasi pendidikan lanjutan terdiri dari video dan panduannya yang di bagi menjadi 5 bagian, pertama tentang program keahlian seni musik, kedua tentang program keahlian seni tari, ketiga tentang program keahlian seni karawitan, keempat tentang program keahlian seni pedalangan, dan kelima tentang program keahlian seni teater. Kegiatan layanan informasi pendidikan lanjutan dilaksanakan dalam 5 kali pertemuan dengan masing-masing pertemuan menayangkan satu program keahlian. Secara singkat, isi video mencakup kompetensi dasar yang harus dimiliki, mata pelajaran yang diajarkan pada masing-masing program keahlian, persyaratan masuk program keahlian tersebut, peluang kerja, dan nama serta alamat sekolah pada masing-masing program keahlian.Hasil uji ahli dan uji pengguna menunjukkan bahwa secara umum paket layanan informasi pendidikan lanjutan bagi siswa SMP yang dikembangkan telah memenuhi kriteria akseptabilitas ditinjau dari aspek kegunaan, kelayakan, ketepatan dan kepatutan,sehingga paket layanan informasi pendidikan lanjutan bagi siswa SMP ini dapat digunakan sebagai alternatif bagi konselor untuk memberikan layanan informasi pendidikan lanjutan bagi siswa sekolah menengah pertama dan masih dapat dikembangkan dikemudian hari. Berdasarkan hasil penelitian dan pengembangan ini disarankan dalam penelitian selanjutnya (1) perlu dilakukan analisis kebutuhan dengan metode yang menghasilkan data lebih akurat dan menyeluruh, misalnya metode survei, (2) langkah-langkah penelitian pengembangan ini terbatas hanya sampai pada revisi produk utama, sehingga masih perlu dikembangkan sampai langkah-langkah berikutnya, (3) video terbatas penggunaannya hanya untuk siswa lulusan Sekolah Menengah Pertama yang akan melanjutkan pendidikan ke Sekolah Menengah Kejuruan bidang keahlian seni pertunjukan, sehingga masih dapat dikembangkan untuk siswa Sekolah Menengah Pertama yang akan melanjutkan pendidikan ke Sekolah Menengah Kejuruan bidang keahlian lainnya dan atau yang akan melanjutnya pendidikan ke Sekolah Menengah Atas.

Perencanaan konstruksi beton III bangunan perkuliahan
oleh Adi Ruswanto

 

Ultimate strength design untuk gedung perkantoran lantai satu
tugas perencanaan
disusun oleh Meiga Rasdiana

 

Kajian pemahaman konsep materi dan perubahannya pada siswa kelas IX SMP Negeri 1 Tulungagung / Tutik Sri Wahyuni

 

Kata Kunci: pemahaman konsep, materi, perubahan fisika, perubahan kimia. Konsep kimia merupakan konsep yang berurutan dan berjenjang. Siswa diharapkan benar-benar memahami konsep yang fundamental terlebih dahulu agar dapat memahami konsep yang lebih kompleks. Salah satu konsep fundamental dalam kimia adalah konsep materi dan perubahannya. Sejak diterapkannya KTSP, konsep tersebut mulai diajarkan di tingkat SMP kelas VII semester ke-2. Konsep materi dan perubahannya mengandung aspek makroskopis dan mikroskopis. Untuk mempelajari konsep yang bersifat abstrak pada tingkat mikroskopis dibutuhkan tingkat berfikir yang lebih tinggi dan akan tercapai bila seseorang telah mencapai tingkat kemampuan berpikir formal. Sejumlah siswa SMP dilaporkan mengalami kesulitan ketika mempelajari materi dan perubahannya yang dihubungkan dengan partikel materi secara mikroskopis (Andersson, Brook, Briggs & Driver, Millar, Novick & Nussbaum, Margel, Eylon, & Scherz, 2007:132). Hal tersebut berhubungan dengan pembelajaran sains di SMP yang jarang menggunakan gambaran mikroskopis untuk menjelaskan suatu konsep yang bersifat abstrak. Kesulitan memahami konsep bagi siswa akan mengakibatkan konsep tersebut menjadi sukar yang memungkinkan siswa mengalami kesalahan konsep karena pemahaman salah yang berlangsung secara konsisten. Tujuan penelitian ini adalah untuk mengetahui; bagaimana pemahaman siswa kelas IX SMP Negeri 1 Tulungagung mengenai partikel materi (wujud zat), klasifikasi materi, dan perubahan materi yang meliputi perubahan fisika dan kimia, hubungan pemahaman pada tingkat makroskopis dan mikroskopis, serta kesalahan konsep yang dialami siswa. Penelitian ini menggunakan rancangan penelitian deskriptif. Subyek penelitian ini adalah siswa kelas IX-A dan IX-C dengan jumlah 50 siswa. Instrumen penelitian berupa tes tulis berbentuk multiple choice two-tier dengan validitas isi sebesar 98,41% dan reliabilitas yang dihitung dengan menggunakan persamaan KR-20 adalah sebesar 0,61. Data yang diperoleh dinyatakan dalam persentase dan dianalisis secara deskriptif. Hasil penelitian menunjukkan bahwa; (1) pemahaman siswa mengenai materi dan perubahannya termasuk dalam kriteria rendah. Persentase siswa yang memahami konsep partikel materi sebesar 42,0%, klasifikasi materi sebesar 12,3%, perubahan fisika sebesar 28,8%, dan perubahan kimia 27,0%, (2) pada umumnya, siswa sudah mampu memahami konsep materi dan perubahannya pada tingkat makroskopis, akan tetapi sebagian besar siswa belum mampu membuat kaitan antara pemahaman konsep pada tingkat makroskopis dan mikroskopisnya. Pemahaman siswa mengenai perubahan materi pada tingkat mikroskopis dan simbolik termasuk dalam kriteria sangat rendah, (3) identifikasi kesalahan konsep yang terjadi pada siswa antara lain; (a) zat padat merupakan materi yang bersifat kontinyu (solid matter is continuous), (b) gas bukan merupakan materi karena gas tidak berwarna dan tidak terlihat (gas is not matter because they are invisible), (c) gelembung di dalam air mendidih mengandung udara atau oksigen, (d) ketika materi dipanaskan, partikel materi akan mengembang (“the molecule expand when heated”), (e) reaksi penguraian air dengan menggunakan arus listrik dihasilkan gas hidrogen dan gas oksigen yang digambarkan sebagai gas monoatomik, (f) mentega yang meleleh menghasilkan air, (g) peristiwa pemurnian iodin (sublimasi) diawali dengan peristiwa meleleh terlebih dahulu sebelum berubah menjadi gas, dan (h) terbentuknya endapan merupakan ciri dari perubahan fisika.

Perencanaan motor bensin empat langkah
oleh Marianus Subandowo

 

Karakteristik tokoh dan penokohan dalam cerpen karya siswa kelas IX MTs Negeri Tulungagung tahun pelajaran 2012/2013 / Mohamad Agus Irwanto

 

ABSTRAK Irwanto, Mohamad Agus. 2015. Karakteristik Tokoh dan Penokohan dalam Cerpen Karya Siswa Kelas IX MTsN Tulungagung Tahun Pelajaran 2012/2013. Tesis. Program Studi Pendidikan Bahasa Indonesia, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Djoko Saryono, M.Pd. (II) Dr. Yuni Pratiwi, M.Pd. Kata Kunci: karakteristik, tokoh, penokohan, cerpen Cerpen hasil karya anak sebagai sebuah karya fiksi yang imajiner berasal dari pengalaman dan pengamatan hidupnya. Berbagai pengalaman hidup dan kehidupan yang diungkapkan melalui cerpen tersebut memiliki gaya yang khas, baik dari unsur intrinsik dan unsur ektrinsiknya terutama tokoh dan penokohannya. Penelitian ini bertujuan untuk mengetahui karakteristik tokoh dan penokohan dalam cerpen karya siswa. Fokus penelitian ini adalah (1) karakteristik posisi tokoh, dan (2) karakteristik teknik pelukisan tokoh. Metode yang digunakan dalam penelitian ini adalah pendekatan kualitatif dengan fokus kajian teks. Metode ini bertujuan untuk mendeskripsikan karakteristik tokoh dan penokohan dalam cerpen. Penelitian ini menitikberatkan kepada kajian analisis teks cerpen. Data dikelompokkan menjadi 2 macam, yaitu data karakteristik posisi tokoh, dan (2) data karakteristik teknik pelukisan tokoh. Sumber data yaitu cerpen karya siswa kelas IX MTsN Tulungagung Tahun Pelajaran 2012/2013. Dalam proses analisis data dilakukan pengumpulan data, pereduksian, dan penyajian data kemudian dilanjutkan penyimpulan data. Pengecekan keabsahan data diuji dengan ketekunan pengamatan, kecukupan rujukan, dan diskusi dengan rekan sejawat. Hasil penelitian mencakup dua hal. Pertama, penelitian tentang karakteristik posisi tokoh, yaitu (1) karakteristik posisi tokoh berdasarkan peran, yang terdiri atas (a) tokoh utama dan (b) tokoh tambahan. Karakteristik tokoh aku sebagai tokoh utama lebih banyak digunakan dalam cerpen karya siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 di samping karakteristik tokoh orang lain pelajar dan orang lain orang tua. Sedangkan karakteristik teman sekolah banyak digunakan sebagai tokoh tambahan oleh siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 di samping tokoh orang tua, guru sekolah, guru mengaji, saudara kandung, saudara/famili, teman bermain, kakak kelas, tetangga, sopir pribadi, petugas keamanan sekolah, dan pedagang di kantin sekolah. (2) karakteristik posisi tokoh berdasarkan fungsinya, terdiri atas (a) tokoh protagonis dan (b) tokoh antagonis. Karakteristik aku sebagai tokoh protagonis lebih banyak digunakan dalam cerpen karya siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 di samping tokoh orang lain pelajar, orang tua, dan teman sekolah. Sedangkan karakteristik orang lain pelajar sebagai tokoh antagonis lebih banyak digunakan dalam cerpen karya siswa kelas IX MTsN tulungagung tahun pelajaran 2012/2013 di samping tokoh teman sekolah, saudara/famili, dan orang lain. (3) karakteristik posisi tokoh berdasarkan perwatakannya, terdiri atas (a) tokoh sederhana dan (b) tokoh bulat. Karakteristik aku sebagai tokoh sederhana lebih banyak digunakan dalam cerpen karya siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 di samping tokoh orang lain pelajar dan orang tua. Sedangkan karakteristik orang lain pelajar sebagai tokoh bulat lebih banyak digunakan dalam cerpen karya siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 di samping tokoh teman sekolah dan orang tua. Kedua, penelitian tentang karakteristik teknik pelukisan tokoh, yang terdiri atas (a) teknik analitik dan (b) teknik dramatik. Karakteristik teknik analitik (langsung) yang berupa deskripsi kedirian tokoh berwujud sikap, sifat, watak, dan tingkah laku dalam cerpen karya siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 lebih banyak digunakan di samping deskripsi ciri fisik.(2) karakteristik teknik dramatik (tak langsung) yang menggunakan cakapan lebih banyak digunakan dalam cerpen karya siswa kelas IX MTsN Tulungagung tahun pelajaran 2012/2013 di samping teknik tingkah laku, teknik arus kesadaran, teknik reaksi tokoh utama, teknik reaksi tokoh lain terhadap tokoh utama, teknik pelukisan latar, teknik pelukisan keadaan fisik, dan teknik pelukisan keadaan batin. Berdasarkan hasil penelitian, disampaikan empat saran. Pertama, Bagi Dinas Pendidikan Kabupaten Tulungagung, hasil penelitian ini dapat digunakan sebagai bahan pembelajaran dalam diklat, workshop, dan kegiatan sejenis dalam rangka meningkatkan pengetahuan para guru terutama berkaitan dengan karakteristik cerpen para pelajar. Kedua, bagi para penyusun buku, hasil penelitian ini dapat digunakan sebagai bahan penyusunan buku ajar, modul, atau LKS, dalam kegiatan MGMP madrasah tsanawiyah di Kabupaten Tulungagung. Ketiga, bagi guru bidang studi bahasa Indonesia, hasil penelitian ini dapat digunakan sebagai bahan ajar dalam pembelajaran analisis cerpen yang menitikberatkan pada karakteristik tokoh dan penokohan, terutama yang menyangkut karakteristik posisi tokoh maupun karakteristik teknik pelukisan tokoh, dan Keempat, bagi peneliti selanjutnya, hasil penelitian ini dapat digunakan sebagai bahan untuk melakukan penelitian selanjutnya, terutama yang berkaitan dengan karakteristik tokoh dan penokohan.

Perencanaan turbin uap air type Cross Flow
disusun oleh Nurmaida Cicilia S.

 

Hubungan antara kecerdasan emosional dengan prestasi belajar pada remaja panti asuhan / Sandy Hidayat

 

Kata Kunci : kecerdasan emosional, prestasi belajar Remaja yang tinggal di panti asuhan menemui banyak aturan yang ketat dan aktivitas yang membosankan sehingga membuat remaja merasa tertekan. Hal ini berpengaruh dalam motivasi belajar anak, sehingga prestasi belajarnya menurun, namun tinggi rendahnya prestasi belajar dipengaruhi oleh kecerdasan emosional yang dimiliki. Penelitian ini bertujuan untuk: (1) mendeskripsikan kecerdasan emosional remaja panti asuhan Se-Kota Batu, (2) mendeskripsikan prestasi belajar pada remaja panti asuhan Se-Kota Batu, (3) mengetahui hubungan antara kecerdasan emosional dan prestasi belajar pada remaja panti asuhan Se-Kota Batu. Penelitian ini dilaksanakan dengan dISAINdeskripsi dan korelasional dengan populasi seluruh remaja panti asuhan Se-Kota Batu. Sampel diambil dengan teknik proposional dan random sampling. Data diambil dengan menggunakan skala kecerdasan emosional dan metode dokumentasi. Hasil penelitian ini menunjukkan bahwa 7,5% remaja memiliki kecerdasan emosional yang sangat tinggi, 78,75% remaja memiliki kecerdasan emosional yang tinggi, 12,5% remaja memiliki kecerdasan emosional yang sedang, 1,25% remaja memiliki kecerdasan emosional yang rendah. Sebanyak 47,5% remaja memiliki prestasi belajar yang memuaskan, 52,5% remaja memiliki prestasi belajar yang cukup. Hasil analisis korelasional Pearson menunjukkan ada hubungan yang signifikan antara kecerdasan emosional dan prestasi belajar (rxy=0,361; sig=0,001<0,0,05), artinya semakin tinggi kecerdasan emosional maka akan tinggi prestasi belajar, sebaliknya semakin rendah kecerdasan emosional maka prestasi belajar akan semakin rendah. Saran bagi anak asuh, diharapkan dapat meningkatkan kecerdasan emosionalnya dengan cara menghargai potensi yang dimiliki serta berfikir positif, memahami emosinya dan mengekspresikannya dengan baik dan optimis untuk meningkatkan prestasi belajarnya. Bagi pengurus panti asuhan, diharapkan pembimbing dan pengawas lebih memahami karakter tiap-tiap anak asuh sehingga dapat membimbing dengan baik.

Perencanaan motor bensin empat langkah sebagai penggerak pompa
oleh Muadji

 

Pelevelan penalaran aljabar siswa kelas X dalam memecahkan masalah berdasarkan Taksonomi Solo / Filda Febrinita

 

ABSTRAK Febrinita, Filda. 2015. Pelevelan Penalaran Aljabar Siswa Kelas X dalam Memecahkan Masalah Berdasarkan Taksonomi SOLO. Tesis. Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Subanji, M.Si. (II) Dr. Sisworo, M.Si. Kata Kunci: level penalaran aljabar, pemecahan masalah, taksonomi SOLO Siswa pasti akan dihadapkan pada masalah matematis ketika belajar matematika, khususnya ketika mempelajari aljabar.Aljabar merupakan salah satu cabang matematika yang sangat penting dipelajari siswa sebagai modal untuk membentuk keterampilan hidup yang bermanfaat, salah satunya adalah keterampilan pemecahan masalah. Untuk terampil dalam memecahkan masalah, salah satunya dibutuhkan keahlian dalam bernalar. Hasil belajar siswa dalam memecahkan masalah aljabar yang melibatkan kemampuan penalaran, dapat diketahui dan diases. Salah satu alat yang dapat digunakan untuk mengases hasil belajar aljabar adalah Taksonomi SOLO.Dalam Taksonomi SOLO, ketika siswa menjawab tugas yang diberikan, tanggapan mereka terhadap tugas tersebut dapat diringkas dalam lima level struktur respon yaitu: 1) prastruktural, 2) unistruktural, 3) multistruktural, 4) relasional dan 5) extended abstract. Dengan demikian, kemampuan bernalar siswa dalam memecahkan masalah aljabar dapat diketahui dengan lebih detail sehingga diharapkan dapat membantu guru untuk memilih strategi yang tepat dalam membelajarkan aljabar. Oleh karena itu, tujuan dari penelitian ini adalah untuk mengetahui bagaimana pelevelan penalaran aljabar siswa dalam memecahkan masalah berdasarkan Taksonomi SOLO. Penelitian ini merupakan penelitian yang menggunakan pendekatan kualitatif, dengan jenis penelitian adalah penelitian deskriptif ekploratif. Dalam penelitian ini, peneliti bertindak sebagai instrumen utama. Data penelitian adalah hasil kerja siswa dalam memecahkan masalah aljabar serta hasil rekaman wawancara peneliti dengan subjek terkait dengan aktivitas bernalar yang dilakukan subjek dalam memecahkan masalah aljabar. Hasil penelitian menunjukkan bahwa level penalaran aljabar siswa kelas X dalam memecahkan masalah dapat diklasifikasikan dalam empat level, yaitu: (1) Level 1 (level unistruktural) yang diantaranya ditandai dengan aktivitas bernalar siswa yang mampu menggunakan satu informasi dari masalah untuk menyusun strategi pemecahan masalah dan mampu menentukan suku selanjutnya dari suatu pola bilangan; (2) Level 2 (level multistruktural) yang diantaranya ditandai dengan aktivitas bernalar siswa yang mampu menggunakan lebih dari satu informasi untuk menyusun strategi pemecahan masalah dan mampu mendaftar suku-suku dari suatu pola bilangan; (3) Level 3 (level relasional) yang diantaranya ditandai dengan aktivitas bernalar siswa yang mampu memprediksikan penyelesaian masalah berdasarkan informasi yang dipahami dan mampu membuat kesimpulan dari penyelesaian masalah dengan membuat keterkaitan antara dua informasi; (4) Level 4 (level extended abstract) yang diantaranya ditandai dengan aktivitas siswa yang mampu menggeneralisasikan pola bilangan yang muncul dari masalah dan mampu mengubah dan menciptakan ilustrasi baru untuk suatu pola bilangan.

Perencanaan pompa sentrifugal
oleh Sukarno

 

Kepemimpinan kepala sekolah dalam menerapkan nilai-nilai profetik(kenabian) di sekolah (studi kasus di SD Yayasan Islam Malik Ibrahim Fullday School Gresik, SD Katolik Santa Maria II Malang, SD Metta School Surabaya) / Nerita Setiyaningtiyas

 

ABSTRAK Setiyaningtiyas, Nerita. 2015. Kepemimpinan Kepala Sekolah dalam Menerapkan Nilai-nilai Profetik (Kenabian) di Sekolah (Studi Kasus di SD Yayasan Islam Malik Ibrahim Fullday School Gresik, SD Katolik Santa Maria II Malang, SD Metta School Surabaya). Tesis. Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Ali Imron, M.Pd., M.Si., (II) Prof. Dr. H. Bambang Budi Wiyono, M.Pd. Kata Kunci: kepemimpinan, profetik, kepala sekolah Kepala sekolah adalah agen penting dalam sebuah proses pendidikan. Ia mengupayakan usaha sadar dan terencana untuk menciptakan suasana belajar agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan religius keagamaan, pengendalian diri, kepribadian, kecerdasan, sikap sosial, dan ketrampilan yang diperlukan dirinya, masyarakat, bangsa, dan negara. Dalam kurun waktu terakhir ini, para ahli menyadari bahwa pendidikan yang menanamkan nilai-nilai utama profetik kepada semua warga sekolah agar mereka mempunyai pengetahuan, kesadaran, dan terlibat dalam melaksanakan nilai-nilai profetik belumlah memadai. Berkaitan dengan itu, diperlukanlah pembahasan mengenai kepemimpinan profetik kepala sekolah. Fokus penelitian ini adalah (1) nilai-nilai profetik yang disebarkan oleh kepala sekolah kepada pemangku kepentingan, (2) strategi kepala sekolah dalam mengkonservasi nilai-nilai profetik dalam kehidupan warga sekolah, (3) strategi kepala sekolah dalam mengakomodasi nilai-nilai, dan (4) nilai-nilai profetik yang diperjuangkan di tengah kehidupan pemangku kepentingan. Penelitian ini menggunakan rancangan penelitian kualitatif studi kasus. Sumber data adalah ketiga kepala sekolah SD YIMI Fullday School Gresik, SDK St. Maria II Malang, SD Metta School Surabaya beserta beberapa informan yang relevan. Metode perolehan data adalah metode wawancara, observasi, dan dokumentasi. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri. Pengecekan keabsahan data digunakan metode yang relevan, secara khusus dilakukanlah kegiatan triangulasi data. Kegiatan pengolahan data dimulai dengan tahap penelaahan data berupa pembuatan transkrip wawancara, pengumpulan gambar dokumentatif yang relevan, dan merapikan data observasi, kemudian dilakukan tahap identifikasi berupa reduksi data untuk mengurangi duplikasi sehingga dapat dilakukan klasifikasi data, dan akhirnya pada tahap evaluasi data peneliti memperoleh keyakinan bahwa data yang ada layak untuk di analisis. Peneliti menggunakan dua bentuk analisis, yaitu analisis kasus individual dan analisis lintas kasus. Kegiatan analisis kasus individual menghasilkan temuan berikut ini. Pertama, kepemimpinan profetik Kepala Sekolah SD YIMI Fullday School Gresik menampilkan kepemimpinan profetik sebagai kegiatan yang menyelaraskan antara kedalaman batin karena aktivitas keagamaan dan keluasan budi karena aspek sosial manusia. Kedua, kepemimpinan profetik Kepala Sekolah SDK St. Maria II Malang menampilkan kepemimpinan sebagai kegiatan yang meyakini kebaikan setiap pribadi dan menerima setiap orang bermartabat sama. Ketiga, kepemimpinan profetik Kepala Sekolah SD Metta School Surabaya menampilkan kepemimpinan sebagai kegiatan menghantar setiap pribadi kepada kehalusan budi dan kebeningan batin agar tercapailah kebebasan yang sejati. Kegiatan analisis lintas kasus menghasilkan empat simpulan hasil penelitian berikut. Pertama, nilai-nilai profetik yang disebarkan oleh kepala sekolah kepada pemangku kepentingan adalah nilia-nilai yang membimbing mereka memaknai hidup masing-masing. Ketiga kepala sekolah menunjukkan pesan profetik di lembaga pendidikan kepada warga sekolah melalui teladan, arahan, dan pemberian wawasan. Kedua, strategi kepala sekolah dalam mengkonservasi nilai-nilai profetik dalam kehidupan warga sekolah adalah pendekatan personal dan fungsional.Ketiga, strategi kepala sekolah dalam mengakomodasi nilai-nilai adalah dengan memberi makna atas nilai-nilai itu dalam perspektif baru. Warga sekolah, yaitu: guru, murid, karyawan, dan orang tua siswa, melihat bahwa ketiga kepala sekolah menghayati pesan profetik di dalam pelaksanaan kepemimpinan di lembaga pendidikan. Keempat, nilai-nilai profetik yang diperjuangkan di tengah kehidupan pemangku kepentingan adalah nilai-nilai profetik dari para nabi. Kesimpulan dari penelitian ini adalah bahwa kepemimpinan profetik kepala sekolah adalah karakter kepemimpinan yang ditunjukkan oleh kepala sekolah ketika yang bersangkutan mengimplementasikan nilai-nilai utama kenabian untuk memengaruhi orang lain dalam mencapai tujuan. Secara teoritik, kepemimpinan profetik kepala sekolah mengelaborasi pikiran, ajaran, karya, dan hidup para Nabi ke dalam seluruh proses yang ada di sekolah. Secara praktis ruang lingkupnya bukan pada aspek-aspek normatif seperti teologi. Tujuan kepemimpinan profetik adalah rekayasa untuk perubahan sosialdalam rangka memanusiakan manusia.

Perencanaan turbin uap curtis, satu tingkat tekanan dua tingkat kecepatan
oleh Hariyanto

 

Penerapan model pembelajaran problem based learning untuk meningkatkan berfikir kritis dan hasil belajar siswa pada mata pelajaran sosiologi / Izanhalily

 

ABSTRAK Izanhalily. 2015. Penerapan Model Pembalajaran Problem Based Learning untuk Meningkatkan Berfikir Kritis dan Hasil Belajar Siswa pada Mata Pelajaran Sosiologi. Tesis. Prodi Teknologi Pembelajaran, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. AJE Toenlioe, M.Pd, (2) Dr. Sulton, M.Pd. Kata kunci: model pembelajaran, problem based learning, berfikir kritis, hasil belajar. Penelitian ini didasarkan dari permasalahan dalam pembelajaran dimana pembelajaran yang sering dilakukan adalah pembelajaran ekpository (exspository learning) yang merupakan proses pembelajaran yang berpusat pada guru (teacher centered). Pembelajaran juga masih berkutat pada low order thingking. Pembelajaran ini membuat siswa tidak mampu berfikir kritis dan hasil belajar yang rendah. Karena itulah peneliti melaksanakan tindakan pembelajaran berupa penerapan model pembelajaran berbasis masalah yang menekankan pemberian pengalaman pembelajaran secara langsung dengan kata lain merubah pemebelajaran teachered centered menjadi student centered. Tujuannya agar siswa mampu berfikir kritis serta mampu menganalisis setiap permasalahan dengan benar dan mampu mengambil keputusan yang tepat dan meningkatkan hasil belajar siswa. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang dilaksanakan dalam dua siklus, dan masing-masing siklus terdiri dari 4 kali pertemuan. Setiap siklus dilaksanakan dengan tahapan perencanaan, tindakan, observasi dan refleksi. Peneliti tidak melaksanakan tindakan, tidakan dilakukan oleh guru sosiologi. Subjek yang diteliti adalah siswa kelas XI IPS I di SMAN 3 Kundur yang berjumlah 33 siswa, terdiri dari 17 siswa laki-laki dan 16 siswa perempuan. Pengumpulan data dilakukan dengan cara: (1) observasi, (2) tes tertulis (3) wawancara. Berdasarkan hasil penelitian diperoleh temuan tentang langkah PBL yang diterapkan yaitu: (1) orientasi terhadap masalah, menjelaskan strategi yang akan digunakan, mengadakan tanya jawab dan menayangkan video, memotivasi dengan menjanjikan penghargaan, (2) mengorganisasi siswa untuk belajar, guru membagi siswa dalam kelompok kecil yang heterogen dengan memperhatikan kemampuan dan jenis kelamin, (3) membimbing penyelidikan individu/kelompok, mengarahkan dan membimbing siswa untuk menyusun sendiri kerangka penelitian, mengajukan pertanyaan-pertanyaan menggali untuk mengarahkan siswa dan memotivasi siswa, (4) mengembangkan / menyajikan hasil karya, siswa menuliskan hasil diskusi dalam bentuk laporan serta chart untuk dipresentasikan, (5) analisis dan evaluasi proses pemecahan masalah, dengan tanya jawab, siswa mengevaluasi proses diskusi untuk pemecahan masalah. Peningkatan kemampuan berfikir kritis itu terlihat dengan meningkatnya pencapaian angka pada siklus I hanya mencapai 72,73% meningkat sebesar 18,18% menjadi 90,91% pada siklus II dan dikategorikan berhasil.Penerapan model Problem Based Learning dapat meningkatkan hasil belajar dengan cara melibatkan siswa secara aktif dalam proses pembelajaran, menyimpulkan materi, merangkum kembali dalam bentuk chart. Peningkatan hasil belajar siswa terlihat dalam pencapaian angka siswa yaitu pada siklus I hasil belajar siswa mencapai 72,72% lalu meningkat 24,25% pada siklus II menjadi 96,97%. Saran yang dapat diberikan adalah: (1) upaya peningkatan berfikir kritis dan hasil belajar dengan model problem based learning sebaiknya dikombinasikan dengan model pembelajaran lainnya sehingga pencapaian kemampuan dapat lebih optimal, (2) disarankan untuk semua guru-guru meningkatkan pemahaman dan ketrampilannya terhadap model-model pembelajaran. Hal ini bisa dilakukan dengan memberdayakan forum MGMP, (3) peningkatan fasilitas dan sarana prasarana di sekolah sangat penting dan mendesak karena dengan minimnya fasilitas dan sarana prasarana sekolah dirasa sangat menghambat pelaksanaan proses pembelajaran, (4) bagi peneliti lainnya, diharapkan dapat lebih mengembangkan penelitian baik dalam model pembelajaran problem based learningmaupun pada mata pelajaran sosiologi sehingga dapat lebih dapat meningkatkan kualitas pembelajaran.

Perencanaan Konstruksi
disusun oleh Winarto Hadi

 

Pengembangan bahan ajar berbasis web untuk matakuliah desain pesan di Program Studi Teknologi Pendidikan Universitas Negeri Makassar / Mesach Dayunison Parumbuan

 

ABSTRAK Parumbuan, Mesach Dayunison. 2015. Pengembangan Bahan Ajar Berbasis Web Untuk Matakuliah Desain Pesan di Program Studi Teknologi Pendidikan Universitas Negeri Makassar. Pembimbing: (I) Dr. Sulton, M.Pd., (II) Dr. Sihkabuden, M.Pd. Kata Kunci: pengembangan, web, bahan ajar berbasis web, desain pesan. Teknologi web memungkinkan pembelajar untuk menciptakan lingkungan belajar yang efektif, efisien, menarik dan interaktif untuk memfasilitasi belajar pebelajar. Kenyataan dilapangan, khususnya di Program Studi Teknologi Pendidikan Universitas Negeri Makassar masih belum memanfaatkan media web dengan optimal, baik dalam menyajikan materi atau melaksanakan pembelajaran. Berdasarkan, penilaian pada matakuliah desain pesan, pembelajaran masih terpusat pada dosen, dosen menyajikan materi secara verbal di kelas, bahan ajar yang digunakan masih sangat abstrak karena hanya didominasi teks, menyebabkan mahasiswa pasif dan kesulitan dalam memahami konsep-konsep desain pesan dan merancang desain pesan sesuai dengan prinsip-prinsip desain pesan. Penelitian dan Pengembangan ini menggunakan model pengembangan Lee dan Owens (2004) untuk menghasilkan produk bahan ajar berbasis web. Langkah-langkah pengembangan dalam model ini adalah 1) penilaian kebutuhan (need assessment) dan analisis awal-akhir (front-end analysis); 2) desain (design); 3) pengembangan (development); 4) implementasi (implementation); dan 5) evaluasi (evaluation). Instrumen yang digunakan untuk memperoleh data ialah angket dan tes hasil belajar. Data dalam pengembangan ini adalah data kuantitatif yang bersumber dari skor angket dan tes hasil belajar, dan data kualitatif berupa saran dan komentar. Dalam pengembangan ini data dari ahli isi, ahli media, ahli desain, uji perorangan, uji kelompok kecil, uji lapangan merupakan evaluasi formatif, sedangkan data dari hasil tes belajar adalah evaluasi sumatif. Hasil uji coba yang dilakukan terhadap subjek coba menunjukkan bahan ajar berbasis web untuk matakuliah desain pesan di Program Studi Teknologi Pendidikan, Universitas Negeri Makassar, layak dan efektif digunakan dalam pembelajaran. Berdasarkan penilaian ahli isi, diperoleh skor 98% (sangat layak), penilaian ahli media 92% (sangat layak), penilaian ahli desain 96% (sangat layak), dan uji coba perorangan 3 mahasiswa 81% (sangat layak) dan dosen pengampu matakuliah 95% (sangat layak), uji kelompok kecil 78% (layak), dan uji lapangan 83% (sangat layak). Untuk menilai tingkat efektivitas, maka produk diimplemetasikan kedalam pembelajaran. Berdasarkan hasil uji efektivitas terhadap 34 orang mahasiswa diperoleh persentase mahasiswa yang mencapai kelulusan sebesar 85%, yang berarti produk bahan ajar berbasis web untuk matakuliah desain pesan di Program Studi Teknologi Pendidikan, Universitas Negeri Makassar, sangat efektif digunakan dalam pembelajaran.

Perencanaan pompa sentrifugal
Dwi Andoko

 

Konstruksi beton III
oleh M. Zainul Arifin

 

Perilaku masyarakat yang mencerminkan nilai-nilai kepercayaan dalam upacara adat siraman gonmg Kyai Pradah di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar / Nunik Ratnawati

 

Kata Kunci: Perilaku, Masyarakat, Nilai-nilai, Kepercayaan, Upacara adat Siraman Gong Kyai Pradah. Upacara Siraman Gong Kyai Pradah (SGKP) di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar mengandung nilai-nilai yang tercermin dalam perilaku masyarakatnya. Nilai-nilai dalam upacara siraman Gong Kyai Pradah di Kelurahan Kalipang merupakan realitas sosial yang dirasakan sebagai daya pendorong atau prinsip-prinsip yang menjadi pedoman dalam hidup. Kepercayaan Masyarakat Kelurahan Kalipang bahwa Tuhan Memiliki Kekuatan yang luar biasa dan dengan perantara Pusaka Gong Kyai Pradah diyakini bisa melindungi masyarakat. Upacara adat Siraman Gong Kyai Pradah bertujuan untuk menghormati, mensyukuri, memuja, memohon keselamatan kepada Tuhan Yang Maha Esa melalui makhluk halus dan leluhurnya. Penelitian ini bertujuan untuk mengetahui;(1) Sejarah Pusaka Gong Kyai Pradah (PGKP) di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar;(2) Proses upacara siraman Gong Kyai Pradah (SGKP) di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar;(3) Nilai-nilai kepercayaan yang terdapat dalam SGKP di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar;(4) Perilaku masyarakat yang mencerminkan nilai-nilai kepercayaan yang terkandung dalam SGKP di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar. Metode yang digunakan dalam penelitian ini adalah menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Teknik pengumpulan data yang digunakan adalah observasi partisipatif, wawancara mendalam, dokumentasi. Jadi data yang digunakan berasal dari hasil observasi di Kelurahan Kalipang Kecamatan Sutojayan Kabupaten Blitar, wawancara dari informan, dan temuan penelitian lapangan. Hasil Penelitian ini diperoleh kesimpulan bahwa, (1) Sejarah keberadaan Pusaka Gong Kyai Pradah ada sejak tahun 1719 di bawa oleh Pangeran Prabu ke Desa Ludoyo dan Dititipkan kepada seorang janda nenek tua yang bernama Potrosuto, dan di warisi turun temurun oleh keturunannya, (2) Pelaksanaan upacara SGKP di Kelurahan kalipang, Kecamatan sutojayan, Kabupaten Blitar ini, terdiri dari dua tahap, yaitu tahap persiapan dan tahap pelaksanaan, (3) Nilainilai kepercayaan yang tedapat dalam upacara siraman gong kyai pradah, diantaranya: Nilai religi, nilai musyawarah, nilai kekeluargaan, nilai gotong royong, nilai persatuan, nilai estetika, nilai kebudayaan, dan nilai ekonomis, (4) Perilaku masyarakat yang mencerminkan nilai-nilai kepercayaan yang terkandung dalam upacara siraman gong kyai pradah , masyarakat mendatangi tempat upacara ii dan memperebutkan air sisa siraman agar penyakit yang diderita bisa sembuh, dan bisa awet muda, serta mendapat berkah. Selain itu kepercayaan masyarakat terhadap pusaka itu sendiri mendorong masyarakat untuk melakukan kegiatankegiatan seperti, nyekar pada saat punya hajatan, dan nyekar rutinan pada hari malam jumat legi. Berdasarkan hasil penelitian ini, dapat disarankan; (1) Agar upacara SGKP tetap terjaga kelestariannya dan tidak punah sampai kapanpun, sebaiknya upacara SGKP dilakukan setiap tahun oleh Masyarakat Kabupaten Blitar karena SGKP sebagai budaya asli daerah Kabupaten Blitar, (2) Agar dalam upaya pengembangan kebudayaan yang ada di kabupaten Blitar ini tetap terjaga, sebaiknya pemerintahan Kabupaten Blitar teliti terhadap setiap kebudayaan yang ada di Kabupaten Blitar, jangan sampai budaya Kabupaten Blitar diambil oleh daerah lain bahkan diklaim budaya asing, (3) Agar kebudayaan yang ada tetap terjaga, sebaiknya melakukan pendataan ulang secara cermat mengenai kebudayaan-kebudayaan yang ada di Kabupaten Blitar, sehingga budaya yang ada tidak akan hilang, karena sebagai aset budaya lokal, (4) Agar kebudayaan yang telah ditinggalkan oleh nenek moyang kita dari jaman dulu hingga sekarang ini tidak akan punah sampai akhir jaman, sebaiknya warga masyarakat kelurahan Kalipang dan sekitarnya perlu adanya pembinaan khusus terhadap generasi muda, karena generasi muda sebagai penerus kebudayaan dari nenek moyangnya, (5) Agar memiliki arsip dan dokumentasi mengenai upacara SGKP yang setiap tahun diadakan di daeranya, sebaiknya setiap tahun selalu memiliki dokumentasidokumentasi yang berkaitan dengan upacara SGKP, (6) Agar upacara SGKP dapat dikenal luas diwilayah lain di Indonesia, sebaiknya ketika menyaksikan prosesi upacara SGKP tidak hanya melihat dan memperebutkan airnya, namun juga ikut mendokumentasikannya dan bekerjasama dengan media elektronik untuk meliput berlangsungnya proses upacara SGKP.

Perencanaan Konstruksi I
laporan
disusun oleh Sudibyo

 

Pengembngan perangkat pembelajaran ekonomi dengan model flipped classroom untuk meningkatkan keaktifan belajar siswa / Aditya Dewantari

 

ABSTRAK Dewantari, Aditya. 2015. PengembanganPerangkatPembelajaranEkonomidengan Model Flipped Classroom untukMeningkatkanKeaktifanBelajarSiswa.Tesis, Program StudiPendidikanEkonomi, JurusanEkonomi Pembangunan, FakulrasPascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. HariWahyono, M.Pd. (II) Dr. MitWitjaksono, Ms.Ed. Kata Kunci:flipped classroom,pembelajaran ekonomi, keaktifan Peran guru dalam prosespembelajaranadalahmembimbingsiswapadakondisibelajaruntukmengkonstrukpengetahuanbaruberdasarkanpengetahuanbelajarawal yang dimilikisiswadankegiatanpembelajaranhendakberpusatpadasiswa. Guruhendaknyamampuuntukmenyajikandanmerancangpembelajaran yangmenarik, dengankegiatan yang berpusatpadasiswasehinggasiswaaktifdalam proses pembelajaran. Banyak model pembelajaran yang dapatdigunakan guru untukmencapaihaltersebut, salahsatunyadenganpembelajaranFlipped Classroom.Tujuanpenelitianiniadalahuntuk (1) Menghasilkansebuahrancanganpembelajaranekonomi yang dikembangkandenganmenggunakan model Flipped Classroomuntukmeningkatkankeaktifanbelajarsiswa, (2) mengetahuikeefektifandaripenggunaanperangkatpembelajarandenganmenggunakan model Flipped Classroom padamatapelajaranekonomi. Pengembanganperangkat pembelajaranekonomiinimenggunakanpendekatandesign based research (DBR) denganmelewatienamfaseyaitu, melakukanidentifikasimasalah, merumuskanprodukberupaperangkatpembelajaranekonomidengan model flipped classroom, desaindanpengembanganperangkatpembelajaran, ujicobapengembanganperangkatpembelajaran, evaluasikelayakanpengembanganperangkatpembelajaran, dankomunikasihasilujicobapengembanganperangkatpembelajaran. Penelitiandanpengembanganperangkatpembelajaraninidiujicobakanpadasiswakelas XI kelompokpeminatanekonomi di SMA Negeri 5 Malang.Dari hasilpenelitianini diperoleh hasilbahwakeaktifanbelajarsiswameningkatcukuptinggidibandingkandengansaatobservasiawal.Setelahpenerapanperangkatpembelajarandenganmenggunakan model flipped classroompersentasekeaktifansiswa yang masukdalamkategorisangatbaikyaitusebesar 87,09%. Penelitian dan pengembangan ini telah menghasilkan perangkat pembelajaran berupa Rencana Pelaksanaan Pembelajaran, Buku Kegiatan Guru, Lembar Kerja Siswa, dan Video Pembelajaran. Dan dari hasil uji coba lapanganmenunjukkanbahwakegiatanpembelajaran yang dikembangkandengan model Flipped Classroomdapatmenigkatkankeaktifanbelajarsiswa, karenadalampembelajaraninidisusunberbagaikegiatan yang langsungmelibatkansiswa.

Perencanaan irigasi
oleh I Kom. Sukarata

 

Pengembangan paket bahan ajar cetak bahasa korea berbantuan mobile device untuk kelas X di SMA Diponegoro Tumpang Kabupaten Malang / Dwi Ristin Sulistiana

 

ABSTRAK Sulistiana, DwiRistin. 2015. PengembanganPaketBahan Ajar Bahasa KoreaBerbantuan Mobile Device untukKelas X di SMA DiponegoroTumpangKabupaten Malang. Tesis.JurusanTeknologiPembelajaran, PascasarjanaUniversitasNegeri Malang. Pembimbing: (1) Dr. Sulthon, M. Pd , (II) Dr. Anselmus. J. E Toenlioe, M.Pd. Kata Kunci:PaketBahan Ajar, Bahasa Korea, QR Code Bahasa Korea adalahsalahsatumatapelajaranbahasaasing di SMA DiponegoroTumpangKabupaten Malang.Tujuanpenelitiandanpengembanganiniadalahmenghasilkanpaketbahan ajarcetakBahasa Koreauntukkelas Xdi SMA DiponegoroTumpang yang layakdandapatdigunakansecaraklasikalmaupun individual berbantuanMobile DeviceberupaSmartphone.Paketbahan ajar iniberupabahancetak yang terdiridaribahan ajar, panduan guru, danpanduansiswa. Penelitianpengembanganinidirancangmenggunakan model pengembangan Dick and Carey.Langkah-langkah yang dilakukandalampengembanganpaketbahan ajar inihanyalahsampaipadatahapevaluasiformatif.Padaevaluasiformatifdilakukanujiperorangan, ujikelompokkecil, danujilapangan.Sebelumketigapengujiantersebutdilakukan, bahan ajar diPenilaianterlebihdahuluolehahlibidangstudi, ahli media, danahlidesain. Penelitianinidilakukan di SMA DiponegoroTumpangKabupaten Malang.Subjekpenelitianterdiridari 29 siswadan 1 orang guru.Instrumenpengumpulan data menggunakanangket, wawancara, danobservasi.Data yang dihasilkanberupa data kualitatifdankuantitatif.HasilPenilaianahlimaterimenunjukkankualifikasibahan ajar sangat valid ataudapatdigunakantanparevisi (91,66%), panduan guru cukup valid ataudapatdigunakandenganrevisikecil (75%), panduansiswacukup valid ataudapatdigunakandenganrevisikecil (75%). Penilaianahli media menunjukkankualifikasipaketbahan ajar cukup valid ataudapatdigunakandenganrevisikecil (bahan ajar 78,57%, panduan guru 77,4%, panduansiswa 75%). Penilaianahlidesainmenunjukkanbahwapaketbahan ajar dalamkualifikasisangat valid ataudapatdigunakantanparevisi (bahan ajar 95,58% , panduan guru 97,5%, panduansiswa 97,5%). Hasilujicobaperoranganmenunjukkanpaketbahan ajar dalamkualifikasisangat valid ataudapatdigunakantanparevisi (bahan ajar 86, 97%, panduansiswa 86,66%). Hasilujicobakelompokkecilmenunjukkankualifikasibahan ajar cukup valid ataudapatdigunakandenganrevisikecil (84,68%), panduansiswasangat valid ataudapatdigunakantanparevisi (86,56%). Hasilujicobakelompokbesarmenunjukkanbahwapaketbahan ajar dalamkualifikasisangat valid ataudapatdigunakantanparevisi (bahan ajar 85,41%, panduansiswa 86,80%, panduan guru 90%, penilaian guru padabahan ajar 90%). Hasilkeseluruhandariujicobakelompokbesarmenunjukkanbahwabahan ajar dalamkualifikasisangat valid ataudapatdigunakantanparevisi.Berdasarkanteshasilbelajardidapatkanbahwabahan ajar mampumembantusiswadalammemenuhitujuanpembelajaran. Saran pemanfaatan1) bahan ajar dapatdimanfaatkandalampembelajaranklasikal.Sebelummemanfaatkanbahan ajar inidalampembelajaranklasikal, guru sebaiknyamemperhatikanalokasiwaktudanstrategipembelajaran yang tercantumdalampanduan guru, 2) bahan ajar dapatdigunakandalampembelajaran individual.Padapembelajaran individual, pebelajarharusmempelajaricarapenilaianpadasetiapbabuntukdapatmenilaihasilkerjanyasendiri, 3) padamateri yang membutuhkanakseske media audio, sebelummemanfaatkanbahan ajar, pastikansmartphonemendapatkankoneksi internet yangbaik, 4) pebelajar yang tidakmemilikismartphonedapatmenggunakanbahan ajar inibersamadenganpebelajar yang memilikismartphone, 5) penggunaanheadsetdapatmemudahkanpebelajarmendengarkan audio secarajelas. Bahan ajar inidapatdigunakansecaraluassetelahdilakukanevaluasisumatifdanditerapkanpadasekolah yang memilikikurikulumbahasa Korea yang samadengan SMA DiponegoroTumpang. Selanjutnya, diharapkanadanyapengembangandalambentuk multimedia, permainanatauaplikasi yang menarikdanmudahdiaksesolehpebelajar

Pengembangan paket pembelajaran pendidikan agama Katolik kelas 5 SLB-B Karya Kasih Ambon dengan model Dick & Carey / Fransina Lamere

 

Kata Kunci: Pengembangan, Paket Pembelajaran, Pendidikan Agama Katolik, Model Dick dan Carey. Manusia diciptakan Allah baik adanya sehingga memiliki hak hidup yang sama, hak sebagai warga negara termasuk hak mendapat pendidikan yang layak. Layanan pendidikan ditujukan kepada semua orang tanpa membedakan normal atau anak berkebutuhan khusus (cacad). Karena kecacatan tidak membatasi seseorang untuk mendapat pendidikan yang baik dan layak. Tunarungu merupakan salah satu dari anak berkebutuhan khusus yang perlu mendapat pendidikan seperti anak sebayanya yang normal. Tunarungu artinya anak yang mengalami gangguan pendengaran dan komunikasi. Dampak dari ketunarunguan adalah hambatan dalam berkomunikasi dan dalam melaksanakan aktivitas dalam kehidupan sehari-hari, serta dapat menghambat perkembangan kepribadian secara keseluruhan. Pendidikan bagi anak tunarungu, bertujuan untuk membantu mereka agar mampu mengembangkan sikap, pengetahuan, dan keterampilan sebagai pribadi maupun anggota masyarakat dalam mengadakan hubungan timbal balik dengan lingkungan sosial, budaya, dan alam sekitar, serta dapat mengembangkan kemampuan dalam dunia kerja atau mengikuti pendidikan lanjutan. Pendidikan Agama Katolik merupakan mata pelajaran wajib diajarkan di sekolah. Selama ini mata pelajaran Pendidikan Agama Katolik diajarkan dengan menggunakan buku-buku paket yang semestinya bagi anak - anak normal pada setiap jenjang pendidikan mulai dari jenjang sekolah dasar (TK dan SD) sampai pada jenjang menengah (SMP). Secara umum, isi materi dalam buku mata pelajaran Pendidikan Agama Katolik ini lebih banyak diarahkan kepada anak-anak normal dan belum menjawab kebutuhan anak-anak tunarungu. Untuk itu, pengembang mengembangkan paket pembelajaran Pendidikan Agama Katolik sesuai dengan kebutuhan anak tunarungu dengan memperhatikan karakteristik dan kondisi siswa. Tujuan dari pengembangan paket pembelajaran ini adalah: menghasilkan seperangkat paket pembelajaran mata pelajaran Pendidikan Agama Katolik kelas 5 untuk tunarungu, berupa buku teks, panduan guru, panduan siswa. Pengembangan paket pembelajaran tersebut diharapkan dapat menjadi salah satu sumber belajar, memudahkan siswa mempelajarinya dan memahami isinnya, serta memperlancar dan mempermudah proses pembelajaran. Pengembangan paket pembelajaran tersebut didesain/ dirancang dengan menggunakan model Dick dan Carey (2001). Desain Pembelajaran model Dick dan Carey terdiri atas 10 langkah di mana setiap langkah sangat jelas maksud dan tujuannya, Kesepuluh langkah tersebut menunjukkan hubungan yang sangat jelas, dan tidak terputus antara langkah yang satu dengan langkah yang lainnya. Namun untuk kepentingan penulisan tesis ini pengembang hanya sampai pada langkah kesembilan. Langkah-langkah model rancangan pembelajaran Dick dan Carey (2001) adalah sebagai berikut: (1) analisis kebutuhan untuk menentukan tujuan, (2) melakukan analisis pembelajaran, (3) mengidentifikasi tingkah laku masukan dan karakteristik siswa, (4) merumuskan tujuan khusus pembelajaran, (5) mengembangkan instrumen penilaian, (6) pengembangan strategi pembelajaran, (7) mengembangkan dan memilih materi pembelajaran, (8) merancang dan melaksanakan penilaian formatif, (9) revisi pembelajaran. Penelitian ini dilaksanakan di SLB-B Karya Kasih Ambon Siswa kelas 5. Penelitian ini menempuh beberapa tahapan sesuai dengan model yang digunakan dengan teknik pengumpulan data yakni uji coba instrumen yakni uji coba perorangan yang terdiri atas 2 siswa dan uji coba lapangan yang terdiri atas 5 siswa, wawancara dengan para ahli, dan pengisian angket. Hasil penelitian menunjukkan bahwa uji validasi produk oleh Ahli isi mata pelajaran Pendidikan Agama Katolik mencapai kualifikasi sangat baik dimana rerata produk buku ajar 93,75%, panduan guru 90,63%, panduan siswa 87,5%. Selanjutnya dari hasil validasi ahli desain pembelajaran dinyatakan baik dengan rerata produk buku ajar 76,79%, panduan guru 80,36%, panduan siswa 82,5%. Pada tahap uji coba perorangan dilaporkan bahwa produk ini perlu direvisi baik menyangkut kesalahan ketik, tanda baca, penggunaan huruf kapital dan huruf kecil. Hasil uji coba lapangan, 1 responden yaitu guru mata pelajaran menyatakan rerata pencapaian produk buku ajar 90% sangat baik, panduan guru mencapai 89% sangat baik, dari hasil angket 5 siswa dinyatakan sangat baik, rerata bahan ajar 91,79% dan rerata panduan siswa 89%. Dari gambaran hasil penelitian diatas, maka dapat disimpulkan bahwa paket pembelajaran Pendidikan Agama Katolik kelas 5 Sekolah Luar Biasa Tunarungu sesuai dengan karateristik dan kebutuhan anak tunarungu dan layak untuk digunakan. Beberapa saran untuk meningkatkan persentase dan kualitas pemanfaatan produk adalah: (1) peran guru sangat diperlukan sebagai fasilitator demi kelancaran dan kualitas proses pelaksanaan pembelajaran (2) cerita Kitab Suci sebaiknya tidak disertai gembar yang telah disiapkan guru, melainkan cerita tersebut diilustrasikan/digambar sendiri oleh siswa. (3) melaksanakan pembelajaran sesuai dengan petunjuk yang tercantum dalam paket pembelajaran ini. (4) sebagai salah satu sumber belajar baik bagi guru maupun siswa. (5) dalam proses pembelajaran terdapat kata atau kalimat yang belum dimengerti/dipahami siswa, maka guru perlu memberikan penjelasan tentang kata atau kalimat tersebut agar dipahami siswa.

Perencanaan motor diesel empat langkah sebagai penggerak generator
oleh Untung

 

Pengaruh strategi pembelajaran job safety analysis dan lokus kendali terhadap hasil belajar kompetensi Keselamatan dan Kesehatan Kerja (K3) program keahlian teknik pemesinan siswa SMK Kota Malang dan Kabupaten Malang / Duwi Leksono Edy

 

Hubungan pemahaman konsep asam-basa arrhenius dan brosnted-lowry dengan konsep hidrolisis garam siswa kelas XI IPA SMA Negeri 1 Lawang tahun ajaran 2009/2010 / Ratna Kartika Irawati

 

Kata Kunci : Pemahaman konsep, asam-basa, hidrolisis garam Ilmu kimia merupakan cabang dari Ilmu Pengetahuan Alam (IPA). Konsep-konsep yang abstrak dan saling berhubungan merupakan salah satu ciri dari ilmu kimia sehingga diperlukan pemahaman yang benar terhadap konsep-konsep kimia tersebut. Konsep asam-basa merupakan dasar untuk mempelajari konsep hidrolisis garam. Pemahaman konsep-konsep yang sederhana akan mempermudah dalam memahami konsep yang lebih kompleks. Pemahaman konsep asam-basa mendasari untuk memahami konsep hidrolisis garam, sehingga diperkirakan apabila siswa kurang menguasai konsep asam basa, maka siswa juga kurang menguasai konsep hidrolisis garam. Tujuan dari penelitian adalah untuk mendeskripsikan: (1) tingkat pemahaman konsep asam-basa siswa kelas XI IPA SMA Negeri 1 Lawang; (2) tingkat pemahaman konsep hidrolisis garam siswa kelas XI IPA SMA Negeri 1 Lawang; (3) hubungan antara tingkat pemahaman konsep asam-basa dengan tingkat pemahaman konsep hidrolisis garam siswa kelas XI IPA SMA Negeri 1 Lawang. Penelitian ini menggunakan rancangan penelitian deskriptif dan korelasional. Populasi penelitian adalah siswa kelas XI IPA SMA Negeri 1 Lawang. Sampel penelitian adalah siswa kelas XI IPA 3 SMA Negeri 1 Lawang tahun ajaran 2009/2010 yang berjumlah 35 orang, diambil dengan teknik sampling kelompok (cluster). Data penelitian diperoleh dari tes pemahaman konsep asam-basa dan tes pemahaman konsep hidrolisis garam. Instrumen penelitian yang digunakan adalah tes tertulis obyektif yang terdiri atas 30 soal pilihan ganda yang valid dengan koefisien reliabilitas sebesar 0,728. Analisis data yang digunakan yaitu uji normalitas, uji linearitas dan uji korelasi product moment Pearson. Hasil penelitian menunjukkan bahwa (1) tingkat pemahaman konsep asam-basa siswa kelas XI SMA Negeri 1 Lawang tergolong cukup dengan nilai rata-rata 72; (2) tingkat pemahaman konsep hidrolisis garam tergolong cukup dengan nilai rata-rata sebesar 73,91; (3) terdapat hubungan yang kuat antara pemahaman konsep asam-basa dengan pemahaman konsep hidrolisis garam siswa kelas XI IPA SMA Negeri 1 Lawang dengan nilai rxy sebesar 0,665 pada taraf signifikansi 0,05 sehingga konsep asam-basa harus diajarkan terlebih dahulu kepada siswa sebelum diajarkan konsep hidrolisis garam.

Perencanaan konstruksi beton berlantai III gedung museum
tugas
oleh Nggau Behar

 

Perencanaan konstruksi beton III (bangunan gedung pabrik tebu)
tugas
oleh Ismudjadi

 

Perencanaan konstruksi beton untuk bangunan pertokoan
oleh Eko Budi Mardianto

 

Penerapan model pembelajaran timed pair share dan Fan-N-Pick untuk meningkatkan motivasi dan hasil belajar IPS (studi kelas VIIIb SMP Gaya Baru kecamatan Gedangan Kabupaten Malang) / Mustifah

 

ABSTRAK Mustifah. 2015. Penerapan Model Pembelajaran Timed Pair Share dan Fan-N-Pick untuk Meningkatkan Motivasi dan Hasil Belajar IPS (Studi Kelas VIII B SMP GAYA BARU Kecamatan Gedangan Kabupaten Malang). Tesis. Program Studi Pendidikan Dasar, Konsentrasi Pendidikan IPS, Pascasarjana Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Budi Eko Soetjipto M. Ed., M.Si (II) Prof. Dr. Sumarmi M. Pd. Kata Kunci: Timed Pair Share, Fan-N-Pick, Motivasi Belajar, Hasil Belajar . Berdasarkan observasi awal yang dilakukan di SMP GAYA BARU Kecamatan gedangan Kabupaten Malang dapat ditemukan permasalahan sebagai berikut ; 1) motivasi belajar siswa di sekolah tersebut rendah; 2) nilai hasil belajar kognitif juga rendah. Hal tersebut dapat dilihat dari perhatian siswa terhadap pelajaran masih kurang, hal ini dibuktikan dengan masih banyaknya siswa yang tidak serius dalam mengerjakan tugas dari guru. Kurang adanya rasa percaya diri siswa selama proses pembelajaran yang dilakukan di sekolah, pembelajaran cenderung berpusat pada guru yang menyebabkan siswa pasif. Kurang adanya pemahaman siswa terhadap kegunaan materi yang dipelajari, karena dianggap tidak ada keterkaitan dalam kehidupan sehari-hari. Untuk mengatasi hal tersebut maka diterapkan model pembelajaran Timed Pair Share dan Fan-N-Pick sebagai salah satu upaya yang dapat dilakukan untuk mengatasi permasalah-permasalahan yang ada. Tujuan penelitian secara rinci adalah (1) untuk mengetahui bagaimana pembelajaran Timed Pair Share dan Fan-N-Pick yang dapat meningkatkan motivasi dan hasil belajar siswa kelas VIII B SMP GAYA BARU Kecamatan Gedangan Kabupaten Malang, (2) untuk mengetahui bagaimana peningkatkan motivasi belajar IPS siswa setelah penerapan model pembelajaran Timed Pair Share dan Fan-N-Pick pada kelas VIII B SMP GAYA BARU Kecamatan Gedangan Kabupaten Malang, (3) untuk mengetahui bagaimana peningkatan hasil belajar siswa setelah penerapan model pembelajaran Timed Pair Share dan Fan-N-Pick pada siswa kelas VIII B SMP GAYA BARU Kecamatan Gedangan Kabupaten Malang. Rancangan yang digunakan adalah penelitian tindakan kelas dengan 4 tahapan, yaitu (1) perencanaan, (2) pelaksanaan, (3) pengamatan, (4) refleksi. Subyek penelitian adalah siswa kelas VIII B SMP GAYA BARU Kecamatan Gedangan Kabupaten Malang. Instrumen pengumpulan data yang digunakan yaitu (1) observasi, (2) angket, (3) tes, dan (4) dokumentasi. Data tentang penerapan model pembelajaran Timed Pair Share dan Fan-N-Pick dikumpulkan melalui lembar observasi keterlaksanaan pembelajaran oleh guru dan siswa, data motivasi dikumpulkan melalui pengisian angket motivasi belajar siswa yang dilakukan sebelum tindakan dan tiap akhir siklus, data hasil belajar siswa dikumpulkan melalui tes hasil belajar yang dilakukan pada tiap akhir siklus. Hasil penelitian menunjukkan penerapan model pembelajaran Timed Pair Share dan Fan-N-Pick telah berjalan dengan baik. Hal tersebut dapat dilihat dari keterlaksanaan pembelajaran oleh guru pada tiap siklus mengalami peningkatan siklus I mencapai 86,8% pada siklus II mencapai 90,5% sedangkan keterlaksanaan pembelajaran oleh siswa juga meningkat pada siklus I mencapai 79% dengan kriteria baik, siklus II mencapai 85,8% dengan kriteria sangat baik. Penerapan model pembelajarn Timed Pair Share dan Fan-N-Pick juga dapat meningkatkan motivasi belajar siswa dimana sebelum tindakan skor rata-rata motivasi belajar siswa mencapai 46,32%, siklus I skor rata-rata motivasi belajar siswa mencapai 61,95 dengan kriteria tinggi sedangkan pada akhir siklus II skor rata-rata motivasi belajar siswa mencapai 81,54% yaitu berada pada kriteria sangat tinggi, hasil belajar kognitif siswa juga mengalami peningkatan dari nilai rata-rata kelas siklus I sebesar 2,98 meningkat pada siklus II mencapai 3,19 sedangkan ketuntasan klasikal kelas siklus I mencapai 72%, pada siklus II meningkat menjadi 92% atau pada kriteria sangat baik. Berdasar hasil penelitian disarankan (1) bagi guru untuk dapat mempertimbangkan model pembelajaran Timed Pair Share dan Fan-N-Pick sebagai salah satu pilihan model pembelajaran yang layak digunakan dalam pembelajaran IPS yang sesuai dengan karakteristik materi pembelajaran. Penerapan model pembelajaran Timed Pair Share dan Fan-N-Pick membutuhkan pengelolaan kelas yang baik karena pembelajaran ini melibatkan siswa secara aktif dalam pembelajaran, sehingga pembelajaran dapat berjalan sesuai dengan tujuan, (2) Bagi peneliti selanjutnya dalam melaksanakan penelitian tindakan kelas menggunakan model pembeajaran Timed Pair Share dan Fan-N-Pick sebaiknya, a) guru menjelaskan langkah-langkah pembelajaran hingga siswa benar-benar memahami cara kerja kelompok maupun individu sehingga siswa dapat menjalankan perannya dalam pembelajaran dengan baik, b) perhatian guru pada siswa di tiap kelompok harus dimaksimalkan serta mengarahkan dan membimbing siswa dalam kerja kelompok mengingat model pembelajaran ini melibatkan semua siswa dalam pembelajaran, dengan demikian pembelajaran dapat berjalan efektif

Hubungan antara tingkat pendidikan dan lingkungan sosial dan perilaku konsumtif masyarakat desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar / Rinata

 

Kata kunci : Tingkat pendidikan, lingkungan sosial, perilaku konsumtif. Masyarakat Desa Tumpak Kepuh pada saat ini sebagian besar adalah bekerja sebagai TKI. Sebagian besar masyarakatnya dapat dikatakan memiliki tingkat pendidikan yang rendah, banyak para pemudanya yang setelah lulus dari SMP atau bahkan SD lebih memilih bekerja sebagai TKI di luar negeri dari pada melanjutkan sekolah ke jenjang yang lebih tinggi. Dahulunya masyarakat Desa Tumpak Kepuh ini memiliki mata pencaharian utama sebagai petani di ladang, namun saat ini dengan banyaknya warga masyarakat yang menjadi TKI maka telah terjadi peningkatan pendapatan dan perbaikan di bidang ekonomi. Namun demikian hal tersebut justru seakan mengubah gaya hidup masyarakat yang cenderung mengarah pada perilaku konsumtif. Fenomena perilaku konsumtif ini semakin terlihat di Desa Tumpak Kepuh, pakaian model terbaru, memakai perhiasan yang berlebihan, kendaraan yang bagus dan perabotan rumah tangga yang beraneka ragam seakan-akan menjadi kebutuhan utama yang harus dipenuhi oleh masyarakat di desa ini, bahkan pemenuhan kebutuhan terhadap barangbarang tersebut dapat dikatakan berlebihan. Berdasarkan latar belakang di atas maka dilakukan penelitian tentang hubungan antara tingkat pendidikan dan lingkungan sosial dengan perilaku konsumtif masyarakat Desa Tumpak Kepuh. Tujuan dari penelitian ini adalah: (1) mendeskripsikan tingkat pendidikan masyarakat Desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar; (2) mendeskripsikan kondisi lingkungan sosial masyarakat Desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar; (3) mendeskripsikan perilaku konsumtif masyarakat Desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar; (4) menjelaskan hubungan antara tingkat pendidikan dengan perilaku konsumtif masyarakat Desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar; (5) menjelaskan hubungan antara lingkungan sosial dengan perilaku konsumtif masyarakat Desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar. Penelitian ini menggunakan pendekatan kuantitatif. Lokasi penelitian di Desa Tumpak Kepuh, Kecamatan Bakung, Kabupaten Blitar. Sumber data dalam penelitian ini adalah manusia, peristiwa, dan dokumen. Teknik pengumpulan data menggunakan metode angket, wawancara, observasi(pengamatan)dan dokumentasi. Populasi dalam penelitian ini adalah seluruh KK di Desa Tumpak Kepuh yang berjumlah 1.070 KK, dengan teknik pengambilan sampel menggunakan teknik proporsional random sampling dengan kriteria sampel sebesar 7% dari jumlah populasi yaitu sebanyak 75 KK. Prosedur analisis data menggunakan teknik analisis deskriptif dan teknik analisis statistik inferensial (Analisis regresi berganda). i Temuan penelitian menunjukkan bahwa: (1) tingkat pendidikan masyarakat Desa Tumpak Kepuh 52% merupakan lulusan Sekolah Dasar (SD), 32% merupakan lulusan SMP, 10,7% lulusan SMA dan hanya sebesar 5,3% yang telah menempuh pendidikan tinggi; (2) sebesar 53,3% masyarakat Desa Tumpak Kepuh bekerja sebagai wiraswasta(termasuk TKI), sebesar 38,7% bekerja sebagai petani di ladang, serta hanya sebagian kecil yang bekerja sebagai guru atau nelayan yaitu masing-masing sebesar 5,3% dan 2,7%. Tingkat interaksi sosial masyarakat Desa tumpak Kepuh tergolong tinggi, yaitu sebesar 52% masyarakat Desa Tumpak Kepuh memiliki tingkat interaksi sosial yang tinggi, 48% memiliki tingkat interaksi sosial yang sedang dan 0% yang memiliki tingkat interaksi sosial rendah, masyarakat Desa Tumpak Kepuh telah memperoleh kemudahan akses informasi, komunikasi dan transportasi; (3) sebesar 57,3% masyarakat Desa Tumpak Kepuh tergolong konsumtif , 33,4% tergolong sangat konsumtif, terhadap pakaian, perhiasan, kendaraan dan perabotan. Serta hanya sebesar 9,3% masyarakat yang tergolong tidak konsumtif; (4) ada hubungan yang signifikan antara tingkat pendidikan dengan perilaku konsumtif masyarakat Desa Tumpak Kepuh, berdasarkan uji hipotesis secara simultan dengan uji F menunjukkan bahwa F sebesar 63,664 dengan signifikansi sebesar 0,000 sehingga sig F < 0,05 (0,000< 0,05) artinya semakin rendah tingkat pendidikan masyarakat maka akan cenderung berperilaku konsumtif, dan sebaliknya semakin tinggi tingkat pendidikan masyarakat maka akan cenderung tidak berperilaku konsumtif ; (5) ada hubungan yang signifikan antara lingkungan sosial dengan perilaku konsumtif masyarakat Desa Tumpak Kepuh, berdasarkan uji hipotesis dengan menggunakan uji t yang menunjukkan bahwa thitung pada variabel lingkungan sosial (interaksi sosial) sebesar 5,391 dengan signifikansi 0,000 maka thitung > ttabel (5,391>1,665) dan besarnya probabilitas 0,000<0,05. Demikian juga berdasarkan uji F yang menunjukkan bahwa, F sebesar 63,664 dengan signifikansi sebesar 0,000 sehingga sig F < 0,05 (0,000< 0,05), artinya semakin tinggi tingkat interaksi sosial masyarakat maka akan cenderung berperilaku konsumtif, dan sebaliknya semakin rendah tingkat interaksi sosial masyarakat maka akan cenderung tidak berperilaku konsumtif. Berdasarkan temuan penelitian di atas, saran yang diajukan adalah sebagai berikut; (1)perlu diadakan penelitian lain serta pemikiran kritis terhadap fenomena perilaku konsumtif ini; (2) masyarakat diharapkan lebih sadar akan pentingnya pendidikan sebagai sarana untuk dapat membentuk pribadi manusia yang lebih baik, serta diharapkan lebih bijak dalam bergaul serta merespon kondisi di lingkungannya agar terhindar dari pengaruh yang kurang baik. ii

Perencanaan konstruksi beton ultimate strength design method untuk gedung pertokoan lantai tiga
oleh Hariyanto

 

Pengaruh model pembelajaran biologi berbasis reading concept mapping (remap) stad terhadap minat baca, kemampuan metakognitif, keterampilan berpikir kritis dan hasil belajar kognitif siswa Kelas X SMA Malang / Lya Ratnawati

 

ABSTRAK Ratnawati, Lya. 2015. Pengaruh Model Pembelajaran Biologi Berbasis Reading Concept Mapping (REMAP) STAD terhadap Minat Baca, Kemampuan Metakognitif, Keterampilan Berpikir Kritis, dan Hasil Belajar Kognitif Siswa Kelas X SMA Malang. Tesis, Program Studi Pendidikan Biologi, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Hj. Siti Zubaidah, M.Pd., (II) Prof. Dr. A. Duran Corebima, M.Pd. Kata Kunci: Remap STAD, minat baca, kemampuan metakognitif, keterampilan berpikir kritis, hasil belajar kognitif. Membaca merupakan aktivitas yang dapat merangsang otak untuk berpikir sehingga memperluas dan memperkaya wawasan, serta dapat membentuk pribadi yang unggul dan kompetitif. Faktanya minat baca siswa di Indonesia rendah. Rendahnya minat baca dikhawatirkan berdampak pada kesadaran metakognitif, keterampilan berpikir kritis, dan hasil belajar kognitif siswa. Upaya untuk memberdaya¬¬kan minat baca, kemampuan metakognitif, keterampilan berpikir kritis, dan hasil belajar kognitif Biologi siswa dilakukan melalui pembelajaran Reading concept mapping (Remap) STAD. Model pembelajaran ini mengharuskan siswa membaca (Reading) sebelum diterapkan model pembelajaran kooperatif STAD, kemudian siswa diminta membuat peta konsep (Concept Map). Melalui membaca siswa dapat menambah wawasan dan pengetahuan baru. Pengetahuan baru yang diperoleh siswa diperdalam dengan berdiskusi melalui pembelajaran kooperatif STAD, kemudian dituangkan dalam pembuatan peta konsep. Pada akhirnya diharapkan dapat meningkatkan minat baca, kemampuan metakognitif, keterampilan berpikir kritis, dan hasil belajar kognitif siswa. Jenis penelitian ini adalah penelitian eksperimen semu atau quasi experiment dengan rancangan pretest-posttest non equivalent control grup design. Populasi dalam penelitian ini adalah seluruh siswa SMA di wilayah Kota Malang, sedangkan sampel yang digunakan adalah siswa kelas X MIA SMA Negeri 9 Malang. Instrumen penelitian berupa angket minat baca siswa, inventori kesadaran metakognitif (MAI), tes keterampilan metakognitif, tes keterampilan berpikir kritis, dan tes hasil belajar kognitif. Pengumpulan data melalui pretest dan posttest. Analisis data dilakukan dengan analisis deskriptif dan untuk menguji hipotesis dilakukan uji anakova. Sebelum dilakukan uji statistik, terlebih dahulu dilakukan uji normalitas dan homogenitas. Berdasarkan analisis data dan pembahasan dapat dirumuskan kesimpulan sebagai berikut: (1) model pembelajaran berpengaruh signifikan terhadap keterampilan metakognitif, keterampilan berpikir kritis, dan hasil belajar kognitif siswa; tetapi (2) model pembelajaran tidak berpengaruh signifikan terhadap minat baca dan kesadaran metakognitif siswa. Berdasarkan kesimpulan tersebut, peneliti menyarankan pada waktu proses pembelajaran guru diharapkan menggunakan model pembelajaran Remap STAD secara konsisten karena telah terbukti keberhasilannya untuk meningkatkan keterampilan metakognitif, keterampilan berpikir kritis, dan hasil belajar kognitif siswa.

Pemanfaatan multimedia dalam pembelajaran fisika kelas VIII siswa RSBI di SMP Negeri IV Kepanjen Malang tahun pelajaran 2009-2010 / Prabawanto Adi Sasongko

 

Kata kunci: pemanfaatan, multimedia, pembelajaran Fisika Perkembangan ilmu pengetahuan dan teknologi saat ini sangat pesat. Perkembangan ini berpengaruh dalam berbagai aspek kehidupan, salah satunya adalah pendidikan. Pendidikan diharapkan dapat melahirkan sumber daya manusia yang akan memberikan kontribusi bagi pembangunan ekonomi, politik, sosial, moral dan budaya bangsa. Oleh karena itu peran pendidikan sangatlah vital dalam rangka pengembangan SDM yang lebih kompeten di era yang sarat dengan perkembangan teknologi dan informasi. Salah satu contohnya dalah perkembangan teknologi informasi berupa multimedia. Lahirnya teknologi multimedia adalah hasil dari perpaduan kemajuan teknologi elektronik, teknik komputer dan perangkat lunak. Multimedia merupakan konsep dan teknologi dari unsur - unsur gambar, suara, animasi serta video disatukan dalam komputer untuk disimpan, diproses dan disajikan guna membentuk interaktif yang sangat inovatif antara komputer dengan user. Dengan adanya penggunaan berbagai media pembelajaran tersebut diharapkan membuat pembelajaran menjadi lebih menarik, efisien dan efektif. Rintisan Sekolah Berstandar Internasional yang terus berupaya meningkatkan kualitas proses pembelajaran untuk melayani siswa-siswanya dalam mengembangkan potensi yang dimiliki. Upaya tersebut didukung dengan peningkatkan mutu pendidikan dan menjadikan lembaga pendidikan yang berkualitas dengan pemenuhan sarana dan prasarana pendidikan untuk terciptanya pembelajaran yang berkualitas, salah satunya dalam pembelajaran fisika dengan menggunakan multimedia khususnya.  Penelitian ini bertujuan untuk mendeskripsikan (1) jenis multimedia yang digunakan guru dalam pembelajaran Fisika pada materi cahaya kelas VIII H RSBI di SMP Negeri IV Kepanjen Malang, (2) proses pemanfaatan multimedia dalam pembelajaran Fisika pada materi cahaya kelas VIII H RSBI di SMP Negeri IV Kepanjen Malang, (3) interaksi guru dan siswa dalam memanfaatkan multimedia pada pembelajaran Fisika materi cahaya Untuk mencapai maksud tersebut, maka penelitian ini dilaksanakan dengan menggunakan metode deskriptif. Instrumen pengumpulan data menggunakan pedoman observasi, pedoman wawancara dan pedoman dokumentasi dokumentasi. Hasil penelitian ini menunjukkan bahwa (1) jenis multimedia yang digunakan dalam pembelajaran fisika kelas VIII H RSBI di SMP Negeri IV kepanjen adalah multimedia interaktif yang berupa CD interaktif dan multimedia yang dipakai untuk media presentasi dengan menggunakan powerpoint 2007. Untuk pembelajaran yang lain guru menggunakan multimedia lain berupa video, tutorial yang bersifat interaktif, (2) proses pemanfaatan multimedia terdiri dari persiapan multimedia dan pemanfaatannya dalam pebelajaran. Dalam proses persiapan guru mempersiapkan dengan baik dan dalam proses pemanfaatannya multimedia telah memenuhi berbagai fungsi sehingga guru dan siswa dapat merasakan manfaat dari multimedia meskipun i ii terdapat beberapa hambatan, (3) interaksi antara guru dan siswa berlangsung dengan baik karena guru dapat menyampaikan seluruh materi dan siswa memahami materi pembelajaran yang telah dilaksanakan. Selain itu siswa juga mendapatkan pengalaman belajar melalui interaksi secara aktif baik kepada guru dan kepada mulmedia yang diberikan oleh guru. Berdasarkan hasil penelitian ini, saran yang dapat diberikan (1) Diharapkan guru Fisika lebih meningkatkan pengetahuan dan kemampuannya dalam rangka pelaksanaan tugas profesinya. Salah satnya dengan melakukan pembelajaran berbasis multimedia. (2) Diharapkan untuk peneliti-peneliti lain dapat mengkaji secara mendalam tentang permasalahan yang berkaitan dengan pemanfaatan multimedia dalam mata pelajaran yang lain.

Pemanfaatan kapur sebagai filter untuk campuran aspal beton ditinjau dari parameter marshall / Yusti Anggraeni Pertiwi

 

Kata kunci : kapur, filler, aspal beton, parameter marshall. Batu kapur merupakan salah satu bahan bangunan yang mudah dicari di daerah khususnya yang memiliki tanah dan pegunungan kapur yang ada di Indonesia. Batu kapur adalah salah satu filler yang diharapkan dapat meningkatkan sifat-sifat fisik pada campuran aspal, terutama pada lapisan aspal beton yang kurang baik dalam menggunakan campuran beraspal. Berdasarkan pada pentingnya kualitas bahan yang digunakan untuk lapisan aspal beton, maka perlu dilakukan penelitian kualitas perkerasan lapisan aspal beton yang dihasilkan dari campuran aspal yang menggunakan filler kapur dan dicampur dengan aspal penetrasi 60/70 kemudian diuji dengan menggunakan alat Marshall. Tujuan penelitian ini adalah: (1) Mengetahui sifat dan karakteristik aspal bahan penyusun aspal beton, (2) Mengetahui sifat dan karakteristik aspal beton dengan digunakannya kapur sebagai filler. Metode penelitian ini dibagi menjadi tiga tahap yaitu tahap pemilihan bahan, tahap persiapan, dan pembuatan benda uji, serta tahapan pengujian dan analisis data. Hasil dari penelitian menunjukkan bahwa: (1) Sifat dan karakteristik bahan penyusun aspal beton dapat diketahui dengan pengujian berat jenis dengan nilai 2,645 gr/cm3, penyerapan agregat kasar 2,24% , pengujian keausan agregat kasar 17,67%, pengujian penetrasi aspal 63,33 mm, pengujian berat jenis aspal 1,069 gr/cm3, pengujian daktilitas aspal 134,8 cm, pengujian titik nyala 3290C, dan pengujian titik lembek 490C, (2) Sifat dan karakteristik aspal beton dengan digunakannya filler kapur sebagai bahan penyusun aspal beton ditinjau dari Parameter Marshall dapat diketahui dengan nilai Stabilitas maksimum 1313,18 kg pada kadar kapu 0%, Flow yang memenuhi syarat diperoleh pada kadar kapur 0-80% yaitu 3,85-3,92 mm, Marshall Quotient dengan nilai 257,314 mm pada kadar kapur 80%, VIM yang memenuhi syarat pada kadar kapur 0% dengan nilai 4,57%, dan VMA yang memenuhi syarat pada kadar kapur 0-100% dengan nilai 17,14-22,51 %, (3) Berdasarkan tahap dan hasil penelitian dapat disimpulkan bahwa penggunaan filler batu kapur yang paling baik dengan menggunakan kadar dibawah 80% dan filler batu kapur ini dapat dimanfaatkan pada campuran Lapisan Aspal Beton (LASTON).

Perancangan dan pembuatan aplikasi sistem pakar untuk analisa kelayaan kredit motor honda (Studi kasus pada PT. Nusa Surya Ciptadana (NSC) Finance Sumbawa Besar) / Yessi Kustiyaningsih

 

Sistem pakar berfungsi sebagai media untuk menampung pengetahuan atau keahlian seorang pakar, kemudian mengelolanya agar dapat digunakan untuk membantu mengimplementasikan peranan pakar tersebut. Diharapkan dengan demikian pengetahuan yang dimiliki oleh pakar tersebut dapat dimanfaatkan oleh masyarakat dengan lebih efisien dan aplikatif. Aplikasi Sistem Pakar Analisa Kelayakan Kredit Motor Honda dibuat untuk membantu perusahaan kredit dalam menganalisa layak tidaknya seseorang untuk menerima kredit. Aplikasi ini dikembangkan dengan menggunakan bahasa pemrograman Delphi 7 dengan basis data menggunakan Microsoft Access. Pada program ini, analisa dilakukan dengan mengajukan pertanyaan-pertanyaan untuk tiap-tiap aspek penilaian melalui user interface yang dirancang sesederhana mungkin untuk memudahkan penggunaannya. Ada empat aspek penilaian untuk analisa kelayakan kredit ini, yaitu aspek Character, Capability, Capital, dan Condition. Setiap pertanyaan mempunyai pilihan jawaban masing-masing, dan setiap pilihan jawaban diberikan suatu point tertentu. Jika semua pertanyaan pada tiap-tiap aspek telah dijawab berdasarkan data pemohon yang diperoleh dari hasil survey, point-point yang diperoleh berdasarkan jawaban tersebut akan dijumlahkan sehingga menghasilkan suatu total point tertentu. Total point inilah yang menentukan keputusan diterima atau ditolaknya aplikasi permohonan kredit. Pada prinsipnya seluruh data pertanyaan dan pilihan jawaban tiap-tiap aspek penilaian akan dimasukkan pada suatu knowledge base yang berupa suatu kumpulan database di mana kemudian Inference Engine dari sistem pakar akan mengolahnya untuk mendapatkan keputusan kelayakan kredit berdasarkan pilihan jawaban yang dimasukkan oleh user melalui fasilitas user interface. Hasil implementasi dan pengujian sistem yang telah dibuat secara keseluruhan dapat berjalan dengan baik. Selain menganalisa kelayakan kredit, program ini juga menyediakan fasilitas lainnya, yaitu: fasilitas untuk mencetak laporan hasil analisa dalam bentuk Memo Persetujuan Kredit, fasilitas untuk menambah, mengubah, maupun menghapus basis pengetahuan jika suatu saat ada perubahan pertanyaan, pilihan jawaban, maupun point yang digunakan untuk analisa, fasilitas untuk melakukan pencarian data pemohon dan dapat pula digunakan untuk menyimpan data pembayaran angsuran.

Penggunaan satuan luas dalam peningkatan trasfer belajar pelajaran matematika tentang luas bangun datar pada siswa kelas III SDN Karangrejo 2 / Nurhidayatiningtyas

 

Penggunaan Satuan Luas dalam Peningkatan Transfer Belajar Pelajaran Matematika Tentang Luas Bangun Datar pada Siswa Kelas III SDN Karangrejo 2. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Pra Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Tumardi, S.Pd., M.Pd. (II) Dra. Siti Umayaroh, S.Pd., M.Pd. Kata Kunci: Satuan Luas, Transfer Belajar, Luas Bangun Datar Berdasarkan dokumen dan hasil observasi awal yang dilakukan peneliti pada pembelajaran Matematika di kelas III SDN Karangrejo 2 menunjukkan bahwa indikator keberhasilan transfer belajar belum tampak secara mantab. Hasil belajar Matematika secara utuh pada dokumen yang tersedia di sekolah menunjukkan siswa yang mendapat nilai di atas KKM ada 50% dengan nilai rata-rata 67,75 sedangkan hasil observasi menunjukkan bahwa guru belum cukup banyak memberi kesempatan kepada siswa untuk mengkaitkan materi sebelumnya yang terkait dengan materi yang akan dipelajari. Pembelajaran dilakukan dengan menekankan menghafal. Media pun belum membantu terjadinya transfer belajar secara optimal. Penelitian ini bertujuan untuk mendeskripsikan penggunaan satuan luas dalam peningkatan transfer belajar pelajaran Matematika tentang luas bangun datar, hasil belajar siswa dan peningkatan transfer belajar pelajaran Matematika tentang luas bangun datar. Rancangan penelitian yang digunakan adalah PTK dengan model Siklus Kemmis dan Taggart yang terdiri dari tahap rencana tindakan, pelaksanaan tindakan, observasi, dan refleksi. Penelitian ini dilaksanakan dalam 3 siklus pada materi luas bangun datar dengan subjek penelitian yaitu siswa kelas III SDN Karangrejo 2 sebanyak 24 anak. Hasil penelitian menunjukkan bahwa pembelajaran guru dengan penggunaan satuan luas dapat meningkatkan transfer belajar pelajaran Matematika tentang luas bangun datar. Hasil belajar secara utuh mengalami peningkatan mulai dari 77,48 pada siklus 1 hingga mencapai 81,25 pada siklus 3. Pencapaian transfer belajar juga mengalami peningkatan mulai dari 13 siswa pada siklus 1 hingga mencapai 17 siswa pada siklus 3. Melalui analisis data dapat disimpulkan bahwa penggunaan satuan luas dapat meningkatkan transfer belajar pelajaran Matematika tentang luas bangun datar pada siswa kelas III SDN Karangrejo 2. Saran peneliti yaitu pembelajaran luas bangun datar dengan menggunakan satuan luas ini untuk diterapkan agar dapat meningkatkan transfer belajar khususnya pada pelajaran Matematika.

Perencanaan pompa sentrifugal
oleh Taufan Purwanto Udha Ugi

 

Particularized conversational implicature as seen in the play "a streetcar named desire" / Widyarini Cahyaningtyas

 

ABSTRAK Cahyaningtyas, Widyarini. 2015. Penggunaan Implikatur dalam Drama A Streetcar Named Desire. Graduate Program in English Language Teaching, State University of Malang. Advisors: (I) Dr. Emalia Iragiliati M.Pd, (II) Dr. Mirjam Anugerahwati, MPd, M.A. Keywords: implikatur, strategioff record, kesopanan. Tesis ini membahas mengenai penggunaan implikature dalam drama “A Streetcar Named Desire”. Tesis ini juga membahas tentang salah satu strategi kesopanan yang dikenal dengan strategi off record. Tesis ini bertujuan untuk mengetahui dan mempelajari tentang strategi off record dan bagaimana cara merespon dan menggunakan strategi tersebut sehingga face pembicara dan lawan bicara dapat dipertahankan. Data yang digunakan adalah implikature yang diucapkan oleh tokoh dalam drama ini, Blanche dan Stanley, dari bab 1 - 8, dan bagaimana implikatur tersebut dapat digunakan dalam strategi off record. Data tersebut kemudian dianalisis dengan menggunakan prinsip kooperasi dari Grice (1974) dan strategi kesopanan oleh Brown dan Levinson (1978). Hasil dari analisa menunjukkan bahwa strategi off record muncul 17 kali dalam drama. Kesimpulan yang dapat diambil adalah, Blanche dan Stanley sering menggunakan cara ini untuk menjatuhkan lawan bicara, namun mereka masih ingin menjaga face lawan bicara dan diri mereka sendiri. Selain itu, dengan tidak ditemukannya implikatur setelah bab 8 yang merupakan klimaks, menunjukkan bahwa mereka sudah tidak lagi berusaha untuk menjaga face dari lawan bicara mereka, dan mereka dengan bebas mengungkapkan emosi dan ekspresi mereka. Dengan mempelajari penggunaan implikatur untuk melakukan strategi off record diharapkan akan memperkaya kajian teori kesopanan oleh Brown dan Levinson (1978). Walaupun tesis ini sangat terbatas dalam hal analisis, namun diharapkan banyak tindak lanjut dari pembelajaran ini, terutama penggunaan strategi off record dalam drama.

Perencanaan pompa sentrifugal
Y. Sugeng Santoso

 

Inventarisasi jenis tumbuhan lumut kelas bryopsida di Coban Glotak Kecamatan Wagir Kabupaten Malang / oleh Nur Maslaha

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |