Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema "mata" bagi siswa SMP Negeri 1 Tumpang / Rohman Aminullah Firdaus

 

ABSTRAK Firdaus, Rohman Aminullah. 2010. Pengembangan Paket Pembelajaran IPA Terpadu Berbasis Konstruktivisme Tema Mata Bagi Siswa SMP Negeri 1 Tumpang. Skripsi, Jurusan Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Supriyono Koes H., M.Pd, MA (II) Drs. Triastono Imam P.,M.Pd. Kata kunci : Pengembangan, Paket IPA Terpadu, Konstruktivisme, Mata Hasil survey terbatas pada guru-guru IPA SMP/MTs di Jawa Timur dalam beberapa pelatihan PAKEM (Pembelajaran Aktif, Kreatif, Efektif, dan Menyenangkan) yang diselenggarakan oleh proyek MBE tahun 2006 menunjukkan bahwa sebagian besar guru (92 dari 118 orang atau 79%) mengalami kesulitan untuk merancang pembelajaran IPA Terpadu berdasarkan standar isi pada kurikulum IPA. Oleh sebab itu, hampir semua guru SMP belum melaksanakan pembelajaran secara terpadu (Koes H. dkk, 2008). Selain itu, hasil pengamatan di beberapa toko buku di Kota Malang menunjukkan bahwa belum ditemukan buku IPA SMP yang dirancang secara terpadu. Padahal, Peraturan Menteri Pendidikan Nasional nomor 22 tahun 2006 tentang standar isi secara tegas menyatakan bahwa substansi mata pelajaran IPA pada SMP/MTs merupakan IPA Terpadu. Berdasarkan hal tersebut maka dikembangkan Paket Pembelajaran IPA Terpadu yang dapat membantu pelaksanaan pembelajaran IPA Terpadu. Pengembangan ini bertujuan untuk mengetahui kelayakan paket pembelajaran IPA Terpadu dengan tema mata untuk siswa SMP Negeri 1 Tumpang. Metode pengembangan paket pembelajaran yang digunakan adalah penelitian pengembangan menurut Borg dan Gall, langkah-langkah penelitian ini adalah: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal produk, (4) penilaian produk, dan (5) revisi produk (Borg dan Gall, 2003, dalam Koes H., 2008). Instrumen penelitian yang digunakan berupa kuesioner kelayakan paket pembelajaran IPA Terpadu dengan tema mata dan panduan pelaksanaannya yang diisi oleh validator. Jenis data berupa data kualitatif dan kuantitatif. Data kualitatif berupa tanggapan, saran, maupun kritik dari validator dan hasil keterbacaan siswa, sedangkan data kuantitatif diperoleh dari analisis nilai rata-rata kuesioner skala likert. Hasil penelitian menunjukkan bahwa paket pembelajaran yang dikembangkan layak diuji cobakan namun perlu direvisi, dengan skor rata-rata untuk paket IPA Terpadu adalah 3,5 dan skor rata-rata untuk panduan pelaksanaannya adalah 3,31. Berdasarkan hasil pengembangan, disarankan agar dilakukan penelitian lebih lanjut terhadap paket IPA Terpadu ini dengan melakukan uji coba berulang terhadap paket IPA Terpadu dan panduannya. Sebelum paket dan panduan digunakan hendaknya dilakukan penelitian eksperimen terlebih dahulu agar diketahui keefektifan dan efisiensinya dalam pembelajaran IPA Terpadu, sehingga diperoleh paket dan panduan yang layak dan dapat digunakan siswa.

Pengembanmgan paket IPA terpadu berbasis konstruktivisme dengan tema mata untuk siswa SMP Negeri 4 Malang / Chintya Indika Rahayu

 

ABSTRAK Rahayu, Chintya Indika. 2010. Pengembangan Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Mata Untuk Siswa SMP Negeri 4 Malang. Skripsi, Jurusan Pendidikan Fisika FMIPA Universitas Negeri Malang: (I) Drs. Supriyono Koes H., M.Pd, MA (II) Drs. Triastono Imam P.,M.Pd. Kata kunci: Pengembangan, Paket IPA Terpadu, Mata Peraturan Menteri Pendidikan Nasional nomor 22 Tahun 2006 tentang Standar Isi untuk satuan pendidikan dasar dan menengah secara tegas menyatakan bahwa substansi mata pelajaran IPA pada SMP/MTs merupakan IPA Terpadu. Selain itu, penelitian evaluatif terhadap pendidikan IPA di SMP yang dilaksanakan di lima propinsi di Indonesia pada tahun 1996 menunjukkan bahwa pendidikan IPA di SMP masih mengalami berbagai masalah. Berdasarkan hasil penelitian pendidikan terhadap pengembangan paket IPA Terpadu berbasis kostruktivisme di wilayah Malang Raya pada tahun 2008 menunjukkan bahwa kebutuhan guru IPA terhadap Paket IPA Terpadu benar-benar mendesak. Sebagian besar guru IPA (35 dari 37 orang atau 94,6%) menyatakan bahwa mereka membutuhkan paket IPA terpadu untuk pembelajaran IPA SMP, seperti guru IPA di SMP Negeri 4 Malang. Kondisi di SMP Negeri 4 Malang, tidak menggunakan paket IPA Terpadu yang benar-benar dirancang secara terpadu, artinya antar mata pelajaran biologi, fisika dan kimia masih terpisah-pisah penyajiannya dalam paket IPA Terpadu. Selain itu hasil pengamatan di beberapa toko buku di Kota Malang menunjukkan bahwa tidak ditemukan buku IPA SMP yang benar-benar dirancang secara terpadu. Oleh sebab itu, perlu dikembangkan paket IPA Terpadu yang dapat membantu proses pembelajaran. Tujuan penelitian adalah untuk menyusun paket IPA Terpadu tema Mata bagi siswa dan panduan pelaksanaannya bagi guru IPA di SMP Negeri 4 Malang. Metode penilitian menggunakan penelitian pengembangan yang terdiri atas 5 dari 10 tahap penelitian pengembangan Borg dan Gall, yaitu : (1) Studi pendahuluan, (2) Perencanaan, (3) Pengembangan bentuk awal produk, (4) Uji lapangan awal, dan (5) Revisi produk. Instrumen penelitian yang digunakan berupa angket yang diisi oleh validator. Jenis data berupa data kuantitatif dan data kualitatif. Data kuantitatif diperoleh dari analisis nilai rata-rata angket skala Likert, sedangkan data kualitatif berupa tanggapan, saran, dan kritik dari validator. Validator berasal dari dosen fisika, dosen kimia, guru IPA SMP dan siswa SMP kelas IX semester I. Hasil penelitian menunjukkan bahwa paket IPA Terpadu tema Mata di SMP Negeri 4 Malang sudah memenuhi kriteria layak dengan skor rata-rata 3,47 sehingga paket IPA Terpadu dengan tema Mata ini dapat digunakan oleh siswa SMP. Panduan guru paket IPA Terpadu tema Mata di SMP Negeri 4 Malang juga memenuhi kriteria cukup layak dengan skor rata-rata 3,23 sehingga panduan guru paket IPA Terpadu tema Mata sudah dapat digunakan oleh guru SMP. Berdasarkan hasil penelitian ini, disarankan agar dilakukan penelitian lebih lanjut terhadap paket IPA Terpadu dengan melakukan kajian eksperimen.

Beberapa Faktor Yang Berpengaruh Terhadap Fertilitas Pada Wanita Bekerja Di Desa Benawa Tengah Kecamatan Barabai Kabupaten Hulu Sungai Tengah Propinsi Kalimantan Selatan oleh Karunia Puji Hastuti

 

Penelitianin i bertujuanu ntukm engetahu(il ) tingkatf ertilita'sp adaw anita yangb ekerja( 2) hubungana ntsrau siak awinp ertamais tri denganti ngkatf ertilitas( 3) hubungana ntaral ama pemakaiana lat kontiasepsid engant ingkat fertilitas (4) hubungana ntaral ama pcrioder eproduksid engant ingkat fertilitas (5) hubungan antarati ngkatp endidikanis tri denganti ngkatf ertilitas( 6) pengaruha ntarau siak awin pertamais tri, lama pemakaiana lat kontrasepsil,a ma perioder eproduksi,d an tingkat pendidikanis tri dcnganti ngkatt brtilitas( 7) bobots umbangayna ngd iberikano leh usiak awin pertemai stri, lama pemakaiana lst konrasepsi,l ama perioder eproduksi, dant ingkatp endidikanir tri terhadapti ngkatf ertilitas.M etodep enelitiany ang dipakai adalah metode survei dengan populasi ibu rumah tangga usia produktif (15- 49) tahun,k awin, ikut KB/tidak ikut KB dan bekerja.T'ekniky ang digunakand alam pengambilans ampely aitu denganc arss tratified randoms ampling,s ebagasi trata dalamp enelitianin i adalahje nis pekerjoanw anita. Teknik pengumpuland atad ilakukan deng;and ua caray aitu: wawancarad an dokumentasdie ngank uesionesr ebagaai latp €ngumpudl ata.T eknika nalisad atay ang digunakana dalaht abulasit unggald an silang ditenskan dengana nalisisr egresi ganda. Berdasarkaann rlisad atad i dapatb ahwat ingkatf ertilitasm enurutk elompok umurr eproduktifm enunjukkanb ahwas emakinti nggi kelompoku nrurw anitaa ka.r semakint inggi rata-rataf ertilita.snyas, edapgkanti ngkat fertilitas tertinggi berdasarkanjenisp ekerjaana dap adaw anita yang bekerj'rs ebagapi etani,d isusul kemudianp egawani egeris ipil, pedagandga njasa.B erdasarkapne ngujianh ipt,tesis dapat diketahui ada hubungan yang n€gatif ontara usia kawin p€rtama istri dengan tingkat fertilitas, adah ubungany ang positif lama pemakaiana lat kontraseosdi engan tingkatf ertilitas,a dah ubungany angp ositiflamap erioder eproduksdi enganti ngkat fertilitas dan ada hubungan yang negatifantara tingkat pendidikan is$i dengan tingkat fertilitas. Sumbangane fektif dari masing-masingv ariabeld ari yangt erbesara dalah: lama periode reproduksi, usia kawin peftama isti, tingkat pendidikan dan lama pemakaiana lat konbasepsi.D ari analisisr egresig andad apatd isimpulkanb ahwau sia kawin pertamai stri, lama pemakaiana lar kontrasepsil,a ma perioder eproduksi,d an tingkat pendidikani stri berpengaruhte rhadapf ertilitas dan secaras erentakd apat mempredikstin ggi rendahnyafe rtilit'rsp endudukd i DesaB enawaT engah.

Konsep impuls dan momentum linear serta aplikasinya dalam kehidupan / Bambang Rumakat

 

Abstrak Rumakat Bambang, 2010. Konsep Impuls dan Momentum linear serta aplikasinya dalam kehidupan. Tugas Akhir, Jurusan Fisika, Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing: Drs. Widjianto Mkom. Kata kunci. Momentum, impuls, Hukum kekekalan energi, tumbukan, koefisien restitusi. Setiap benda yang bergerak dan bermassa tentu memiliki momentum. Momentum merupakan ukuran kesukaran untuk memberhentikan suatu benda yang bergerak dan didefinisikan sebagai hasil kali massa dengan kecepatan (p = mv). Impuls yang dikerjakan pada suatu benda sama dengan perubahan momentum yang dialami benda tersebut, yaitu beda antara momentum akhir dan momentum awalnya (I = Δp atau I = p2 – p1). Hukum II Newton menyatakan bahwa gaya yang dikerjakan pada suatu benda sama dengan laju perubahan momentum benda tersebut, sehingga konsep momentum juga menjelaskan munculnya gaya dorong pada roket akibat perubahan massa bahan bakar pada roket tersebut. Hukum kekekalan momentum menyatakan bahwa dalam suatu interaksi (antara dua benda atau lebih), momentum total sistem sesaat sebelum dan sesudah reaksi adalah sama asalkan tidak ada gaya luar yang bekerja. Untuk setiap tumbukan berlaku hukum kekekalan momentum tetapi tidak selalu berlaku hukum kekekalan energi kinetik karena terjadi perubahan energi.

Persamaan kuadrat dan aplikasinya / Husein Kelimagun

 

ABSTRAK Kelimagun, Husein, 2010. Persamaan Kuadrat dan Aplikasinya. Skripsi, Jurusan Matematika FMIPA Universitas Negeri Malang Pembimbing Lucky Tri Oktoviana, S.Si, M.Kom. Kata Kunci : Persamaan, Persamaan Kuadrat. Bentuk umum dari persamaan kuadrat adalah ax2 + bx + c = 0, dimana a 0≠. Cara-cara yang digunakan dalam menyelesaikan persamaan kuadrat adalah dengan cara memfaktorkan, melengkapkan kuadrat sempurna dan rumus persamaan kuadrat, Apabila suatu persamaan kuadrat dapat difaktorkan menjadi (x - x1)(x - x) = 0 maka x1 dan x merupakan akar-akar suatu persamaan kuadrat tersebut. Sebaliknya apabila x1 dan x2 merupakan akar-akar persamaan kuadrat, maka persamaan kuadrat itu dapat ditentukan dengan rumus (x - x1)(x - x) = 0. Persamaan kuadrat mempunyai dua akar real yang berlainan, dua akar yang sama, atau tidak mempunyai akar real. 222 Persamaan kuadrat dapat digunakan untuk menyelesaikan beberapa masalah, misalnya mencari panjang dan lebar sebuah persegi, dan menentukan unit produk yang harus diproduksi agar mendapatkan laba tertentu.

Pengembangan konten media bergambar untuk layanan informasi bahaya free sex dan penyakit menular seksual (PMS) di sekolah menengah pertama / Athik Hidayatul Ummah

 

ABSTRAK Ummah, Athik Hidayatul. 2010. Pengembangan Konten Media Bergambar untuk Layanan Informasi Bahaya Free Sex dan Penyakit Menular Seksual (PMS) di Sekolah Menengah Pertama. Skripsi, Program Studi Bimbingan dan Konseling Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dr. Andi Mappiare AT., M.Pd (II) Dr. Nur Hidayah, M.Pd. Kata Kunci : layanan informasi, konten media, media bergambar, free sex, PMS Penelitian pengembangan konten media bergambar untuk layanan informasi bahaya free sex dan PMS di SMP ini dilatarbelakangi karena belum adanya media yang efektif dan menarik untuk dapat digunakan dalam memberikan informasi bahaya free sex dan PMS. Topik ini perlu diangkat karena banyaknya kasus free sex dan bahaya yang diakibatkan sangat mengerikan, sehingga media ini sebagai upaya preventif terhadap free sex. Strategi ceramah, menasehati tidak lagi efektif dan kurang mengena, sehingga dibutuhkan media yang menarik agar siswa tertarik untuk mengetahuinya kemudian mereka tidak akan melakukan hal-hal yang mengarah pada pergaulan bebas. Tujuan dari penelitian pengembangan ini ialah (1) diperoleh karakteristik konten yang layak digunakan untuk layanan informasi bahaya free sex dan PMS di SMP, (2) diperoleh karakteristik media bergambar yang layak digunakan untuk layanan informasi bahaya free sex dan PMS di SMP, (3) diperoleh deskripsi penilaian ahli dan calon pengguna mengenai kemanfaatan konten dan media bergambar yang layak digunakan untuk layanan informasi bahaya free sex dan PMS di SMP. Metode yang digunakan dalam penelitian pengembangan ini diadaptasi dari model pengembangan Borg and Gall (1983) melalui studi lapangan/need assessment, pengembangan produk, menguji produk dengan ahli konten dan ahli media, merevisi, menguji kepada calon pengguna produk (4 siswa), merevisi produk tersebut sehingga dihasilkan produk yang sesuai dengan tujuan pengembangan. Produk yang berhasil dikembangkan yakni konten media bergambar dalam bentuk buku yang sudah diuji kelayakannya. Berdasarkan penilaian ahli konten dan media, pengembangan konten media bergambar ini sudah layak digunakan. Dilihat dari aspek kegunaan, kemudahan, ketepatan dan kemenarikan. Harapan ke depan, pengembangan konten media bergambar ini bisa dimanfaatkan dengan baik oleh berbagai pihak, seperti: konselor, guru, orang tua, masyarakat dan pengambil kebijakan sebagai media informasi penting yang perlu disampaikan kepada remaja. Saran yang diberikan adalah : bagi peneliti selanjutnya, apabila berminat dapat melakukan replikasi penelitian lanjutan dengan memodifikasi sasaran yang lebih luas, menambah topik lain yang berkaitan sesuai dengan kebutuhan di lapangan dan melakukan uji efektivitas terhadap pengembangan media ini.

Penerapan teknik behavior contracts untuk meningkatkan tanggung jawab pribadi siswa kelas XI-IPS 3 dalam mengikuti layanan bimbingan dan konseling di SMA Negeri 2 Malang / Hidayatul Laili

 

Kata Kunci: Behavior Contracts, tanggung jawab pribadi, Siswa SMA Remaja yang memiliki tanggung jawab pribadi ialah remaja yang dapat mengerti tentang apa yang baik untuk dilakukan atau dicegah, dan mau mencoba untuk mengubahnya dengan tingkah laku yang positif. Oleh karena itu, layanan BK sangat berperan penting untuk membentuk siswa SMA yang mandiri dan memiliki tanggung jawab terhadap apa yang dilakukannya sendiri. Berdasarkan informasi dari guru pembimbing SMA 2 Malang dan observasi awal selama PPL II di SMAN 2 Malang, terdapat beberapa fakta bahwa siswa kelas XI-IPS 3 memiliki tingkat tanggung jawab pribadi yang rendah dalam mengikuti layanan BK di kelas. Hal ini ditunjukkan dengan tingkah laku siswa seperti ramai, memainkan HP, tidur-tiduran, membuka buku mata pelajaran lain, dan kurang aktif dalam kegiatan layanan BK. Tingkah laku di atas, disebabkan oleh anggapan bahwa layanan BK di kelas tidak berpengaruh terhadap nilai rapor siswa. Berdasarkan masalah di atas, maka pemecahan masalah dilakukan dengan menggunakan teknik Behavior Contracts, yaitu berupa perjanjian secara tertulis untuk bertingkah laku dengan cara tertentu dalam mengikuti layanan BK di kelas dan untuk menerima konsekuensi bagi tingkah laku itu. Tujuan penelitian ini adalah menerapkan kontrak tingkah laku (Behavior Contracts) untuk meningkatkan tanggung jawab pribadi siswa kelas XI-IPS 3 SMAN 2 Malang dalam mengikuti layanan BK di kelas. Penelitian ini menggunakan rancangan penelitian tindakan yang terdiri atas dua siklus. Pada masing-masing siklus dilakukan tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Instrumen penelitian yang digunakan adalah teknik wawancara, pedoman observasi, cacatan lapangan, dan dokumentasi berupa rekaman foto kegiatan pemberian kontrak tingkah laku. Analisis data yang digunakan adalah teknik analisis interaktif, yang terdiri atas reduksi data, paparan data, dan penarikan kesimpulan. Subjek penelitian adalah siswa kelas XI-IPS 3 SMA Negeri 2 Malang berjumlah 38 siswa. Hasil penelitian menunjukkan bahwa teknik kontrak tingkah laku dapat meningkatkan tanggung jawab pribadi siswa dalam mengikuti layanan BK di kelas. Dibuktikan dengan hasil siklus I mendapatkan skor 56,77 % (banyak), sedangkan siklus II mendapatkan skor 79,16 (sangat banyak). Dengan demikian, ada peningkatan tanggung jawab pribadi siswa kelas XI-IPS 3, ditunjukkan dengan hasil skor siklus II lebih banyak atau tinggi dari siklus I. Atas dasar hasil penelitian, maka disarankan: (1) Konselor menggunakan teknik kontrak tingkah laku untuk meningkatkan tanggung jawab pribadi siswa, (2) Dalam penelitian selanjutnya, disarankan menggunakan hadiah non-materi yang lebih menarik agar siswa dapat lebih antusias dalam melaksanakan kontrak.

Pengembangan model permainan untuk mengembangkan kecerdasan kinestetik anak usia 7-9 tahun di SDN Karang Besuki I Malang / Salasiah

 

ABSTRAK Salasiah. 2010. Pengembangan Model Permainan untuk Mengembangkan Kecerdasan Kinestetik Anak Usia 7-9 Tahun di SDN Karang Besuki I Malang. Skripsi, Jurusan Ilmu Keolahragaan, Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (I) Dr. Roesdiyanto, M.Kes (II) Drs. Mulyani Surendra, M.S. Kata kunci: pengembangan, model permainan, kecerdasan kinestetik. Perkembangan motorik merupakan salah satu faktor yang sangat penting dalam perkembangan individu secara keseluruhan. Perkembangan gerak dasar dan penyempurnaannya merupakan hal penting selama masa kanak-kanak. Dalam kegiatan bermain, semua aspek kecerdasan anak semakin berkembang, salah satunya kecerdasan kinestetik anak. Kecerdasan kinestetik lebih menekankan pada kemampuan seseorang dalam menangkap informasi dan mengolahnya sedemikian cepat, lalu diaplikasikan dalam wujud gerak, yakni dengan menggunakan badan, kaki, dan tangan. Berdasarkan hasil analisis kebutuhan di SDN Karang Besuki I Malang, diketahui bahwa 87,34% dari jumlah siswa kelas I dan II, mereka lebih sering bermain game atau menonton televisi. Hal ini dapat mempengaruhi perkembangan gerak anak tersebut. Sehingga 92,41% orangtua siswa merasa anak mereka perlu mendapat permainan yang dapat mengembangkan kecerdasan kinestetiknya. Dari data analisis kebutuhan guru, dinyatakan pula bahwa guru menyetujui jika model-model permainan kecerdasan kinestetik tersebut diterapkan pada siswanya. Rumusan masalah dalam penelitian ini, belum adanya model permainan untuk mengembangkan kecerdasan kinestetik anak usia 7-9 tahun di SDN Karang Besuki I Malang. Tujuan penelitian ini adalah untuk mengembangkan model permainan untuk mengembangkan kecerdasan kinestetik anak usia 7-9 tahun di SDN Karang Besuki I Malang. Dalam penelitian pengembangan ini peneliti merujuk model pengembangan (Research and Development) Borg dan Gall. Langkah-langkah yang digunakan oleh peneliti adalah sebagai berikut: (1) Melakukan observasi dan pengumpulan data informasi termasuk kajian pustaka dan analisis kebutuhan, (2) Mengembangkan bentuk produk awal, (3) Evaluasi ahli dengan kualifikasi yaitu, 1 ahli perkembangan motorik, 1 ahli perkembangan anak, dan uji coba (kelompok kecil), (4) Revisi produk awal (sesuai dari hasil evaluasi para ahli dan uji coba), (5) Uji coba lapangan, dengan mengujicobakan hasil revisi produk awal, (6) Revisi produk akhir (sesuai dari hasil uji lapangan), (7) Hasil akhir, produk pengembangan model permainan untuk mengembangkan kecerdasan kinestetik anak usia 7-9 tahun di SDN Karang Besuki I Malang. Pengumpulan data menggunakan kuesioner untuk ahli dan observer, dengan kualifikasi 1 orang ahli perkembangan motorik, 1 orang ahli perkembangan anak, dan 6 orang observer. Sedangkan uji coba (kelompok kecil) dilakukan oleh 12 siswa dan uji lapangan (kelompok besar) dilakukan oleh 79 siswa. Hasil penilaian atau evaluasi model permainan ini yaitu sebagai berikut: dari ahli perkembangan motorik yaitu 91,25% (valid), dari ahli perkembangan anak yaitu 92,11% (valid), dari uji coba (kelompok kecil) 86,25% (valid) dan dari uji lapangan (kelompok besar) 91,46% (valid). Berdasarkan hasil penelitian yang dilakukan diperoleh kesimpulan bahwa pengembangan model permainan untuk mengembangkan kecerdasan kinestetik ini menyenangkan dan mudah dilakukan siswa serta diharapkan dapat meningkatkan kecerdasan kinestetik. Produk yang dihasilkan berupa model permainan untuk mengembangkan kecerdasan kinestetik anak usia 7-9 tahun di SDN Karang Besuki I Malang. Peneliti menyarankan, model permainan tersebut digunakan sebagai buku pedoman bagi guru pendidikan jasmani dalam mengajarkan materi gerak dasar pada siswa sekolah dasar usia 7-9 tahun. Disarankan pula agar digunakan oleh para orangtua yang ingin mengembangkan kecerdasan kinestetik putra-putrinya di rumah. Saran diseminasi dari peneliti yaitu sebelum disebarluaskan sebaiknya produk ini dievaluasi kembali dan disesuaikan dengan kondisi sasaran yang ingin dituju, dan disosialisasikan kepada pihak-pihak terkait misalnya: Dinas Pendidikan, tim MGMP (Musyawarah Guru Mata Pelajaran) Pendidikan Jasmani, dan sekolah-sekolah dasar untuk memperoleh pengakuan dan perijinan untuk penerapan model pembelajaran ini, jika ingin diajarkan di sekolah. Saran untuk penelitian lebih lanjut, untuk subyek penelitian, sebaiknya dilakukan pada subyek yang lebih luas, baik itu anak usia dini maupun anak usia sekolah dasar yang digunakan sebagai kelompok uji coba. Hasil pengembangan ini hanya sampai tersusun sebuah produk, belum sampai pada tingkat efektivitas produk yang dikembangkan, jadi sebaiknya dilanjutkan pada penelitian mengenai efektivitas produk yang dikembangkan.

Pengaruh persepsi siswa tentang keberadaan guru PPL terhadap motivasi belajar siswa pada mata pelajaran akuntansi di SMA Negeri 6 Malang / Khairul Umam

 

ABSTRAK Umam, Khairul. 2010. Pengaruh Persepsi Siswa Tentang Keberadaan Guru PPL terhadap Motivasi Belajar Siswa pada Mata Pelajaran Akuntansi di SMA Negeri 6 Malang. Skripsi, Jurusan Akuntansi Program Studi Pendidikan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Dr. Bambang Sugeng, S.E., Ak. M.A., M.M. (2) Helianti Utami, S.E., M.Si., Ak. Kata kunci: Persepsi, PPL, motivasi belajar. Persepsi siswa tentang keberadaan guru PPL adalah proses penilaian atau cara pandang siswa mengenai keberadaan guru PPL di sekolah mereka yang meliputi persepsi tentang sikap dan praktik mengajar guru PPL di dalam kelas. Sedangkan motivasi belajar siswa merupakan keseluruhan daya pendorong atau penggerak psikis di dalam diri siswa yang menimbulkan kegiatan belajar, menjamin kelangsungan kegiatan belajar dan memberikan arah pada kegiatan belajar demi tercapainya suatu tujuan. Penelitian ini bertujuan untuk mengetahui apakah terdapat pengaruh antara persepsi siswa tentang keberadaan guru PPL terhadap motivasi belajar siswa pada mata pelajaran Akuntansi di SMA Negeri 6 Malang. Jenis penelitian ini adalah penelitian eksplanasi dan instrumen yang digunakan berupa kuesioner (angket). Teknik pengambilan sampel pada penelitian ini adalah proportional random sampling dengan jumlah sampel sebanyak 38 responden. Sedangkan teknik analisis data menggunakan analisis deskriptif dan regresi linear sederhana. Berdasarkan hasil penelitian diketahui bahwa persepsi siswa tentang keberadaan guru PPL berpengaruh signifikan terhadap motivasi belajar siswa pada mata pelajaran Akuntansi di SMA Negeri 6 Malang. Semakin baik persepsi siswa tentang keberadaan guru PPL, maka semakin tinggi motivasi belajar siswa. Dan sebaliknya apabila persepsi siswa tentang keberadaan guru PPL kurang baik, maka motivasi belajar siswa akan kurang baik juga selama proses belajar mengajar di kelas bersama guru PPL. Implikasi hasil penelitian ini adalah terdapat pengaruh antara persepsi siswa tentang keberadaan guru PPL terhadap motivasi belajar siswa pada mata pelajaran akuntansi di SMA Negeri 6 Malang. Saran yang diberikan yaitu: (1) bagi pihak sekolah hendaknya lebih membimbing dan membina guru-guru PPL, karena hal tersebut berpengaruh pada motivasi belajar siswa. (2) bagi mahasiswa (guru PPL) hendaknya meningkatkan kemampuan mengajar dan faktor-faktor lainnya agar siswa lebih termotivasi untuk belajar dan tidak cepat merasa jenuh dengan mata pelajaran yang dihadapinya sehingga tujuan pembelajaran dapat tercapai. (3) bagi peneliti lain yang akan melakukan penelitian sejenis, hendaknya hasil penelitian lebih dikembangkan mengingat keterbatasan dalam penelitian ini, dengan mengembangkan indikator dan teknik pengumpulan data sehingga variabel-variabel dapat diukur lebih luas.

Profil Demografi Dan Sosial Ekonomi Mahasiswa Asal Kabupaten Tapin Di Kota Malang oleh Sardiansyah

 

Mahasiswa asal Kabupaten Tapin datang dari latar belakang usia, jenis kelamin, frekuensi pulang (demografi), tingkat pendidikan (sosial), jenis p'seekheinrjgagaano rang tua &n tingkat pendapatano rang tua (ekonomi) yang berbeda' hasil yang diperoleh dalam proses belajar pada Perguruan Tinggi akan berbeda pula, walaupun mahasiswa tersebut diberikan fasilitas dan tenaga p' en- g-a jayr ang sama. Penelitiani ni bertujuanu ntuk mengetahupi rofil demografim ahasiswaa sal KabupatenT apin berdasarkanu si4 jenis kelamin,dant ingkat keseringanp ulang. untuk mengetahupi rofil sosialm a&rasiswaas alK abupatenT apin di Kota Malang berdasarkanti ngkat pendidikan orang tua dan tingkat pendidikan mahasiswa. Untuk mengetahui profil ekonomi mahasiswa asal Kabupaten Tapin di Kota Malangb erdasarkanjenisp ekerjaano rangt ua dan tingkat pendapatano rangt ua. Penelitian ini merupakan penelitian diskriptif dengan pendekatan L:uantitatif yang menggunakan seluruh responden sebagai subjek penelitian. D4lam mengumpulkan data penelitian ini menggunakan tehnik wawancara terpimpin agaf ja*aUan atau data yang di kumpulkan tidak bias. Untuk mencapai tujuan penelitian yang akan dicapai, maka digunakan analisis tabulasi tunggal atau anatisii satu variabel dalam analisis datanya. Analisis satu variabel dengan firckuenspi ersentasein i digUnakanu ntuk menggambarkans eluruh variabel yang di teliti. Dari hasil penelitian ini menunjukkan bahwa mahasiswa asal Kabupaten Tapin di Kota Mal-angb erjumlah 30 orang yang te'rbagrd alam 20 orang lakiJaki dan 10 orangp erempuanM. ahasiswaa salK abupatenT apin ini berusiaa ntara1 8 - 36 tahun d""g* rata-rata tingkat frekuensi pulang 2 kali pertahun. Mahasiswa tersebutk ebanyakanb erasald ari keluargay ang bisa dibilang keluargam ampu,h al ini dapat dilihat dari jenis pekerjaan orang tua, tingkat pendidikan, dan yang utamat ingkat pendapatano rangt ua mahasiswate rsebutp erbulan'

Penggunaan model in other people's shoes Peter McPhail untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn kelas IV SDN 1 Serut Kabupaten Tulungagung / Eka Yuliana Sari

 

Kata Kunci: PKn SD, Model In Other People’s Shoes Peter McPhail, Aktivitas dan hasil belajar. Pendidikan Kewarganegaraan (PKn) SD adalah mata pelajaran yang memfokuskan pembentukan warganegara yang memahami dan mampu melaksanakan hak-hak dan kewajibannya untuk menjadi warganegara Indonesia yang cerdas, terampil, dan berkarakter sejalan dengan amanat Pancasila dan UUD 1945 untuk dapat mempertahankan berdirinya Negara Kesatuan Republik Indonesia. Didalam penelitian ini penulis menemukan berbagai masalah dengan pembelajaran PKn khususnya dalam penerapan sikap siswa yang memiliki sifat individualis, acuh takacuh terhadap lingkungan sekitarnya. Menurut Mulkhan (2001:189-192) In Other People’s Shoes Peter McPhail adalah suatu model yang dikembangkan oleh Peter McPhail untuk memelihara kepekaan siswa terhadap kebutuhan dan perasaan orang lain. In Other People’s Shoes diartikan dalam bahasa Indonesia yaitu (di dalam sepatu-sepatu orang lain) atau bisa diartikan dengan “Andai saya dalam posisi orang lain. Model ini dibuat untuk memelihara atau mengetahui kepekaan siswa terhadap kebutuhan dan perasaan orang lain. Sehingga dapat membantu siswa tau dan mengerti keadaan nyata orang lain. Tahap pertama disebut In Other People’s Shoes (di dalam sepatu-sepatu orang lain). Tujuan pokoknya adalah mengembangkan “perhatian yang lebih“ terhadap minat dan perasaan orang lain. Aspek penting dari pendekatan McPhail itu adalah bahwa materi-materi tersebut dikembangkan bersama-sama dengan bantuan peserta didik guna mengenali kunci bagi materi-materi tersebut. Dalam tahap “di dalam sepatu-sepatu orang lain" dibagi menjadi tiga unit, yaitu:Kepekaan, Konsekuensi, Sudut pandang. Tujuan penelitian ini adalah sebagai berikut (1) Mendeskripsikan penggunaan Model In Other People’s Shoes Peter McPhail pada siswa kelas IV pelajaaran PKn di SDN 1 Serut Kabupaten Tulungagung, (2) Mendeskripsikan aktivitas siswa dengan penggunaan model In Other People’s Shoes Peter McPhail dalam pelajaran PKn siswa kelas IV SDN 1 Serut Kabupaten Tulungagung, (3) Mendiskripsikan hasil belajar siswa dengan penggunaan model In Other People’s Shoes Peter McPhail dalam pelajaran PKn siswa kelas IV SDN 1 Serut Kabupaten Tulungagung Rancangan penelitian yang digunakan adalah penelitian tindakan kelas, Subyek penelitian adalah siswa kelas IV SDN 1 Serut Kabupaten Tulungagung. Data diperoleh dengan menggunakan metode pengamatan langsung, wawancara dan dokumentasi. Instrumen yang digunakan adalah Lembar observasi aktivitas belajar siswa dengan model In Other People’s Shoes Peter McPhail, pedoman wawancara dan dokumentasi. Dalam penelitian ini dapat ditemukan bahwa pengunaan model In Other People’s Shoes Peter McPhail dapat meningkatkan aktivitas dan hasil belajar siswa kelas IV pelajaaran PKn di SDN 1 Serut Kabupaten Tulungagung. Hal ini dapat dilihat dari meningkatnya nilai rata-rata aktivitas dan hasil belajar siswa dapat meningkat, pada siklus 1 nilai rata-ratnya adalah 60,5, dan pada siklus 2 meningkat menjadi 79,8. Untuk Hasil belajar dari nilai rata-rata yang diperoleh dari pre test pada siklus I meningkat menjadi 68,8 dan pada siklus II meningkat menjadi 86,7 . Guru harus lebih kreatif dalam proses belajar mengajar agar siswa mendapatkan hasil yang lebih bagus lagi. Pengunaan model In Other People’s Shoes Peter McPhail akan membantu siswa dalam meningkatkan aktivitas dan hasil belajar siswa, sehingga aktivitas dan hasil belajar siswa dapat tercapai. Model In Other People’s Shoes ternyata mampu meningkatkan aktivitas dan hasil belajar siswa. Dari uraian diatas dapatlah dikatakan bahwa terdapat pengaruh positif dalam penggunaan model In Other people’s Shoes Peter McPhail . Sebagai saran kepada guru dan sekolah, sebaiknya lebih kreatif lagi dalam menggunakan model alternatif yang lain untuk meningkatkan kinerja guru dan keberhasilan kegiatan belajar mengajar.

Pengaruh lingkungan dan ketaatan siswa dalam melaksanakan peraturan sekolah terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Batu / Maryatti

 

ABSTRAK Maryatti. 2010. Pengaruh Lingkungan dan Ketaatan Siswa dalam Melaksanakan Peraturan Sekolah Terhadap Prestasi Belajar Siswa Kelas XI IPS SMA Negeri 1 Batu. Skripsi, Jurusan Akuntansi Program Studi Pendidikan Akuntansi. FE. Universitas Negeri Malang. Pembimbing: (I) Ika Putri Larasati, S.E., M.Com. (II) Hj. Yuli Widi Astuti, S.E., M.Si., Ak. Kata kunci : lingkungan, ketaatan siswa dalam melaksanakan peraturan sekolah, prestasi belajar siswa Lingkungan tempat siswa tumbuh dan berkembang yang meliputi lingkungan keluarga, lingkungan sekolah, dan lingkungan masyarakat memiliki peran dalam perkembangan prestasi belajar siswa di sekolah. Selain itu sistem yang ada di dalam sekolah juga mempengaruhi prestasi belajar siswa, salah satu sistem itu adalah peraturan atau tata tertib sekolah. Berdasarkan uraian tersebut, maka penelitian ini bertujuan mengetahui seberapa besar pengaruh lingkungan dan ketaatan siswa dalam melaksanakan peraturan sekolah terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Batu. Variabel bebas dalam penelitian ini adalah lingkungan (X1) dan ketaatan siswa dalam melaksanakan peraturan sekolah (X2), sedangkan variabel terikat adalah prestasi belajar siswa (Y). Jenis penelitian ini adalah eksplanatif kuantitatif. Teknik pengambilan sampel yang digunakan adalah random sampling. Skala yang digunakan adalah skala likert dengan 4 (empat) pilihan jawaban. Teknik pengumpulan data menggunakan kuesioner dan dokumentasi. Penelitian ini menggunakan analisis deskriptif dan analisis regresi linear berganda. Berdasarkan hasil analisis data lingkungan berpengaruh signifikan terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Batu. Hal ini dapat dilihat dari nilai thitung (3,277) > ttabel (2,048) atau sig t (0,003) < 0,05. Ketaatan siswa dalam melaksanakan peraturan sekolah berpengaruh signifikan terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Batu. Hal ini dapat dari nilai thitung (3,766) > ttabel (2,048) atau sig t (0,001) < 0,05. Lingkungan dan ketaatan siswa dalam melaksanakan peraturan sekolah berpengaruh signifikan terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Batu. Nilai R square sebesar 0,570 menunjukkan bahwa variabel lingkungan dan ketaatan siswa dalam melaksanakan peraturan sekolah secara bersama-sama mempengaruhi prestasi belajar siswa sebesar 57%. Sedangkan sisanya 43% dipengaruhi variabel lain di luar penelitian. Saran dalam penelitian ini adalah: (1) Guru hendaknya lebih memperhatikan kondisi lingkungan siswa dan ketaatan siswa dalam melaksanakan peraturan sekolah untuk menciptakan suasana belajar yang kondusif untuk meraih prestasi belajar yang baik. (2) Sekolah hendaknya memperhatikan peraturan yang telah ditetapkan sekolah dengan tetap memperhatikan kepentingan siswa. (3)Siswa hendaknya menyadari kedudukan, hak, dan kewajibannya sebagai peserta didik sehingga pada akhirnya siswa dapat mengendalikan diri dari tingkah laku yang melanggar peraturan sekolah yang mengganggu suasana kegiatan pembelajaran.

Survei tingkat kesegaran jasmani atlet bulutangkis kelompok pemula di PB Nine Malang / Reny Kurniawati Aman

 

ABSTRAK Kurniawati, Reny. 2010. Survei Tingkat Kesegaran Jasmani Atlet Bulutangkis Kelompok Pemula di PB NINE Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (I) Drs. I Nengah Sudjana, M.Pd (II) Drs. Mulyani Surendra, M.S Kata kunci: tingkat kesegaran jasmani, atlet bulutangkis, kelompok pemula Kesegaran jasmani yang berkaitan dengan diri seorang atlet merupakan aspek penting yang harus dijaga. Untuk mempertahankan kesegaran jasmani, atlet dituntut untuk dapat menjaga kebugarannya dengan cara teratur berlatih atau menghindari makanan yang tidak sesuai dengan tubuh. Dengan begitu atlet memiliki tingkat kesegaran jasmani yang tinggi agar dapat menggunakan pikiran dan tenaganya untuk semangat berlatih. Untuk itulah kesegaran jasmani sangat menunjang keberhasilan prestasi atlet bulutangkis tersebut. Penelitian ini adalah tentang ”Survei Tingkat Kesegaran Jasmani Atlet Bulutangkis Kelompok Pemula di PB NINE Malang”. Permasalahannya yaitu bagaimana tingkat kesegaran jasmani atlet bulutangkis kelompok pemula di PB NINE Malang. Tujuannya untuk mengetahui tingkat kesegaran jasmani atlet bulutangkis kelompok pemula di PB NINE Malang. Populasi penelitian ini adalah atlet bulutangkis kelompok pemula di PB NINE Malang. Teknik pengambilan sampel yang digunakan adalah teknik total sampel yaitu semua atlet bulutangkis kelompok pemula yang ada di PB NINE Malang yaitu berjumlah 25 orang. Penelitian ini termasuk jenis penelitian deskiptif kuantitatif, pengumpulan data dengan menggunakan instrumen tes. Instrumen tes yang digunakan adalah Tes Kesegaran Jasmani Indonesia untuk Sekolah Dasar (SD) usia 6-12 tahun yang meliputi: a) lari 30 meter, b) baring duduk 30 detik, c) angkat tubuh 30 detik, d) loncat tegak, dan e) lari 600 meter untuk umur 6-9 tahun putra dan putri, serta a) lari 40 meter, b) baring duduk 30 detik, c) angkat tubuh 30 detik, d) loncat tegak, dan e) lari 600 meter untuk umur 10-12 tahun putra dan putri. Metode yang digunakan dalam penelitian ini adalah metode survei tes lapangan. Dari hasil tes kesegaran jasmani rata-rata tingkat kesegaran jasmani dengan jumlah atlet bulutangkis kelompok pemula di PB NINE Malang 25 atlet diperoleh hasil yaitu tingkat kesegaran jasmani kategori baik sejumlah 16 atlet (64%), kategori sedang 8 atlet (32%), dan kategori kurang berjumlah 1 atlet (4%). Atlet bulutangkis pemula di PB NINE Malang tidak ada yang masuk dalam kategori sangat baik maupun kurang sekali.

Kemampuan menyelesaikan soal cerita ditinjau dari tahapan analisis kesalahan Newman pada siswa SMP kelas VIII bilingual Kota Malang / Ratih Kumalasari

 

Sekolah-sekolah yang mengadakan kelas bilingual saat ini telah menjadi incaran para orang tua untuk memajukan pendidikan putra-putrinya. Tetapi dari beberapa penelitian yang telah dilakukan terdahulu, diketahui bahwa kemampuan siswa dalam matematika, khususnya dalam menyelesaikan soal cerita masih cukup rendah. Kemungkinan hal tersebut terjadi karena adanya kesalahan yang dilakukan oleh siswa. Salah satu metode yang dapat digunakan dalam menganalisis letak kesalahan siswa dalam menyelesaikan soal cerita matematika adalah Metode Analisis Kesalahan Newman. Penelitian ini bertujuan untuk mendeskripsikan: (1) kemampuan siswa kelas VIII bilingual SMP di Kota Malang dalam menyelesaikan soal cerita ditinjau dari Tahapan Analisis Kesalahan Newman, dan (2) bentuk-bentuk kesalahan yang dilakukan oleh siswa kelas VIII bilingual SMP di Kota Malang dalam menyelesaikan soal cerita matematika dengan menggunakan Tahapan Analisis Kesalahan Newman. Penelitian ini merupakan penelitian deskriptif dengan pendekatan kuantitatif. Populasi penelitian ini yaitu semua siswa kelas VIII SMP negeri di Kota Malang yang mendapatkan pembelajaran matematika berbahasa Inggris, yang berjumlah 253 siswa. Sedangkan sampel penelitian yaitu siswa kelas VIII bilingual SMP Negeri 1 Malang yang berjumlah 30 siswa dan siswa kelas VIII bilingual SMP Negeri 8 Malang yang berjumlah 33 siswa. Pengambilan data dilakukan melalui tes dan wawancara. Analisis data yang dilakukan dalam penelitian ini terdiri dari analisis statistik sederhana dan analisis deskriptif terhadap data kemampuan menyelesaikan soal cerita. Data hasil penelitian menunjukkan bahwa kemampuan reading siswa kelas VIII bilingual Kota Malang terkategori baik yaitu sebesar 78,51%, kemampuan comprehension siswa kelas VIII bilingual Kota Malang terkategori cukup sebesar 67,69%, kemampuan transformation terkategori baik yaitu sebesar 79,24%, kemampuan process skills terkategori baik sekali yaitu sebesar 92,40%, dan kemampuan encoding terkategori baik yaitu sebesar 78,95%. Jadi kesalahan terbanyak siswa terjadi pada tahap comprehension. Bentuk-bentuk kesalahan yang dilakukan oleh siswa diklasifikasikan menurut kesalahan bahasa dan kesalahan matematika. Bentuk kesalahan bahasa antara lain: siswa mengerti konteks tetapi tidak dapat menuliskan arti/representasi dengan tepat, tidak melihat konteks kalimat dan salah dalam struktur kalimat representasi. Sedangkan bentuk kesalahan matematika antara lain: kesalahan konsep matematika, memberikan jawaban mustahil dari konteks soal dan kesalahan dalam struktur kalimat interpretasi. Beberapa saran yang diajukan terhadap penelitian ini: (1) melakukan penelitian ulang terhadap kemampuan siswa bilingual di Kota Malang untuk semua tingkatan kelas menengah pertama dan menengah atas; (2) memperluas instrumen penelitian; (3) memperluas variasi cakupan materi soal tes dan (4) mengadakan pembelajaran dalam rangka meningkatkan kemampuan siswa bilingual dalam menyelesaikan soal cerita, terutama pada tahap comprehension.

Kehidupan Sosial Ekonomi Karyawan Perkebunan Teh Wonosari Desa Wonorejo Kecamatan Lawang Kabupaten Malang Oleh Novi Variyanti

 

PerkebunaTne h Wonosarmi erup-akapne rkebunanb esary angd ikelola oteh PeneroanT erbatasP erkebunaNn usantaraX II atauP TPN XIl. sahamnyad imiliki olehn egarad iusahakadne nganp rinsipm anajemepne rusahaamn,e nggunakatenn aga kgfjad airm encarki euntrmgint.e nagak erja dalamh al ini karyawanm erupakasna lah .utu foho, penting kebeihasilanp engembangainn dustri perkebunanK. aryawan perkebunamn empunyahi ubungans osialy angk hususd enganp erusahaanka, ryawan menerimpae ndapatasne bagaimi Ualany angd igunakanu ntukm embiayahi idupnya Masalahy anga kan-dibahadsa lamp enelitiani ni adalah,1 ) faktor'faktora pa yangm endoronkg; i"w* bekerjad i PerkebunaTne h Wonosari2, ) bagaimanakah CstiUusi pcnAapatank aryawan PerkebunanT eh Wonosari, 3) bagaimanakah kehidupaLnt onomi karyawanP erkebunaTne h Wonosardi ilihat dari segik ekayaan' p' end'appeanteaplnito,ia lank onsumsi. ini berttrjuanu ntuk 1) mengetahufia ktor-faktory ang mendorong karyawabne kerjad i Perke[tmanT eh Wonosari2, ) mengetahudii stribusip endapatan t"ry"**, 3) mcngetatruki ehidupane konomik aryawan'U ntuk memenuhtiu juan t o.u,rt p"otiti -menggunakan pendekatan kualitatif dengan jenis penelitian *rop"togi ekonomif.i lnit yang& gunal

Pengembangan bahan ajar membaca cerita anak berbasia cerita rakyat Kalimantan Barat untuk mata pelajaran bahasa Indonesia siswa kelas V sekolah dasar / Irma Zuliana

 

Membaca cerita anak merupakan salah satu aspek keterampilan berbahasa yang harus dikuasai oleh siswa kelas V SD. Cerpen anak-anak sebagai bentuk karya sastra mengandung nilai-nilai luhur yang berguna bagi pengalaman hidup anak-anak. Tujuan dari penelitian ini adalah untuk mengahasilkan bahan ajar membaca cerita anak berbasis cerita rakyat Kalimantan Barat yang sesuai dengan kebutuhan siswa yang meliputi kelayakan isi materi dan penyajian materi, sehingga dapat memberikan pengalaman belajar bahasa Indonesia yang menyenangkan. Penelitian ini dilaksakan pada bulan Oktober 2009 di SDN 1 Karangjati, Kabupaten Ngawi. Penelitian ini merupakan penelitian pengembangan dengan teknik analisis deskriptif kualitatif. Data dalam penelitian ini berupa skor angket berkaitan dengan kriteria-kriteria yang telah ditentukan. Selain itu juga data tidak terstruktur yang berupa masukan atau komentar validator. Data yang diperoleh dari kuesioner dianalisis dengan menggunakan teknik kuantitatif sederhana dengan menghitung persentase jawaban masing-masing pertanyaan yang diberikan kepada responden. Sedangkan data kualitatif yang berupa data tidak terstruktur (data verbal) digunakan setelah diseleksi sesuai dengan kebutuhan. Dari kegiatan uji kelayakan oleh ahli isi, ahli media, dan guru diperoleh kesimpulan bahan ajar yang dihasilkan memiliki rata-rata persentase kelayakan materi 87,5% dengan kategori sangat layak, penyajian 78,99% dengan kategori layak, bagian pendahuluan 89,58% dengan kategori sangat layak, bagian isi 85,88% dengan kategori sangat layak, bagian penutup 95,83% dengan kategori sangat layak, ilustrasi 85,42% dengan kategori sangat layak, evaluasi terhadap konsep 91,66% dengan kategori sangat layak. Dari data ini dapat disimpulkan bahwa bahan ajar yang dikebangkan dikategorikan sangat layak untuk digunakan. Sementara itu dari penjaringan data kepada peserta didik diperoleh data tingkat kelayakan materi/isi sebesar 81,25% dengan kriteria layak, dan tingkat kelayakan penyajian sebesar 82,5 dengan kriteria layak. Secara umum rata-rata presentase kelayakan bahan ajar yang dikembangkan adalah 85,74 dengan kriteria layak. Dari data ini disimpulkan bahwa bahan ajar yang dikembangkan dikategorikan layak untuk digunakan. Pengembangan bahan ajar ini diharapkan memberikan manfaat bagi siswa dan guru. Dengan menggunakan bahan ajar pembelajaran bahasa Indonesia, diharapkan lebih bermakna. Siswa dituntut untuk dapat melaksanakan setiap kegiatan dalam proses membaca cerita anak yang ada dalam bahan ajar ini. Bahan ajar ini hanya sebagai alternatif dan bukan satu-satunya bahan pembelajaran yang dapat digunakan sehingga guru bahasa Indonesia disarankan dapat memadukan bahan ajar dengan bahan belajar yang lain sehingga siswa termotivasi dalam belajar bahasa Indonesia.

Perencanaan masa depan para remaja di Desa X di Tulungagung (sebuah penelitian fenomenologis atas pelaku pesta ulur-ulur) / Rimawati

 

ABSTRAK Rimawati . 2010. Perencanaan Masa Depan Para Remaja di Desa X di Tulungagung (Sebuah Penelitian Fenomenologis atas Pelaku Pesta Ulur- Ulur). Skripsi, Program Studi Bimbingan dan Konseling Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dr. Andi Mappiare AT, M.Pd, (II) Dr. Nur Hidayah, M.Pd. Kata Kunci: Perencanaan Masa Depan, Remaja, dan Fenomenologis. Berdasarkan hasil observasi awal diketahui bahwa para remaja di desa X di Tulungagung, rata-rata pendidikannya sampai tingkat Sekolah Menengah Pertama, padahal dari segi ekonomi penduduk desa itu tergolong mampu. Tujuan penelitian ini dimaksudkan untuk mendeskripsikan pemahaman subyek mengenai masa depan, mendeskripsikan pemahaman subyek mengenai pendidikan, dan mendeskripsikan pemahaman subyek mengenai pekerjaan. Jenis penelitian ini adalah penelitian fenomenologis dengan menggunakan pendekatan kualitatif. Subyek penelitian ini adalah seorang remaja kelas IX SMP yang sudah tidak mau melanjutkan ke SMA dan mempunyai kebiasaan minum-minuman keras. Teknik pengumpulan data menggunakan observasi dan wawancara kepada subyek dan sumber lain yang berkaitan dengan subyek sejumlah empat subyek. Hasil analisis data dapat diketahui bahwa pemahaman subyek mengenai masa depan adalah subyek memiliki pemahaman bahwa masa depan sudah ada yang mengatur, merencanakan masa depan adalah sia-sia, dan masa muda dianggap sebagai masa untuk bersenang-senang. Pemahaman subyek mengenai pendidikan terdiri dari empat hal yaitu subyek memiliki kecenderungan untuk bebas dari pada terikat maksudnya subyek menganggap bahwa bersekolah hanya dituntut untut mematuhi sejumlah peraturan yang ada, sehingga subyek tidak ingin melanjutkan sekolah supaya subyek memiliki kebebasan, pendidikan dianggap sia-sia sebab subyek tidak mampu bersaing dengan orang-orang yang memiliki akses luas, subyek tidak mencontoh keberhasilan orang lain, dan kepuasan subyek sangat rendah. Sedangkan pemahaman subyek mengenai pekerjaan yaitu terjadilah upaya pembenaran dari kebenaran yang tidak bisa dirubah (Distorsi Visi Realitas), dan kebenaran subyek hanyalah semu. Temuan penelitian ini dapat disimpulkan bahwa: (1) Subyek adalah orang yang memiliki karakter kepribadian pasif dan pasrah. (2) Subyek menginginkan suatu kebebasan dari peraturan-peraturan yang mengikatnya, sehingga terjadilah tarik menarik antara security and freedom hal ini karena subyek menganggap bahwa sekolah hanya dituntut untuk mematuhi sejumlah peraturan yang ada. (3) Adanya kebutuhan akan keterkaitan atau relatedness yang sangat kuat dalam diri subyek, sehingga subyek selalu ingin sama dengan orang-orang disekitarnya termasuk dalam hal pekerjaan. Saran dalam penelitian ini untuk konselor dan para peneliti selanjutnya. Kepada konselor diharapkan dapat memberikan tindak lanjut melalui pengembangan program bimbingan preventif. Bagi peneliti lain, dapat dijadikan sebagai bahan pustaka untuk penelitian yang selanjutnya tentang perencanaan masa depan remaja dengan subyek yang berbeda.

Laporan perhitungan tugas bangunan pengairan
disusun oleh Parwoko

 

Penerapan activity based assessment dalam model pembelajaran inkuiri untuk meningkatkan keterampilan proses siswa SMA kelas X semester 2 SMA Negeri 9 Malang / Intan Aprilia Pradibtha

 

ABSTRAK Pradibtha, Intan Aprilia. 2010. Penerapan Activity Based Assesment dalam Model Pembelajaran Inkuiri untuk Meningkatkan Keterampilan Proses Siswa SMA Kelas X Semester 2 SMA Negeri 9 Malang. Skripsi, Jurusan Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Asim M.Pd., (II) Sugiyanto, S. Pd, M. Si. Kata kunci : Activity Based Assesment , Pembelajaran Model Inkuiri, Keterampilan Proses Observasi yang dilakukan di SMAN 9 Malang didapatkan bahwa pembela-jaran yang dilakukan hanya pembelajaran konvensional. Praktikum jarang dilaku-kan oleh siswa karena laboratorium diperbaiki sejak tahun 2008. Penilaian yang digunakan hanya sebatas penilaian aspek kognitif tanpa mempedulikan proses da-lam kegiatan pembelajaran tersebut. Penilaian hanya berupa tugas maupun tes, kinerja siswa dalam melakukan pembelajaran tidak pernah diperhitungkan. De-ngan pembelajaran konvensional dan penilaian yang hanya aspek kognitif saja menyebabkan keterampilan proses siswa menjadi rendah. Siswa hanya sebatas menerima konsep dan pasif sehingga keterampilan proses siswa menjadi sangat rendah. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kua-litatif, dan jenis penelitiannya adalah penelitian tindakan kelas (PTK) yang terdiri dari 2 siklus. Subjek penelitian ini adalah siswa kelas X-1 SMAN 9 Malang de-ngan jumlah 39 siswa. Pokok bahasan yang digunakan pada penelitian ini adalah kalor. Instrumen penelitian yang digunakan berupa pedoman penilaian Activity Based Assesment, lembar wawancara dan lembar observasi berupa lembar keter-laksanaan pembelajaran inkuiri, penggunaan Activity Based Assesment dan lembar kete-rampilan proses , rekaman data, dan catatan lapangan. Instrumen pembelaja-ran yang digunakan meliputi LKS dan RPP. Keterlaksanaan pembelajaran model inkuiri dalam penelitian ini yaitu se-besar 79,6% dan dapat dikategorikan baik. Sedangkan pada Activity Based Assesment semua tahapan telah terlaksana 100%. Hasil penelitian tentang kete-rampilan proses ilmiah siswa pada penelitian meningkat yaitu sebesar 1,44, siklus I rata-rata keterampilan proses siswa sebesar 0,91 (kurang) dan pada siklus II sebesar 2,35 (cukup). Pada siklus I didapatkan aspek mengamati 1,26 (kurang), menafsirkan 0,67 (kurang), meramalkan 1,9 (cukup), mengunakan 1,27 (kurang), menerapkan 0,55 (kurang), merencanakan 0,64 (kurang), berkomunikasi 0,51 (kurang) dan bertanya 0,48 (sangat rendah). Pada siklus II didapatkan aspek mengamati 2,59 (baik), menafsirkan 2,15 (cukup), meramalkan 2,67 (baik), mengunakan 2,71(baik), menerapkan 2,57 (baik), merencanakan 2,05 (cukup), berkomunikasi 1,84 (cukup) dan bertanya 2,18 (cukup). Peningkatan semua aspek keterampilan proses dari siklus I ke siklus II mencapai lebih dari 100%. Berdasar-kan hasil penelitian dapat diambil kesimpulan bahwa keterampilan proses siswa mengalami peningkatan melalui penerapan Activity Based Assement dalam model pembelajaran inkuiri.

Studi evaluasi pelaksanaan pertandingan gulat Porprov Jawa Timur II tahun 2009 di Kota Malang / Lutvie Zhakaria

 

ABSTRAK Zhakaria, Lutvie. 2010. Studi Evaluasi Pelaksanaan Pertandingan Gulat PORPROV Jawa Timur II Tahun 2009 di Kota Malang. Skripsi, Program Studi S-1 Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Drs. Heru Widijoto, M.S., (II) Drs. Mulyani Surendra, M.S Kata kunci : Evaluasi, pelaksanaan pertandingan, gulat PORPROV Jawa Timur II . PORPROV Jatim II tahun 2009 yang diselenggarakan di Kota Malang, mempertandingkan 20 cabang olahraga salah satu di dalamnya adalah cabang olahraga gulat, yang diikuti 13 Kota/Kabupaten. cabang olahraga gulat merupakan cabang olahraga unggulan Jawa Timur di mana selama hampir 29 tahun (1975-2004) cabang olahraga gulat selalu menjadi lumbung medali emas untuk Kontingen Jawa Timur pada ajang Pekan Olahraga Nasional (PON). Pada PORPROV Jatim II tahun 2009 ini, gulat termasuk salah satu cabang olahraga yang baru dipertandingkan, karena pada PORPROV Jatim I tahun 2007 yang dilaksanakan di Surabaya, cabang olahraga gulat belum dipertandingkan. Tujuan penelitian ini adalah untuk mengevaluasi pelaksanaan pertandingan gulat pada PORPROV Jatim II tahun 2009 di kota Malang, sehingga hasil penelitian ini dapat dijadikan bahan pertimbangan untuk menetapkan kebijakan yang berkaitan dengan pelaksanaan kegiatan PORPROV yang akan datang. Penelitian ini menggunakan model evaluasi CIPP (contexts evaluation, input evaluation, process evaluation, product evaluation) menurut Stufflebeam (dalam Arikunto dan Jabar, 2008:45). Instrumen yang digunakan adalah kuesioner angket. Teknik analisis data yang digunakan yaitu dengan persentase. Penelitian ini dilaksanakan di KONI Kota Malang, venues pertandingan gulat (universitas negeri malang) serta penginapan atlet. Dengan jumlah responden 57 atlet, 36 official, 7 wasit dan 4 Panitia Pelaksana. Hasil penelitian menunjukkan bahwa: Kualitas pelaksanaan pertandingan gulat PORPROV Jatim II tahun 2009 secara umum masuk pada kategori baik dengan persentase 71,97%. Kemudian kualitas pelaksanaan pertandingan gulat PORPROV Jatim II tahun 2009 secara khusus terbagi menjadi tujuh aspek. Pertama terkait kualitas layanan akomodasi, menurut atlet dinyatakan memenuhi kategori cukup dengan persentase 51,81%, sedangkan menurut wasit dinyatakan memenuhi kategori baik sekali dengan persentase 85,4%. Kedua terkait kualitas layanan konsumsi, menurut atlet dinyatakan memenuhi kategori cukup dengan persentase 52,32%, sedangkan menurut wasit dinyatakan memenuhi kategori baik sekali dengan persentase 81,59%. Ketiga terkait kualitas layanan transportasi, menurut atlet dinyatakan memenuhi kategori cukup dengan persentase 58,83%, sedangkan menurut wasit dinyatakan memenuhi kategori baik sekali dengan persentase 97,14%. Keempat terkait kualitas layanan kesehatan, menurut atlet dinyatakan memenuhi kategori baik dengan persentase 68,17%, sedangkan menurut wasit dinyatakan memenuhi kategori baik sekali dengan persentase 84,76%. Kelima terkait kualitas layanan keamanan, menurut atlet dinyatakan memenuhi kategori baik dengan persentase 65,09%, sedangkan menurut wasit dinyatakan memenuhi kategori baik sekali dengan persentase 85,71%. Keenam terkait kualitas bidang pertandingan, menurut atlet dinyatakan memenuhi kategori cukup dengan persentase 57,29% menurut official kualitas bidang pertandingan dinyatakan memenuhi kategori baik sekali dengan persentase 73,78%, menurut wasit kualitas bidang pertandingan dinyatakan memenuhi kategori baik sekali dengan persentase 84,49%, dan menurut panpel kualitas bidang pertandingan dinyatakan memenuhi kategori baik sekali dengan persentase 96,25%. Ketujuh terkait kualitas bidang keuangan, menurut wasit dinyatakan memenuhi kategori baik dengan persentase 65,71%, sedangkan menurut panpel dinyatakan memenuhi kategori cukup dengan persentase 52,5%. Berdasarkan hasil penelitian yang diperoleh, disarankan untuk pelaksanaan PORPROV di tahun berikutnya agar lebih memperbaiki kekurangan-kekurangan yang ada pada pelaksanaan pertandingan gulat PORPROV Jatim II tahun 2009 di Kota Malang di antaranya pada layanan akomodasi untuk atlet, layanan konsumsi untuk atlet, layanan transportasi untuk atlet, layanan bidang pertandingan untuk atlet, dan layanan bidang keuangan untuk wasit dan panitia pelaksana. Dan juga untuk pelaksanaan PORPROV di tahun berikutnya agar dibentuk panitia/tim yang bertugas memonitoring dan mengevaluasi terhadap pelaksanan PORPROV tersebut.

Pengaruh strategi pembelajaran peer mediated instruction and intervention tipe reverse role tutoring dan kemampuan akademik terhadap kemampuan berpikir kritis dan hasil belajar kognitif biologi peserta didik kelas VII SMP Negeri 1 Sukorejo Pasuruan / Yus Setriarini

 

ABSTRAK Setriarini, Yus. 2009. Pengaruh Strategi Pembelajaran Peer Mediated Instruction And Intervention Tipe Reverse Role Tutoring dan Kemampuan Akademik Terhadap Kemampuan Berpikir Kritis dan Hasil Belajar Kognitif Biologi Peserta Didik Kelas VII SMP Negeri 1 Sukorejo Pasuruan. Tesis, Jurusan Pendidikan Biologi, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Hj. Mimien Henie Irawati, M.S., (II) Prof. Dra. Herawati Susilo, M.Sc.,Ph.D. Kata Kunci: reverse role rutoring, kemampuan akademik, kemampuan berpikir kritis, hasil belajar kognitif. Selama ini pendidikan kita masih didominasi oleh pandangan bahwa penge-tahuan adalah seperangkat fakta-fakta yang harus dihafalkan oleh peserta didik. Akibatnya peserta didik masih menunjukkan cara-cara menghapal untuk mengua-sai pelajaran. Potensi yang dimiliki peserta didik dapat dimanfaatkan untuk mengembangkan strategi pembelajaran yang dapat melibatkan peserta didik secara aktif. Kemampuan akademik peserta didik yang bervariasi mulai dari kemampuan akademik bawah sampai dengan kemampuan akademik atas akan menunjang strategi pembelajaran yang akan diterapkan dalam proses pembelajaran. Ketika peserta didik aktif, berarti mereka mendominasi aktivitas pembelajaran dan peserta didik secara aktif telah menggunakan kemampuan berpikirnya. Strategi pembelajaran Peer Mediated Instruction and Intervention (PMII) tipe reverse role tutoring memfasilitasi peserta didik agar lebih mudah memahami materi pelajaran dan akhirnya dapat meningkatkan kemampuan ber-pikir kritis dan hasil belajar kognitifnya. Penelitian ini dilakukan untuk (1) mengetahui pengaruh penerapan strategi pembelajaran PMII Tipe reverse role tutoring terhadap kemampuan berpikir kritis pada peserta didik kelas VII SMP Negeri 1 Sukorejo, (2) mengetahui pengaruh penerapan strategi pembelajaran PMII Tipe reverse role tutoring terhadap hasil belajar biologi peserta didik kelas VII SMP Negeri I Sukorejo, (3) mengetahui pengaruh kemampuan akademik terhadap kemampuan berpikir kritis peserta didik kelas VII SMP Negeri I Sukorejo, (4) mengetahui pengaruh kemampuan akademik terhadap hasil belajar biologi peserta didik kelas VII SMP Negeri I Sukorejo, (5) mengetahui pengaruh interaksi penerapan strategi pembelajaran PMII Tipe reverse role tutoring dan kemampuan akademik terhadap kemampuan berpikir kritis peserta didik kelas VII SMP Negeri I Sukorejo, (6) mengetahui pengaruh penerapan strategi pembelajaran PMII Tipe reverse role tutoring dan kemampuan akademik terhadap hasil belajar biologi peserta didik kelas VII SMP Negeri I Sukorejo. Rancangan penelitian yang digunakan dalam penelitian ini adalah “ran-cangan eksperimen semu” untuk mengungkapkan hubungan sebab akibat dengan cara melibatkan kelompok kontrol di samping kelompok eksperimen. Rancangan eksperimen semu yang digunakan adalah rancangan Pretes-Posttest Nonequiva-lent Control Group. Sampel penelitian yaitu 2 kelas yang masing-masing terdiri atas 40 peserta didik. Penelitian ini menggunakan tes dan angket sebagai instru-ment dalam pengumpulan data. Hasil penelitian ini menunjukkan bahwa: (1) ada pengaruh strategi pembe-lajaran PMII Tipe reverse role tutoring terhadap kemampuan berpikir kritis. Hasil uji lanjut menunjukkan bahwa strategi pembelajaran PMII Tipe reverse role tutoring memiliki selisih nilai lebih tinggi yaitu 12.89 dari strategi tradisional, (2) ada ada pengaruh strategi pembelajaran.PMII..Tipe reverse role tutoring terhadap hasil belajar kognitif. Hasil uji lanjut menunjukkan bahwa stra-tegi pembelajaran PMII memiliki selisih nilai lebih tinggi yaitu 12.22 dari startegi tradisional, (3) tidak ada pengaruh yang signifikan kemampuan akademik terhadap kemampuan berpikir kritis, (4) ada pengaruh kemampuan akademik terhadap hasil belajar kognitif. Hasil uji lanjut menunjukkan bahwa kemampuan akademik atas memiliki selisih nilai lebih tinggi yaitu 10.46 dari kemampuan akademik bawah, (5) tidak ada pengaruh yang signifikan interaksi strategi pembe-lajaran PMII Tipe reverse role tutoring dan kemampuan akademik terhadap kemampuan berpikir kritis, (6) tidak ada pengaruh yang signifikan interaksi stra-tegi pembelajaran.PMII Tipe reverse role tutoring dan kemampuan akademik terhadap hasil belajar kognitif, (7) respons peserta didik terhadap strategi pembe-lajaran.PMII Tipe reverse role tutoring termasuk dalam kategori baik. Bertolak dari temuan penelitian ini, beberapa saran yang diperkirakan dapat diajukan antara lain: 1) bagi peserta didik, penerapan strategi pembelajaran PMII Tipe RRT mampu meningkatkan kemampuan berpikir kritis dan hasil belajar kognitif, membantu meningkatkan respons positif dalam proses pembelajaran dan yang tidak kalah pentingnya strategi pembelajaran PMII Tipe RRT mampu meningkatkan kemampuan berkomunikasi, mendengar dan beker-jasama hal ini menunjukkan semakin berkembangnya kemampuan sosial peserta didik; 2) bagi guru dan peneliti yang tertarik dengan strategi pembelajaran PMII Tipe RRT perlu lebih meningkatkan kemampuan berpikir kritis peserta didik dengan menggunakan berbagai macam strategi pembelajaran. Penelitian ini diharapkan mampu memotivasi pendidik pula dalam meningkatkan mutu pembelajaran dengan mengembangkan kemampuan pendidik dalam menguasai berbagai strategi pembelajaran inovatif di antaranya PMII Tipe RRT dan juga tetap mempertimbangkan kesiapan peserta didik, kesiapan guru, dan ketersediaan sumber belajar; 3).bagi sekolah merupakan landasan berpijak untuk meningkatkan mutu pendidikan dengan tetap melaksanakan Lesson Study Berbasis Sekolah dan memberikan kesempatan bagi guru untuk mengikuti berbagai pelatihan tentang strategi pembelajaran inovatif sehingga mampu meningkatkan mutu sekolah.

Studi Kondisi Sosial Ekonomi Pengrajin Genteng Di Desa Kamulan Durenan Kabupaten Trenggalek Oleh Nurin Rochayati

 

Industrai dalahs alahs atuw ujudp emerintadha lamm elaksanakan pembangunaKne. beradaaind ustrki ecild iharapkadna patm cnjadip endaurping sektopr ertaniayna ngb isam enyeratpe nagak erja.S eperthi alnyai,n dustrki ecily ang adad i desaK amulany angb ergerakd alamu sahap engadaabna hanb angunan,yaitu usahpae mbuatagne ntengs ekaligums atap encaharianU.s ahap encetakacnu kup beralasakna, renak ebutuhaank anp erumahasne makinm eningkat,e rsedianybaa han bakud anp emasarannlyaan carU. sahag entengin i membutuhkakne cakapadna n ketrempiland ari pengrajing entenga, garu sahanybai sab erkembangd anm ampu bersaindge nganp roduksgi entengd arip abrik.O lehk arenait u sikapw iraswasthaa rus ditanamkapna dad iri pengrajin. Penelitianin i bertujuanu ntukm engetahuuis ahap engrajing entengd alam mengembangkuasna hanydaa nu ntukm engetahukio ndisis osiael konompi engra.yin gentengP.e nelitianin i merupakapne nelitiand eskriptikf uantitatifP'. opulasdi alam penelitiainn i berjumlah4 60p engrajing entengy,a ngt ersebadri desaK amulany aitu dukuhK arangN ongkol1 0p engrajing entengd, ukuhG entungabne rjumlah1 20 pengrajigne ntengd,u kuhK amulanb erjurnlah1 40p engrajing entengd and ukuh Sendang9p0e ngrajigne ntengO. lehk arenajumlapho pulasmi elebih1i 00o rang, makap engambilasna mpeal dalahl5 % darij umlahp opulasiA. dapunp engarnbilan jumlahr epondepna dam asing-masindgu kuhm enggunakatenk nikp ropotional. Hasilp enelitiainn i menunjukkabna hrvak:o ndissi osiael konommi eliputi: pendidikatnin gkatp endidikanp engrajing entengra ta-rattaa matS D( 33,33%). pendapatapne ngrajing entengra ta-rataIt p.300.000-":Rp.405000 ,00j,u mlah tanggungakne luargara ta-rataan tara3 -4( 52,17%\U. sahap cngrajing entengd alam mengembangkuasna hanynar eli puti:pneg alatnauns ahap cngar.igine ntengra ta-rata I I -20t ahun( 55,07%)m. cnrprodukjcsni i s gcntenkga rangp ilangd cngajn u mlah 47,83o/ron,o daul saha walr ata-rataan tarall p. 300.(X)0,00lt-p"',1 500 00,00s ebanvak 37,7yod,a nr ata-ratma odalu sahas ckaranbgc rutrarhn cnladli p..150.000,00-

Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema cahaya untuk siswa kelas VIII SMP Negeri 10 Malang / Ahmad Mukhlis Anshori

 

ABSTRAK Anshori, Ahmad Mukhlis. 2010. Pengembangan Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Cahaya untuk Siswa Kelas VIII SMP Negeri 10 Malang. Skripsi, Program Studi Pendidikan Fisika. Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (1) Drs. Supriyono Koes Handayanto, M.Pd, M.A, (2) Drs. Triastono Imam P, M.Pd Kata kunci : IPA Terpadu, konstruktivisme, cahaya Peraturan Menteri Pendidikan Nasional nomor 22 tahun 2006 tentang standar isi, secara tegas menyatakan bahwa substansi pembelajaran IPA SMP/MTs adalah pembelajaran IPA terpadu. Hasil penelitian kebutuhan paket IPA terpadu di Malang Raya menunjukkan bahwa kebutuhan paket IPA Terpadu sangat mendesak. Sebanyak 94,6% guru membutuhkan paket IPA Terpadu sehingga perlu dikeluarkan paket IPA Terpadu (Koes H, 2008). Berdasarkan alasan di atas maka disusunlah sebuah paket IPA Terpadu dengan tema cahaya untuk SMP kelas VIII semester II. Selain paket IPA Terpadu, disusun pula panduan pelaksanaan pembelajaran IPA Terpadu. Penelitian ini adalah jenis penelitian pengembangan. Pengembangan paket IPA Terpadu dan panduan pelaksanaan pembelajaran melalui lima langkah, yaitu studi pendahuluan, perencanaan, pengembangan bentuk awal produk, uji lapangan awal dan revisi produk utama. Untuk mengetahui kelayakan paket IPA Terpadu dan panduan pelaksanaan pembelajaran IPA Terpadu dengan tema cahaya maka dilakukan uji validasi kepada tim ahli dan pengguna produk. Tim ahli terdiri dari dua orang dosen IPA, sedangkan pengguna produk terdiri dari dua orang guru IPA SMP Negeri 10 Malang. Selain validasi oleh dosen dan guru IPA, juga dilakukan uji keterbacaan oleh enam orang siswa yang memiliki tingkat penguasaan IPA tinggi, sedang dan rendah. Hasil validasi menunjukkan nilai rata-rata untuk paket IPA Terpadu dengan tema cahaya adalah sebesar 3,39 yang dapat dikategorikan layak. Hasil validasi terhadap panduan pelaksanaan pembelajaran diperoleh nilai rata-rata 3,12 yang dapat dikategorikan cukup layak. Meskipun demikian, kedua produk tersebut belum bisa digunakan untuk pembelajaran karena belum dilakukan uji empiris. Oleh karena itu perlu dilakukan uji empirik untuk mengetahui apakah paket IPA Terpadu yang dikembangkan layak untuk digunakan atau tidak.

Pengaruh ukuran kinerja keuangan dan closing price terhadap harga saham pada perusahaan property yang go publik di Bursa Efek Jakarta (BEJ) pada periode 2006-2007 / Adinda Agustina

 

ABSTRAK Agustina. Adinda. 2010. Pengaruh Ukuran Kinerja Keuangan dan Closing Price Terhadap Harga Saham Pada Perusahaan Property Yang Go Publik Di Bursa Efek Jakarta (BEJ) Pada Periode 2006-2007. Skripsi, Jurusan Akuntansi Program Studi S1 Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Drs. H. Sumadi, S.E., M.M., (II) Triadi Agung Sudarto, S.E., M.Si., Ak. Kata-kata kunci: Net Profit Margin (NPM), Earning Per Share (EPS), Price Earning Ratio (PER), Price to Book Value (PBV), dan Closing Price. Keberadaan pasar modal sangatlah penting, mengingat perannya yang begitu besar bagi perekonomian, dimana pasar modal memiliki manfaat yaitu sebagai wahana investasi bagi para investor. Semakin majunya perekonomian kita saat ini dimana objek investasi juga semakin banyak ragamnya. Oleh karena itu diperlukan suatu pengetahuan atau analisis agar dalam berinvestasi seorang investor dapat mencapai tujuan yang diharapkan secara maksimal. Salah satu analisis yang dapat digunakan adalah analisis fundamental, rasio harga saham atas nilai buku (PBV), dan analisis tekhnikal. Dimana untuk mengukur harga saham diantaranya yaitu Net Profit Margin (NPM) , Earning Per Share (EPS) yang menunjukkan kemampuan perusahaan dalam menghasilkan laba bersih per lembar saham, Price Earning Ratio (PER) menunjukkan bahwa investor mengharapkan pertumbuhan dividen yang tinggi, Price to Book Value (PBV) menggambarkan kepercayaan pasar akan prospek perusahaan tersebut, dan Closing Price merupakan harga saham di masa lalu yang memiliki suatu pola tertentu dan berulang yang dapat digunakan untuk memprediksi harga saham dimasa yang akan datang. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh secara parsial dan simultan antara Net Profit Margin (NPM), Earning Per Share (EPS), Price Earning Ratio (PER), Price to Book Value (PBV), dan Closing Price terhadap harga saham saat ini. Populasi penelitian ini adalah seluruh perusahaan Property di BEJ yang listing periode 2006-2007, sedangkan sampel yang diambil sebanyak 30 perusahaan dengan teknik purposive sampling, dimana teknik pengumpulan datanya adalah dengan teknik dokumentasi sedangkan teknik analisis data yang digunakan adalah analisis regresi linier berganda. Hasil penelitian ini menunjukkan bahwa secara parsial dan secara simultan variabel-variabel tersebut berpengaruh signifikan terhadap harga saham sekarang. Berdasarkan hasil penelitian, disarankan untuk penelitian selanjutnya yaitu dapat menambah periode penelitian dan mengganti objek penelitian, misal semua perusahaan yang listing di BEJ agar hasil penelitian lebih mencerminkan kondisi pasar secara keseluruhan.

Pengaruh Modernisasi Dalam Sektor Ekonomi Terhadap Plapisan Sosial Masyarakat Nelayan Desa Tambakrejo Kecamatan Wonotirto Kabupaten Blita Oleh Dyah Rahayu Susanti

 

Istilah modemisasmi erupakans uatuk onsepy ang samad engani stilahpembangunaenk onomit etapil ebih luasj angkauannyaS. ehinggam odernisasimengarahp adap erubahante knik, ekonomid an ekologi yangb erlangsungd alamkeseluruhanjaringasno siald ank ebudayaanP. erubahand alamh al ekonomim engarahpadap erubahans fratifikasis osial.S tratif,rkassi osiall ahir sebagaai kibat dari adanyaperubahajne nis pekerjaan. Masalahy anga kand i bahasad alamp enelitiani ni adalah:1 ) Bagaimanakahkondisie konomim asyarakant elayanD esaT ambakrejok ecamatanw onotirtokabupateBn litar akibata danyam odernisasi2, ) Bagaimanakahm obilitas sosialmasyarakante layanD esaT ambakejo kecamatanw onotirto kabupatenB litar akibatadanyam odemisapi erikanand an 3) Sejauhmanap engaruhm odernisastie rhadappelapisans osialp adam asyarakant elayand esaT ambakrejok ecamatanW onotirtokabupatmB litar. Penelitianin i bertujuanu ntuk 1) Mengetahuki ondisie konomim asyarakatnelayanD esaT ambakejo kecamatanW onotirto KabupatenB litar akibat adanyamodernisas2i), Mengetahumi obilitass osialm asyarakante layand esaT ambakrjokecamatawn onotirto kabupatenB litar akibat adanyam odemisasid an 3) Mengetahuisejauhmanpae ngaruhm odemisastie rhadapp elapisans osialp adam asyarakant elayandi DesaT ambahejoK ecamatanW onotirtoK abupatenB litar. Untuk memenuhipendekatafenn omenologisln. formand alamp enelitianin i diambil secarpau rposivesampling.Informatne rsebuat dalaha paratd esa,p engurusk operasid, ans ebagiannelayany anga dad i DesaT ambakrejoK ecamatanW onotirto KabupatenB litar.Tekniky angd igunakanu ntuk mengumpulkand ata dari parai nformana dalaht eknikobservaswi, awancarad an dokumentasiD. ata yang diperolehd ianalisisd enganmenggunakating a alur kegiatany aitu l) penyederhanaa2n); penyajiand ata;d an3 )penyimpulan. Hasilp enelitiand i lapangand apatd iperolehk esimpulanb ahwam odernisasidalams ektore konomiy ang terjadi di daerahT ambakrejob erpengaruhte rhadapadanyap elapisans osialy angt elaha da.p elapisans osialy angt erjadid i DesaTambakrejob ersifatt erbukas ehinggab anyakn elayany ang mengalamim obilitassosiabl aik mobilitasi ntragenerasmi aupunm obilitasa ntarg enerasip, elapisans osialters€bubt ersifatv ertikald anh orisontal.

Hubungan Kecenderungan Dengan Kenakalan Remaja Pada Siswa Kelas I SMP Negeri 6 Malang Tahun Ajaran 2003/2004 Oleh Lutfiatul Rokhmah

 

Inteligensi itu merupakan kemampuan secarzr umum unfuk memecahkan setiap nasalah dengan cepat, tepat dan berhasil. Sehingga inteligensi merupakan salah satu fahor yang mempengaruhi keberhasilan seseorang rmtuk mencapai cita-citanya tersebut. Dengan kata lain dapat dikatakan bahwa inteligensi dapat menentukan tingkah laku sesoorimgB.a hkan anak yang menrprmyaiI Q rendah maka dia merupakanr emaja nakal- Tetapi memang tidak semuanya seperti iru tergantung pada indiVdu masing-masing bagaimanma engolahI Q yang dimilikinya. Tujuan penelitian ini adalah: 1) tmhrk mengetahui hubugan kecerdasan dengan kenakalarne majak elas I. Populasi dalam penelitian ini adalah siswa nakal kelas I SMP Negeri 6 Malang Tahuna jaran2 00312004S. ampely ang digurtakana dalah siswa kelas I.4, L5, dan I.6 sebesa3r0 orang yarg memiliki point kenakalan terbesar. Telcrik yang digunakan untrrk pengambilasna mpela dalah denganp urposive sompling. Metode penelitian yang digunakan adalah metode dokumentasi data hasil tes inteligensdi an data kenakalan remaja yang diperoleh dari buku tatib. Instrumen yang dtpakai berupa buku tata tertib siswa. Teknik yang digunakan adalah teknik korelasi productmoment. I{asil penelitian menrmjukkan ba}rwa antara kecerdasan dengan kenakalan renaja tdak ada hubungan yang signifikan yaitu sebesar 0,214. Dengan kata lain hipotesisn ol (Ho) yang diterima sebaliknyah ipotesis kerja/altematif (Hl) ditolak. Kenakalan remaja di kelas I SMP Negeri 6 Malang tidak ada hubungannya dengank ecerdasan.Faktory ang menyebabkan hal ini terjadi adalah adanya sampling error atan kesalahan dalam pengambilan sampel. Peneliti melakukan kesalahan dengan mogambil sampel yang IQnya rata-rata bukad di bawah rata-rata. Selain itu pengertian remaja nakal antara pihak sekolah dengan yang diajukan peneliti tidak sama. Untuk itu sebapi saran unnrk penelitian selanjutnya hendaknya sampel yang diarnbil harus benarbenar sesuai dengan penelitian yang akan diambil dan harus ada kesamaan pengertian dari tempat yang dileliti dengan teori yang diajukan.

Neraca kehidupan Spodoptera litura (Fabricius) pada tanaman kedelai, kacang hijau, kapas dan jarak / oleh Anik Dwi Handayani

 

Argumen dalam karangan esai siswa kelas XII IPA 3 SMAN 2 Pare tahun pelajaran 2014/2015 / Isma Wakhidatul Amroh

 

ABSTRAK Amroh, Isma Wakhidatul. 2015. Argumen dalam Karangan Esai Siswa Kelas XII IPA 3 SMAN 2 Pare Tahun Pelajaran 2014/2015. Skripsi, Program Studi Pendidikan Bahasa, Sastra Indonesia dan Daerah, Fakultas Sastra Universitas Negeri Malang. Pembimbing: Dr. Nurchasanah, M.Pd, dan Dr. Muakibatul Hasanah M.Pd. Kata Kunci: argumen, karangan esai, pembelajaran menulis Perwujudan pemikiran kritis dan logis dapat dilihat dari tulisan yang bersifat argumentatif. Salah satu tulisan yang bersifat argumentatif adalah karangan esai. Di dalam esai, penalaran kritis dan logis berwujud argumen. Penelitian ini mengkaji tentang tindak penalaran berupa argumen dalam karangan esai siswa Kelas XII IPA SMA. Secara khusus, fokus penelitian ini adalah mendeskripsikan (1) unsur argumen, (2) struktur argumen, dan (3) pola argumen pada karangan esai siswa kelas XII IPA 3 SMAN 2 Pare. Dasar terbentuknya tiga fokus tersebut adalah dari teori karakteristik argumen. Penelitian ini menggunakan pendekatan kualitatif dengan desain penelitian analisis dokumen. Lokasi penelitian yang dipilih sebagai tempat penelitian adalah SMAN 2 Pare dengan subjek penelitian siswa kelas XII IPA 3. Data yang akan diambil adalah data kutipan teks yang berisi argumen yang bersumber pada karangan esai siswa kelas XII IPA 3 SMAN 2 Pare. Terdapat dua jenis instrumen yang akan digunakan, yaitu (1) instrumen pengumpul data (perekam dan tabel pedoman reduksi data), serta (2) instrumen analisis data (tabel analisis data yang dipandu oleh pedoman analisis data). Langkah pengambilan data pada penelitian ini adalah (1) meminta izin ke sekolah, (2) menemui guru bahasa Indonesia yang bersangkutan, lalu berwawancara secara terbuka, serta (3) mengambil contoh karangan esai dari kelas XII IPA 3 lalu mencermati semua karangan, dan (4) melakukan pengecekan kevalidan sumber data dengan guru, dosen pembimbing, dan peneliti secara berulang-ulang. Langkah-langkah analisis data adalah (1) membaca dengan cermat, (2) mereduksi serta mengklasifikasikan data, serta (3) membuat korpus data berdasarkan tiga fokus penelitian. Analisis data unsur argumen didasarkan pada teori Toulmin, Rieke, dan Janik (1984), analisis data struktur argumen didasarkan pada teori Dawud (2008), dan analisis data pola argumen didasarkan pada teori Keraf (2001) dan Toulmin, Rieke, dan Janik (1984). Unsur argumen yang ditemukan pada karangan siswa adalah gabungan dua unsur (pernyataan utama dan bukti); gabungan tiga unsur ((a) pernyataan utama, bukti, dan modalitas, (b) pernyataan utama, bukti, dan penyanggah, serta (b) pernyataan utama, bukti, dan penguat); gabungan empat unsur (pernyataan utama, bukti, penguat, dan pendukung); serta gabungan lima unsur ((a) pernyataan utama, bukti, penguat, pendukung, dan penyanggah dan (b) pernyataa utama, bukti, penguat, pendukung, dan modalitas). Gabungan unsur terbanyak yang ditemukan merupakan gabungan dua unsur argumen (47 data), sedangkan temuan unsur paling sedikit adalah gabungan tiga (pernyataan utama, bukti, dan penyanggah) dan lima unsur argumen (pernyataan utama, bukti, penguatan, pendukung, dan penyanggah) yang masing-masing ditemukan sebanyak satu data. Maka dari itu, dapat disimpulkan bahwa gabungan unsur yang dominan digunakan adalah gabungan unsur yang tidak lengkap, karena terdiri dari gabungan dua unsur argumen. Struktur argumen yang ditemukan pada karangan esai siswa adalah struktur tunggal ((a) struktur sederhana dan (b) struktur kompleks) serta struktur gabungan ((a) struktur matarantai dan struktur kompleks, (b) struktur matarantai dan struktur sederhana, dan (c) struktur matarantai dan struktur majemuk). Temuan terbanyak dari struktur argumen pada karangan esai siswa adalah gabungan struktur matarantai dan kompleks (49 data), sedangkan temuan paling sedikit adalah gabungan struktur matarantai dan struktur majemuk (dua data). Pola argumen yang ditemukan pada karangan esai siswa adalah pola induktif (hipotesis, teori, generalisasi, dan hubungan kausal), serta pola deduksi, (entimem). Temuan yang paling dominan adalah pola induksi berupa hipotesis (44 data), dan yang paling sedikit adalah entimem (lima data). Maka dari itu, dapat disimpulkan bahwa siswa cenderung bernalar dengan cara mengajukan suatu fakta-fakta atau fenomena tertentu yang menurunkan suatu kesimpulan (induksi). Setelah melakukan penelitian dan mendapatkan hasil penelitian, disarankan untuk guru agar memberikan latihan-latihan berargumen yang tepat, sehingga siswa dapat menyusun argumen dengan unsur yang lengkap. Saran untuk peneliti lain adalah peneliti lain sebaiknya dapat memastikan data yang diambilnya valid dengan cara memberi tes menulis untuk siswa. Hasil tulisan tersebut dapat dijadikan sumber data.

Pembangunan jaringan untuk mendukung sistem informasi jadwal pelajaran berbasis web di SMP-SMA Baiturrohmah Malang / Susmiari

 

Kata Kunci: Pembangunan Jaringan, Router Buffalo, Sistem Informasi Jadwal. Proses belajar mengajar sebagai sistem dipengaruhi oleh banyak faktor. Salah satu yang terpenting adalah manajemen waktu dan Sumber Daya manusia. Di SMP dan SMA Islam Baiturrohmah Kota Malang, sejumlah guru yang mengalami kekurangan jam mengajar sehingga harus mengajar di sekolah lain. Untuk itu antar sekolah perlu saling berkoordinasi dalam membuat jadwal pelajaran. Koorinasi ini menghindari adanya guru yang mengajar dalam dua tempat dalam waktu yang bersamaan dan pihak siswa atau sekolah tidak dirugikan karena para pengajarnya bisa mengajar sesuai dengan jadwal pelajaran yang dibuat oleh sekolah. SMP dan SMA Baiturrohmah Malang merupakan salah satu lembaga formal pendidikan yang belum memiliki koneksi jaringan antar komputer yang satu dengan komputer yang lain, dengan kata lain komputer masih stand alone. Sementara jaringan internet hanya terkoneksi di satu komputer saja. Melihat kondisi saat ini, SMP dan SMA Baiturrohmah Malang membutuhkan jaringan intranet maupun internet yang mendukung sistem informasi jadwal pelajaran tersebut. Untuk itu dalam proyek tugas akhir ini, penulis menggunakan router Buffalo untuk menunjang jaringan intranet maupun internet. Sistem yang jaringan intranet dan internet yang dibangun dalam pengerjaan ini menggunakan Topologi Star. Topologi ini punya bentuk fisik seperti bintang, dimana setiap node dihubungkan ke pusat. Media transmisinya bersifat tertutup dan setiap client mempunyai kabel tersendiri untuk langsung berhubungan dengan file server sehingga apabila salah satu client mengalami kegagalan, maka client yang lain tetap bisa berkomunikasi dengan server. Dengan pembangunan jaringan di SMA-SMP BaiturrohmahMalang dengan menggunakan Router Buffalo bisa mengakses aplikasi jadwal pelajaran pada jaringan intranet dan internet. Dan sistem informasi jadwal pelajaran yang dibuat telah terakses pada jaringan intranet dan internet dengan lancar sesuai yang direncanakan oleh penulis sehingga dapat bermanfaat bagi sekolah.

Pengaruh penambahan bioetanol dari tetes tebu pada bahan bakar bensin jenis pertamax dengan berbagai variasi putaran mesin terhadap unjuk kerja mesin bensin empat langkah / Topan Dwi Susanto

 

ABSTRAK Susanto, Topan, Dwi. 2010. Pengaruh Penambahan Bioetanol dari Tetes Tebu pada Bahan Bakar Bensin Jenis Pertamax dengan Berbagai Variasi Putaran Mesin terhadap Unjuk Kerja Mesin Bensin Empat Langkah. Skripsi, Jurusan Teknik Mesin FT Universitas Negeri Malang. Pembimbing: (I) Sukarni, S. T, M. T., (II) Drs. Partono, M. Pd. Kata kunci : unjuk kerja mesin bensin, penambahan bioetanol, pertamax. Penelitian ini bertujuan untuk mengetahui pengaruh penambahan bioetanol dari tetes tebu pada bahan bakar bensin jenis petamax dengan berbagai variasi putaran mesin terhadap unjuk kerja mesin bensin empat langkah. Unjuk kerja mesin yang dimaksud adalah prestasi yang dicapai mesin bensin empat langkah akibat variasi putaran mesin dan penambahan bioetanol pada pahan bakar bensin jenis pertamax dengan indikator yang meliputi daya efektif dan konsumsi bahan bakar spesifik efektif. Penelitian ini dilakukan pada mesin Toyota Seri 5K dalam kondisi standar yang dilaksanakan di laboratorium otomotif VEDC Arjosari Kota Malang pada tanggal 23 Februari 2010. Rancangan penelitian yang digunakan adalah eksperimental sungguhan (true experimental). Analisis hasil penelitian yang digunakan adalah analisis anava dua jalan. Variasi putaran mesin yang digunakan dalam penelitian ini adalah 1000 rpm, 1500 rpm, 2000 rpm, 2500 rpm, 3000 rpm, dan 3500 rpm. Hasil dari penelitian ini diharapkan dapat dijadikan sebagai referensi bagi mahasiswa teknik mesin khususnya dan bagi mahasiswa pada umumnya serta bagi pemakai kendaraan bermotor. Penambahan bioetanol adalah menambahkan bioetanol dari tetes tebu pada bensin jenis pertamax dengan cara dicampurkan dalam satuan persen yang kemudian digunakan untuk bahan bakar mesin bensin empat langkah. Persentase bioetanol yang dicampurkan pada pertamax yaitu bioetanol 0% + pertamax 100%, bioetanol 5% + pertamax 95%, bioetanol 10% + pertamax 90%, Bioetanol 15% + pertamax 85%, bioetanol 20% + pertamax 80%, dan bioetanol 25% + pertamax 75%. Bioetanol yang digunakan adalah jenis absolut yang dapat diperoleh dari toko-toko kimia. Pertamax adalah bahan bakar motor bensin tanpa timbal yang mempunyai nilai oktan 92, merupakan bahan bakar ramah lingkungan dan dapat menghasilkan pembakaran yang lebih sempurna jika dibandingkan dengan premium. Pertamax yang dipakai dalam penelitian ini adalah pertamax yang dijual di SPBU. Hasil penelitian menunjukkan bahwa penambahan bioetanol dari tetes tebu dan variasi putaran mesin pada bahan bakar bensin jenis pertamax berpengaruh terhadap unjuk kerja mesin bensin empat langkah. Daya efektif mesin paling tinggi pada penelitian ini diperoleh pada persentase 10% pada putaran mesin 3000 rpm yaitu 25,544192 PK sedangkan untuk konsumsi bahan bakar spesifik efektif yang paling rendah dicapai pada persentase 10 % dengan putaran mesin 1000 rpm yaitu 0,33170 Kg.PK-1.Jam-1.

Penerapan pembelajaran kontekstual dengan strategi reciprocal teaching untuk meningkatkan kemampuan berpikir siswa kelas XI IPA 1 SMAN 4 Malang / Agung Mulyo Setiawan

 

ABSTRAK Setiawan, Agung Mulyo. 2010. Penerapan Pembelajaran Kontekstual dengan Strategi Reciprocal Teaching untuk Meningkatkan Kemampuan Berpikir Siswa Kelas XI IPA 1 SMA Negeri 4 Malang. Skripsi Program Studi Pendidikan Fisika, Jurusan Fisika, FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Lia Yuliati, M.Pd, (II) Drs. H. Edi Supriana, M.Si. Kata kunci: kemampuan berpikir, pembelajaran kontekstual, reciprocal teaching. Berdasarkan hasil observasi yang dilakukan pada tanggal 7 Februari sampai dengan 6 Maret 2010 di kelas XI IPA1 SMA Negeri 4 Malang ditemukan bahwa, pembelajaran fisika yang dilakukan selama ini bersumber pada buku siswa; kegiatan pembelajaran belum memenuhi filosofi konstruktivisme, rendahnya kemampuan berpikir siswa, dan nilai UTS beserta ulangan harian yang diperoleh sebelumnya belum mencapai Standar Kompetensi Minimum. Berdasarkan permasalahan tersebut, perlu dilakukan penelitian tentang penerapan pembelajaran yang dapat meningkatkan kemampuan berpikir siswa. Salah satu tindakan perbaikan adalah dengan penerapan pembelajaran kontekstual dengan strategi Reciprocal Teaching untuk meningkatkan kemampuan berpikir siswa kelas XI IPA 1 SMA Negeri 4 Malang. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK), yang dilaksanakan dalam dua kali siklus. Siklus pertama terdiri atas tiga kali pertemuan, dan siklus kedua dua kali pertemuan. Subjek penelitian yang digunakan dalam penelitian tindakan kelas ini yaitu siswa kelas XI IPA1 semester genap tahun ajaran 2009-2010 SMA Negeri 4 Malang yang berjumlah 36 siswa. Data yang diperoleh berupa kemampuan berpikir siswa yang terdiri dari kemampuan bertanya dan kemampuan menjawab siswa, serta data pendukung berupa hasil tes akhir siklus dan catatan lapangan. Kemampuan bertanya siswa diukur berdasarkan frekuensi pertanyaan siswa pada 10 kategori dengan revisi taksonomi Bloom, yang terdiri dari remember, understand, apply,dan analysis. Kemampuan menjawab siswa diukur berdasarkan frekuensi dalam 10 kategori, yaitu pemahaman konsep, keruntutan pola pikir, dan gramatika bahasa yang digunakan. Instrumen penelitian yang digunakan dalam penelitian ini adalah lembar observasi kemampuan bertanya dan kemampuan menjawab siswa, RPP, LKS, tes akhir siklus, dan catatan lapangan. Berdasarkan hasil penelitian yang diperoleh, berturut-turut kemampuan bertanya dan kemampuan menjawab siswa pada siklus I sebesar 57,6% dan 57,1%; sedangkan pada siklus II sebesar 80,6% dan 87,5%. Meningkatnya persentase kemampuan bertanya dan kemampuan menjawab siswa, menunjukkan bahwa penerapan pembelajaran kontekstual dengan strategi Reciprocal Teaching dapat meningkatkan kemampuan berpikir siswa kelas XI IPA 1 SMA Negeri 4 Malang.

Membangun jaringan LAN untuk pengembangan E-Learning pada SMP Negeri 1 Bendungan Trenggalek / Hadi Muhtarom, Maryoto

 

Kata kunci : jaringan, e-learning, moodle Letak suatu daerah mempengaruhi kualitas pendidikan, penyebaran dan pengaksesan informasi. Jaringan internet merupakan salah satu media yang mudah dan luas jangkauanya dalam penyebaran informasi, selain itu juga mudah dalam aplikasinya. SMP Negeri 1 Bendungan sebagai salah satu SMP Calon Rintisan Sekolah Standar Nasional berada di daerah pegunungan Trenggalek belum mempunyai jaringan internet, maupun jaringan LAN. Namun demikian dalam mendukung pembelajaran SMP Negeri 1 Bendungan mempunyai fasilitas komputer 10 buah. Guna meningkatkan kinerja dan membangun media pembelajaran maka diperlukan jaringan LAN dan e-learning di SMP negeri 1 Bendungan. Jaringan LAN yang dibangun di SMP negeri 1 Bendungan menggunakan topologi star yang terdiri dari 9 client dan 1 server dengan menggunakan IP 192.168.0.1 sebagai server dan IP 192.168.0.2 sampai dengan IP 192.168.0.10 sebagai client. Sedangkan e-learning yang dibangun memuat materi pelajaran, soal dan pengumuman dengan menggunakan software Moodle lates 15 dan Xampp win 32.1.5.4. Setelah dilakukan proses instalasi dan setting jaringan, maka diperoleh jaringan LAN yang menghubungkan 9 client dengan 1 server. E-learning dibangun dengan terlebih dahulu menginstal software moodle dan xampp win.32.1.5.4 ke server. Sedangkan pada komputer client dilakukan seting IP dengan menggunakan kelas C. E-Learning yang dibangun berisi nama pelajaran, pengumuman, dan login pengguna. Setiap pelajaran berisi materi pelajaran dengan format PDF dan doc, tugas, profil pengajar dan forum diskusi. Setiap siswa dapat menggunakan komputer client untuk mengakses materi pelajaran atau e-learning yang ada di server. Berdasarkan hasil ujicoba, maka dapat disimpulkan bahwa jaringan LAN yang dibangun dapat digunakan untuk mengakses e-learning. Moodle, xampp dapat digunakan untuk membangun e-learning dengan mudah dan interaktif. Untuk meningkatkan kualitas e-learning maka tiap guru dituntut untuk dapat mengoperasikan komputer, kreatif, dan siswa dituntut lebih aktif.

Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema cahaya siswa kelas VIII di SMP Negeri 1 Pakisaji / Kristanto

 

ABSTRAK Kristanto. 2010. Pengembangan Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Cahaya untuk Siswa Kelas VIII di SMP Negeri 1 Pakisaji. Skripsi. Program Studi Pendidikan Fisika. Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (1) Drs. Supriyono Koes H., M.Pd, MA, (2) Drs. Triastono Imam P., M.Pd Kata kunci: paket IPA Terpadu, konstruktivisme, tema cahaya Dalam Peraturan Menteri Pendidikan Nasional (Permendiknas) Nomor 22 Tahun 2006 tentang Standar Isi, secara tegas dinyatakan bahwa substansi mata pelajaran IPA untuk SMP/MTs merupakan IPA terpadu. Di lain pihak, penelitian ahli pendidikan di Malang menunjukkan bahwa kebutuhan guru terhadap bahan ajar terpadu benar-benar mendesak seiring diberlakukannya pembelajaran IPA Terpadu. Hasil pangamatan lapangan beberapa toko buku di Malang juga menunjukkan belum adanya buku IPA SMP yang dirancang secara benar-benar terpadu. Oleh karena itu, peneliti berusaha mengembangkan Paket IPA Terpadu. Sasarannya adalah tersusunnya; Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Cahaya untuk Siswa Kelas VIII di SMPN 1 Pakisaji yang layak, dan Panduan Guru Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Cahaya untuk Siswa Kelas VIII di SMPN 1 Pakisaji yang layak. Penelitian ini merupakan penelitian pengembangan yang menggunakan metode Borg dan Gall. Langkah-langkah pengembangan dalam penelitian ini terdiri dari 5 langkah, yaitu; (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal produk, (4) uji lapangan awal, dan (5) revisi produk utama. Kelayakan paket IPA Terpadu dan panduan gurunya diukur dengan instrumen yang diisi oleh 2 dosen IPA (fisika dan biologi) dan 2 guru IPA SMP. Hasil penelitian menunjukkan bahwa Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Cahaya memperoleh nilai rata-rata 3,60 yang berarti layak. Panduan Gurunya memperoleh nilai rata-rata 3,70 yang berarti layak. Walaupun Paket IPA Terpadu dan Panduan Guru Paket IPA Terpadu Berbasis Konstruktivisme dengan Tema Cahaya layak, paket dan panduan guru masih perlu diuji secara eksperimen tentang keefektivannya.

Latihan dalam buku teks BIPA tirai nusantara Indonesia for advanced learner / Yuliana Dwi Utari

 

ABSTRAK Utari, Y. D. 2010. Latihan dalam Buku Teks BIPA Tirai Nusantara (Indonesian for Advanced Learner). Skripsi, Jurusan Sastra Indonesia FS Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Imam Suyitno, M.Pd., (II) Dr. Kusubakti Andajani, M.Pd. Kata kunci: latihan, buku teks BIPA, pebelajar asing Buku teks merupakan salah satu media belajar terpenting khususnya dalam pembelajaran BIPA. Seluruh unsur yang terdapat di dalamnya memiliki kelebihan dan kekurangan masing-masing, seperti materi dan latihan, serta unsur kebahasaan dan budaya yang harus tercantum dalam suatu buku teks BIPA. Penyajian latihan dalam buku teks merupakan salah satu faktor penting dalam menentukan keberhasilan pembelajaran BIPA. Buku teks Tirai Nusantara (BTTN) sebagai salah satu media dan sumber belajar untuk pebelajar asing tingkat lanjut memiliki keragaman baik dari materi maupun latihan yang disajikan. Karena ditujukan pada pebelajar jenjang lanjut atau advanced, pemilihan materi dan penyajian latihan memiliki kompleksitas tersendiri. Penelitian kualitatif deskriptif ini bertujuan untuk menjabarkan berbagai jenis dan bentuk latihan, cakupan tujuan pembelajaran pada tiap topik esesmen, cakupan budaya pada tiap topik latihan, serta cakupan keterampilan berbahasa pada buku. Temuan dihasilkan melalui proses klasifikasi data, penghitungan persentase penyajian serta penginterpretasian hasil analisis data. Hasil penelitian menunjukkan bahwa BTTN memiliki latihan yang cukup beragam walaupun terjadi banyak pengulangan ragam latihan pada tiap unit dalam buku. Selain itu, berdasarkan catatan awal penulis serta tinjauan tiap topik latihan, terdapat pula beberapa tujuan pembelajaran yang belum tersaji sebagai latihan pada setiap topik latihan. Akan tetapi, dari segi kelengkapan aspek keterampilan berbahasa yang disajikan, BTTN memiliki nilai lebih dengan menyajikan beberapa latihan terkait aspek menyimak. Dari segi budaya, BTTN telah memiliki latihanlatihan yang mengandung nilai-nilai budaya Indonesia. Berdasarkan hasil penelitian ini, dapat disarankan agar ditambahkannya beberapa ragam latihan yang unik, kreatif, dan menyenangkan, dan menambah beberapa tujuan pembelajaran yang belum tersaji. Terlepas dari hal tersebut, BTTN dapat menjadi contoh bagi penulis atau calon penulis buku ajar BIPA melalui kelengkapan aspek budaya dan keterampilan berbahasa yang disajikan. Selain itu, diharapkan kepada peneliti selanjutnya untuk menelaah lebih dalam Buku Teks Tirai Nusantara.

Penerapan permainan "tebak gambar" untuk meningkatkan kemampuan bahasa anak kelompok B2 TK Negeri Pembina Kepanjenkidul Kota Blitar / Umi Farida

 

Kata Kunci:Permainan, tebak gambar, kemampuan berbahasa, Taman Kanak-Kanak Bahasa adalah segala bentuk komunikasi dimana pikiran dan perasaan manusia disimbolisasikan agar dapat menyampaikan arti atau maksud kepada orang lain. Berdasarkan hasil observasi terhadap siswa kelompok B2 di TK Negeri Pembina Kepanjenkidul Kota Blitar, ditemukan bahwa 11 dari 20 anak (50, 9%) kemampuan bahasanya rendah. Hal ini berdampak pada kurangnya kosa kata yang dimiliki anak untuk mengembangkan ketrampilan menyimak, mendengar, dan berbicara. Rumusan masalah dalam penelitian ini sebagai berikut: (1) Bagaimana penerapan permainan “tebak gambar” untuk meningkatkan kemampuan bahasa anak kelompok B2 TK Negeri Pembina Kecamatan Kepanjenkidul Kota Blitar? (2) Apakah dengan penerapan permainan “tebak gambar” dapat meningkatkan kemampuan bahasa anak kelompok B2 TK Negeri Pembina Kecamatan Kepanjenkidul Kota Blitar? Rencana Penelitian dengan menggunakan pendekatan kualitatif, jenis penelitian tindakan kelas (PTK). Penelitian ini direncanakan sebanyak dua siklus melalui tahap perencanaan, pelaksanaan tindakan penelitian, observasi dan refleksi. Subjek penelitian adalah anak kelompok B2 TKN Pembina Kecamatan Kepanjenkidul Kota Blitar yang berjumlah 20 anak. Analisis penelitian data dilakukan secara deskriptif kualitatif. Kegiatan analisis data menggunakan lembar observasi dan dokumentasi. Tehnik analisis data dihitung menggunakan rumus presentase untuk setiap komponen penilaiannya. Hasil tindakan penelitian pada penerapan permainan ”tebak gambar” untuk meningkatkan kemampuan bahasa anak di TKN Pembina Kecamatan Kepanjenkidul Kota Blitar pra tindakan dengan rata-rata 49,10 % setelah diadakan tindakan siklus I jumlah anak yang tuntas adalah 13 dari 20 anak (66,25 %). Selanjutnya untuk tindakan penelitian pada siklus II rata-rata kemampuan bahasa anak mencapai kriteria ketuntasan kelas dengan perolehan (17 dari 20 anak tuntas) dengan rata-rata 85,42 %. Penerapan permainan tebak gambar dapat meningkatkan kemampuan bahasa anak terbukti dengan semakin banyaknya kosa kata yang didapat anak melalui bermain menggunakan kartu gambar dan kartu kata. Saran yang diberikan untuk pihak sekolah hendaknya untuk mengembangkan kemampuan bahasa anak khususnya ketrampilan mendengar, menyimak dan berbicara, diharapkan menerapkan permainan tebak gambar yang lebih menarik dan bervariasi.

Penerapan pembelajaran model ARCS untuk meningkatkan motivasi dan hasil belajar sistem persamaan linier dan kuadrat dua variabel siswa SMU Laboraturium UM kelas X semester I / Resti Switaning Edy Seputri

 

ABSTRAK Seputri, Resti Switaning Edy . 2010. Penerapan Pembelajaran Model ARCS Untuk Meningkatkan Motivasi Dan Hasil Belajar Matematika Siswa Smu Laboratorium Um Kelas X Semester I . Skripsi, Jurusan Pendidikan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Sri Mulyati, M.Pd. (II) Drs. Rustanto Rahardi, M.Si. Kata kunci: Hasil belajar, Motivasi belajar, Model ARCS. Guru memiliki peranan penting dalam kegiatan pembelajaran untuk memberikan pemahaman siswa terhadap materi yang disampaikan. Mengingat kemampuan daya tangkap dan motivasi belajar siswa yang berbeda-beda, guru harus pandai memilih srategi pembelajaran yang tepat dan sesuai dengan keadaan kelasnya. Pembelajaran Model ARCS merupakan salah satu alternatif pembelajaran yang berdasarkan prinsip-prinsip motivasi. Pada pembelajaran ini siswa terlebih dahulu diajak untuk mengingat kembali konsep materi yang telah dipelajari sebelumnya, menunjukkan hubungan bahan ajar dengan kebutuhan dan kondisi siswa, melalui permasalahan open ended yang dikerjakan secara individu atau berkelompok sesuai dengan pengalaman-pengalaman pengetahuan siswa sebelumnya, memberikan umpan balik terhadap pelaksanaan tugas, dan memberikan penguatan terhadap keberhasilan pelaksanaan tugas yang telah dipelajari dengan pemberian tes. Penelitian ini dilakukan di SMA Laboratorium Universitas Negeri Malang, tanggal 22 Oktober 2009 sampai 3 Desember 2009. Rancangan penelitian yang digunakan adalah penelitian tindakan kelas dengan pendekatan kualitatif. Penelitian ini dilakukan karena adanya kesulitan siswa dalam memahami himpunan penyelesaian Sistem Persamaan Linier dan Kuadrat Dua Variabel. Penelitian ini terdiri dari siklus I dan siklus II. Tingkat keberhasilan peningkatan motivasi dan hasil belajar dapat dilihat dengan mengamati peningkatan yang diperoleh sebelum pelaksanaan siklus I, setelah siklus I dan setelah siklus II. Instrumen yang digunakan untuk mengukur hasil belajar siswa adalah tes kemampuan awal, dan tes di akhir siklus. Sedangkan untuk mengukur motivasi belajar siswa digunakan instrumen berupa angket dan lembar observasi motivasi siswa selama pembelajaran berlangsung. Hasil penelitian menunjukkan bahwa motivasi belajar siswa pada siklus II menunjukkan peningkatan dibandingkan siklus I. Peningkatan skor motivasi rata-rata angket sebelum pelaksanaan tindakan dengan rata-rata skor siswa sebesar 3,99 meningkat menjadi 4,05 sesudah pelaksanaan tindakan. Rerata kelas dari hasil evaluasi di setiap siklus juga mengalami peningkatan, sebelum tindakan sebesar 35.04 dan hasil belajar setelah tindakan sebesar 82,05 dengan peningkatan sebesar 47,01. Ketuntasan belajar secara klasikal pada siklus I sebesar 76,1% dan pada siklus II meningkat menjadi 100%. Jadi, ketuntasan belajar mengalami peningkatan sebesar 23,09%. Berdasarkan hasil penelitian guru dapat menerapkan model ARCS dalam proses pembelajaran sebagai variasi pembelajaran Matematika yang dapat meningkatkan motivasi dan hasil belajar siswa. i

Pancasila sebagai suatu sistem filsafat dalam masyarakat Indonesia (suatu tinjauan dari segi konstitusi) / oleh Sopandi

 

Pengaruh Persepsi Anggota tentang tatalaksana Usaha KUD Terhadap Partisipasi Anggota Di Bidang Usaha Pada KUD "Sari Bumi" Bululawang Malang Oleh Widyamah

 

KUD adalahb entukk operasyi angb ersifatm ultipurposeH. inggak ini bentuk usahay angd isebust ebagasio kog urup erekonomianna sionainl i masihs edikit kontribusinydaa lamp embangunaenk onomni asionajilk a dibandingkadne ngan bentuku sahala innyaK. ondisis emacamin i ter1adki arenap artisipasain ggota tergolongre ndah.S alahs atub entukp artisipasai nggotad i koperasai dalahp artisipasi di bidangu saha. Faktory angd idugad apatm empengaruhpia rtisipasai nggotad i bidangu saha salahs atunyaa dalahb agaimanakaphe rsepsai nggotate ntangta talaksanuas ahaO. leh karenait u penelitianin i bertujuanu ntukm engetahupi engaruhp ersepsai nggota tentangta talaksanuas ahate rhadapa rtisipasain ggotad i bidangu saha. Penelitianin i dilaksanakadni KUD "SARI BUMI" Bululawanmg alang. RancangaPne nelitiayna ngd igunakaand alahp enelitiand eskriptif-korelasional (sebaba kibat)d enganm enggunakaann alisisd eskriptifdanre gresgi andaA. dapun penggaliadna tap enelitiand ilakukanm elaluis ebaraann gkette rhadapjurnlasha mpel penelitians ebanya9k l respondedna njugam enggunakadna tad okumeny ang kemudiand iolah. Berdasarkahna silp enelitiand itemukanb ahwa( l) Sebanya6k4 ,g3% respondemn emilikip ersepsyi angp ctsitift entangt atalaksanau iaha sprR. dan sebanyak4 1,76%r espondemn emilikiperse psiy ang negattft entanEta4t aluksana usultut oserbu( 2) Sebanyak6 3,83%r espondenm emilikip urtisipaii tinggiid i bidang u.rahus impunp inlum (sPl'l?),d ans ebanyak3 5,16%r espondemn emlliii partrstpusi rendahd i bidungu sahat rserbu( 3) Atlu penguruhp ositt/'yangs ignifikuna ntaru persep'rui n!:gota! entungt atulaksanau sahat erhadapp artisipa.tinyatI i birtang usuhu,yaitud engand iperolehnyhaa silR 2= 0,g1430p. engaruhva riabeXl terhadap variabelY adalahs ignifikank arenan ilai F ni,*e) F e,b.yl,a ituF li,*e : 192,93791d an F,,&r:3,1Ip adad b2 lawan8 8,N :91, q,:5%. Besarnysau mbangraenl atixf 1: 74,48%s, umbangarne latifx 2: 25,52% dans umbangaenf ektifx , :3O,OSN, sumbangaenfb ktifx 2= 20,78%J. adid apatd isimpulkanb ahwas umbangavna riabel X1t erhadavpa riabeYl lebihb esadr aripadas umbangaXn2 . tsertitikto lakd arit emuanp enelitianin r,d iajukanb eberapsaa rany ang dapat dtyadikasnc bagapi ertirnbangabna gip engurudsa lamu payam eningkatkapna rtisipasi anggotdai bidangu sahato serbay,a itu( l) menambacha bangto serbate rutamad i rvilal'ahk erlaK UD yangp elosok(2 ) melengkapdia nm emviriasbi arang-barangyang dtjuald i toserbag unam emenuhkie butuhaann ggotab aiks ecarain dividuaml aupun bertindaske bagaaig enb agia nggotaya ngm embukau sahak ios/toko(3 ) mencrptakan kenyamanabne rbelanjaan ggotam elaluip enambahafans ilitasb idangto serbad an penataakne mbalri uangto serba(4 ) melakukapnr omossi ederhana'relalluisi an. pemasangapna mfletu ntukb arangy angb elump ernahd rjuald i toserbap,e mberian potongahna rgau ntukp ernbeliasne besanri lair upiaht ertentud, anm enyflenggarakan kuponb erhadiah.

Variasi metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek / Andi Asngari

 

ABSTRAK Asngari, Andi. 2009. Variasi Metode Pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek. Skripsi. Jurusan Hukum dan Kewarganegaraan Fakultas Ilmu Sosial (FIS) Universitas Negeri Malang (UM). Pembimbing: (1) Drs. H. A. Rosyid Al Atok M.Pd., M.H, (II) Siti Awaliyah, S.pd., M.Hum. Kata Kunci: Variasi Metode, Pembelajaran PKn Untuk mencapai hasil pendidikan maksimal sesuai target, maka diperlukan berbagai perencanaan pelaksanaan dan evaluasi terhadap kegiatan yang diselenggarakan dalam istitusi atau lembaga pendidikan. Masalah utama dalam pembelajaran Pendidikan Kewarganegaraan (PKn) ialah penggunaan metode atau model pembelajaran dalam menyampaikan materi pelajaran secara tepat, yang memenuhi muatan tatanan nilai, agar dapat diinternalisasikan pada diri siswa serta mengimplementasikan hakekat pendidikan nilai dalam kehidupan sehari-hari. Guru PKn mengajar lebih banyak mengejar target yang berorientasi pada nilai ujian akhir, di samping masih menggunakan model konvensional yang monoton, aktivitas guru lebih dominan daripada siswa, akibatnya guru seringkali mengabaikan proses pembinaan tatanan nilai, sikap, dan tindakan; sehingga mata pelajaran PKn tidak dianggap sebagai mata pelajaran pembinaan warga negara yang menekankan pada kesadaran akan hak dan kewajiban tetapi lebih cenderung menjadi mata pelajaran yang jenuh dan membosankan. Penelitian ini bertujuan untuk mengambarkan tentang variasi metode pembelajaran PKn di SMP negeri 1 Pule Kabupaten Trenggalek. Secara khusus penelitian ini bertujuan untuk mendeskripsikan: (1) metode pembelajaran yang dipakai dalam pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek, (2) faktor-faktor yang mendorong penggunaan berbagai metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek, (3) faktor-faktor yang menghambat penggunaan berbagai metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek, (4) upaya-upaya yang dilakukan guru untuk menciptakan variasi metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek. Penelitian ini menggunakan pendekatan kualitatif. Kegiatan pengumpulan data adalah obsevasi, yaitu pengamatan khusus dengan pencatatan yang sistematis, wawancara yaitu dengan melaksanakan Tanya jawab secara langsung dengan responden untuk memperoleh informasi yang diperlukan, dokumentasi yaitu dengan menelusuri, mengumpulkan informasi dan dokumen yang berkaitan dengan penulisan skripsi. Hasil penelitian ini menunjukkan bahwa metode pembelajaran yang dipakai guru dalam pembelajaran PKn di SMP Negeri 1 Pule kabupaten Trenggalek antara lain: metode ceramah, metode tanya jawab, metode diskusi, metode penugasan. Perumusan tujuan oleh guru biasanya lebih dari satu rumusan, oleh karena itu di dalam setiap proses pembelajaran guru selalu menggunakan kombinasi/variasi metode. Metode yang satu digunakan untuk mencapai tujuan yang satu, sementara metode yang lain, juga digunakan untuk mencapai tujuan yang lain, (1) metode ceramah, Tanya jawab dan tugas, (2) metode ceramah, diskusi dan tugas. Penggunaan berbagai metode pembelajaran PKn di SMP Negeri 1 Pule Kabupaten Trenggalek ditemukan adanya hambatan, yaitu: alasan guru, ketersediaan sarana dan prasarana, karakteristik siswa, karakteristik materi. Berdasarkan penelitian ini, dapat disarankan agar siswa selalu memperhatikan penyampaian pelajaran yang disampaikan oleh guru. Sehingga metode yang digunakan oleh guru dalam proses pembelajaran siswa dapat mengikuti dan mengerti tujuan pembelajaran yang ingin dicapai guru dalam proses pembelajaran.

Peranan Dispenda Dalam Upaya meningkatkan Pendapat Daerah Melalui Penerimaan PBB Di Kabupaten Situbondo Oleh Lindayanti

 

PBB rnerupakansu mbery angs angapt otensiadl alamp enerimaanka bupaten.Untuk itu perlu penanganayna ngs eriuso lehp emerintahd aerahD. ispendad alamh alini yangd iserahti ugaso lehp emerintahd aerahu ntukm enanganai tass emuapenerimaand aerahk hususnyaP BB.D is'pendam erupakanin stansyi angl angsungberadad i bawahd anb ertanggUng-jawakebp adak epalad aerahD. inasP endapatanDaerahin i mempunyapi eranany angs angapt entingk arenad i sampingm enanganisegalaje nis penerimaand aerahju ga diserahti ugasu ntukm empertinggpi endapatandaerah. Penelitianin i bertujuanu ntukm engetahutie ntangp erananD ispendad alarnmeningkatkapne ndapatadna erahm elaluip enerimaanP BB di KabupatenS itubondo, hambatany angd ialalrrid anu payam engatashi ambatante rsebutP. endekatayna ngdipakadi aiamp enelitianin i adalahp endekataknu alitatifdengamn enggunakanjenispeneiitians tudik asus.S umberd atad ipilih danl angsungd itentukanp ihaky angmenjadrin formany aitu bagiar.s ubd inasp enagihand anp ernbukuanse banyatki gaorangd ans ubd inzrsp erencanaapne ndapatasne banyadk uao rangd engana lasanbahrvain fonnani tu benar-benasru mbery angr nemiliki banyaki nlbrmasi,d apatdipercayad anv alid. Pengumpuladna tad ilakukand engano bservaswi awancara<,l an dokumentasUi. ntuk pengecekakne absahatne muand ilakukand enganp gngafr"tatan,triangulasir,e ferensyi angc ukup.U ntuk analisisd atam enggunakaann alisisd atan onstatistikdenganc arar eduksid ata,p enyajiand atad anr nenarikk esimpulan. Hasil p,cnelitianin i menunjukkanp eranany angd ilakukanD ispendaKabupatenS itubondod alamm eningkatkanp endapatadna erahd ari sektorp enerinraanPBB masihp erlu dioptimalkand enganm elakukanu payai ntensifikasdi anekstensifikaslil.a i ini dapatd ilihat dari peningkatanp endapatadna erahti aptahunnyaH. ambatan'hambatadna lamm eningkatkanp endapatadna erahm elaluiP BByaitu masalahte knisa ntarala in (i) sistemp endataa)n/ angb eluma icura(ti i)terbatasnyfaa silitasd ank apasitask erja( iii) kurangm antapnyas istemk omunikasidani nformasi( iv) sulitnyam enerapkasna nkspi adaw ajib pajak.H ambatany angbersifatr on-teknisa ntarala in (i) tingkatp ertumbuhaenk onomir akyat( ii) kurangsadamyam asyarakadta larnr nernbayapra jak( iii) keadaand an situasti ertentul.J paya.untukm engataspi erinasalahayna ngb ersifatt eknis( i) penyediaasna ranad anprasarankae ria( ii) kerjasamdaa nk oordinasyia ngb aika ntarin stans(ii ii) membentuk tim pencariatnu nggakaPnB B( iv) peningkatasnu mbedr ayar nanusiaU. payav angdilakukanu ntukr ne:rgatapsei mrasalahanno n"tekni(si) melakukapne nlruluhaPn! lil (ii) mensosiaiisasikaPnB B lewatr adio (iii) menerjunkanp etugasg abunganu ntukmengklarifikaspi ennasalahaPnB B di suatuw ilayah.Berdasarkapne neiitianin i, makad isarankana garD ispendate rusi ebih giatlagi dalaurm enjalanirapne rannyaa garm ampum eningkatkanp endapatadna etahsehinggpae rlua danyak erjasanlyaa .nglc bihb aikd enganle mbagate rkaitd anmasyarakat.

Model Pembelajaran Observasi Ke Industri Krupuk "YSN" Untuk Sub Pokok Bahasan Industri Pada Kelas II IPS 4 Semester I Tahun Pembelajaran 2003 / 2004 Di MAN 3 Kediri Oleh Marwah

 

Guru sangabt erperand alamm emperbaikpi rosesp embelajaranA' pa yangdialamiw aktum engajars angabt erhargad alamu saham emperbaikpi rosesp embelajaran.G uruh arusm ampum embuatm odelp embela.;arayna ngm empum enuntaskanbelajars iswa. Berdasarkanhasilpengamatandilapangan,hasitbelajardanaktivitasbelajarsiswadalam rosesp emblelajarang eografid alam mengtkuti prosesp embei";uiur-ru"gut purif, ut iuutny a laiangteiganaik etuntasanb elajar.U ntuk mengatasitratt ersebuidiperlukans uatu;odel-pembeiajalayl angm amp!-meningkatkaank -tivitas belajar sis*a dan mencapai kitunasan belajamya' Model pembelajaranyang dimaisud adalahm odel pembelajarano bservaski e indusri krupuk *YSN"'Penelitian tindakan keias ini birtu.luan untuk mendiskripsikan proses danhasilp enerapamn odelp embelajaraonb servaski e industrik rupuk"YSN"dalam upu'u -"ningtutkan keaktifan 6ehjar siswad an ketuntasanh asil belajarp adas iswatelas II IpS 4 MAN 3 Kediri. Pinelitian ini dilaksanakapna das emesteIr t ahunpembelaaj ran2003l2}04y, aitu padab u]anA gustus2 003' Subyekp enelitianadatafsr iswak elasI I IPS 4 MAN 3 kediri denganju mlah siswas ebanya4k 0 siswa.Datap enelitianb erupap enerapamn odelp embelajaryol bservaski e industrikrupuk..V'Sf,berupa; (f) Keaktifan6 slEal sisway angd ikumpulkand enganobservasoi leh seorango bsirver,( 2) Hasil belajars isway angd ikumpulkand engunp""iru*nakhirti-ndakan,dan(3)Kesenanganbelajarsiswayangdikumpul.kin denganm etodea ngket.D ataa ktivitasb elajars iswad ianalisisd enganc aramengkta"sifikasikadna n menarik kaitan-kaitana tauh ubungand ari semuad atayangt erkumpuls ehinggad iperolehs uatuk emantapanDatah asil trJltrljasri iwa menunjukknb ahwam odelp embelajaraonb servasik e industrik rupuf'YSN- dapatm enuntaskabne lajars iswak elasI I IPS4untukS ubP okokB ahasanIn dustri.N ilai tertinggiy angd iperolehs iswaa dalah9 5yaitu sebanyak1 orang( 2,5 o/o)S. iswap alingb anyakm empero-lenhil ai 80 yattui6 ,ir*u (4-0% ) Nilaiterendai yangd iperolehs iswaa dalah7 5 yaitu sebanyak8siswa( 20 %). Lainnyam emperolehn ilal 85 yaitu sebanyak9 siswaQ 2,5 o/o)d annilai 9b sebanyak6 siswa( l\ %). Datat entangk esenangabng lajars iswam enunjukkan28 siswa( 70 %) merasas angats €nang1, 2 siswa( 30%).merassae nang' Hasil analisisd atam enunjukkanb ahwa( 1) penerapamn odelp embelajaranobservaski e industrik rupuk';YSN" untuks ubp okokb ahasanin dustrid apatmeningkatkana ktivitasb elajars ,iswak elasI I IPS4 MAN 3 Kediri. (2) Penerapanmodepl embelajarano bservasik e industri krupuk "YSN" dapatm enun-taskanhlajar siswak elasI I IPS4 MAN 3 Kediri danm embuats iswam erasas enang.Berdasarkante muanp enelitiand apatd ikemukakans aran-saratne rutamakepadap arag uru geografi.G uru geografi dalam menyusuns trategip embelajarankhususnysau bp okok bahasanin dustri diusahakanb isa memanfaatkanli ngkunganberupain dustriu ntukt empatp embelajarasni swa.

Pengembangan paket IPA terpadu berbasis konstruktivisme dengan tema kendaraan bermotor untuk siswa kelas VIII semester II di SMP Negeri 2 Malang / Mu'minul Muhaimin

 

Peraturan Menteri Pendidikan Nasional Nomor 22 Tahun 2006 tentang Standar Isi secara tegas menyatakan bahwa subtansi mata pelajaran IPA pada SMP/MTs merupakan IPA Terpadu. Berdasarkan data penelitian yang diperoleh, kebutuhan guru IPA SMP di Malang Raya terhadap paket IPA Terpadu benarbenar mendesak. Oleh sebab itu sangat beralasan bahwa sebagian besar guru IPA ( 35 dari 37 orang atau 94,6%) menyatakan bahwa mereka membutuhkan paket IPA Terpadu untuk pembelajaran IPA SMP (Koes H., 2006: 32). Selain itu, hasil pangamatan di beberapa toko buku di kota dan Kabupaten Malang menunjukkan bahwa belum ditemukan buku IPA SMP yang dirancang secara terpadu. Berdasar-kan hal tersebut maka dikembangkan Paket IPA Terpadu yang dapat membantu pelaksanaan pembelajaran IPA Terpadu di SMP. Penelitian pengembangan ini bertujuan untuk mengetahui kelayakan Paket IPA Terpadu dengan tema Kendaraan bermotor dan Panduan Pelaksanaan Pembelajarannya di SMP Negeri 2 Malang. Penelitian ini merupakan penelitian pengembangan dengan langkahlangkah yang telah disesuaikan dengan kebutuhan peneliti, yaitu: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal, (4) uji lapangan awal, dan (5) revisi produk. Instrumen penelitian yang digunakan berupa angket uji kelayakan Paket IPA Terpadu dan Panduan Pelaksanaan Pembelajarannya. Data hasil uji kelayakan diperoleh dari tim penelaah. Data penelitian terdiri dari dua jenis, yaitu data kualitatif dan data kuantitatif. Data kualitatif berupa tanggapan, masukan, kritik dan saran dari tim penelaah, sedangkan data kuantitatif diperoleh dari tim penelaah dengan cara pengisian angket kriteria uji kelayakan. Data kuantitatif dianalisis dengan menggunakan nilai rata-rata. Hasil uji kelayakan dari tim penelaah menunjukkan bahwa paket pembelajaran yang dikembangkan layak digunakan dengan nilai ratarata untuk Paket IPA Terpadu adalah 3,56 dan nilai ratarata untuk Panduan Pelaksanaaan Pembelajarannya adalah 3,60, namun perlu adanya direvisi. Berdasarkan hasil penelitian ini disarankan untuk melakukan penelitian dan pengembangan lebih lanjut terhadap Paket IPA Terpadu dengan Tema Kendaraan bermotor. Penelitian lebih lanjut adalah dengan melakukan kajian eksperimen dan uji coba yang lebih luas, sehingga diperoleh paket dan panduan pelaksanaan yang teruji validitasnya secara empiris.

Studi evaluasi pelaksanaan pertandingan tenis lapangan porprov Jawa Timur II tahun 2009 di kota Malang / Arief Darmawan

 

ABSTRAK Darmawan, Arief. 2010. Studi Evaluasi Pelaksanaan Pertandingan Tenis Lapangan PORPROV Jawa Timur II Tahun 2009 di Kota Malang. Skripsi, Jurusan Ilmu Keolahragaan Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (I) Drs. Heru Widijoto, M.S, (II) Dra. Sri Purnami M.Pd Kata Kunci: Evaluasi, Tenis Lapangan, PORPROV Evaluasi adalah suatu penilaian tentang cara membandingkan dan menilai untuk mengetahui tingkat keberhasilan suatu proyek atau even, berdasarkan evaluasi dalam pelaksanan Porprov Jawa Timur II tahun 2009 di kota Malang belum pernah ada evaluasi pelaksanaan pertandingan tenis lapangan PORPROV Jatim II di Kota Malang, untuk itu perlu diadakan evaluasi dalam pelaksanaan pertandingan tenis lapangan Porprov Jawa Timur II tahun 2009 di kota Malang. Penelitian ini bertujuan untuk melakukan evaluasi pelaksanaan pertandingan tenis lapangan PORPROV Jawa Timur II tahun 2009 yang baru pertama kali dilaksanakan di Kota Malang pada tanggal 5-10 Oktober 2009, subyek penelitian ini adalah atlet tenis lapangan dari 31 kota atau kabupaten peserta pertandingan tenis lapangan dengan jumlah 151 atlet, 10 orang wasit luar Kota, 5 orang wasit dalam Kota, 71 orang pelatih dan official, dan panitia pelaksana sebanyak 4 orang yang terdiri dari ketua pelaksana, sekretaris, bendahara dan ketua bidang pertandingan. Pengumpulan data ini dengan menggunakan angket tertutup yang jawaban sudah disediakan. Analisis data yang digunakan adalah analisis deskritif kuantitatif yang pengolahan datanya dipresentasekan. Hasil penelitian ditemukan bahwa pada pelaksanaan Porprov Jawa Timur II tahun 2009 di kota Malang yang terkait dengan layanan untuk atlet, wasit luar Kota, wasit dalam Kota, dan panitia pelaksana yang berhubungan dengan layanan akomodasi untuk atlet dengan persentase 72,78% yang termasuk kategori baik, sedangkan layanan akomodasi untuk wasit luar Kota dengan persentase 83,56% yang temasuk kategori baik sekali, pada layanan konsumsi untuk atlet dengan persentase 63,88% yang termasuk kategori baik, kemudian konsumsi untuk wasit luar Kota dengan persentase 84,67% yang termasuk kategori baik sekali, sedangkan konsumsi untuk wasit luar Kota dengan persentase 68% yang termasuk kategori baik, kemudian layanan transportasi untuk atlet dengan persentase 70,05% yang termasuk dalam kategori baik, layanan transportasi untuk wasit luar Kota dengan persentase 87,42% yang termasuk dalam kategori baik sekali, kemudian layanan kesehatan untuk atlet dengan persentase 69,80% yang termasuk dalam kategori baik, sedangkan layanan kesehatan untuk wasit luar Kota dengan persentase 89,14% yang termasuk dalam katergori baik sekali, layanan kesehatan untuk wasit dalam Kota dengan persentase 72% yang termasuk dalam katergori baik, kemudian layanan keamanan untuk atlet dengan persentase 69,55% yang termasuk dalam kategori baik, kemudian layanan kemanan untuk wasit luar Kota dengan persentase 86,33% yang termasuk dalam kategori baik sekali, layanan kemanan untuk wasit dalam Kota dengan persentase 68% yang termasuk dalam kategori baik kemudian bidang pertandingan untuk atlet dengan persentase 72,04% yang termasuk dalam kategori baik, sedangkan bidang pertandingan untuk wasit luar Kota dengan persentase 82,54% yang termasuk dalam kategori baik sekali, sedangkan bidang pertandingan untuk wasit dalam Kota dengan persentase 70,90% yang termasuk dalam kategori baik, sedangkan bidang pertandingan untuk panitia pelaksana dengan persentase 81,50% yang termasuk dalam kategori baik sekali, sedangkan bidang pertandingan untuk official dengan persentase 70,28% yang termasuk dalam kategori baik, kemudian bidang keuangan untuk wasit luar Kota dengan pesentase 62% yang termasuk dalam kategori baik, kemudian bidang keuangan untuk wasit dalam Kota dengan pesentase 56% yang termasuk dalam kategori cukup, sedangkan bidang keuangan untuk panpel dengan pesentase 60,00% yang termasuk dalam kategori baik. Bedasarkan hasil penelitian ini dapat disarankan agar bidang layanan pada penyelenggaraan PORPROV Jawa Timur II tahun 2009 di kota Malang untuk meningkatkan pelayanannya khususnya dalam layanan penginapan untuk atlet dan wasit, kemudian pada bidang keuangan untuk panpel, sehingga dalam pelaksanaan PORPROV tahun 2011 diharapakan untuk layanan akomodasi dan pada bidang keuangan diharapkan lebih ditingkatkan lagi.

Kesiapan Mental Mahasiswa Fakultas Ilmu Pendidikan Universitas Negeri Malang Untuk Berwirausaha Oleh Ika Murni Hidayati

 

Kewirausahaanm erupakans uatup rosesp encapaians esuatub erdasarkan semangat,s ikap, perilaku, dan kemampurn seseorangd alam menanganiu saha denganm eningka&an efisiensi supayat ercapaik esejahteraanin dividu ataupun nilai tambah bagi masyarakat. Dengan adanya akrualisasi jiwa kewirausahaan diharapkan mahasiswa mampu membaca lingkungan untuk membuka peluang usaha. Dalam mengembangkans ikap berwirausaha,m ahasiswad apat me,mbanguns ikap tersebutm elalui beberapaf aktor antaral ain; kemauank eras, pengambanganra sap ercayad iri, pengernbangans ikap kreatifdan inovatil pengembanganc ina diri yang positif, dan pengembangans ikapjujur dan tanggungjawab. Masalahy ang dikaji dalam penelitian ini adalah:b agaimanakahti ngkat kesiapanm ental kewirausahaanm ahasiswaF akultasI tnu PendidikanU niversitas Negeri Malang. Populasi penelitian ini adalah Mahasiswa FIP UM angkatan tahun 1998 - 2000 yang berjumlah 565 mahasisw4 terdiri dari 77 mahasiswa Jurusan BKP/BK, 99 mahasiswa Jurusan AP, 67 mahasiswa Jurusan TEP, 49 mahasiswa Jurusan PLS, 73 mahasiswa Jurusan PPKN, 36 mahasiswa Jurusan IK/IK 124 mahasiswa Jurusan PJKR/IK, dan 40 mahasiswa Jurusan PSIK/BKP. Sampel yang diambil berjumlah 234 mahasisway ang diteapkan berdasarkanT abel Krejcie. Pengumpulan data dilakukan dengan teknik angket. Teknik analisis data yang digunakana dalaht eknik persentaseu ntuk analisis disftritif menggunakan SPSS For Windows 97 Release 10.0. Berdasarkan hasil analisis data disimpulkan bahwa: kesiapan mental mahasiswa Fakultas Ilmu Pendidikan Untuk Berwirausaha termasuk dalam kriteria tinggi dalam tingkatan persentaseH. asil analisisp ersentasem enunjukkanb ahwad ari 234 mahasiswaa da 165m ahasiswa(7 0,5%)m enyatakanb aik dengams kor 53 - 68. Saran yang dapat dikemukakan dalam penelitian ini adalah mahasiswa hendaknyam empertahankand an meningkatkanp eneftpan pengembangans ikap berwirausaha sehingga motivasi berwirausaha mahasiswa menjadi lebih meningkat.

Kesusaian silabus yang dikembangkan oleh guru bahasa arab Madrasah Tsanawiyah se-kecamatan Donomulyo Kabupaten Malang dengan kurikulum inti / Deni Bayu Wijaya

 

ABSTRAK Bayu Wijaya, Deni. 2010. Kesesuaian Silabus yang Dikembangkan oleh Guru Bahasa Arab MTs se-Kecamatan Donomulyo Kabupaten Malang dengan Kurikulum Inti. Skripsi, Jurusan Sastra Arab Fakultas Sastra Universitas Negeri Malang. Pembimbing: Drs. M. Syatibi Nawawi M.Pd. Kata Kunci: kesesuaian silabus, guru Bahasa Arab, kurikulum inti. Silabus merupakan salah satu perangkat pembelajaran yang harus ada dan dikuasai oleh pendidik, terutama dalam pendidikan formal. Seiring dengan tuntutan profesionalisme guru dan berjalannya Kurikulum Tingkat Satuan Pendidikan maka guru juga harus mampu mengembangkannya. Kesesuaian silabus pelajaran Bahasa Arab yang dikembangkan guru-guru Bahasa Arab MTs di Kecamatan Donomulyo Kabupaten Malang diperoleh dari hasil penelitian di MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Penelitian ini bertujuan mendapatkan deskripsi kesesuaian format silabus, kesesuaian komponen silabus, dan kesesuaian isi silabus yang dikembangkan oleh guru-guru Bahasa Arab kelas VII, VIII, dan IX semester ganjil MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Rancangan penelitian yang digunakan ialah rancangan deskriptif, instrumen utama dalam penelitian ini adalah peneliti (human instrument) dilengkapi dengan dokumentasi dan wawancara sebagai instrumen pendukung, dan hasil penelitian ini diuraikan secara deskriptif. Dalam penelitian ini yang menjadi sumber data ialah kepala sekolah dan guru-guru Bahasa Arab MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Data yang digunakan ialah silabus kelas VII, VIII, dan IX MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo. Tahapan-tahapan analisis data terdiri atas pengumpulan data dan pemeriksaan kembali catatan lapangan, reduksi data, penyajian data, sintesisasi, dan pengambilan kesimpulan. Pengecekan keabsahan data melalui teknik triangulasi. Tahap-tahap penelitian meliputi tahap pra penelitian, tahap penyelenggaraan penelitian, dan tahap paska penelitian. Hasil penelitian ini ialah (1) format silabus yang digunakan guru-guru Bahasa Arab kelas VII, VIII, dan IX MTs Negeri Donomulyo dan MTs NU Futuhiyyah Donomulyo sesuai dengan acuan BSNP, yaitu format matriks/kolom dengan prinsip lebih mudah dibaca dan dipahami oleh guru-guru Bahasa Arab; (2) komponen silabus yang digunakan oleh guru Bahasa Arab MTs Negeri Donomulyo kelas VII dan VIII sesuai dengan acuan BSNP meliputi identitas sekolah, standar kompetensi, kompetensi dasar, materi pokok/pembelajaran, kegiatan pembelajaran, indikator, jenis penilaian, alokasi waktu, dan sumber belajar, sedangkan untuk kelas IX tidak sesuai karena tidak dicantumkan salah satu komponen, yaitu kegiatan pembelajaran. Komponen silabus yang digunakan guru MTs NU Futuhiyyah Donomulyo sesuai dengan acuan BSNP meliputi identitas sekolah, standar kompetensi, kompetensi dasar, materi pokok/pembelajaran, kegiatan pembelajaran, indikator, jenis penilaian, alokasi waktu, dan sumber belajar; dan (3) kesesuaian isi silabus sudah mengalami pengembangan, tetapi jika dianalisis tiap komponen masih ada beberapa yang belum sesuai penggunaannya. Guru-guru belum benar-benar mengembangkan isi silabus sesuai ketentuan atau acuan dari BSNP. Berdasarkan hasil penelitian ini, dapat disarankan kepada Kepala Mapenda Kementerian Agama Kabupaten Malang agar melakukan kegiatan pelatihan bagi guru-guru Bahasa Arab di wilayah pinggiran. Kepada peneliti yang akan datang diharapkan melakukan penelitian misalnya, pengaruh pengembangan silabus Bahasa Arab terhadap pengajaran, pengembangan rencana pelaksanaan pembelajaran Bahasa Arab. Kepada guru Bahasa Arab diharapkan dalam mengembangkan silabus mempertimbangkan kemampuan dan keadaan tiap siswa serta keadaan sekolah.

Penggunaan Model Pembelajaran Andragogi Pada Pelatihan Kewirausahaan (Studi Kasus Pada Lembaga Pengembangan Manajemen dan Kepemimpinan (LPMK) "Insan Dinami" Indonesia, Malang) Oleh Akhmad Hasan Saleh

 

Pendekatamn odel pembelajaradni sekolahs ementarian i banyak menggunakamn odel konvensionatl anpaa daf ormulasi yang disesuaikand engan keinginanp arap esertad idik, sehinggap emahamanp esertad idik terhadapr ealita sosiadl anp engalamanla ngsungs angatt erbatash al ini menyebabkanb anyak lulusany angt idak cukup meiliki kemampuanu ntuk berkompetisid i dunia ke{a. Modelp embelajarana ndragogiy ang lebih menekankanp adap enciptaanp roses pmbelajarasne carate rbukad anm emberikana presiaspi adap engalamainn dividu menjadsi ebuahja wabana kanp ermasalahainn i. Penelitianin i bertujuanu ntukm endiskripsikakne ingrntahuasne jauhm ana perkembangamn otivasi berwirausahap esertad idik selamai ni denganm odel pembelajaraonr angd ewasay ang selamai ni digunakano leh instruktur atau pendidik dalam dunia pelatihan. Penelitiani ni menggunakanm etodep endekatand iskriptif kualitatif, karena memungkinkapne nelitim emperolehd atah olistik sertad irasam ampu menafsirkank enyataan-kenyataayna ng adad i lapanganb erupap roses pelaksanaapne mbelajarana ndragogip adap elatihanm otivasi berwirausahad an efeltifitasnya. Teknik pengumpulan data yang digunakan dalam penelitian ini adalah wawancarao, bservaslia ngsung denganp engamatanb erperanserta(p art isipant Obsevationd) an catatand okumen( berupaa rsip, foto). Sumberd atay ang dipakai berupa informan yang memiliki informasi banyak tentang objek penelitian yaitu instrukturf,a silitatord anp esertad idik. Model analisisy angd ipakaia dalahm odel analisisi nterallif yaitu waktu pengumpuland atap eneliti selalum embuatr eduksi dans ajiand atay angd igunakanu ntukm enyimpulkanh asilp enelitian. Hasil penelitiani ni mengungkapkanb ahway angm elatarbelakangLi PMK "InsanD inami" Indonesiam enggunakanm odel pembelajarana ndragogtp ada pelatihank ewirausahaank,a renap adam odel mampum engeksploraspi engalaman belajar( experientiall earning) sertam ampum emberikank ebebasanb elajarp ada pesertad idik. Dan perancanganp embelajarand ilakukan dengana nalisak ebututran belajarm elaluik uisenerS. ementarap adatahapp engelolaaant aup roses pembelajaranr,u angand itata semeriahm ungkin denganb erbagaim ediay ang digunakand anm etodep embelajarasne suadi engang ayab elajarm asing-masing pesertad idik antarala in ceramahd, iskusi,g ame( ice breaking)r, ole playing. Selanjutnyata hape valuasid ilakukan padaw aktu persiapank egiatan,p roses kegratany angb ersifat intem kelembagaand, an evaluasih asil yang melibatkan peransertap esertad idik dalamm enilai keberhasilans uatup elatihan.

Perencanaan pengembangan sekolah (studi kasus di SMP Negeri 2 Paiton Probolinggo) / Andhika Anang Lubis

 

Lubis, Andhika Anang. 2013. Perencanaan Pengembangan Sekolah (Studi Kasus di SMP Negeri 2 Paiton Probolinggo). Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan. Universitas Negeri Malang, (I) Prof. Dr. H. Ali Imron, M.Pd. M.Si, (II) Teguh Triwiyanto, M.Pd. Kata kunci: perencanaan, pengembangan sekolah     Dalam suatu organisasi agar kegiatan berjalan dengan baik dan terkoordinasi yaitu diperlukan adanya suatu perencanaan. SMP Negeri 2 Paiton Probolinggo sebagai lembaga pendidikan melaksanakan proses manajemen yang menekankan pada pencapaian kualitas output peserta didik yang tinggi. SMP Negeri 2 Paiton Probolinggo merencanakaan pendidikan dalam 1 tahun kedepannya, serta proses pengembangannya. Penelitian ini berawal dari pertanyaan bagaimana perencanaan pengembangan sekolah. Dari hasil studi pendahuluan didapatkan dua subfokus penelitian yaitu bagaimana perencanaan pengembangan sekolah di SMP Negeri 2 Paiton.    Penelitian ini dilakukan di SMP Negeri 2 Paiton yang merupakan salah satu lembaga pendidikan yang terus berkembang. Penelitian ini menggunakan pendekatan kualitatif. Teknik pengumpulan data yang digunakan meliputi: (1) observasi; (2) wawancara; (3) dokumentasi; dan (4) perpanjangan kehadiran peneliti. Data yang diperoleh dari teknik-teknik tersebut dianalisis guna menyusun temuan lapangan. Keabsahan data diuji dengan menggunakan trianggulasi.    Kesimpulan penelitian ini meliputi: (1) Perencanaan pengembangan sekolah di SMP Negeri 2 Paiton disusun dalam dua (2) bentuk yaitu rencana strategis (renstra) dan rencana operasional (renop). Manajemen pengembangan sekolah di SMP Negeri 2 Paiton sejalan dengan berbagai teori pengembangan strstegis. Dalam hal ini pelaksana manajemen sekolah (kepala sekolah beserta perangkat) terlebih dahulu melakukan analisis lingkungan untuk menentukan strategi pengembangan jangka panjang dalam konteks rencana strategis. Dalam hal ini jangka waktu yang ditetapkan adalah lima (5) tahun. Sementara itu rencana operasional diarahkan untuk memberikan panduan yang jelas tentang bagaimana program-program kerja didasarkan untuk kepentingan pencapaian tujuan jangka panjang sebagaimana dituangkan dalam renstra. Pengembangan sekolah di SMP Negeri 2 Paiton sebagaimana dituangkan dalam rencana strategis dan rencana operasional kemudian diterjemahkan kedalam pelaksanaan berbagai program kerja sebagai implementasi nyata. Guna menjaga agar implementasi program yang sesuai dengan apa yang direncanakan, disusun sebuah program pendukung yaitu pengawasan dan evaluasi.    Berdasarkan hasil temuan penelitian disarankan saran kepada kepala sekolah dan guru di SMP Negeri 2 Paiton, penelitian ini hendaknya dapat memberikan informasi atau masukan kepada pengelola dalam mengelola sekolahnya khususnya perencanaan dan pengembangan sekolah. Sehingga dapat dijadikan tolak ukur untuk mengetahui dengan jelas berhasil tidaknya dalam melaksanakan rencana dan pengembangan di sekolah. Di samping itu hasil penelitian ini agar dapat dijadikan suatu perbaikan bila dalam pelaksanaannya masih terdapat kekurangan. Dinas Pendidikan dan Kebudayaan Kabupaten Probolinggo, hendaknya dapat dipakai sebagai bahan pertimbangan untuk lebih memperhatikan perkembangan sekolah dimasa yang akan datang. Jurusan Administrasi Pendidikan, lebih memperdalam tentang perencanaan pengembangan sekolah. Bagi peneliti lain, hasil penelitian ini juga hendaknya dapat memberikan informasi tambahan atau pembanding tehadap yang masalah penelitian yang sejenis.

Bentuk dan fungsi logaritma dan aplikasinya / Ahmad Sato Rahayaan

 

ABSTRAK Rahayaan, Ahmad Sato. 2010. Bentuk Fungsi Logaritma dan Aplikasinya. Skripsi, program Studi Matematika, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Indriati Nurul Hidayah, Spd, M.Si Kata kunci : Fungsi, persamaan, logaritma, turunan, integral. Pada skripsi ini akan dibahas tentang fungsi logaritma dan aplikasinya. Sebelum masuk pada bentuk fungsi logaritma terlebih dahulu dilihat fungsi logaritma asli. Fungsi logaritma asli, dapat ditulis sebagai ln dan dapat didefinisikan dengan ∫=xdttx11ln 0>x Daerah asal fungsi logaritma asli adalah himpunan bilangan real positif. Fungsi logaritma asli memenuhi sifat: Jika a dan b bilangan-bilangan positif dan r sembarang bilangan rasional, maka (i) (ii) 01ln=;lnlnlnbaba+= (iii) babalnlnln−= (iv) .lnlnarar= Untuk fungsi logaritma dapat didefenisikan, andaikan a adalah bilangan positif bukan 1maka yaaxxy=⇔=log Fungsi logaritma memenuhi hukum yang sama seperti fungsi logaritma asli sehingga sifat fungsi logaritma asli adalah: jika , dan maka 1,0≠>aa0,>yx yxxyaaaloglog)(log).1+= 01log).3=ayxyxaaalogloglog).2−= xyxayaloglog).4= Fungsi logaritma ini dapat diaplikasikan pada bidang Fisika, permasalahan yang dibahas pada bidang Fisika tersebut adalah tentang bunyi.

Pengaruh kompensasi finansial dan karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja (studi pada karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung) / Dwi Cahyati

 

ABSTRAK Cahyati, Dwi. 2010. Pengaruh Kompensasi Finansial dan Karakteristik Pekerjaan Terhadap Kinerja Karyawan Melalui Kepuasan Kerja (Studi Pada Karyawan Bagian Produksi PT. Guna Atmaja Jaya, Tulungagung). Skripsi, Jurusan manajemen, Progran Studi S1 manajemen Universitas Negeri Malang. Pembimbing: Dr. Syihabudhin, S.E dan Drs. I Nyoman Saputra, M. Si Kata Kunci: kompensasi finansial, karakteristik pekerjaan, kepuasan kerja, kinerja karyawan. Kompensasi finansial dan karakteristik pekerjaan dapat menumbuhkan kepuasan kerja bagi karyawan. Dengan kepuasan kerja tersebut pencapaian tujuan perusahaan akan akan lebih baik dan akurat, dengan tercapainya tujuan perusahaan dan terpenuhinya kebutuhan karyawan melalui kepuasan kerja, tentu saja kinerja mereka akan meningkat pula. Penelitian ini bertujuan untuk mengetahui pengaruh kompensasi finansial dan karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja pada karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung. Penelitian ini dilaksanakan di PT. Guna Atmaja Jaya, Tulungagung pada bulan November 2009-Januari 2010. Subjek dalam penelitian ini adalah karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung. yang berjumlah 106 orang, sedangkan sampelnya diambil sebanyak 84 orang dan teknik pengambilan sampel menggunakan Proportional Random Sampling. Dalam penelitian ini mempunyai variabel bebas yaitu kompensasi finansial (X1), karakteristik pekerjaan (X2), variabel intervening yaitu kepuasan kerja (Z), dan variabel terikat kinerja karyawan (Y). Instrumen penelitian ini menggunakan item-item dari penelitian terdahulu yang telah teruji, sehingga untuk uji validitas dan reliabilitas tetap dilakukan untuk menguji validitas dan reliabilitas data yang diperoleh. Analisis data yang dipakai adalah analisis jalur (Path Analysis). Tujuan dari analisis jalur adalah untuk mengetahui pengaruh langsung dan pengaruh tidak langsung antar variabel. Hasil penelitian ini dapat diketahui : (1) terdapat signifikansi pengaruh langsung kompensasi finansial terhadap kepuasan kerja. (2) terdapat signifikansi pengaruh langsung karakteristik pekerjaan terhadap kepuasan kerja. (3) terdapat signifikansi pengaruh langsung kompensasi finansial terhadap kinerja karyawan. (4) terdapat signifikansi pengaruh langsung karakteristik pekerjaan terhadap kinerja karyawan. (5) terdapat signifikansi pengaruh langsung kepuasan kerja terhadap kinerja karyawan. (6) terdapat pengaruh tidak langsung kompensasi finansial terhadap kinerja karyawan melalui kepuasan kerja. (7) terdapat pengaruh tidak langsung karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja. ii Berdasar pada hasil penelitian, maka saran yang dapat peneliti berikan kepada PT. Guna Atmaja Jaya, Tulungagung adalah untuk kompensasi finansial yang diterapkan, disarankan pada pimpinan PT. Guna Atmaja Jaya agar lebih memperhatikan pemberian upah lembur. Hal ini dikarenakan pada hasil distribusi frekuensi pernyataan karyawan tentang kompensasi finansial, masih terdapat karyawan yang menyatakan kurang setuju dalam hal pemberian upah lembur. Sedangkan untuk karakteristik pekerjaan, disarankan pada pimpinan PT. Guna Atmaja Jaya agar lebih memperhatikan permasalahan karyawan dalam bekerja, identitas tugas, dan signifikasi tugas. Hal ini dikarenakan masih terdapat beberapa karyawan yang menyatakan kurang setuju terhadap item-item pernyataan tersebut.

Pengaruh Harga Produk Pertanian Terhadap Income Petani Di Kecamatan Kepung Kabupaten Kediri Oleh Murtaji

 

Indonesia adalah negara agraris yang kebanyakan dari penduduknyaberpenghrdupapne tani. Bila petani yang memiliki populasi tbrbesar darikomposisipendudumke ncapaik esejahteraanb,e rarti sejahierab angsad an negaraselamian i petanib elumm encapatia raph idup yang sejalrteras ecara-meratHa.a l initerkait dengan income mereka yang belum rayak. income petani sangat terkaitdengahna rgap rodukp ertanian.Penelitiani ni adlah penelitiank orelasionaly, ang meneliti perihal seberapakuatp engaruhh argap rod_upk ertaniant erhadapin comep etani.s edangkans ubyeknyaadal;ahp ara petani di KeccamatanK epung Kabupatin Kediri. oJngan memakaiteknik samplinga rea, teknik pengumpuland ata dokumentasdi an iiterviu, sertaanalisikso relasdi enganp roductm omentnyam elaluip rogam komputerS pSS.- _ Penelitianb ertujuanu ntukm engetahutii ngkafhaigap roduf pertanian4 tahunlerakhirs ejak1 999,u ntuk mengetahutii ngkatp endapatapne tani,d an seberapaku athargap rodukp ertanianb erpengaruthe rhadapp endapatapne tani. Dari hasil penelitian bahwa tingkat harga prbdut pertanian 4 tahun berturutturutadalah: Tahun t999 tingkat harga sedang sumpai tinggi. Harga sedang :3^7,:9%ti,n gkath argat inggi 62,50.T ahun2 000t ingkath urgus iiung (t6ozo;.r atrun?90_lli ngkat harga rendah sampai tingkat harga sidang. iingkat [aiga rendah43,.75%ti,n gkat hargas edang= s6,25%.t atrun zo0z tingtatiarga .Jnout sampaisedangJingkaht argar endah5 9,37%d ant ingkath argas edang4 O ,6SW.Tingkatp endapatapne tani4 tahunb erturut-turuat dalah:T ahun 1999t ingkatpendapatapne tani sedangs ampai tinggi. Tingkat pendapatans edang 4a,6zvo.Tingkar pendapatan tinggi 59.,38%. Tahun zoOb tingkat pendapatan dari rendah samp_taini ggi. Tingkatp endapatarne ndah: 3j,50% sedang= 31,25%t inggi :3l'25%-T ahun2 001 tingkat pendapatapne tanid ari rendaht i*pr iinggi. rGtatpendapatarne ndah: 43,75%,s edang= 40,62%,d an tinggi : 15',63o/o.\rahu2n0 02tingkatp endapalanp etani-darit ingkat pendapatanre ndal sampait inggi. Tingkatpendapatarne ndah= 68,75%s, edang2 9,13%,danti nggi hanya3,'l2o/o. Dari uji hipotesis terbukti bahwa harga pioduk' pertanian mempunyaipengar.uly, ang kuat (signifikan) terhadap p"naapatunp eiani. Secara simultanmenunjukkanb ahwa r hirung sebesara ,sqi sedangkanr taber 0,334. uii Fl..g ryn:ukqn F hilung 17,27s edangkaFn tabel7 ,50.B esarnyak oefisiend eterminasi;0,841A. rtinyab ahwa8 4,15t ingkat pendapatadni pengaruhoi leh tingkat harga.Scdangkyaann g1 5,9%doip engaruhfia ktor lain.Berdasarkahna sil penelitiani ni perlu disarankank epadap ara petani untukmenanatman amany angm emiliki prospektifh argam aupunp endapatatnin ggi.

Subtitusi tepung kacang merah dalam pembuatan bidaran / Rosyida aini

 

Kata Kunci: Bidaran, Kacang merah, uji kesukaan. Bidaran merupakan makanan ringan yang berbentuk panjang meruncing, berwarna kuning keemasan dan mempunyai rasa gurih. Bahan yang digunakan untuk membuat bidaran adalah, tapioka, garam, telur dan keju. Subtitusi tepung kacang merah pada pembuatan bidaran bisa dijadikan sebagai penganekaragaman pangan, serta untuk meningkatkan nilai gizi karena kandungan protein yang tinggi. Kacang merah merupakan bahan makanan yang mempunyai sumber p[rotein nabati yang potensial. Kadar protein dari kacang merah hampir setara dengan kadar protein kacang hijau yaitu 23,1 g per 100 g kacang merah. Kacang merah kering merupakan sumber protein nabati, karbohidrat kompleks, serat, vitamin B, folasin, tiamin, kalsium, fosfor, dan zat besi. Awal pembuatan biadaran kacang merah terlebih dahulu kacang merah dolah menjadi tepung. Tepung kacang merah adalah tepung dengan butiran halus, berwarna putih kekuningan dan berbau khas kacang merah. Tepung kacang merah yang digunankan sebanyak 100 g (50%) mengasilkan bidaran yang berwarna kuning kecoklatan, rasa gurih dan tekstur yang renyah. Hasil uji kesukaan terhadap bidaran substitusi tepung kacang merah menunjukkan bahwa responden yang menyukai warna bidaran substitusi tepung kacang merah sebesar 51,1%, responden yang menyukai rasa bidaran substitusi tepung kacang merah sebesar 56,6%, dan yang menyukai tekstur bidaran substitusi tepung kacang merah sebesar 55,6%. Produk bidaran substitusi tepung kacang merah memperoleh nilai gizi yang lebih tinggi dilihat dari segi Energi 1,4%, Protein 47,7%, Karbohidrat 76,77%, Ca 25,57%, P 56,37%, Vit A 16,67%, Vit B 80,97%, Vit C 93,67%, kalori yang dimilki oleh bidaran substitusi tepung kacang merah lebih tinggi 11,9% daripada kalori yang dimiliki bidaran yang tidak disubstitusi tepung kacang merah disamping itu kandungan lemak lebih rendah 0,87% dibanding dengan lemak yang terkandung dalam bidaran yang tidak disubstitusi tepung kacang merah. Satu resep bidaran substitusi tepung kacang merah 200 g dapat menghasilkan 500 g produk bidaran substitusi tepung kacang merah. Bidaran substitusi tepung kacang merah dapat dipasarkan dengan harga Rp 1.500 perkemasan dengan berat 50 g.

Pengembangan prototipe layanan informasi sekolah lanjutan berbasis multimedia interaktif bagi siswa SMP Negeri 18 Malang / Wahyu Setiawan

 

ABSTRAK Setiawan, Wahyu. 2010. Pengembangan Prototipe Layanan Informasi Sekolah Lanjutan Berbasis Multimedia Interaktif Bagi Siswa SMP Negeri 18 Malang. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing (I) Dr. Triyono, M.Pd, (II) Drs. H. Widada, M.Si. Kata Kunci: Multimedia, Layanan Informasi, Sekolah Lanjutan. Sekolah lanjutan merupakan pendidikan yang ditempuh setelah lulus dari jenjang pendidikan sebelumnya dalam hal ini SMP dan melanjutkan ke Sekolah Lanjutan Tingkat Atas yaitu sebutan untuk tahap kedua dalam sekolah lanjutan setelah Sekolah Lanjutan Tingkat Pertama di Indonesia. Dalam pemilihan sekolah lanjutan ini masih sering dijumpai kesalahan yang dilakukan oleh siswa setelah lulus SMP, dalam hal ini salah menentukan sekolah yang dipilih. Ini disebabkan karena kurangnya pengetahuan dan informasi yang tepat dimiliki oleh siswa. Dalam memilih sekolah lanjutan setelah lulus SMP, seorang siswa juga harus mempertimbangkan prospek setelah lulus dari SMA. Selain SMA juga ada lembaga pendidikan setingkat SMA, yaitu MA (madrasah aliyah) dan SMK (Sekolah Menengah Kejuruan). SMA adalah lembaga pendidikan dibawah naungan Departemen Pendidikan Nasional yang didalamnya lebih mengutamakan tentang pengetahuan-pengetahuan yang bersifat umum. Madrasah Aliyah (MA) adalah lembaga pendidikan yang berada dibawah naungan Departemen Agama. Madrasah Aliyah disini lebih mengutamakan tentang pengetahuan Agama dan Akhlak. Sedangkan SMK merupakan lembaga pendidikan yang lebih mengutamakan skil untuk menciptakan keahlian para siswa lulusannya agar setelah lulus, bisa siap kerja. Tujuan dari penelitian ini adalah untuk menghasilkan sebuah produk layanan informasi sekolah lanjutan berbasis multimedia interaktif bagi siswa SMPN 18 Malang yang berterima baik secara teoritis maupun praktis dan bisa digunakan oleh siswa maupun konselor di sekolah sebagai media layanan informasi tentang sekolah lanjutan. Menurut penilaian dari ahli media yaitu dosen BK, multimedia interaktif tentang sekolah lanjutan mendapatkan skor 36 dengan nilai rata-rata 2,77 yang berarti sesuai dalam segi kemenarikan media. Sedangkan menurut dari hasil penilaian uji ahli materi yaitu oleh uji materi I adalah 2,75 yang berarti sesuai, dan penilaian uji ahli materi II adalah 3 yang berarti sesuai/akurat. Jadi rata-rata skor total keseluruhan adalah 2,87 yang berarti cukup akurat dalam hal materi yang disusun dalam multimedia interaktif. Jadi berdasarkan hasil penilaian uji ahli materi, dapat disimpulkan bahwa materi yang disusun dalam multimedia berklasifikasi cukup akurat dan dapat digunakan ii Berdasarkan penilaian ahli media dan materi yaitu dosen BK dan konselor SMP, layanan informasi berbasis layanan informasi sekolah lanjutan ini sangat berguna bagi siswa agar mempunyai gambaran tentang sekolah yang akan menjadi pilihan setelah lulus SMP, selain itu bagi konselor bisa memudahkan dalam memberikan layanan informasi karena multimedia interaktif ini sangat mudah dioperasikan. Peneliti menyarankan kepada pihak sekolah khususnya konselor hendaknya memanfaatkan software multimedia untuk mengetahui keefektifan produk yang dihasilkan sehingga pemberian layanan informasi lebih maksimal.

Penerapan model pembelajaran kooperatif tipe Student Teams Achievement Divisions (STAD) untuk meningkatkan motivasi dan hasil belajar kognitif fisika siswa kelas XI IPA 6 SMA Negeri 5 Malang / Mochammad Samsul Arifin

 

ABSTRAK Arifin, Moch. Samsul. 2010. Penerapan Model Pembelajaran Kooperatif Tipe Student Teams Achievement Division (STAD) Untuk Meningkatkan Motivasi dan Hasil Belajar Kognitif Fisika Siswa Kelas XI IPA 6 SMA Negeri 5 Malang. Skripsi, Program Studi Pendidikan Fisika Jurusan Fisika FMIPA UM. Pembimbing: (1) Drs. Asim M.Pd. (2) Drs. Purbo Swasono, M.Si. Kata Kunci: Student Teams Achievement Division (STAD), Motivasi, Hasil Belajar kognitif. Berdasarkan pengamatan awal di SMA Negeri 5 Malang, metode yang sering digunakan pada saat pembelajaran mata pelajaran fisika adalah metode ceramah, jumlah siswa yang telah tuntas belajar hanya 1 siswa dari 34 siswa, siswa berbicara dengan teman sebangku ketika pelajaran berlangsung, siswa jarang mencatat, kurang aktif dalam bertanya dan menjawab pertanyaan, mengirim pesan singkat (SMS) dan lain-lain. Berdasarkan pengamatan awal dapat dikatakan bahwa siswa kurang termotivasi dan hasil belajar kognitifnya rendah. Penelitian ini bertujuan untuk mengetahui penerapan model pembelajaran kooperatif tipe Student Teams Achievement Division (STAD) dalam meningkatkan motivasi dan hasil belajar kognitif fisika siswa kelas XI IPA 6 SMA Negeri 5 Malang. Penelitian ini merupakan penelitian tindakan kelas yang terdiri dari dua siklus. Masing-masing siklus terdiri dari empat tahap yaitu perencanaan penelitian, penerapan tindakan, observasi dan refleksi. Tindakan yang diberikan pada siklus I dan siklus II berupa penerapan skenario pembelajaran model pembelajaran kooperatif tipe STAD yang terdiri dari lima langkah, yaitu 1) tahap penyajian materi, 2) tahap kegiatan kelompok, 3) tahap tes individual, 4) tahap penghitungan skor perkembangan individu, dan 5) tahap pemberian penghargaan kelompok. Instrumen yang dipakai dalam penelitian ini adalah rencana pelaksanaan pembelajaran, lembar kerja siswa, soal tes, angket dan lembar observasi kegiatan guru. Hasil penelitian menunjukkan bahwa motivasi dan hasil belajar kognitif mengalami peningkatan, setelah diberi tindakan dengan menerapkan model pembelajaran kooperatif tipe STAD. Peningkatan persentase motivasi belajar ditunjukkan dengan meningkatnya persentase motivasi belajar secara keseluruhan yaitu 70,7% (Siklus I) menjadi 79,1% (siklus II). Peningkatan persentase motivasi belajar secara keseluruhan diikuti peningkatan persentase motivasi belajar tiap indikator meliputi perhatian dari 71,3% (siklus I) menjadi 79,5% (siklus II), keterkaitan dari 69,1% (siklus I) menjadi 76,5% (siklus II), keyakinan diri dari 70,3% (siklus I) menjadi 78,8% (siklus II), kepuasan dari 72,1% (siklus I) menjadi 81,4% (siklus II). Hasil Belajar Kognitif fisika siswa juga menunjukkan

Penerapan cooperative learning dengan model numbered head together (NHT) untuk meningkatkan keterampilan sosial siswa kelas VIII-D SMPN 18 Malang pada layanan bimbingan dan konseling / Erlin Dessy Trihandayani Anugrahsari

 

A B S T R A K Anugrahsari, Erlin Dessy Trihandayani. 2010 .Penerapan Cooperative Learning dengan Model Numbering Head Together (NHT) untuk Meningkatkan Keterampilan Sosial Siswa Kelas VIII-D SMPN 18 Malang. Skripsi, Program Studi Bimbingan dan Konseling, Jurusan Bimbingan Konseling dan Psikologi FIP Universitas Negeri Malang. Pembimbing: (1) Dra.Ella Faridati Zen, M.Pd (2) Drs. Djoko Budi Santoso. Kata Kunci : Cooperative Learning, Numbering Head Together (NHT) dan Keterampilan Sosial. Pada saat pelaksanaan layanan bimbingan konseling berlangsung di kelas, siswa cenderung kurang memperhatikan konselor yang menyampaikan materi bimbingan, siswa cenderung berbicara dengan teman sebangku, kurang dapat bekerja sama dengan teman yang tidak dekat dan saat konselor memberikan pertanyaan mengenai materi bimbingan, siswa cenderung menjawab bersama-sama sehingga membuat kelas menjadi gaduh. Selain itu konselor cenderung menggunakan teknik ekspositori saat menyampaikan materi di kelas, hal ini kurang memberikan kesempatan pada siswa untuk aktif salama pelaksanaan layanan bimbingan konseling. Siswa kelas VIII-D SMPN 18 Malang kurang memiliki keterampilan sosial yang dapat dijadikan bekal saat berada di masyarakat, maka salah satu model pembelajaran yang di duga dapat meningkatkan keterampilan sosial siswa adalah pendekatan Cooperative Learning model Numbering Head Together yang memiliki empat tahapan yang sistematis yaitu (1) Numbering, (2) Questioning, (3) Head Together dan (4) Answering. Penelitian ini bertujuan untuk mengetahui bahwa pelaksanaan layanan bimbingan dan konseling dengan model Numbered Head Together (NHT) dapat meningkatkan keterampilan sosial siswa kelas VIII-D SMPN 18 Malang. Penelitian ini merupakan Penelitian Tindakan yang dilakukan dalam empat tahapan yaitu (1) perencanaan, (2) pelaksanaan tindakan, (3) observasi dan (4) refleksi. Empat tahapan tersebut membentuk satu putaran yang beruntunan yang diberi nama satu siklus. Pada penelitian ini dilakukan dalam dua siklus penelitian. Hasil data yang diperoleh di analisis dalam bentuk analisis kualitatif dan kuantitatif. Penerapan model numbered head together pada layanan bimbingan konseling dapat mencapai skor maksimal yaitu 100% pada siklus II serta dapat meningkatkan keterampilan sosial siswa kelas VIII-D. Hal ini tampak dari hasil analisis angket keterampilan sosial siswa sebelum tindakan mencapai 77% dan setelah siklus II mencapai 91% sehingga terjadi peningkatan sebesar 14%. Selain itu juga mampu meningkatkan kemampuan dalam memahami materi bimbingan. Berdasarkan hasil penelitian maka dapat disimpulkan bahwa penerapan Cooperative Learning dengan model Numbered Head Together (NHT) dapat meningkatkan keterampilan sosial siswa kelas VIII-D SMPN 18 Malang pada layanan bimbingan konseling karena terjadi peningkatan keterampilan sosial setelah pelaksanaan tindakan. Dari hasil penelitian ini dapat disarankan Bagi konselor saat menggunakan model numbered head together pada saat pelaksanaan layanan bimbingan konseling perlu memiliki kemampuan untuk mengelola kelas dengan baik serta memiliki sikap yang asertif pada siswa sehingga selama proses berlangsung dapat berjalan dengan lancar. Dapat dijadikan salah satu alternatif saat menyampaikan materi bimbingan sehingga dapat memberikan manfaat yang banyak bagi siswa setelah mengikuti layanan bimbingan serta membuat siswa lebih antuasias saat mengerjakan tugas yang diberikan konselor. Untuk peneliti selanjutnya dapat memperhatikan kekurangan yang terjadi saat pelaksanaan tindakan sehingga dapat lebih efektif dalam menerapkan model numbered head together pada layanan bimbingan konseling. Untuk program studi Bimbingan dan Konseling dapat digunakan dapat memperhatikan pelaksanaan model Numbered Head Together karena dijadikan bahan kajian peneliti selanjutnya.

Studi Komparatif Tingkat Pendapatan Petani Antara Petani Yang Menanam Padi Pola Sawit Dupa Dan Petani Yang Menanam Padi Secara Tradisional Di Kecamatan Belawang Kabupaten Barito Kuala Oleh Sumiatun

 

Pendapatan merupakan salah satu indikator kesejahteraan penduduk. semakaint inggi tingkat pendapatanb erarti kesejahteraapne nduduks emakinb aik. Alasand ilaksanakannypae nelitiani ni adalahm asih rendahnyati ngkat pendapatan petanit erutamad i daerahp asangs urut di luar pulau Jawa.K arenas ebagianb esar mereka masih mengelola usaha taninya secara tradisional yang berbasis pada pertanian tanaman pangan. Padahal dengan adanya kemajuan teknologr di bidang pertanians angatm emungkinkanu ntuk peningkatanp roduktivitasp ertaniand engan pemilihanp olat anamy angs esuai. Pola tanams awit dupa merupakans alahs atu alternatifu ntuk meningkatkan jumlah produksi padi, sehinggaa kan dapat meningkatkanp endapatanp elani di daerahp asangs urut. Tujuan penelitiani ni adalahm engetahupi erbedaan:-(l)p ola penggunaanla han antarap etani yang menanamp adi pola tanTms awit dupa dan petanry angm enanamp adi secarat radisional,( 2) pemanfaatanI'a hanta bukana ntara petani yang rlenanam padi pola tanarn sawit dupa dan petani yang menanam padi secara tradisional, (3) produksi padr petani yang menanam padi pola sawit dupa denganp etani yang menanamp adi secarat radisional,( 4) pendapatanp etani yang menanam padi pola tanam sawit dupa dan petani yang menanam padi secara tradisional. Populasi dalam penelitian ini adalah petani yang berada di Kecamatan BelawangK abupatenB arito Kualad an sebagasi ampelw ilayah( daerah)a dalahd esa Karang Dukuh dan Karang Buah yang terdiri dari 35 orang petani yang menanam padi dengan pola sawit dupa dan 35 orang petani yang menanam padi secara tradisional.Datpae nelitiand ikurnpulkand enganm etodeo bservasi,w awancarad an dokumentasui.n tuk mengujia danyap erbedaantin gkatp endapatapne tani,d igunakan metodea nalisaU ji-t ataut test. Hasil analisisd atap enelitianm enunjukkaand anyap erbednn(:l ) pola penggunaanla han pada petani sawit dupa ditandai dengana danyat abukan sedangkan pada pada petani tradisional sebagian besar tidak membuat tabukan, (2) pemanfaatan lahan tabukan, petani pola sawkit dupa menanami lahan sawah untuk tanaman padi sedangkan lahan tabukan dengan jenis tanaman yang mempunyai nilai ekonomis tinggi serta perawatan intensif, dan untuk petani tradisional lahan utamanaya untuk tanamanp adi sedangkany ang mempunyail ahan tabukanb elum dimanfaatkans ecara maksimal, (3) jumlah produksi padi dan tanaman lainnya dimana pada pola sawit dupa rata-rata produksinya diatas 3,5 ton/ha/th sedanlkan pada petani tradisional kurang dari 2,5 ton/ha/th, (4) tingkat pendapatan dimana pendapatan petani pola sawitd upal ebih tinggi dari padap etaniy ang menanamp adi secarat radisional.r lal ini terbukti dengan adanya perbedaan jumlah produksi petani secara keseluruhan setelahm emperhitungkahna sil produksit otal dikurangis eluruhb iayap roduksiy ang dikeluarkans elamas atut ahun( musimt anam1 998/1999).

Peningkatan kemampuan pemahaman bacaan melalui strategi known-want to know-learned (KWL) pada siswa kelas III SDN Lecari Kecamatan sukorejo Kabupaten Pasuruan / Leres Febby

 

ABSTRAK Febby, Leres. 2010. Peningkatan Kemampuan Pemehaman Bacaan Melalui Strategi Know-Want To Know-Learned (KWL) Pada Sisiwa Kelas III SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan. Skripsi, Jurusan Kependidikan Sekolah Dasar Dan Pra Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Rumidjan, M.Pd, (II) Drs. Sjarfuddin A.R, S.Pd, M.Pd Kata kunci: Peningkatan Kemampuan Pemahaman Bacaan, Strategi KWL, SD. Keterampilan membaca dan menulis merupakan modal utama bagi peserta didik. Dengan bekal kemampuan membaca dan menulis, siswa dapat mempelajari ilmu lain. Siswa dapat mengkomunikasikan gagasan dan mengekspresikan dirinya melalui lisan dan tulisan. Oleh kerena itu, kegagalan dalam penguasaan keterampilan ini akan mengakibatkan masalah fatal, baik untuk melanjutkan pendidikan ke jenjang yang lebih tinggi maupun untuk menjalani kehidupan sosial kemasyarakatan. Strategi KWL memberikan kepada siswa tujuan membaca dan memberikan suatu peran aktif siswa sebelum, saat, dan sesudah membaca. Tujuan penelitian ini secara umum adalah untuk mengembangkan kemampuan pemahaman bacaan siswa dengan menggunakan Strategi KWL di kelas III SDN Lecari. Secara khusus, tujuan penelitian ini dirumuskan sebagai berikut: (1) untuk mendeskripsikan proses peningkatan kemampuan pemahaman bacaan melalui penerapan strategi KWL pada siswa kelas III SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan; (2) untuk mendeskripsikan hasil peningkatan kemampuan pemahaman bacaan melalui penerapan strategi KWL pada siswa kelas III SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan. Rencana penelitian dengan menggunakan pendekatan kualitatif, jenis penelitian tindakan kelas (PTK). Subjek penelitian adalah siswa kelas III SDN Lecari kecamatan Sukorejo kabupaten Pasuruan yang berjumlah 24 siswa. Teknik pengumpulan data menggunakan tes, observasi, wawancara, dan dokumentasi selama proses pembelajaran. Penelitian ini dilaksanakan sebanyak dua siklus melalui tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Hasil peningkatan kemampuan pemahaman bacaan melalui penerapan strategi KWL pada siswa kelas III SDN Lecari, nilai hasil belajar berupa tes tertulis dengan soal evaluasi pada pra tindakan nilai rata-rata kelas 49,58%, dengan 9 (37,5%) orang siswa mendapat nilai di atas standar dan 15 (62,5%) orang siswa mendapat nilai di bawah standar nilai. Pada siklus I terdapat nilai rata-rata kelas 52,87%, jumlah siswa yang lulus sebanyak 15 orang siswa atau 62,5% dan siswa yang tidak lulus berjumlah 9 orang siswa atau 37,5%. 6 orang siswa mendapat nilai 54 atau tepat nilai standar, 9 orang siswa mendapat nilai di atas nilai standar, dan 9 orang siswa mendapat nilai di bawah nilai standar. Sedangakan pada siklus II rata-rata kelas adalah 61,5%, 21 (87,5%) orang siswa mendapat nilai di atas standar dan 3 (12,5%) orang siswa yang masih berada di bawah standar nilai yang ditetapkan.

Pengaruh Inflasi Terhadap Tingkat Rentabilitas Pada Perusahaan Manufaktur Yang Dilisting Di Bursa Efek Jakarta Oleh Ulfani

 

Pada kondisi inflasi dimana terjadi kenaikm harga barang secara t€rus menerus, secara tidak langsung akan berpengaruh pada pendapatan perusahaan. Pada saat inflasi pausahaan tidak mampu lagi membiayai operasi perusahaan karena seperti kita tahu bahwa sector riil di Indonesia termasuk indusfri manufakmr yang masih tergantmg pada import barang modal, dan bahan baku. Hd ini akan menyebabkan harga produk meningkat, karena tingginya biaya produksi. Dengan harga produk yang terlalu tinggi, maka akan menunrnkan daya beli konsume,n yang secara otomatis juga akan menyebabkan pendapatan pousahaan turun.. Penelitian ini bertujuan unhrk mengetattui (l) pengaruh inflasi tahadap tingkat rentabilitas ekonomi (Z) pengaruh inflasi terhadap tingkat rentabilitas modal sendiri. Jenis penelitian ini adalah penelitian asosiatif (associarif research) yang b€rtujuan unmk mengetahui pengaruh antara dua vriabel atau lebih yang basifat kausal. Variabel bebas (E dalan penelitian ini adalah inflasi sedmgkm variabel terikat (D adalah tingkat rentabilitas ymg terdiri dari rentabilitas ekonomi (Yl) dan rentabilitas modal sendiri (Y2). Populasi dalam pe'nelitian ini addah seluruh perusahaanm anufaktur yang terdaftar di Bursa Efek Jakarta-S edangkant ekhnik pengambilans mpel me,ng:gunakatne lfui/r. purposive sampling,yaitu mengambil smpel dengan criteria tertqrtu Criteria smpel yang masuk dalam penelitian ini yaitu perusatraanm anuftkhu yang listing di Bursa Ef€k Jakartas ejak tahun 1998 sampai 2002 dan perusahaan tersebut aktif dalam mengeluarkan laporan keuangm. Berdasarkan criteria tersebut terpiih sepuluh perusahaan msrufakhr yang dijadikan sampel. Tekhnik pengrrmpulan data menggunakan tekbnik dokumentasi, sedangkan tekhnik analisa data ymg digunakan adalah analisa regresi sederhana. Hasil penelitian penelitian ini menunjukkan bahwa (l)hngkat inflasi di tndonesia selma tahun 1998 sampai 2002 meiniliki intensitas ymg berbeda tahun 1998i nflasi sebesa7r 7,55yo,A hun 1999 turun tajam sebesa2r ,010/",tahtrlrr 2000 naik sebesar 9,35yo, tahun 2001 naik kerrbali menjadi 12,55y% tahun 2002 inflasi murcapai 10,03%. (2)tingkat rentabilitas *onomi maupun tingkat rentabilias modal sendiri selama tahun 1998 sampai 2002 mengalani fluktuasi. (3)inflasi tidak berpengaruh signifikan terhadap r€ntabilitas ekonomi, hal ini t€rlihat dari hasil uji t yaitu t hitung -0,758t tabe{, -2,021y aor.tg€ rl€takd i daerahg agalt olak Ho, yang artinyat idak adap engaruh yangs igrifikana ntarain flasi denganre ntabilitasm odali bndiri. Berdasarkahna sil penelitiani ni maka sran bagi perusahaana dalah( l) melakukaenf iensim odal dan menekmb iaya produksi agar tingkat rentabilitas tdry ttlaga dan oendaung mengalamik enaika. Kuena perusahanny ang rendabeml encerrninkakni nerja manaj€xn€yna ng baik. (2) munperbaikik inerja rnmajanenp erusahail" untuk kelangsunganp erusahaand alan menghasilkan p€ndapatatann pam engabaikanft ctor ekstemy mg berpengaruhse pertik ondisi social dan politik. Dengan kinerja mmjerne,n ymg baik akan menambah kepercayaamn asyarak* t€rutamap ihak yang berkepentingo sepertik reditor yang akan merrberikro pinjaman dan para investor ymrg ingin menanamkm modalnykae p€rusahaan.

Pengaruh Latar Belakang Sosial Ekonomi Orang Tua Terhadap Sikap Berekonomi Mahasiswa (Studi Komparasi Daerah Asal) Oleh Yati Nurhayati

 

Setiapk egiatany ang dilatrukanm anusiad alam kehidupannyab ermuara pada usaha untuk memenuhi kebutuhan hidup diri pribadi dan keluarganya. Seiringd enganp ergeserana ntaraj umlah manusiad enganju mlah ragam kebutuhannyma,a kat erjadilahk elangkaans umberd ayas ebagafir emuas kebutuhanD. iikuti oleh perkembangank ebudayaanm anusiay ang menyebabkan ragamk ebutuhannyam eningkat,p ermasalahny ang dihadapi manusiad alam pemenuhhakne butuhanm enjadi kompleks.K ompleksitast ersebutm endorong manusiau ntukd apatm enentukans ikap/cara-caryaa ngl ebih efektifdan efisien dalamb eraktivitase konomid ant entus ajam enentukansk alap referens(ip rioritas dari masing-masingk ebutuhant ersebut,g unam engaturb erbagaip ermasalahan yangt imbul dalamp emenuhakne butuhannyaA-t au dengank ata lain manusia harusm emiliki sikapb erekonomid, imanap erilakue konominyam encerminkan adanyap enerapapnr insipprinsipe konomi. Tujuan dilaksanakannyap enelitian ini adalahu ntuk mendeskripsikanla tar belakangs osiale konomio rangt u4 mendeskripsikans ikap berekonomi mahasiswdaa lamh al perencanaaank tivitase konomi,e fisiensid alama ktivitas ekonomio, rientasmi asad epan,d ang ayah idup,m enganalisise caras imultand an parsial pengaruh latar belakang sosial ekonomi oranng tua terhadap sikap berekonommi ahasiswa. Penelitianin i dilaksanakasne lamab ulanD esembe2r 003t erhadap mahasiswFaa kultasE konomij urusanE konomiP embangunadni Universitas Negeri Malang. Teknik yang digunakan dalam pengumpulan data adalah angket. Sedangkapne ngambilans ampeml enggunakapne rtimbangand aeraha sald engan jumlah sampels ebanyak8 0 orangk arenak eterbatasank emampuanp eneliti dalam hal waktut enagad and ana. Pengolaliand atad alamp enelitiani ni dilakukand enganm enggunakan teknika nalisiss tatistikd eskriptifdani nferensialT. eknik analisiss tatistik deskriptifu ntukm endeskripsikakno ndisil atarb elakangs osiale konomio rangt ua dans ikapb erekonommi ahasiswaS. edangkatne knik analisiss tatistiki nferensial melalui analisis regresi linier berganda untuk mengetahui pengaruh latar belakang sosiale konomio rangt ua terhadaps ikapb erekonommi ahasiswa. a) Kondisil atarb elakangs osiale konomio rangt ua dilihat dari tingkat pendidikans ecarak umulatifm asihr endahy aitu sebesa5r 3,75%D. an menurut daeraha sal,t ingkat pendidikano rangt ua respondens ama-samam asih rendah yaitu Jatimb agianb arats ebesa5r 5%od anJ atimb agiant imur sebesa5r 7,50. b) Kondisil atarb elakangs osiale konomio rangt ua dilihat dari besarp endapatan secarak umulatifm asihr endahv aitu sebesa6r 5Yo.Danm enurutd aeraha sal. besarp endapatano rangt ua respondens ama-samam asih rendahy aitu Jatim bagianb arat sebesar5 2,5Vod anJ atim bagiant imur sebesar7 7,5o/o. c) Kondisi sikap berekonomim ahasiswas ecarak umulatif sudahc ukup baik yaitu sebesar8 7,25y o.D an menurutd aeraha sal , sikapb erekonomi mahasiswas ama-samas udahc ukup baik yaitu Jatim bagianb arat sebesar 87,5%d anJ atimb agiant imur sebesa7r 5%o. d) Secarap arsialt erdapatp engaruhy ang signifikan antaral atar belakangs osial ekonomi orang tua dari segi tingkat pendidikan terhadap sikap berekonomi mahasiswate.,r buktid ari nilai sig t (0,000)< cr( 0,05) e) Secarap arsialt erdapatp engaruhy ang signifikan antaral atar belakangs osial ekonomio rang tua dari segi besarp endapatante rhadaps ikap berekonomi mahasiswate, rbulli dari nilai sig t (0,000)< a (0,05) f) Secara simultan terdapat pengaruh yang signifikan antara latar belakang sosial ekonomio rangt ua terhadaps ikapb erekonommi ahasiswat,e rbuktid ari nilai sigF(0,000)

Pengaruh Persepsi Siswa Tentang Kondisi Fisik Sekolah Terhadap Motivasi Belajar Siswa Madrasah Aliyah Ghozaliyah Sumbermulyo Jogoroto Jombang oleh M. Sholeh

 

Dalamb elajars iswad iharapkanm emilikim otivasiy angt inggl,k arenad engan motivasi yang tinggi maka siswa akan mempunyai banyak tenaga atau energi untuk melakukakne giatanb elajarD. emikianju ga sebaliknyas isway angt idakm emiliki motivasim akai a akane ngganu ntuk melakukank egiatanb elajar.U ntuk itu sekolah harusm enyediakans aranad nn prasaranab elajary ang sesuadi engank eadaans iswa saaitn i sebagasi alahs atuf aktor pendorongm otivasib elajars iswa. Masalahy ang dikaji sekaligusm enjadit ujuanp enelitiana dalah1 ) bagaimanakaphe rsepssi iswatentangk ondisi fisik sekolahy angm eliputi saranad an prasaranMa adrasahA liyah GhazaliyahS umbermulyoJ ogorotoJ ombang2, ) bagaimankao ndisi motivasib elajars iswat ahun ajwan2002-20033. ) Adakah pengaruhp ersepssi iswat entangk ondisi fisik sekolaht erhadapm otivasib elajars iswa MadeasahA liyah GhazaliyahS umbermulyoJ ogorotoJ ombang. Rancanganp enelitiany ang digunakand alamp enelitiani ni adalahd iskriptif korelasionalM. etoded eskriptif digunakanu ntuk rnenggambarkanm, enganalisisd an menafsirkand atad ari variabely ang diteliti yaitu persepssi iswat entangk ondisi fisik MadrasahA liyah Ghozaliyahd an motivasib elajars iswaM adrasahA liyah GhazaliyahM. etodek orelasionadl igunakanu ntuk menentukanb esarnyap engaruh antarav ariabely ang diteliti yaitu persepssi iswat entangk ondisi fisik sekolah MadrasahA liyah danM otivasi belajars iswaM adrasahA liyah Ghazaliyah SumbermulyoJ ogorotoJ ombang. Populasid alamp enelitiani ni adalahs eluruhs iswaM adrasahA liyah Ghazaliyahta huna jaran2 002-2003y angt erdiri dari kelasI " IL m yangjunlah seluruhnyaa dalah3 59 siswa.S ampepl enelitiand itetapkand enganm enggunakan tehnik proportional statifiet random sampling, dengan meletakkan 15 % sampel dari keseluruhanp opulasiy aitu sebanyak5 0 siswa.T ehnik pengumpuland atad engan menggunakaanu gketd an dokumentasi. , Berdasarkanh asil analisisd at4 diperolehk esirnpulan1 ) tingkat persepsi siswa tentang kondisi fisik sekolah Madnsah Aliyah Gha"aliyah Menunjukkan dari 50r esponden1,2 r esponde(n2 4%)m enjawabs angabt aik, 18r esponde(n3 6 %) menjawabb aik dan2 0 responde(n4 0%)m enjawabc ukupb aik.2 ) kondisim otivasi belajars iswaM adrasahA liyah Ghazaliyahm enunjukkan5 0 respondenl0, responden (20%)m empunyami otivasbi elajary angs angatti nggi, 22raponden( 44o/o) mempunymaio tivasbi elajary angt inggi, l8 responde(n3 694)m empunyami otivasi belajayra ng cukupt inggi. Sedangkapne nganrhp ersepssi iswat entangk ondisi fisik sekolaht erhadap motivasbi elajarm enunjulkank oefisienk orelasi@ ) sebesa0r ,868a rtinyaa da keeratahnu bunganv ariabelp ersepssi iswat entangk ondisi fisik sekolah( x) dengan notivasbi elajars iswa( y). Koefisiend eterminas@i Squares) ebesa0r, 753a rtinya.pengaruvha riabel persepssiis wat entangk ondisif isik sekolah(x ) terhadapm otivasib elajars iswa sebes7a5r ,3%osi,s anya2 4,7o/okeberhasislaisnw ad itentukanv ariabella in. Nilai F hitung= 146,32le bihb esard arin ilai F tabel0 .0(5r, 4s=) 4,04 dengan probabilita0s. 000( lebihk ecil) dari 0,05)jadia dap engaruhy angn yatav ariabel penepssi iswat urtang kondisi fisik sekolah( x) terhadapm otivasi belajars iswa( y). Sarury ang dapatd iberikany aitu kepadak epalas ekolahs ebagaai dministrator sekolah endaknyam embantum enumbuhkanra sab anggap adap aras taf,p engajar terutamkae padas iswat erhadaps ekolahd enganc aram eningkatkanp engadaansa rana danp rasaranase kolahd enganm emperhatikanku rikulum yangb erlakud ank ondisi siswap adas aati ni, karenad engana danyas aranad an prasaranay angm emadami aka siswaa kanm erasas enangd ant enangd alamm elaksanakabne lajamyas ehinggaa kan menimbulkanm otivasib agi siswad i dalamm elaksanakakne giatanb elajard i sekolah dans iswah enclaknyma eninglcatkamn otivasib elajarnyak, arenad engana danya motivasib elajary arrgt inggi makaa kanm empermudathu juan belajar, vl

Hubungan Antara Pengelolaan Perpustakaan Dengan Motivasi Belajar Siswa Di Perpustakaan SMUN 2 Pare Kediri oleh Muh. Nur Taufiq

 

Hubungan Persepsi Siswa Tentang Kondisi Fisik Sekolah Dengan Motivasi Belajar Siswa Di Sekolah Lanjutan Tingkat Pertama (SLTP) Negeri 3 Lawang Malang Oleh Imam Suhariyanto

 

Motivasi belajar adalah hal yang paling penting bagi seorang siswa untuk dapatm elakukana ktivitas belajar, sebabd enganm otivasi belajar,s eseoranga kan memiliki banyak tenaga dan kemaqan untuk melakukan aktivitas belajar. Sebalikny4 seseoranyga ng tidak memiliki motivasi belajarm akad ia akane ngganu ntuk melakukan aktivitas belajar. Maka yang pertama kali harus dilakukan oleh seseorang unhrkd apatb el4iard enganb aik adalahb €rusaham enumbuhkanm otivasi belEar tersebut,b aikyang datangd ari dalam individu mauplmy ang datangd ari luar individu. Terkait dengan motivasi dari luar individu, salah satu faktor yang paltng urgena dalahs ekolahh arusm enyediakans aranad an prasaranab elajary ang memadai dan relevan dengan kondisi siswa pada saat itu. Masalahy ang dibahasd alam penelitiani ni adalah( l) Bagaimanakahp ersepsi siswa tentang kondisi fisik sekolah di Sekolah Lanjutan Tingkat Pertama Negd 3 Lawang,( 2) Bagaimanakahm otivasi belajar siswad i SekolahL anjutanT ingkat Pertama Negen 3 Lavrang (3) Adakah hubungan antara persepsi siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa di Sekolah Lanjutan Tingkat Psr&amaN egeri 3 Lawang.A dapun tujuan yang ingin dicapai adalah( l) Ingin mengetahupi ersepssi iswat entangk ondisi fisik SekolahL anjutanT ingkat Pertama Negeri 3 Lawang (2) Ingin mengetahui motivasi belajar siswa Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawang (3) Untuk mengetahui ada tidaknya hubungan persepsi siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawang. Rancanganp enelitiannyam enggunakand eskriptif Korelasional.M etode ini digunakanu ntuk menggambarkanko ndisi fisik SekolahL anjutanT ingkat Pertama Negeri 3 Lawangd an Motivasi Belajar Siswa.S edangkanM etode Korelasional digunakanu ntuk menentukans eberapab esarh ubungana ntaraP ersepsSi iswat entang KondisiF isik Sekolahd enganM otivasiB elajarS iswad i SekolahL anjutanT ingkat Pertama Negeri 3 Lawang. Populasi dalam penelitian ini adalah siswa/siswi Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawangy angj umlah keseluruhannya8 11 siswa.M etode pengumpuland ata dilakukan denganm enggunakana ngket,o bservasi,d okumend an wawancara.S edangkante knik pengmbilan sampeld ilakukand enganm enggunakan teknik Proponional RandomS amplingy aitu, pengambilans ampels ecarap roporsip sesuaid enganb esamyak elasm asing-masingd engana lasanu ntuk memberikan i kesempatayna ng samak epadas emuai ndividu sehinggad apatd ipilih meqiadi anggotasa mpeld enganc arau ndiaq yangj umlahnya 81 siswa. Teknik Analisa daa yang digunakan meliputi (1) Analisis deslriptif yaitu untukm endiskripsikank ondisi fisik dan motivasi belajar siswaS ekolahL anjutan Tingkat Pertama Negeri 3 Lawang, (2) Analisis Froduct Moment, yaitu untuk menguji hipotesis nol (H0) dan hipotesis alternatif GIa). Berdasarkana nalisad ata,d iperolehk esimpulanb ahwa, l) 14 dari 81 responde(n1 7,28%) menyatakanb ahwak ondisi fisik SekolahL anjutanT ingkat Pertama(S LTP) Negeri 3 l^awangd alam keadaanb aik, 25 responden( 30,86 %) menyatakacnu kup, 29 responden( 35,807 om enyatakans edangd an 13 responden (16,04%)m enyatakaknu rang.S edangkan2,) Motivasib elajars iswa,l 5 dari 8l responde(n1 8,18% ) memiliki motivasib elajar baik,2 3 responden(2 8,39o /o) ' memiliki motivasi belajar cukup, 26 responden( 32,09 o/o)m emiliki motivasi belajar sedangs erta 17 responden( 2A,98o /o)m asihd alarnk eadaank urang.3 ) Hubungan prsepei siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa menur{ukkanh argar xy sebesa0r ,903p adat arafsignifikasi sebesa0r ,000.O leh karena probabilitas < 0,05 maka Ho di tolak. Dengan demikian dapat dikaakan bahwa terdapat hubungan positifyang signifikan antara persepsi siswa tentang kondisi fisik sekolah dengan motivasi belajar siswa di Sekolah Lanjutan Tingkat Pertama Negeri 3 Lawang. Saran yang dapat penulis berikan dalam penelitian ini, Kepala Sekolah sebagaAi dministrator sekolahh endalnyas elalu memperhatikand an meningkatkan kelengkapans aranap rasaranay ang menadai yang disesuaikand engank urikulum dan keadaans iswap da saati tu. Sebaby ang demikian itu diharapakana kan membangkitkanm otivasi belajar sisway ang padaa khirnyaa kan tercapainyata rget tujuan pendidikan yang maksimal.

Hubungan Antara Latar Belakang Pendidikan Oang Tua, Status Sosial Denga Motivasi Belajar Siswa SLTP Negeri 2 Malang Oleh Yayuk Sriwahyuni

 

Dalam kehidupan manusia tidak lepas dari lingkungan. Lingkungan pertama yang dikenal manusia adalah keluarga. Keluarga merupakanpeletak dasar pembentukan kepribadian seseorang, maka keluarga memberikan andil besar dalam setiap perilaku seseorangte rmasuk motivasi belajar. Motivasi belajar dapat dipengaruhi oteh berbagai hal diantaranya latar belakang pendidikan orang tua yang dapat memicu motivasi anak untuk belajar lebih tinggi atau sebaliknya. Disamping itu yang tak kalah pentingny; dalam pendidikan diperlukan biaya. Dalam belajar anak memerlukan fasilitas dan sarana penunjang untuk kelancaran belajamya. Keadaan sosial ekonomi suatu keluargad apatm empengaruhmi otivasib elajara nak. Penelitian ini bertujuan untuk mendeskipsikan: (1) latar belakang pendidikan orang tua, (2) satus sosial ekonomi keluarga, (3) motivasi belajar siswa SLTP Negeri 2 Malang dan (4) hubungan antara latar belakang pendidikano rangt ua, statuss osiale konomik eluargad enganm otivasib elajar. - Rancangan yang digunakan dalam penelitian ini adalah deskriptif korelasional. Dalam pengumpulan data alat yang digunakan adalah angket t:rtutup dimana responden tinggal memberikan tanda cek pada kolomyang $teltukan Sampel yang digunakan adalah siswa SLTp Negeri 2 Marang kelai II dengan cara m€ngambil secara acak unhrk setiap kelasnya (proportional random Teknik analisisd atay angd igunakana dalahk orelasip roduct Moment Regresi Linier Berganda. Hasil penelitianm enunjukkanb ahwas ebagianb esaro rangt ua siswas LTp Negeri2 Malangb erpendidikans edang(s MU) denganp rosentassee besa4r 2%o. Latar belakang status sosial ekonomi orang tua dengan status sosial sedang sebesa4r 0%.D an rata-ratas iswam empunyami otivasiy angt inggi (660/o). Kesimpulan dari hasil penelitian menunjukkan bahwa ada hubungan yang signifikan antara latarbelakang pendidikan orang tua dengan motivasi uetajar, ada hubungan yang sigaifikan antara latar belakang status sosial ekonomi lefuarga dengan motivasi belajar dan ada hubungan yang signifikan antaralatar belakang pendidikan oranga tua, status sosial ekonomi keluarga dengan motivasi belajar.

Penerapan metode pembelajaran kooperatif model TGT (Team Games Tournament) untuk meningkatkan minat da hasil belajar siswa pada mata pelajaran kewirausahaan kelas X Jurusan Penjualan SMK Wisnuwhardhana Malang / Umi Maghfirotin Nisa

 

ABSTRAK Nisa, Umi Maghfirotin. 2010. Penerapan Metode Pembelajaran Kooperatif Model TGT (Team Games Tournament) Untuk Meningkatkan Minat Dan Hasil Belajar Siswa Pada Mata Pelajaran Kewirausahaan Kelas X Jurusan Penjualan SMK Wisnuwardhana Malang. Program Studi Pendidikan Tata Niaga, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Dr. Wening Patmi Rahayu, S.Pd, M.M, (2) Drs. Djoko Dwi Kusumajanto, M.Si. Kata Kunci: Pembelajaran Kooperatif Model TGT (Team Games Tournament), minat belajar, hasil belajar. Pembelajaran kooperatif adalah salah satu bentuk pembelajaran yang berdasarkan faham konstruktivistik. Pembelajaran kooperatif merupakan model pembelajaran dengan sejumlah siswa sebagai anggota kelompok kecil yang tingkat kemampuannya berbeda. Dalam menyelesaikan tugas kelompoknya, setiap siswa anggota kelompok harus saling bekerja sama dan saling membantu untuk memahami materi pelajaran. Metode pembelajaran kooperatif memiliki beberapa model pembelajaran yang bervariasi, salah satu model pembelajaran kooperatif yaitu Model TGT (Team Games Tournament). Pembelajaran kooperatif model TGT (Team Games Tournament) adalah salah satu tipe atau model pembelajaran kooperatif yang dapat diterapkan, melibatkan aktivitas seluruh siswa tanpa harus ada perbedaan status, melibatkan peran siswa sebagai tutor sebaya dan mengandung unsur permainan dan reinforcement (penguatan). Berdasarkan hasil observasi di SMK Wisnuwardhana Malang, pembelajaran masih didominasi oleh guru dan kurang terpusat pada siswa. Guru hanya menjelaskan dan siswa pasif mendengarkan penjelasan guru, hal ini menyebabkan siswa kurang merespon selama kegiatan pembelajaran berlangsung karena siswa merasa bosan, jenuh, mengantuk, dan kurang dilibatkan dalam kegiatan pembelajaran. Hal ini berpengaruh pada hasil belajar siswa yang menjadi kurang optimal, ini terlihat dalam daftar nilai ulangan harian siswa, hanya 21 siswa atau 47,7% dari jumlah seluruh siswa memperoleh nilai tinggi yaitu 70 sampai 80, sedangkan 23 siswa atau 52,3% siswa yang lain mendapatkan nilai sedang yaitu 65. Penelitian ini terdiri dari siklus I dan siklus II, penelitian dilakukan untuk mengetahui penerapan pembelajaran kooperatif model TGT pada mata pelajaran kewirausahaan, hasil belajar melalui pembelajaran kooperatif model TGT, serta minat belajar terhadap pembelajaran kooperatif model TGT pada mata pelajaran kewirausahaan. Subjek penelitian ini adalah siswa kelas X Jurusan Penjualan SMK Wisnuwardhana Malang. Penilaian penelitian ini terdiri dari aspek kognitif, afektif dan psikomotorik. Hasil penelitian ini menunjukkan hasil dari aspek kognitif siswa yang tuntas belajar siklus I (75%) dan siklus II siswa yang tuntas belajar (88,4%). Sedangkan hasil dari aspek afektif siswa yang tuntas belajar 8 kelompok (35 siswa) dan siklus II siswa yang tuntas belajar 10 kelompok (43 siswa). Hasil Dari aspek psikomotorik siswa yang tuntas belajar 8 kelompok (34 siswa) dan siklus II siswa yang tuntas belajar 10 kelompok (43 siswa). Jadi dapat disimpulkan ketiga aspek diatas hasil belajar siswa mengalami peningkatan. Hasil analisis angket minat belajar pembelajaran kooperatif model TGT adalah sebelum pelaksanaan tindakan sebesar 1.014 dengan rata-rata 23,04 meningkat menjadi 1.098 dengan rata-rata 25,5 sesudah pelaksanaan tindakan kooperatif model TGT. Dari angket yang disebarkan sebelum pelaksanaan tindakan diketahui terdapat 3 siswa yang memperoleh kriteria kurang berminat, 24 siswa memperoleh kriteria berminat dan 17 siswa memperoleh kriteria sangat berminat. Sesudah pelaksanaan tindakan pembelajaran kooperatif model TGT minat belajar siswa menunjukkan peningkatan yaitu terdapat 1 siswa yang memperoleh kriteria kurang berminat, 13 siswa memperoleh kriteria berminat dan 29 siswa memperoleh kriteria sangat berminat. Dibandingkan angket yang diberikan sebelum tindakan, respon siswa setelah proses pembelajaran model TGT pada mata pelajaran kewirausahaan cenderung sangat berminat. Jadi dapat disimpulkan bahwa pembelajaran kooperatif model TGT berpotensi meningkatkan minat belajar siswa pada mata pelajaran kewirausahaan. Berdasarkan hasil penelitian ini, dapat disarankan kepada: (1) SMK Wisnuwardhana Malang, hendaknya lebih memperhatikan kebutuhan siswa akan buku-buku pelajaran agar dapat digunakan untuk memperlancar proses pembelajaran dan agar siswa mempunyai buku panduan untuk belajar. (2) Bagi guru mata pelajaran kewirausahaan SMK Wisnuwardhana Malang/guru mata pelajaran lain disarankan menggunakan model pembelajaran kooperatif model Teams Games Tournament (TGT) yang telah terbukti dapat meningkatkan minat dan hasil belajar siswa. (3) Bagi peneliti selanjutnya, diharapkan dapat dijadikan sebagai bahan informasi dan pertimbangan dalam penelitian penerapan pembelajaran kooperatif model TGT agar menjadi lebih baik.

Pengaruh perputaran kas, piutang, dan persediaan terhadap rentabilitas perusahaan tekstil dan garmen yang listing di BEI tahun 2005-2008 / Yeni Astutik

 

ABSTRAK Astutik,Y. 2010. Pengaruh Perputaran Kas, Piutang dan Persediaan Terhadap Rentabilitas Perusahaan Tekstil dan Garmen yang Listing di BEI Tahun 2005-2008. Jurusan Akuntansi. Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing : (1) Dr. Nurika Restuningdiah, S.E.,M.Si.,Ak (2) Triadi Agung Sudarto, S.E.,M.Si.,Ak Kata Kunci : Tingkat Perputaran Kas, Perputaran Piutang, Perputaran Persediaan, Rentabilitas, Rentabilitas Ekonomi. Rentabilitas perusahaan sangat penting diperhitungkan karena merupakan pengukuran kinerja dalam memperoleh laba. Salah satu pengukuran kinerja berdasarkan rentabilitas adalah melalui analisis rasio rentabilitas berdasarkan rentabilitas ekonomi. Semakin tinggi tingkat rentabilitas ekonomi, maka semakin baik keadaan perusahaan dalam menghasilkan laba. Perputaran kas, perputaran piutang dan perputaran persediaan sebagai elemen modal kerja dapat mempengaruhi panjag pendeknya waktu terikatnya dana dalam modal yang pada akhirnya akan mempengaruhi tingkat rentabilitas yang dicapai. Semakin tinggi tingkat perputaran kas, perputaran piutang dan perputaran persediaan menandakan semakin pendek waktu terikatnya modal dalam elemen modal kerja tersebut. Hal ini menunjukkan adanya efisiensi dalam penggunaan modalnya yang akan menaikkan tingkat rentabilitas yang akan dicapai perusahaan. Penelitian ini merupakan penelitian eksplanasi yang berarti menjelaskan ada tidaknya pengaruh perputaran kas, perputaran piutang, dan perputaran persediaan terhadap rentabilitas. Jenis data yaitu pooling data berupa laporan keuangan periode 2005-2008 perusahaan tekstil dan garmen, teknik pengumpulan data berupa teknik dokumentasi dan sumber data diambil dari Pusat Data Bisnis UM dan wapsite www.idx.com, periode 2005-2008. Analisis data menggunakan teknik analisis regresi linier berganda. Populasi dalam penelitian ini perusahaan manufaktur yang listing di BEI tahun 2005-2008, sedangkan sampel dari penelitian ini adalah 18 perusahaan tekstil dan garmen yang terdaftar di BEI tahun 2005-2008. Berdasarkan hasil penelitian tersebut disimpulkan secara parsial perputaran kas berpengaruh positif yang signifikan terhadap rentabilitas ekonomi dengan nilai sig t = 0.000 < 0.05, perputaran piutang berpengaruh negatif yang signifikan terhadap rentabilitas ekonomi dengan nilai sig t = 0.040 < 0.05, perputaran persediaan berpengaruh negatif yang signifikan terhadap rentabilitas ekonomi dengan nilai sig t = 0.025 < 0.05. Dan secara simultan tiga variabel ini berpengaruh terhadap rentabilitas ekonomi dengan nilai sig f = 0.000 < 0.05 Berdasarkan hasil penelitian tersebut diharapkan investor mampu mengukur hasil pengembalian investasi mereka. Bagi kreditur penelitian ini diharapkan bisa menjadi dasar sebagai pengambilan keputusan untuk menentukan lanjut atau tidaknya dalam pemberian pinjaman. Dan bagi peneliti selanjutnya agar memperhatikan faktor-faktor lain yang dapat mempengaruhi rentabilitas.

Perlindungan Hukum Teehadap Hak-hak Tersangka Pelaku Tindak Pidana Menurut KUHAP Oleh Sutini

 

Negara Indonesia adalah negara hukum. Hal ini sesuai dengan penejelasan UUD 1945y ang mengatakan"N egaraI ndonesiab erdasara tas hukum (rechtsstaat) tidak berdasarkana tas kekuasaanb elaka (machl'tslaat)".S ebagain egarah ukum lndonesima emberit empata tauj aminany ang luasa task eberadaahna k asasin ranusia yaituh ak dasary angd imiliki manusias ejakl ahir dan merupakana nugerahT uhan YangM ahaE sa. Salah satu bentuk perwujudan hak asasi manusiaadalah dalam bidang peradilanp idana.D imana tersangkad alam hal ini adalah seseorangy ang karena perbuatannyaat au keadaanyab erdasarkanb ukti permulaanp atut diduga sebagai pelakuti ndak pidana,t idak bolehd ianggapb ersalahs ebeluma dap utusanp engadilan yangm empunyaik ekuatanh ukum tetap yang menyatakanb ahwa ia bersalah. Demikian juga dalam proses penyidikan yang meliputi tindakan-tindakan penangkapanp,e nggeledahanp, enahanand an penyitaan juga harus selalu memperhatikahna ka sastie rsangkdaa nb erpedomapna dah ukumy angb erlaku. Namun dalam prakteknya sebagian orang mengatakan adanya oknum penyidik yang melakukan kekerasand an kesewenang-wenangadna lam bentuk penekananp,e maksaans erta pemukulanu ntuk mengejarp engakuanb ersalahd ari tersangkHa.a l ini berartit idakm enjunjungti nggih aka sasmi anusiad anb ertentangan dengan hukum yang berlaku. Untuk itu diadakan kajian mengenai perlindungan hukumt erhadaph ak-hakt ersangkap elakut indak pidanam enurutK UHAP Kajian ini bertujuan untuk mendiskripsikanp erlindunganh ukum terhadap hak-hak tersangka pelaku tindak pidana menurut KUHAP. Ada 2 hal yang dideskripsikasne hubungadne nganp erlindunganh ukum terhadaph ak-hakt ersangka pelakuti ndak pidanam enurutK UIIAP, yaitu (1) hak-hakt ersangkam enurutK UHAP dan( 2) pelaksanaapne rlindunganh ukumt erhadapte rsangkam enurutK UHAP. Metodey ang digunakana dalahs tudi kepustakaan(l ibrary reseurch)d engan menganalisisd ata kepustakaans ecara yuridis normatif yaitu pengkajian pada peraturanp erundang-undangayann g erat kaitannyad engan skripsi ini. Sedangkan metodete rsebumt eliputi metode induktif, yaitu untukm enarikk esimpuland atay ang bersifatk hususd enganc aram enganalisids atay angb ersifatu mum.M etoded eduktif digunakan untuk menarik kesimpulan data yang bersifat umum dengan cara menganalisisd ata yang bersifat khusus,d an metodea nalisak ornparatifd igunakan membandingkafna ktor-faktort ertentuy ang berhubungand engans ituasid an yang dikaji dengan membandingkan satu faktor dengan faktor lainnya. Hasil kajian menunjukkan bahwa hak-hak tersangka pelaku tindak pidana dari kegiatan penyelidikan sampai penyidikan yang meliputi tindakan penahananp, enggeledahand an penyitaanm enurut KUHAP sangat dijunjuntgin ggi dan pelaksanaanp erlindungan hukum terhadppt ersangkap elaku tindakp idanao leh penyelidik dan penyidik, juga telah diatur secarar inci dalam Sebagasi arand alam rangkam enghormathi ak asasim anusiak hususnyah ak asatsei rsangkpae lakut indakp idanad alamp enyelidikadna np enyidikanh aruss esuai dan menjunjung tinggi hukum yang berlaku dan untuk lebih mernfungsikan sepenuhnpyae ranank epolisians ebagapi enyelidik dan penyidik perlu ditingkatkan profesionalismek,u alitas, etika dan rnoral penyelidik dan penyidik. Hal ini diperlukaunn tukm engirnbangsie makinc anggihnyak e.iahatatnin, gginyak esadaran hukumra kyatd ans emakinb anyaknyag odaany anga da.

Pembelajaran berbasis inkuiri model siklus belajar untuk meningkatkan keterampilan proses dan prestasi belajar fisika siswa kelas 8D SMP Negeri 18 Malang tahun ajaran 2009/2010 / Susieni

 

ABSTRAK Susieni. 2010. Pembelajaran Berbasis Inkuiri Model Siklus Belajar untuk Meningkatkan Keterampilan Proses dan Prestasi Belajar Fisika Siswa Kelas 8D SMP Negeri 18 Malang Tahun Ajaran 2009/2010. Skripsi, Program Studi Pendidikan Fisika, Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Muhardjito, M. S, (II) Drs. Asim, M. Pd Kata kunci: inkuiri, siklus belajar, keterampilan proses, prestasi belajar Berdasarkan pengamatan pada kelas 8D SMP Negeri 18 malang, tampak bahwa pada saat pembelajaran berlangsung siswa cenderung ramai, ketika diajak melakukan praktikum siswa tampak senang tetapi ada beberapa siswa yang belum mengerti nama alat dan cara menggunakan alat tersebut sehingga siswa tidak dapat mengambil data secara benar dan teliti. Hal ini mengindikasikan bahwa keterampilan proses siswa masih rendah. Dari hasil ulangan materi Bunyi, nilai rata-rata kelas 8D hanya mencapai 54,4. Hal ini mengindikasikan bahwa prestasi belajar siswa masih rendah karena nilai rata-rata yang di capai masih di bawah KKM (Kriteria Ketuntasan Minimum) yang ditetapkan oleh sekolah yaitu 70,0. Rendahnya keterampilan proses dan prestasi belajar siswa ini diatasi dengan cara mengubah pembelajaran konvensional menjadi pembelajaran inkuiri berbasis model siklus belajar. Model siklus belajar ini memiliki lima tahapan yang terencana dan terarah yaitu pendahuluan (engagement), eksplorasi, eksplanasi, elaborasi dan evaluasi. Dampak pembelajaran berbasis inkuiri model siklus belajar terhadap peningkatan keterampilan proses dan prestasi belajar fisika siswa diteliti dengan melakukan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam dua siklus. Siklus I pokok bahasan perambatan cahaya dan cermin datar. Siklus II pokok bahasan cermin cekung dan cermin cembung. Perangkat pembelajaran yang dikembangkan adalah Rencana Pelaksanaan Pembelajaran (RPP), LKS, dan media pembelajaran. Adapun instrumen yang dikembangkan dalam penelitian ini yaitu lembar observasi keterampilan proses, tes prestasi berbentuk soal obyektif, dan lembar observasi pelaksanaan pembelajaran siklus belajar. Hasil yang diperoleh dari penelitian ini menunjukkan peningkatan semua aspek keterampilan proses yang diajarkan dari siklus I ke siklus II. Prestasi belajar fisika siswa juga mengalami peningkatan sebesar sebesar 14,6 point dari nilai rata-rata ulangan pada siklus I 65,4 menjadi 80,0 pada siklus II, dengan peningkatan persentase jumlah siswa yang tuntas belajar dari 42,5% pada siklus I menjadi 80% di akhir siklus II.

Manajemen pelatihan kejuruan otomotif (studi kasus di UPT Pelatihan Kerja Singosari Malang) / Indah Iswidia

 

ABSTRAK Iswidia, Indah. 2010. Manajemen Pelatihan Kejuruan Otomotif (Studi kasus di UPT Pelatihan Kerja Singosari Malang. Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Imron Arifin, M.Pd, (II) Dra. Maisyaroh, M.Pd Kata Kunci : manajemen pelatihan, kejuruan otomotif. Pendidikan merupakan kegiatan yang ditujukan untuk memanusiakan manusia dalam membentuk dirinya menjadi suatu pribadi yang utuh. Di dalamnya termasuk kegiatan-kegiatan belajar yang disengaja ataupun yang tidak disengaja, pendidikan formal, informal, dan nonformal. Pelatihan merupakan sebagian saja dari pada pendidikan yang lebih menitikberatkan pada segi-segi keterampilan kerja individu guna memperbaiki unjuk kerja dalam pekerjaannya. Pada hakekatnya pendidikan dan pelatihan mempunyai tujuan yang sama yaitu meningkatkan pengetahuan (knowledge), keterampilan (skill), dan nilai/sikap (attitude). Manajemen pelatihan adalah suatu proses perencanaan, pengorganisasian, pelaksanaan, dan evaluasi sumber daya secara efektif dan efisien untuk meningkatkan keterampilan seseorang agar kinerjanya meningkat. Kinerja disini diartikan sebagai meningkatnya prestasi kerja yang lebih efektif dan efisien bagi dirinya sendiri maupun organisasinya. Upaya peningkatan keterampilan tersebut dalam rangka menyiapkan calon tenaga kerja yang ahli dan kompeten sesuai keterampilannya. Di Indonesia misalnya, pada pendidikan formal telah digagas dan dijalankan pendidikan vokasional. Pada bagian lain, pemerintah menggagas lahirnya Balai Latihan Kerja Industri (BLKI) pada setiap provinsi. Di Jawa Timur lembaga ini berada di Singosari Kabupaten Malang yang kini berubah nama menjadi Unit Pelaksana Teknis (UPT) Pelatihan Kerja. Oleh sebab itu, maka dilakukan suatu penelitian untuk mengetahui manajemen pelatihan di UPT Pelatihan Kerja Singosari Malang khususnya pada kejuruan otomotif, dengan fokus serta tujuan penelitian diantaranya tentang (1) perencanaan; (2) pengorganisasian; (3) pelaksanaan; dan (4) penilaian pelatihan kejuruan otomotif.    Penelitian ini dilakukan dengan pendekatan kualitatif, yaitu suatu metode penelitian yang tidak menguji hipotesis melainkan memaparkan dan mengolah data. Jenis penelitian ini adalah studi kasus karena terdapat satu kasus pada satu objek penelitian, yaitu UPT Pelatihan Kerja Singosari Malang. Dalam penelitian ini, peneliti sendiri lah yang berperan sebagai instrumen kunci, dengan subjek penelitian adalah kepala UPT Pelatihan Kerja, ketua kejuruan otomotif, dan instruktur kejuruan otomotif. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian pada saat wawancara, tindakan yang dilakukan oleh subjek penelitian, dan dokumen yang berkaitan dengan pelatihan kejuruan otomotif. Setelah data tersebut diperoleh kemudian dilakukan pengecekan keabsahan data dengan menggunakan metode trianggulasi, i     ii    ketekunan pengamatan, pemeriksaan sejawat melalui diskusi, dan pengecekan anggota. Hasil penelitian menunjukkan bahwa manajemen pelatihan kejuruan otomotif di UPT Pelatihan Kerja Singosari Malang, meliputi tahapan-tahapan yaitu perencanaan, pengorganisasian, pelaksanaan, dan penilaian. Perencanaan pelatihan meliputi rekrutmen peserta pelatihan dan persiapan rencana pengajaran yang terdiri dari pembuatan (1) ikhtisar program pelatihan; (2) matriks program pelatihan; dan (3) jadwal pelatihan. Kegiatan pelatihan kejuruan otomotif berada di bawah tanggung jawab ketua kejuruan yang membawahi beberapa instruktur. Pada kejuruan otomotif seluruh instruktur berjumlah sembilan orang. Pelaksanaan pelatihan diterapkan melalui kegiatan-kegiatan yang dilakukan di ruang teori, ruang praktek, dan lapangan. Adapun kegiatan tersebut meliputi kegiatan penunjang yang terdiri dari (1) kegiatan FMD (fisik, mental, dan disiplin); (2) kegiatan apel pagi dan apel siang; (3) kegiatan senam. Dilanjutkan dengan pelaksanaan kegiatan inti yang terdiri dari (1) kegiatan teori dan (2) kegiatan praktek. Pada kegiatan akhir terdiri dari (1) kegiatan on the job training dan (2) uji kompetensi. Penilaian yang dilakukan pada pelatihan kejuruan otomotif ini meliputi evaluasi teori dan evaluasi praktek. Aspek yang dinilai meliputi aspek kemampuan pengetahuan atau teori, keterampilan atau praktek, kedisiplinan, kehadiran, sikap, kerjasama, dan keselamatan kerja. Laporan penilaian yang diberikan dalam bentuk sertifikat pelatihan dan Note Book hasil Uji Kompetensi di Tempat Uji Kompetensi (TUK). Berdasarkan hasil penelitian ini, dapat disarankan bagi (1) Pengelola Jurusan Administrasi Pendidikan hendaknya hasil penelitian ini menjadi tambahan referensi bagi penelitian dalam ruang lingkup pendidikan non formal seperti pelatihan yang saat ini lebih kecil dari pada referensi penelitian dalam lingkup pendidikan umum; (2) Kepala UPT Pelatihan Kerja hendaknya dilakukan perubahan terhadap kegiatan on the job training (OJT) yang dahulu sifatnya tidak wajib menjadi wajib diikuti oleh peserta pelatihan sehingga dapat menghasilkan lulusan yang kompeten di bidangnya; (3) Instruktur Kejuruan Otomotif hendaknya mempertahankan ciri khas pada pelatihan yaitu pembentukan sikap (attitude) peserta pelatihan, dengan demikian pelatihan dapat dioptimalkan mengingat potensi yang dimiliki instruktur sangat tinggi, sehingga dapat meningkatkan daya saing dalam menghadapi dunia kerja; dan (4) Peneliti lain hendaknya dapat melanjutkan penelitian yang sejenis pada berbagai aspek lain dengan latar yang berbeda yang nantinya dapat bermanfaat untuk diteliti.

Pembuatan PC router freebsd pada jaringan komputer di SMP Negeri 2 Bangil Kabupaten Pasuruan / Dian Rachmawati

 

Kata kunci : FreeBSD, Router, DHCP Server. Teknologi Informasi atau Information Technology saat ini sudah menjadi kebutuhan mendasar dalam setiap organisasi atau lembaga pendidikan, hal ini terbukti saat ini hampir tidak ada organisasi bisnis atau perusahaan bahkan instansi pendidikan yang tidak menggunakan teknologi informasi khususnya komputer. Dengan perkembangan teknologi komputer yang sangat pesat ini, SMP Negeri 2 Bangil bisa dibilang tidak ketinggalan dengan perkembangan teknologi, karena di SMP Negeri 2 Bangil sudah tersedia Laboratorium Komputer. Pada Laboratorium Komputer di SMP Negeri 2 Bangil sudah terkoneksi internet yang menggunakan Speedy, sedangkan pada Ruang Tata Usaha belum terkoneksi jaringan Internet sama sekali. Melihat kenyataan ini penulis ingin membangun jaringan Intranet pada lingkungan SMP Negeri 2 Bangil yang terkoneksi dengan Speedy, guna mengoptimalkan penggunaan internet dengan menggunakan PC Router berbasis FreeBSD. Pada perancangan PC router ini diawali instalasi FreeBSD dilanjutkan konfigurasi IP address, kemudian mengkonfigurasi DHCP Server. Dari hasil pengujian PC router FreeBSD secara keseluruhan diperoleh hasil bahwa piranti sesuai dengan rancangan, yaitu: (1) Membagi kedua jaringan Tata Usaha dan Lab Komputer untuk mencegah penyebaran virus atara kedua jaringan dan mengamankan file sharing pada Ruang Tata Usaha agar tidak bisa diakses dari Lab.Komputer, (2) mengaktifkan DHCP Server pada jaringan Lab.Komputer. Dengan melihat hasil yang dicapai, untuk pengembangan lebih lanjut disarankan: (1) Perlu dilakukan upgrade FreeBSD ke versi yang terbaru agar mendapatkan penyempurnaan sistem dan stabilitas dari PC Router, (3) Upgrade PC Router yaitu penambahan memory dan kapasitas hardisk untuk mendukung kinerja PC Server.

Radikalisasi Petani Pedesaan Jawa (Studi Kasus Sengketa Tanah di Desa Cepoko Kabupaten Ngawi - Jawa Timur) Tahun 1992-1999 Oleh Mariana Kushariyati

 

Tanah adalah harta yang paling berharga bagl kaum tani' dimana tanah ,n*fut rpat haCr pet;niuntul melakukan kegiatan ber6ni dan mencari ot*fi. fuo- rani seringtati berada pada posisi yang kurang menguntungkan dalam masalah p"rtanahan. Keadaan ini disebabkan karena petani kurang urernehamaki anh ukum agraria Permasalahatna nahy ang dilami-9leh petanu tiUitr tanyat merugikan fttani. Perlawanan p€tani yang disebabkan -karena ketidakadlan rn"n?o*ng petanj untuk melalrukan prlawaqan fepada ;il;th Petani yag 6"tuOu di Desa Cepoko Kabupaten Ngawi.yang tdut** perlaanans ecrab ersama-samma ernperjuangkanh aknya1 e1k!wt r'*o'o*g*berkorban.Perlawananyangdilakukanolehparapetanipada tahun 199r-1999 itu lermasuk sualu kejadian yang langka kargna saat itu l.g,u titu berada dalam keadaan yarrg tidak memiliki kebebasan untuk *"o!af*nu" pendapat. Kebsranian petari untuk melawan pemerintah yang t**** p"O" saat iiu adalah suatu hal yag panlas ntuk diunglapkan' roiuan dari tulisan ynag berjudul * Radjkalisasj Petanj Ped€saanja wa (Studi X.asus Sengketa fanafr Ai Desa Cepoko Kabupatetn Nggwi Jawa iiln*) f*,* w9r-19g9- ini adalah untuk mengetahuip ermasalahany ang t rj# *ruto masyarakat petani Desa gtpoto dergan pemerintah yang b.i;fitt denganm asalahT anah Gedong' Permasalahany ang akan diangkat datamtu tisan'ini adalah apakahy ang melatarbelakangdt ari sengketat anah yangm elsatkan masyarakatd enganp ihatr,p eTerintatL bagaimanata n-ggapa" atau reaksi dan masyarakat deia terhadap kebejakan yang,diambil oleh pemerintah berkartan dengan Tanah 9"1*g' setq bagaimanakah ienyelesa,any ang diambil oleh pemerintah dalam rangka menyelesaikan ffiasalah yang berkailand engans engketata nah' Dalam rangka mencari daalang birkaitan engan sengketalanah ini mak penulis meng;makan pendekatan kualitxif untuk morggali informasi dari r*trr Onuf rng didapatd ari parap endudukd sad an pra perangkal.desyaa g tsrlibai dan m""gaut"i permasatitran tersebut' Metede yang digunakan adalahd enganw awancaraie rhadaps umberd gnnagnd iperkual oleh datadata y'-m-iiea dsitdt apit dari dokumentasyi angb erkitan dgnSanp enelltig' y'angd iperolehd ari peneliiiai ni diketahubi ahwad alamm asalayl ang berkenaand ingan sengketaia nah masyarkat pelani di Desa Cepoko secara bersama-samab erjuang mtuk mendapatkank embali tanah lahan garapan msreka yang terampas oleh pihak swasta. Perlawanan yang dilakukan oleh para petani ini dapat dilakukan tidak lepas dari dukungan dan partisipasi dari para tokoh desa yang memimpin mereka rmruk berjuang. Ketelatenan dan ketepatan arah ttmtulan yang dilakukan oleh para petani membawa keberhasilany ang diwujudkan dengm keluarnyas urat dari pemerintahu antuk menindaklanjuti tunutan masyarkat desa. Wujud dari keberhasilan dari masyarkal itu adalah dengan trrumla ssrtifikat sebagai bsmuk sah kepemilikan tanah oleh para petani. Sertifikat tanah yang diadapatkm merupahan butti sah yang memiliki kekuatan hukum. Berdasarkan penelitian ini dapat diketahui bahwa pengetatruana kan hukurn sangatp enting dimiliki oleh seluruh masyarakal teruatama oleh paetani. Pihak pemerintah harusnya lebih memperhatikan kepentingand an melakukan sosia.lisaai kan pentingnyaa spek hukum dalam kehidupan serta bertindak adil terhadap masyarkat kecil, dalam hal ini adalah perani yang seringltali dilern.palkand alan situasi dan kondisi yang kurang menguntungkand an selalu dirugikan. Peristiwa tahun' 1992-1999y ang berkailsn dengan seng!,sta tarlah ini hendaknya menjadi pelajaran bagl pemerintah sendiri ataupun bagi petani yang pada umumnya untuk lebih beranim emperjungkanb aknyas elamam asih dalamj alur yag benard an sesuai dengan hukum yang bedaku.

Perbedaan penerapan metode ceramah (konvensional) dan pendekatan kontekstual model bertanya (questioning) dalam meningkatkan hasil belajar siswa pada mata pelajaran ekonomi kelas X SMAN 9 Malang (dalam pembahasan materi konsumsi dan investasi) / Tona Aktodhiarama

 

ABSTRAK Aktodhiarama, Tona. 2010. Perbedaan Penerapan Metode Ceramah (Konvensional) dan Pendekatan Kontekstual Model Bertanya (Questioning) Dalam Meningkatkan Hasil Belajar Siswa Pada Mata Pelajaran Ekonomi Kelas X SMAN 9 Malang (Dalam Pembahasan Materi Konsumsi dan Investasi). Skripsi, Program Studi Pendidikan Ekonomi dan Koperasi Jurusan Ekonomi Pembangunan Fakultas Ekonomi Universitas Negeri Malang. Pembimbing : (I) Dr. Agung Haryono, S.E., M.P, (II) Agus Sumanto, S.E, M. SA. Kata-Kata Kunci : Metode Ceramah (Konvensional), Pendekatan Kontekstual Model Questioning, Hasil belajar Ekonomi. Upaya untuk memperbaiki mutu proses belajar mengajar serta hasil belajar tidaklah cukup dengan perubahan kurikulum saja, melainkan perlu dilihat siapa yang ikut terlibat dalam proses belajar mengajar tersebut dan pendekatan yang di gunakan kepada siswa. Proses belajar mengajar tentunya melibatkan banyak faktor antara lain: siswa, guru, minat belajar siswa, metode dan pendekatan yang di gunakan dan tentunya orang tua juga sangat mendukung tercapainya tujuan yang dicita-citakan, khususnya peningkatan hasil belajar siswa. Proses belajar-mengajar perlu dilakukan dengan tenang dan menyenangkan. Hal tersebut tentu akan menuntut aktivitas dan kreativitas guru dalam menciptakan lingkungan yang kondusif. Proses belajar-mengajar dikatakan efektif apabila seluruh peserta didik terlibat secara aktif, baik mental, fisik maupun sosial dalam pendidikan. Pelaksanaan proses belajar mengajar di SMA Negeri 9 Malang khususnya mata pelajaran Ekonomi seringkali pembelajaran membosankan dan masih menggunakan metode pembelajaran konvensional yaitu metode ceramah yang bersifat berpusat pada guru (teacher centered), sehingga siswa cenderung pasif dan hanya siswa tertentu yang mau aktif. Maka dari itu peneliti akn mencoba menerapkan pendekatan kontekstual model bertanya (questioning). Untuk meningkatkan hasil belajar siswa. Jenis penelitian ini adalah eksperimen semu (quasi experiment) sebab penelitian ini menggunakan dua kelas, satu kelas sebagai kelas eksperimen dan satu kelas sebagai kelas kontrol. Kelas eksperimen dalam penelitian ini adalah kelas yang dalam proses pembelajaran menggunakan Pendekatan Kontekstual model Bertanya (Questioning), sedangkan kelas kontrol adalah kelas yang dalam proses pembelajarannya menggunakan metode ceramah (Konvensional). Rancangan penelitian yang digunakan dalam penelitian ini adalah Nonequivalent Control Group Design dengan pre tes dan post tes, serta pemilihan kelompok sampel yang dilakukan dengan dipilih 2 kelas dengan teknik purposive sampling. Hal ini dilakukan dengan pertimbangan bahwa kedua kelas tersebut memiliki potensi yang hampir sama. Instrumen yang digunakan dalam penelitian ini adalah silabus dan RPP, wawancara, lembar observasi kegiatan guru dalam kelas, soal pre tes, soal post tes, soal tugas kelompok dan catatan lapangan. Hasil belajar siswa diukur berdasarkan hasil pre test dan post test. Hasil belajar siswa yang diajar dengan pendekatan Bertanya (Questioning) lebih tinggi dibandingkan siswa yang diajar dengan metode konvensional. Hal ini dibuktikan dengan adanya nilai rata-rata kelas eksperimen setelah diberi perlakuan pada saat post test yaitu 82.82, sedangkan rata-rata kelas kontrol setelah diberi perlakuan pada saat post test yaitu 76.21. Setelah di adakan perlakuan dan post test maka nilai dari kelas eksperimen dan kelas kontrol berbeda secara signifikan. Dapat di simpulkan bahwa kedua rata – rata tidak identik karena nilai Sig. (0,000) < 0,05. Keadaan ini menunjukkan bahwa pendekatan kontekstual model bertanya (Questioning) dapat menghasilkan hasil belajar yang tinggi. Dengan menggunakan pendekatan kontekstual model bertanya (questioning) siswa dapat meningkatkan hasil belajarnya dengan memilih metode dan pendekatan pembelajaran yang menjadikan siswa lebih aktif dan tidak membosankan siswa dalam mengikuti kegiatan pembelajaran di dalam kelas. Sehingga dapat mendukung kegiatan belajar di kelas, bagi Guru dapat menerapkan pendekatan kontekstual model bertanya dalam kegiatan belajar mengajar untuk meningkatkan hasil belajar siswa. Bagi pihak SMA N 9 Malang perlu kiranya penelitian ini dapat digunakan sebagai bahan pertimbangan dalam upaya meningkatkan keterampilan mengajar guru yang dapat mendukung hasil belajar siswa, Kepada peneliti lain dapat menggunakan populasi dan sampel penelitian yang lebih luas serta dengan materi yang berbeda agar mendapatkan data yang lebih baik dalam penelitian tentang pendekatan kontekstual model bertanya (Questioning).

Fungsi komunikatif bahasa Jawa dan bahasa Indonesia dalam konteks kedwibahasaan kerabat Kraton Kasultanan Yugyakarta / oleh Pranowo

 

Pengaruh kondisi sosial ekonomi dan pengetahuan terhadap perilaku anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan sebagai upaya pelestarian hutan RPH Gunung Tukul Desa Suru Kecamatan Sooko Kabupaten Ponorogo / Aprilia Dwi Jayanti

 

ABSTRAK Jayanti, Aprilia Dwi. 2010. Pengaruh Kondisi Sosial Ekonomi dan Pengetahuan Terhadap Perilaku Masyarakat Anggota MPSDH Sido Makmur Dalam Pelaksanaan Budidaya Tanaman Bawah Tegakan Sebagai Upaya Pelestarian Hutan RPH Gunung Tukul Desa Suru Kecamatan Sooko Kabupaten Ponorogo. Skripsi, Jurusan Geografi FIS Universitas Negeri Malang. Pembimbing (I) Dra. Yuswanti Ariani Wirahayu, M.Si, (II) Drs. Marhadi Slamet Kistiyanto, Msi. Kata kunci : kondisi sosial ekonomi, pengetahuan, perilaku. Hutan di RPH Gunung Tukul tetap mengalami pencurian meskipun telah diadakan budidaya tanaman bawah tegakan. Jika dilihat dari kondisi masyarakat pengelolanya yaitu anggota MPSDH Sido Makmur yang latar belakang pendidikan pendapatan dan pengetahuannya beragam maka perilakunya juga beragam. Oleh karena itu perlu adanya penelitian tentang seberapa besar hubungan dari latar belakang sosial ekonomi yakni tingkat pendidikan, serta pendapatan terhadap tingkat pengetahuan masyarakat, dan besarnya pengaruh dari pengetahuan itu terhadap perilaku masyarakat dalam pelaksanaan budidaya tanaman bawah tegakan sebagai upaya untuk pelestarian hutan. Penelitian ini bertujuan untuk mengetahui 1) pengaruh antara tingkat pendidikan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, 2) pengaruh pendapatan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, dan 3) pengaruh pengetahuan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan. Metode penelitian yang digunakan survey dengan sampel yang diambil secara proporsional dari masing-masing KKP(Kelompok Kerja Prayasawana). Untuk penentuan sampel diambel secara random. Teknik pengambilan data menggunakan metode observasi, dokumentasi dan kuesioner. Analisis data yang digunakan dalan penelitian ini adalah analisa tabulasi dan statistik dengan regresi berganda dan korelasi product moment pearson. Hasil penelitian menunjukkan: 1) terdapat pengaruh yang signifikan antara tingkat pendidikan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, 2) terdapat pengaruh yang signifikan antara pendapatan dengan perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan, 3) terdapat pengaruh yang signifikan antara pengetahuan terhadap perilaku masyarakat anggota MPSDH Sido Makmur dalam pelaksanaan budidaya tanaman bawah tegakan. Berdasarkan hasil penelitian ini, dapat disarankan untuk meningkatkan pendidikan dengan pemberian contoh oleh tokoh masyarakat dalam mengikuti penyuluhan oleh Perhutani. Untuk meningkatkan pendapatan adalah meningkatkan hasil budidaya tanaman bawah tegakan dengan mendatangkan penyuluh dari dinas pertanian. Untuk meningkatkan pengetahuan harus ada penyuluhan lebih intensif yang disertai simulasi-simulasinya sehingga masyarakat lebih mudah memahaminya.

Pembelajaran kontekstual pola pemberdayaan berpikir melalui pertanyaan (PBMP) untuk meningkatkan kemampuan berpikir kritis dan hasil belajar fisika siswa kelas X.1 SMAN 1 Tumpang / Sri Handayani Fajarwati

 

ABSTRAK Fajarwati, Sri Handayani. 2010. Pembelajaran Kontekstual Pola Pemberdayaan Berpikir Melalui Pertanyaan (PBMP) untuk Meningkatkan Kemampuan Berpikir Kritis dan Hasil Belajar Fisika Siswa Kelas X.1 SMAN 1Tumpang Tahun Ajaran 2009/2010. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Muhardjito, M.S, (II) Drs. Asim, M.Pd. Kata kunci : Pembelajaran kontekstual, PBMP, kemampuan berpikir kritis, hasil belajar fisika Berdasarkan observasi awal yang dilakukan di kelas X.1 SMAN 1Tumpang, diperoleh informasi metode yang digunakan oleh guru adalah metode klasikal dengan proses pembelajaran berpusat pada guru. Guru menyampaikan materi secara ceramah dan memberikan catatan, sedangkan siswa hanya mendengarkan sambil mencatat. Metode klasikal yang diterapkan oleh guru dapat menghambat kemampuan berpikir kritis siswa dalam memecahkan masalah-masalah fisika dalam kehidupan sehari-hari. Model pembelajaran yang cocok diterapkan untuk dapat menumbuhkan kemampuan berpikir kritis siswa adalah pembelajaran kontekstual pola pemberdayaan berpikir melalui pertanyaan (PBMP). Model pembelajaran PBMP memungkinkan siswa untuk mau mengajukan pertanyaan dan menjawab pertanyaan dalam proses belajar mengajar. Penelitian ini bertujuan untuk mendeskripsikan pembelajaran kontekstual pola pemberdayaan berpikir melalui pertanyaan (PBMP) sehingga dapat meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas X.1 di SMAN 1 Tumpang tahun ajaran 2009/2010. Jenis penelitian yang digunakan adalah penelitian tindakan kelas (PTK) dengan menggunakan pendekatan kualitatif. Kegiatan pembelajaran terdiri dari 2 siklus, setiap siklus terdiri dari kegiatan perencanaan, pelaksanaan, observasi dan refleksi. Pengambilan data dilakukan dengan observasi, tes dan catatan lapangan. Penelitian dilaksanakan di kelas X.1 SMAN 1 Tumpang dengan jumlah siswa 38 orang. Hasil analisis pada siklus I dan siklus II menunjukkan berpikir kritis dan hasil belajar fisika siswa kelas X.I SMAN 1 Tumpang mengalami peningkatan. Kemampuan berpikir kritis mengalami peningkatan dari 49,7 pada siklus I menjadi 76,82 pada siklus II. Peningkatan hasil belajar fisika siswa dapat dilihat dari meningkatnya aspek kognitif dari 74 pada siklus I menjadi 86 pada siklus II, aspek afektif 51,7% pada siklus I menjadi 79,4% pada siklus II, dan aspek psikomotorik dari 56% pada siklus I menjadi 80,9% pada siklus II. Peningkatan kemampuan berpikir kritis dan hasil belajar fisika siswa di atas dipengaruhi oleh peningkatan keterlaksanaan pembelajaran yaitu 69,7% pada siklus I menjadi 100% pada siklus II. Berdasarkan keterangan di atas, dapat disimpulkan bahwa pembelajaran kontekstual pola Pemberdayaan Berpikir Melalui Pertanyaan (PBMP) mampu meningkatkan kemampuan berpikir kritis siswa dan hasil belajar fisika siswa.

Kompetensi pedagogik guru pendidikan kewarganegaraan yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro / Dinar Cindarbumi

 

ABSTRAK Cindarbumi, Dinar. 2010. Kompetensi Pedagogik Guru Pendidikan Kewarganegaraan yang Bersertifikat Pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro. Skripsi, Program Studi S1 Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial Universitas Negeri Malang. Pembimbing I: Drs. H. Suparlan, M.Si. Pembimbing II: Hj. Yuni Astuti, SH, M.Pd. Kata Kunci: Kompetensi Pedagogik, Sertifikat Pendidik Pemberian sertifikat pendidik melalui program sertifikasi pendidik merupakan salah satu upaya yang ditempuh pemerintah untuk meningkatkan mutu pendidikan di Indonesia. Guru dipersyaratkan memiliki kualifikasi akademik minimal S-1 atau diploma IV yang relevan dan menguasai kompetensi sebagai agen pembelajaran. Salah satu kompetensi yang harus dipenuhi adalah kompetensi pedagogik. Tujuan penulisan ini adalah: (1) Untuk mendeskripsikan karakteristik guru profesional, (2) Untuk mendeskripsikan kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro dalam menyusun Rencana Pelaksanaan Pembelajaran, (3) Untuk mendeskripsikan kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro dalam pelaksanaan pembelajaran, (4) Untuk mendeskripsikan kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro dalam pelaksanaan evaluasi pembelajaran. Penelitian ini merupakan penelitian deskriptif kualitatif. Untuk mencapai tujuan tersebut, data dikumpulkan dengan cara observasi non partisipatif, studi dokumentasi serta wawancara. Teknik análisis data yang digunakan adalah model análisis interaktif. Penelitian dilakukan di SMK Kabupaten Bojonegoro dengan obyek penelitian adalah guru PKn yang bersertifikat pendidik, yaitu guru PKn di SMKN 1 Bojonegoro, SMKN 2 Bojonegoro, SMKN 3 Bojonegoro dan SMK PGRI 1 Bojonegoro. Dari hasil analisis menunjukkan bahwa, karakteristik guru profesional antara lain adalah harus memenuhi kualifikasi akademik S-1 atau D-IV, memiliki kompetensi yang dipersyaratkan, mampu menjadi teladan bagi siswa, mampu berkomunikasi dengan baik. Seorang guru harus mempunyai kepribadian yang baik karena tingkah laku guru akan ditiru oleh siswanya. Komunikasi merupakan cara seseorang berinteraksi dengan orang lain. Dengan memiliki kemampuan berkomunikasi yang baik, seorang guru dapat dengan mudah memberikan pengetahuan yang dimikilinya kepada siswa sehingga siswa dapat dengan mudah mencapai kompetensi yang diharapkan. Disamping memiliki kemampuan-kemampuan diatas, seorang guru wajib memiliki kompetensi pedagogik. Kompetensi pedagogik guru PKn yang bersertifikat pendidik di SMK Kecamatan Kota Kabupaten Bojonegoro sudah sangat baik. Rencana Pelaksanaan Pembelajaran telah tersusun berdasarkan kriteria yang ditentukan. Penyusunan tujuan pembelajaran tidak menimbulkan penafsiran ganda. Pemilihan materi ajar sesuai dengan tujuan pembelajaran. Skenario pembelajaran tercermin tiap langkah mulai dari awal, inti dan penutup. Pelaksanaan pembelajaran sesuai dengan skenario pembelajaran. Kegiatan pembelajaran diawali dengan mempersiapkan siswa dan melakukan kegiatan apersepsi. Dan diakhiri dengan kegiatan refleksi dan penarikan kesimpulan. Evaluasi hasil belajar dilaksanakan untuk mengecek pemahaman siswa. Instrumen-instrumen penilaian disusun untuk mempermudah proses penilaian terhadap siswa dan untuk mengetahui tingkat kesulitan siswa. Berdasarkan hasil penelitian ini, dapat disarankan kepada para guru untuk mempersiapkan diri menuju program sertifikasi pendidik agar pemberian sertifikat pendidik dapat menjadi tolok ukur kemampuan guru dalam melaksanakan tugas sehari-hari. Selain itu untuk bagi para peneliti yang ingin melakukan penelitian agar dilakukan penelitian lebih lanjut misalnya mengenai kompetensi profesional, sosial atau kepribadian. Karena kompetensi-kompetensi tersebut juga sangat menentukan kemajuan pendidikan di negara Indonesia.

Pelaksanaan Pembuktian Tindak Pidana Perkosaan Dalam Sidang di Pengadilan Negeri Malang Oleh Catur Nurharyanti

 

Perkosaamn erupakanb entukk ejahatany ang selalum endapast orotand alammasyarakaPt.e ngadilanN egeri sebagait empat untuk mencan keadilan,s eringkalidituntut untuk dapat menuntaskan kasus perkosaan dengan tidak menempatkanpelakud an korban dalam posisi yang berat sebelah.D alarn persidanganp erkaraperkosaanh,a kims eringd ihadapkanp adap ermasalahayna ngc ukupb eraty akni padatahap pembuktian. Tujuan dari penelitian ini adalah untuk mengkaji (l) prosespersidanganp erkara perkosaand i Pengadilan,( 2) Upaya penuntutanp erkaraperkosaano leh Penuntut Umum, (3) Alat-alat bukti yang digunakan dalampembuktianp erkarap erkosaan(,4 ) Kendala-kendalaya ng di hadapih akim dalampembuktiatnin dakp idanap erkosaand alams idangd i pengadrlan. Metoded alam penelitiani ni menggunakapne ndekatann ormatify uridis danlenisnya adalah studi kasus. Kegiatan pengumpulan data dilakukan denganmenggunaliamn etodew awancarad an dokumentasiA. nalisa data yang digunakanyaitu metoded eskriptif,s edangkanm odel analisad ata melalui reduksi data, sajiandata dan penarikan kesimpulan. Untuk menjaga kesahihan data, penelitian inidilakukans ecarat eliti dan cermat.p erpanjangakne hadirand i lokasi penelitiand ankegiatatnr iangulasi. Hasil penelitianm enunlukkanb ahwa prosesp ersidanganp erkarap erkosaanpadad asarnyas amad enganp rosesp ersidanganp erkarap idanal ainnya,h anyas aiadalam perkarap erkosaanp rosesp ersidangannybae rsifat tertutupm engingatk asusperkosaanm erupakana ib yang menyangkuht argad in wanita sehinggati dak layakjika diketahuio leh publik. Dalam upayap enuntutans, eorangp enuntutu mum harusdapatm embuktikand akwaannyad enganm embuktikanu nsur-unsuyr ang ada dalamtindak pidanap erkosaany aitu (l) unsurb arangs iapa,( 2) unsurd engartk ekerasanataua ncamank ekerasaan(3, ) unsurm emaksap erempuanya ngb ukani strinyad an (4)unsurb ersetubuhd engand ia yangd iperolehb erdasarkafna kta yangt erungkapd alamprosesp emeriksaana lat-alabt ukti. Alat-alatb ukti yangd igunakand alamp embuktiantindak pidanap erkosaanb iasanyad apat berupak eterangans aksi, keterangana hli,keterangant erdakwa, dan barang-barangb uk1i. Alat bukti yang diperiksa dipersidangan tersebut nantinya akan memberikan petunjuk bagi hakim tentangkebernarank ejadianp erkosaanD. alam membuktikanti ndak pidanap erkosaant,i dakjarangh akim menghadapbi anyakk endalaK. endala-kendaltae rsebubt iasanyab erasaldari saksi, saksi korban, ahli dan terdakwa, dimana kendala tersebut akanmenghambajat lannyap rosesp emeriksaadni Persidangan.

Penggunaan tutor sebaya untuk meningkatkan hasil belajar ilmu pengetahuan sosial siswa kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan / Sodikin

 

ABSTRAKSI Sodikin. 2010. Penggunaan Tutor Sebaya untuk Meningkatkan Hasil Belajar Ilmu Pengetahuan Sosial Siswa Kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan. Skripsi, Jurusan S 1 Pendidikan Guru Sekolah Dasar FIP Universitas Negeri Malang. Pembimbing (1). Drs I.Wayan Sutama, M.Pd, (2). Dra, Sri Sugiharti M.Pd Kata Kunci : Tutor Sebaya, Hasil Belajar IPS, SD Berdasarkan observasi terhadap pembelajaran IPS dan hasil wawancara dengan guru kelas serta beberapa siswa, dapat diketahui bahwa selama ini pembelajaran IPS di SDN Susukanrejo I masih berpusat pada guru, sehingga siswa cenderung pasif. Akibatnya hasil belajar yang dicapai tidak dapat memenuhi SKM yang ditentukan. Untuk itu perlu dilakukan Penelitian Tindakan Kelas dengan menggunakan tutor sebaya. Tujuan penelitian ini adalah (1) Mendeskripsikan penerapan tutor sebaya dalam meningkatkan hasil belajar ILmu Pengetahuan Sosial materi peninggalan sejarah di Indonesia siswa kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan dan (2) Mendeskripsikan penggunaan tutor sebaya dalam meningkatkan hasil belajar Ilmu Pengetahuan Sosial materi peninggalan sejarah di Indonesia siswa kelas IV SDN Susukanrejo I Kecamatan Pohjentrek Kabupaten Pasuruan.Rancangan dalam penelitian ini menggunakan Penelitian Tindakan Kelas (PTK), model Kemmis dan Taggart melalui 2 siklus (siklus I dan siklus II) dan 2 kali pertemuan. Dalam pelaksanaannya, pembelajaran ini dibagi menjadi beberapa tahap yaitu : (1) pra tindakan, yaitu dengan memberikan pre tes sebagai pratindakan yang bertujuan untuk mengetahui data nilai siswa yang mengalami kesulitan belajar, (2) siklus satu, yaitu melaksanakan pembelajaran dengan menggunakan tutor sebaya dan siklus ke dua yaitu melaksanakan pembelajaran dengan menggunakan tutor sebaya yang disempurnakan dari kekurangan yang dialami pada siklus I, atau hasil refleksi dari siklus I. Hasil penelitian ini adalah pada siklus I ketuntasan belajar individu mencapai 56,6%, yang berarti meningkat sebesar 16,7% dari sebelum menggunakan tutor sebaya melalui pre tes pada pra tindakan yang mencapai 23,3%. Selanjutnya pada siklus II ketuntasan individu meningkat menjadi 87%, dan dinyatakan berhasil tuntas. Dengan demikian disimpulkan bahwa pembelajaran tutor sebaya dapat meningkatkan hasil belajar IPS siswa kelas IV SDN Susukanrejo I kecamatan Pohjenytrek kabupaten Pasuruan. Disarankan kepada guru hendaknya menggunakan tutor sebaya khususnya dalam mata pelajaran IPS. Karena menarik minat siswa dalam belajar, sehingga mudah memahami materi dan tujuan pembelajaran akan tercapai secara optimal. Bagi peneliti lain, penelitian ini dapat dijadikan bahan pertimbangan dan acuan dalam penelitian selanjutnya, sehingga hasilnya dapat dijadikan pedoman dan pengembangan profesi dan meningkatkan hasil belajar siswa.

Penerapan model inkuiri terbimbing pada pembelajaran fisika pokok bahasan kalor dan asas Black untuk meningkatkan hasil belajar siswa kelas X-5 SMAN 02 Batu tahun ajaran 2009/2010 / Dewi Khoirina

 

ABSTRAK Khoirina, Dewi. 2010. Penerapan Model Inkuiri Terbimbing Pada Pembelajaran Fisika Pokok Bahasan Kalor Dan Asas Black Untuk Meningkatkan Hasil Belajar Fisika Siswa Kelas X-5 SMAN 02 Batu Tahun Ajaran 2009/2010. Skripsi, Jurusan Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Wartono, M.Pd, (II) Drs. Mudjihartono Kata Kunci: Model Inkuiri Terbimbing, Hasil Belajar. Berdasarkan observasi awal pada kelas X-5 SMAN 02 Batu nampak bahwa pembelajaran masih terpusat pada guru, siswa tidak dilibatkan secara aktif dalam kegiatan pembelajaran. Siswa pada umumnya hanya aktif dalam mengerja-kan tugas yang biasanya dikerjakan secara individu. Hal ini berarti partisipasi siswa dalam kegiatan pembelajaran dirasa masih kurang karena pembelajaran masih terpusat pada guru, hasil belajar siswapun masih banyak yang dibawah KKM, hal ini disebabkan metode pembelajaran yang sering digunakan oleh guru adalah metode ceramah, pemberian latihan soal dan tugas. Salah satu model pembelajaran yang dapat memperbaiki proses pembelajaran di kelas X-5 tersebut adalah model inkuiri terbimbing. Model inkuiri terbimbing (guided inquiry) merupakan kegiatan inkuiri dimana masalah dikemukakan oleh guru atau bersumber dari buku teks kemudian siswa bekerja untuk menemukan jawaban terhadap masalah tersebut dibawah bimbingan dari guru. Penelitian bertujuan untuk menjawab pertanyaan: (1) Bagaimana keterlaksanaan proses pembelajaran dengan menggunakan model inkuiri terbimbing siswa kelas X-5 SMAN 02 Batu. (2) Apakah hasil belajar siswa kelas X-5 SMAN 02 Batu meningkat setelah diterapkan model inkuiri terbimbing?. Subyek penelitian adalah siswa kelas X-5 SMAN 02 Batu tahun ajaran 2009/2010 dengan jumlah 39 siswa. Penelitian ini menggunakan pendekatan kua-litatif dengan jenis penelitiannya adalah penelitian tindakan kelas dengan dua siklus. Teknik analisis data yang digunakan untuk hasil belajar aspek afektif dan aspek psikomotorik menggunakan angka 1-3 dan keterlaksanaan model inkuiri Terbimbing menggunakan persentase. Untuk hasil belajar aspek kognitif diguna-kan rentang 0-100 dari hasil tes siswa. Hasil penelitian menunjukkan bahwa pembelajaran dengan model inkuiri terbimbing telah terlaksana dengan baik, pada siklus I persentasenya 90,33% dan dapat dikategorikan baik, pada siklus II persentasenya 98,33% dan dapat dikate-gorikan sangat baik. Pembelajaran dengan model inkuiri terbimbing dapat meni-ngkatkan Hasil belajar siswa yang terdiri dari: (a) Hasil belajar aspek kognitif dari rata-rata sebesar 44,3 sebelum tindakan meningkat menjadi 61,9 pada siklus I dan meningkat menjadi 68,9 pada siklus II. (b) Hasil belajar aspek afektif meningkat dari siklus I sebesar 67,86 menjadi 77,94 pada siklus II. (c) Hasil belajar aspek psikomotorik meningkat dari siklus I sebesar 71,4 menjadi 78,18 pada siklus II Berdasarkan hasil penelitian di atas dapat disimpulkan bahwa pembelaja-ran dengan model inkuiri terbimbing dapat meningkatkan hasil belajar fisika sis-wa kelas X-5 SMAN 02 Batu

Perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan Universitas Negeri Malang / Rosyidah Nur Hidayati

 

ABSTRAK Hidayati, Rosyidah Nur. 2010. Perbedaan Motivasi dan Prestasi Belajar antara Mahasiswa Penerima dan Bukan Penerima Beasiswa di Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan Universitas Negeri Malang. Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (I) Dra. Mustiningsih, M.Pd, (II) Dr. Bambang Budi Wiyono, M.Pd Kata kunci : motivasi, prestasi belajar, beasiswa Motivasi belajar merupakan daya penggerak aktif (dorongan) bagi mahasiswa jurusan AP FIP UM yang mampu memberikan semangat, gairah, dan keinginan untuk melakukan suatu kegiatan belajar. Dalam motivasi belajar juga terkandung adanya harapan, kebutuhan, tujuan, dan sasaran untuk meningkatkan efektifitas belajar. Keadaan jiwa inilah yang mengaktifkan, menggerakkan, menyalurkan, dan mengarahkan sikap serta perilaku mahasiswa kepada tujuan belajar. Motivasi belajar yang dimiliki oleh setiap mahasiswa berbeda-beda, hal ini dapat dipengaruhi oleh berbagai faktor, baik faktor internal maupun eksternal. Salah satu faktor eksternal untuk memotivasi mahasiswa diberikan dalam bentuk beasiswa. Dengan diberikannya beasiswa diharapkan motivasi belajar mahasiswa akan terus meningkat. Selain itu, diharapkan dengan semakin meningkatnya motivasi belajar mahasiswa akan memberikan dorongan untuk meningkatkan prestasi belajarnya. Rumusan masalah penelitian ini adalah: (1) seberapa tingkat motivasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM?, (2) bagaimanakah prestasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM?, (3) adakah perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM?. Tujuan penelitian ini adalah: (1) untuk mengetahui seberapa tinggi motivasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM, (2) untuk mengetahui prestasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM, (3) untuk mengetahui perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM. Rancangan penelitian ini menggunakan metode deskriptif komparatif, yaitu mendeskripsikan dan menemukan perbedaan unsur-unsur variabel motivasi dan prestasi belajar antara penerima dan bukan penerima beasiswa. Responden dalam penelitian sebanyak 122 orang. Pengumpulan data dilakukan dengan menyebarkan angket tertutup kepada mahasiswa yang telah ditetapkan sebagai responden penelitian. Setelah data terkumpul, kemudian dilakukan analisis dengan menggunakan analisis deskriptif dan uji manova. ii Adapun hasil penelitian menunjukkan bahwa: pertama, tingkat motivasi belajar mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM termasuk dalam kualifikasi tinggi. Kedua, prestasi belajar mahasiswa penerima dan bukan penerima beasiswa termasuk dalam predikat sangat memuaskan. Ketiga, terdapat perbedaan motivasi dan prestasi belajar antara mahasiswa penerima dan bukan penerima beasiswa di jurusan AP FIP UM. Berdasarkan hasil penelitian tersebut, maka dapat diajukan saran kepada: (1) Pihak Universitas Negeri Malang (UM), diharapkan dapat dijadikan pertimbangan kebijaksanaan dalam hubungan dengan pemberian beasiswa kepada mahasiswa yang dapat meningkatkan motivasi dan prestasi belajar mahasiswa, (2) Ketua Jurusan AP FIP UM, sebagai bahan informasi untuk meningkatkan upaya jurusan dalam menciptakan faktor-faktor yang dapat mendukung motivasi dan prestasi belajar mahasiswa, (3) Dosen Jurusan AP FIP UM, diharapkan dapat membantu meningkatkan motivasi mahasiswa yang memiliki motivasi belajar sedang dan rendah dengan cara menciptakan proses belajar yang lebih aktif, (4) Mahasiswa Jurusan AP FIP UM, untuk tetap dapat mempertahankan serta terus meningkatkan motivasi dan prestasi belajarnya, (5) Peneliti lain, agar dapat mengembangkan penelitian lain yang sejenis dengan lebih memperluas pembahasan pada pokok permasalahan serta variabelnya.

Pelaksanaan Perlindungan Hukum Terhadap Hak-Hak Pekerja/Buruh Wanita Dalam Bidang Keselamatan Dan Kesehatan Kerja Ditinjau Dari UU No. 13 Tahun 2003 Tentang Ketenagakerjaan (Studi Pada PT. Sumber Mas Indah Plywood Gresik) Oleh Wina Desika Indra Cahyati

 

Pekerja/buruwh anitar iterupakana setb erhargay angk emampuannytaid ak bolehd isepetekanta, pi dalamk enyataannypae kerja/buruhw anitas eringk ali tidak mendapatet mpaty angs esuadi enganh ak-haknyas ebagapi ekerja.B erbagabi entuk tindakk etidakadilanb anyakt erjadi padap ekerja/buruwh anita,j aminank eselamatan dank esehatakne rjay angd ibuato leh pemerintahm elaluiU ndang-undang Ketenagakerjaadna lamp elaksanaannydai perusahaabne lums epenuhnybae rjalan, danh al ini mengakibatkasne makinle mahnyap osisip ekerja/buruwh anitad alam perusahaaPn.e nelitianin i bertujuanu ntuk mengetahubi agaimanap elaksanaan pertindungahnu kumt erhadapp ekerja/buruwh anitak hususnyad alamb idang keselamatadna nk esehatakne rja dalamP T. SumberM as IndahP lywood.P enelitian ini termasukjenisp enelitians tudik asus karenap enelitianh anyad ilakukand i satu perusahaaunn tuk mencaria pakahp elaksanaand i lapangand alam hal ini di perusahaasne suaai taut idak sesuadi engank etentuany angd imaksudU ndang-undang No. I 3 Tahun2 003 tentangK etenagakerjaanT. ehnik pengumpuland atad ilakukan denganm enggunakanm etodeo bservasi,w lwancara, dan dokumentasiT. ehnik analisisd atay angd igunakana dalahm etodea nalisisk ualitatifdeskriptif. Hasil penelitianm enunjukkanb ahwap erlindunganh ukumt erhadaph ak-hak pekerjaw anitad alamP T. SumberM as IndahP lywoods ebagianb esars udah dilaksanakasne suadi enganU ndang-undanNgo . 13T ahun2 003t entang Ketenagakerjaankh ususnyad alam bidangk eselamatand an kesehatank erja, kesemua aturand i perusahaain i sudahd ibuatd alamb entuka turant ertulisy angd ituangkan dalamp erjanjiank erjab ersama(P KB) yangd ibuata ntarap engusahdae ngan pekerja/buruyha ngd iwakili oleh SPSIs ebagaoi rganisasrie smip eke{a/buruh. Bentukp erlindunganya ngb erkaitand enganK eselamatadna nK esehataKn erja( K3) antarala in adalah( l) perlindungante rhadapjamk erjad anjam istirahat( 2) perlindungatne rhadapk erjal embur( 3) perlindunganp engupaha(n4 ) perlindungan terhadapke sehatarne produkspi ekerjaAuruhw anitay aitu cuti haidd anc uti hamil (5) perlindungatne rhadapk esejahteraapne kerjad anjaminans osialt enagak erja( 6) pembentukamna najemenke selamatadna nk esehatanke rjad alamp erusahaan. Berdasarkahna silp enelitiadna padt isampaikabne berapsaa rany aitu( l) hendaknypae merinta.h"f ugui pihaky angb erwerrandsa lamm enetapkaantu ran dapabt ertindatke gasp uOufr "ngu'ul"V tlg.t:d"lt,jelis-jetatsid akm elaksanakan ketentuasne pertyl ango trnukttidd alamU U No l3 Tahun2 003t entang Ketenagakerjaunp.tuznl itjit"t"f"-utan dank esehatakne rjas ebagabia danre smi vansa dad alamp erusail;;t;; dapamt elaksanaktaung asnysae suadi engan ffiffir* .;"i"" pil"fu"n pekerja/burautahu pupne ngusa(h3a)b erkaitadne ngan waktuk erjap adam atamh aii oln jui.t remburp, "tiinaunginte lha!1np ekerja/buruh harusle bihd itingkatkan "g"r f".i"*",* danL esehatankerjsag lalut erjagak' arena ;;garm'Jn.p*p Et"tJuib;i;l vangu ttetju berlebihahna nvaa kanm enurunkan produktifitakse ryay ang """liiv""cf"p"t merugikapni hakp engusahsae ndin'

Pengembangan latihan dasar defense bola basket menggunakan permainan tradisional gobaksodor pada ekstrakurikuler di SMK Negeri 5 Malang / Kusrianto Lukman P Saputro

 

ABSTRAK Saputro, K.L.P. 2010. Pengembangan Model Latihan Dasar Defense Bolabasket Menggunakan Permainan Gobaksosor Pada Ekstrakurikuler Di SMK Negeri 5 Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (1) Dr. Saichudin, M.Kes, (2) Drs. Oni Bagus Januarto, M.Kes. Kata kunci: pengembangan, model latihan, dasar defense bolabasket menggunakan permainan tradisional gobaksodor. Dalam permainan bolabasket terdapat 5 teknik dasar salah satunya teknik dasar defense. Teknik dasar defense adalah teknik bertahan untuk menghalangi atau menghambat pemain menyerang memasukkan bola untuk mencetak poin dalam area basket pemain bertahan (Bayu, 2009). Dasar defense adalah kunci pertahanan individu dan tim secara keseluruhan. Oleh karena itu, semua pemain dilapangan harus baik dalam menguasai dasar defense. Latihan dasar defense memang sangat menjenuhkan bagi pemula, tetapi itu salah satu teknik dasar yang harus diberikan, dengan menggunakan kombinasi dalam bentuk permainan seperti gobaksodor pemain tidak akan merasa jenuh dan dasar defense juga akan terbentuk.Berdasarkan hasil surve dan observasi analisis kebutuhan di SMK Negeri 5 Malang khususnya peserta ekstrakrikuler bolabasket diketahui bahwa kurangnya pengembangan variasi model latihan teknik dasar defense. Penelitian ini bertujuan mengembangkan model latihan dasar defense menggunakan permainan tradisional gobaksodor untuk siswa putra dan putri yang mengikuti kegiaatan ekstrakurikuler di SMK Negeri 5 Malang. Sehingga siswa dapat dengan mudah mempelajari latihan dasar defense dengan baik dan benar serta dapat menambah pengetahuan tentang bermain bolabasket dan bisa diterapkan secara maksimal dalam pertandingan. Model pengembangan dalam penelitian ini menggunakan Research and Development yang dikemukakan oleh Borg dan Gall, yang telah dimodifikasi oleh peneliti. Prosedur penelitian pengembangan model latihan dasar defense menggunakan permainan tradisional gobaksodor ini adalah sebagai berikut: (1) kegiatan pengumpulan informasi yakni, penyebaran kuesioner, (2) mengembangkan produk awal (peneliti mengembangkan buku model latihan dasar defense menggunakan permainan tradisional gobaksodor), (3) kegiatan evaluasi ahli (dua ahli pengembangan bolabasket dan satu ahli kepelatihan bolabasket), (4) revisi produk pertama (sesuai tinjauan para ahli) (5) coba tahap I (kelompok kecil) dilakukan dengan melibatkan 12 subjek dengan menguji cobakan revisi produk pertama (6) kegiatan uji coba tahap II (kelompok besar) dengan melibatkan 24 subjek, (7) Hasil akhir, produk pengembangan model latihan dasar defense bolabasket menggunakan permainan tradisional gobaksodor pada ekstrakurikuler di SMK Negeri 5 Malang. Lokasi penelitian ini dilakukan di SMK Negeri 5 Malang. Pengumpulan data untuk evaluasi ahli berupa kuesioner terdiri dari: (1) dua orang pengembangan bolabasket dan (2) satu orang kepelatihan bolabasket. Untuk mendapatkan data uji coba kelompok kecil dan uji coba kelompok besar peneliti ii menggunakan metode pengumpulan data berupa instrumen yang disajikan dalam bentuk kuesioner/angket, untuk: (1) uji coba kelompok kecil sebanyak 12 siswa, (2) uji coba kelompok besar sebanyak 24 siswa. Hasil penelitian model pengembangan diperoleh data sebagai berikut: (1) ahli bolabasket yaitu 97,03% (baik), (2) Uji coba tahap I (kelompok kecil) yaitu 96.38 % (baik), (3) Uji coba tahap II (kelompok besar) yaitu 98.19% (baik). Dari hasil penelitian ini berupa pengembangan model latihan dasar defense bolabasket menggunakan permainan tradisional gobaksodor.Diharapkan dapat diuji cobakan kepada lingkup yang lebih luas dan dapat disosialisasikan kepada sekolah lain dan perguruan tinggi sehingga dapat digunakan sebagaimana mestinya. Hasil pengembangan ini hanya sampai tersusun sebuah produk, belum sampai pada tingkat efektivitas produk yang dikembangkan, jadi sebaiknya dilanjutkan pada penelitian mengenai efektivitas produk yang dikembangkan. Produk yang dihasilkan diharapkan dapat bermanfaat bagi pengguna produk, peneliti sendiri, dan peneliti lain untuk dikembangkan ke arah lebih lanjut.

Peranan Yayasan Lembaga Konsumen Dalam Melindungi Kepentingan Hukum Konsumen (Studi Yayasan Lembaga Konsumen Malang) Oleh Tutik Haditama

 

ABSTRAK Aditamq Tutik. 2003. Peranan YayasanL embagaK onsumend alam Melin&mgi Kepentingan Hulnm Konsumen (studi di Yalnsan Lembaga Konsumen ualang).- slsipsi, JurusanP endidikanP ancasilad an KewarganegaraaFnIP UniverlitasN egeriM alangP. embimbing(l:) Drs.M. YuhdiB atubaraS .H., M.H.( 2) DrsE di SuhartonSo. H.,Lf.Pd' Kata kunci: YayasanL embagaK onsumenk' epentingahnu kum,k onsumen' Pembangunanna sionalb ertgjuanu ntuk mewujudkans uatum asyarakaat dil dan makmur yang merata materiai dan spiritual dalag era demokrasi ekonomi berdasarkan Pancasila dan Undang-Undang Dasar 1945. Pernbangunan PerekonomiaNn asionalp ada efa globalisashi arus dapotm urdukungt umbuhnya dunia usahas ehinggam impu menghasilkabne ranekara gamb arangd an/atauja sa yang memiliki kandungarrte knologi yang dapat meningka*an. kescjahteraan inasyarakasCe kaligusm andapatkakne pastianh ukuma tasb arangd an/atauja say eng diperolehd ari perdagengatna npam engakibatkakne rugrank onsurnetD alamI J[JD 1945t elaha dalaminaniernadahpa k konsumenya itu dalamp €mbt*aanI JUD 1945 alinea4 dand al-anP asal27U UO tq+Sa yat2 . Melalui Undang-UndanNgo .8T ahun 1999 dibarapkan menjadi payung integrasi dari seluruh instrumenlketentuan perlindunganh ukum konsuneny ang telah ada sebelumnyaya ng tersebard alam iprbagar instgmen hukum.B erbagaiu payap €merintahd an fumbaga Konsurnen Swada-yMa asyarakatd ilakukan unuk melindungih {-h"k konsumens ekaligus pernteidayaank onsumen.P erananP emerintahd an LSM dalam hal ini sangat pentingu, ntuki tu diadakanp enelitiante ntangP EranaYn ayasanL embagaK onsumen dalam-melindungkie pentinganh ukumk onsumend i Yayasanl- embap Konsumen Malan-Pg.enelitian ini bertujuan mengetahui gambaran umum Yayasan Lembaga KonsumenM alang,j enis-jenisp erkarap engaduadni YayasanL onbagpK onsumen Malang, p"ranari yayasan Gmbaga Konsumen Malang dalam melindqng tepentinganh ukumk onsumenp, ennasalahan-permasalahan;dniahnagd apYi ayasan HhUag1fonsumenM alangd alamm elindungki epenting3hnu kumk onsumens,e rta opuyu-ipayu yang dilatcukan Yayasan Irmbaga Konsumen Malang untuk memecahkamna salahp erlindungahnu kumk onsumen. penelitian ini -termasuk jenis penelitian sosiologisy undis atau penelitian hukume mpiris( nond oktrinal)y angm engkajpi emnans uatule mbagas ecaran yatad i lapangand,r ogaop endekatsknu alitatif.T eknikp engsmpuladna ta_dil.akukdaenn gan *ingE1rat an-rneioa"o bservasiw, awancarad, an dokumentasiS. edangkatn€ knik analisisd atay angd igunakana dalahte knika nalisisk ualitatifdeslcriptif.

Pengaruh faktor fundamental dan risiko pasar terhadap tingkat underpricing pada penawaran umum perdana di Bursa Efek Indonesia (periode 2006-2008) / Mutia Shorea Ovata

 

ABSTRAK Ovata, Mutia Shorea. 2010. Pengaruh Faktor Fundamental dan Risiko Pasar terhadap Tingkat Underpricing pada Penawaran Umum Perdana di Bursa Efek Indonesia (Periode 2006-2008). Skripsi, Jurusan S1 Akuntasi Universitas Negeri Malang. Pembimbing (1) Sawitri Dwi Prastiti, M.Si, S.E., Ak, Pembimbing (2) Dr. Sunaryanto, Drs., M.Ed. Kata kunci: IPO, Underpricing, Faktor Fundamental, Nilai Penawaran, Financial Leverage, Risiko Pasar, Rata-Rata Kurs, IHSG. Initial Public Offering (IPO) tidak terlepas dari fenomena underpricing, dimana harga saham yang ditawarkan pada pasar perdana justru lebih rendah dibandingkan harga saham ketika diperdagangkan di pasar sekunder. Fenomena ini terjadi hampir di seluruh pasar modal dunia termasuk Indonesia. Berbagai penelitian telah dilakukan untuk menemukan faktor-faktor penyebabnya namun hasilnya berbeda-beda. Oleh karena itu, penelitian ini bertujuan untuk menganalisis kembali faktor-faktor fundamental dan risiko pasar, yang diperkirakan mempengaruhi tingkat underpricing pada saham-saham perusahaan, yang ditawarkan pada penawaran umum perdana di Bursa Efek Indonesia. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh dari faktor fundamental yang diproksikan dengan nilai penawaran dan financial leverage serta risiko pasar yang diproksikan dengan rata-rata kurs dan IHSG terhadap tingkat underpricing. Pengambilan sampel dilakukan dengan menggunakan teknik purposive sampling, yaitu teknik penemuan sampel dengan pertimbangan tertentu yang bertujuan untuk mendapatkan sampel yang representatif. Dengan demikian sampel dalam penelitian ini adalah seluruh perusahaan yang melakukan IPO pada periode 2006-2008 dan mengalami underpricing. Data yang digunakan adalah data sekunder. Teknik analisis data yang digunakan dalam penelitian ini adalah analisis regresi linier baik berganda maupun sederhana. Hasil analisis dalam penelitian ini menunjukkan bahwa secara simultan variabel independen dalam penelitian ini tidak memberikan pengaruh yang signifikan terhadap tingkat underpricing, sedangkan secara parsial hanya variabel financial leverage yang berpengaruh signifikan terhadap tingkat underpricing. Hal ini disebabkan investor lebih mempercayai variabel-variabel lain untuk dianalisis baik dalam faktor fundamental perusahaan maupun risiko pasar dalam pengambilan keputusan investasinya di pasar primer. Berdasarkan hasil penelitian ini, penelitian selanjutnya disarankan untuk menggunakan beberapa variabel lain yang diduga memiliki pengaruh lebih besar terhadap tingkat underpricing. Beberapa variabel tersebut diantaranya reputasi underwriter, prosentase penawaran saham, ukuran perusahaan, serta profitabilitas perusahaan selama minimal 2 tahun sebelum IPO. Sedangkan untuk risiko pasar adalah kondisi ekonomi dalam negeri, tingkat inflasi dan juga tingkat suku bunga.

Pengembangan bahan ajar IPA terpadu berbasis salingtemas dengan tema perubahan partikel dan wujud zat oleh kalor untuk SMP/MTs kelas VII / Anis Fahrurotul Futihat

 

ABSTRAK Futihat. Anis F. 2010. Pengembangan Bahan Ajar IPA Terpadu Berbasis SALINGTEMAS dengan Tema Perubahan Partikel dan Wujud Zat oleh Kalor untuk SMP/MTs Kelas VII. Skripsi. Jurusan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Lia Yuliati, M.Pd, (II) Drs. I Wayan Dasna, M.Si, M.Ed, Ph.D. Kata kunci: bahan ajar IPA terpadu, perubahan partikel dan wujud zat, SALINGTEMAS. Salah satu kebijakan pemerintah dalam meningkatkan kualitas pendidikan di Indonesia adalah perubahan kurikulum. Kurikulum yang berlaku di Indonesia saat ini adalah Kurikulum Tingkat Satuan Pendidikan (KTSP) yaitu kurikulum yang ide pengembangannya diletakkan pada posisi paling dekat dengan pembelajaran. KTSP menuntut substansi mata pelajaran IPA pada SMP sebagai IPA Terpadu antara bidang kajian Fisika, Kimia, dan Biologi. Bahan ajar yang beredar di masyarakat saat ini masih bahan ajar yang terpisah antara ketiga bidang kajian tersebut. Penelitian ini bertujuan untuk mengembangkan bahan ajar IPA Terpadu dan mengukur kelayakan pengembangan bahan ajar IPA Terpadu. Penelitian ini merupakan penelitian pengembangan yang menggunakan desain pengembangan Borg and Gall (1983). Prosedur pengembangan terdiri atas 4 tahapan, yaitu studi pendahuluan, pengembangan draf produk, penilaian draf produk, dan revisi draf produk. Draf hasil pengembangan diuji kelayakan oleh 3 orang reviewer yaitu dari dosen dan guru. Uji keterbacaan draf dilakukan oleh 7 orang siswa SMPN 6 Blitar. Penilaian uji kelayakan produk pengembangan menggunakan angket tertutup. Data kuantitatif uji kelayakan dianalisis dengan teknik rerata sedangkan data kualitatif berupa tanggapan, saran, dan kritik digunakan sebagai pertimbangan dalam melakukan revisi produk bahan ajar. Hasil pengembangan ini berupa bahan ajar IPA Terpadu untuk siswa SMP/ MTs Kelas VII dengan tema “Perpindahan Kalor dan Akibat yang ditimbulkannya” yang mencakup bidang kajian Kimia dan Fisika. Bahan ajar hasil pengembangan dalam bentuk teks 75 halaman yang terdiri dari bagian pendahuluan dan bagian isi. Bagian pendahuluan meliputi halaman muka (cover), kata pengantar, daftar isi, daftar gambar, daftar tabel, SK KD dan indikator, dan peta konsep. Bagian isi meliputi peta konsep untuk materi yang dibahas, uraian materi, rangkuman per subbab, contoh soal, latihan mandiri, tugas individu, tugas kelompok, panduan kegiatan eksperimen, latihan, rangkuman, glosarium, evaluasi, kunci jawaban, dan daftar pustaka. Hasil uji kelayakan bahan ajar yang dikembangkan mempunyai skor total rerata sebesar 3,16 dan termasuk dalam kriteria layak. Hal ini berarti bahwa bahan ajar hasil pengembangan dapat ditindaklanjuti melalui kegiatan uji coba di lapangan.

Proses Pengukuhan Status Warga Negara Asing Menjadi Warag Negara Indonesia (Studi Kasus di Pengadilan Negeri Bangkalan) Oleh Sonny Sutanto

 

Penelitian ini bertujuan untuk menggambarkan proses pengukuhan satus warga negara asing menjadi warga negara Indonesia. Secara khusus penelitian ini bertujuan untuk mengetahui : (l) Untuk mengetahui syarat-syarat yang harus dipenuhi oleh seorang warga negara asing untuk memperoleh status sebagai warga negaral ndonesia.( 2) Untuk mengetahuip rosesp engalihans tatusk ewarganegaradni lndonesia, dari status warga negara asing hingga dikukuhkan sebagai warga negara Indonesia.( 3) Untuk mengetahuih ak dan kewajiban, serta upaya-upayay ang harus dilakukan seorang warga negara asing setelah menjadi warga negara Indonesia. (4) Untuk mengetahuik endala-kendalay ang dihadapi dalam prosesp engukuhans tatus warga negara asing menjadi warga negara lndonesia. Rancanganin i menggunakand eskriptif kualitatif dan jenis penelitian adalah studi kasus. Kegiatan pengumpulan data adalah (1) Wawancara. Yaitu dengan melaksanakanta nya jawab secara langsungd engan respondenu ntuk memperoleh informasi yang diperlukan. (2) Kajian Pustaka. Kajian tersebut mengenai peraturan perundang-undangayna ng membahas tentang kewarganegaraanIn donesia, serta literaturJiteratur yang berhubungan dengan penelitian im. (3) Dokumentasi. Yaitu dengan menelusuri dan mengumpulkan informasi dan dokumen yang berkaitan dengan penulisan skripsi ini. Untuk menjaga keabsahan data penelitian dilakukan secara teliti dan cermat, perpanjangan kehadiran peneliti, trianggulasi, Pengecekan data terakhir dengan melacak dari hasil analisi data serta meminu paftisipan (informan) untuk mengecek kebenaran temuan sehingga hasil penelitian nantinya dapatd ipertangungja wabkan kebenarannya. Hasilp enelitianm enunjukkanp rosesp ewarganegaraadni I ndonesiau mumnya dan di PengadilanN egeri Bangkalank hususnyam enggunakanK EPPRESR I No. 13/ tahun 1980 tentang tata cara penyelesaianp ermohonank ewarganegaraaRn epublik lndonesia. Namun dalam pelaksanaannya sering mengalami kendala, hal ini disebabkanU ndang-UndanNg o.62l tahun 1958 sudahk etinggalanja man sehingga banyak sekali istilah yang telah tidak dipakai lagi. Berdasarkapne mbahasapne nelitianb ahwad alamK EPPRESR I No.13/t ahun 1980 yang mengaturp rosesp ewarg€megaftEdna n Undang-UndangN o. 62l tahun 1958, terlalu banyaknya instansi-instansi yang menangani masalah proses

Penerapan media tiga dimensi KIT untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN PAsinan II Kecamatan Lekok / Supaedah

 

ABSTRAK Supaedah. 2010. Penerapan Media Tiga Dimensi KIT Untuk Meningkatkan Aktivitas Dan Hasil Belajar IPA Siswa Kelas V SDN Pasinan II Kecamatan Lekok. Skripsi. Jurusan KSDP, FIP, Universitas Negeri Malang. Pembimbing (1) Drs. Usep Kustiawan, M.Pd (2) Drs. HjSukamti, M.Pd. Kata Kunci : IPA, KIT, Aktivitas, Hasil Belajar. Dari hasil observasi ditemukan bahwa siswa di SDN Pasinan II Kecamatan Lekok, jarang menerapkan pembelajaran dengan menggunakan media. Sebagian siswa merasa bosan dan kurang bersemangat dalam pembelajaran, sehingga siswa belum mampu mencapai kriteria ketuntasan belajar di kelas 70%. Berdasarkan hal tersebut, pembelajaran dengan menggunakan media sangat tepat dan dianjurkan sebagai alternatif proses belajar mengajar. Tujuan yang ingin dicapai dalam penelitian ini adalah: 1) Mendiskripsikan penerapan media tiga dimensi kit pembelajaran IPA di kelas V SDN Pasinan II Kecamatan Lekok. 2) Mendiskripsikan dampak penggunaan media tiga dimensi kit terhadap aktivitas belajar siswa kelas V SDN Pasinan II Kecamatan Lekok. 3) Mendiskripsikan peningkatan hasil belajar siswa kelas V SDN Pasinan II Kecamatan Lekok setelah menggunakan media tiga dimensi kit. Penelitian ini menggunakan metode Penelitian Tindakan Kelas(PTK) kolaboratif dan bersiklus. Subyek penelitian ini adalah siswa kelas V SDN Pasinan II. Teknik pengumpulan data dalam penelitian ini yaitu: observasi, wawancara, tes evaluasi. Sedangkan instrumen pengumpulan data yang digunakan berupa pengamatan guru, tes evaluasi, dan wawancara. Hasil dari penelitian setelah dilakukan Tindakan Kelas, data menunjukkan bahwa hasil belajar siswa pada pra tindakan rata- rata 60,62. Pada siklus I mencapai 84,72, sedangkan pada siklus II mencapai rata-rata 96,19, sehingga ketuntasan belajar mencapai 100%. Kesimpulan isi sesuai dengan bab V dari penelitian ini yaitu penggunaan media tiga dimensi kit dapat meningkatkan aktivitas belajar siswa serta hasil belajar siswa dari pra tindakan mendapat rata- rata 60,62 menjadi 84,72 pada siklus I. Kemudian mengalami peningkatan yang signifikan pada siklus II menjadi 96,19 dengan ketuntasan belajar 100%. Dengan menerapkan media tiga dimensi kit dapat meningkatkan aktivitas(keaktifan, kerjasama) dan hasil belajar siswa dalam pembelajaran. Selanjutnya peneliti menyarankan kepada guru, supaya dapat menggunakan media dalam pembelajaran IPA, dengan begitu siswa dapat mengembangkan potensi diri dan sikap ilmiah. Pembelajaran dalam penelitian ini juga dapat digunakan dalam penelitian- penelitian lain sebagai bahan perbandingan, sehingga dikemudian hari menjadi lebih baik.

Membangun jaringan komputer menggunakan PC router OS Linux Ubuntu di UPT SDN Karanganyar Kota Pasuruan / Mashur, Fitri Mulyani

 

Kata Kunci : PC Router Ubuntu, Manajemen Bandwidth, Sistem Firewall Kebutuhan akses Internet saat ini sangat tinggi sekali. Baik untuk mencari informasi, artikel, pengetahuan terbaru, hanya sekedar untuk chatting atau bahkan sampai mencari penghasilan secara online dan real time. Peredaran situs yang kurang baik untuk di akses dalam proses kegiatan belajar mengajar (KBM) khususnya di Laboratorium Komputer UPT SDN Karanganyar khususnya situs yang berbau pornografi pun juga semakin berkembang, hal ini berdampak negatif jika siswa mengakses situs tersebut, maka diperlukan suatu sistem yang dapat membatasi akses situs baik browsing maupun searching. Disamping itu perlu dilakukan manajemen bandwidth agar bandwidth yang diterima setiap client sama rata. Upaya untuk menanggulangi permasalahan di atas adalah merancang PC Router yang dapat membatasi akses situs yang kurang baik khususnya situs yang berbau pornografi, dan membagi bandwidth secara merata. PC Router dengan menggunakan OS Linux Ubuntu merupakan alternatif untuk menekan biaya pembelian router pabrikan seperti Cisco, Juniper dan BayNetwork yang harganya masih mahal. Digunakannya Linux Ubuntu sebagai sistem operasi karena lisensinya gratis, tidak membutuhkan spesifikasi hardware yang besar, instalasi tidak rumit dan administrasinya mudah, bisa dijalankan dengan Text Mode maupun GUI. Pada perancangan PC Router OS Linux Ubuntu ini diawali instalasi Sistem Operasi Linux Ubuntu versi 7.10 dengan kode Gutsy Gibbon, dilanjutkan konfigurasi IP Address, konfigurasi IP Forward, konfigurasi bandwidth management menggunakan HTB Tools sehingga bandwidth ISP Telkom speedy sebesar 512 kbps dibagi secara merata setiap client dari 7 client yang aktif, kemudian mengkonfigurasi sistem firewall menggunakan aplikasi Firestarter. Pada konfigurasi firewall dengan Firestarter di sini kita dapat melidungi jaringan komputer kita dari serangan luar berupa hacking, virus, dan lain-lain. Selain itu dengan sistem firewall kita dapat mem-filter situs-situs mana yang tidak kehendaki untuk di akses oleh user misal situs porno, situs judi ataupun situs-situs lainnya yang tidak dikehendaki. Dari hasil pengujian PC Router OS Linux Ubuntu secara keseluruhan diperoleh hasil bahwa piranti sesuai dengan rancangan, yaitu: (1) Membagi bandwidth internet secara merata sesuai dengan jumlah client yang sedang aktif ,(2) Melindungi jaringan komputer dari serangan luar berupa hacking, virus maupun serangan lain, dan (3) Membatasi akses situs tidak dikehendaki karena berbau pornografi, perjudian atau lainnya berdasarkan daftar blacklist alamat situs. Kesimpulan yang dapat diambil dari perancangan dan hasil pengujian adalah sebagai berikut: (1) Sistem manajemen bandwidth dengan HTB Tools membagi bandwidth Internet sama rata sesuai dengan konfigurasi yang telah kita lakukan. Bandwidth speedy yang rata-rata sebesar 512 kpbs (Speedy Test) dibagi kepada 7 client sehingga setiap client akan mendapatkan bandwidth rata-rata 64 kbps, (2) Sistem Firewall melindungi jaringan computer dari serangan luar berupa jacking, virus maupun serangan lain, dan (3) Sistem Firewall dapat membatasi akses ke situs-situs yang tidak dikehendaki baik melalui browsing maupun searching. Akses browsing dan searching dapat di-block jika URL situs tersebut mengandung unsur kurang baik dan berbau pornografi atau perjudian dan terdaftar di blacklist situs sehingga jika siswa mengakses situs tersebut muncul keterangan access denied. Dengan melihat hasil yang dicapai, untuk pengembangan lebih lanjut disarankan: (1) Dalam mengatur manajemen bandwidth sebaiknya memperhatikan hak prioritas, misal untuk komputer klien yang dipakai oleh administrator dan pihak atasan mendapatkan jatah bandwidth yang lebih besar. (2) Untuk menghindari serangan dari luar sebaiknya pada komputer user lebih dilengkapi dengan anti virus maupun anti spam lainnya.

Kepemimpinan kepala sekolah dalam meningkatkan prestasi sekolah unggulan (studi multi kasus di TK Anak Saleh dan BA Restu I di Kota Malang) / Misbakhul Arifin

 

ABSTRAK Arifin, Misbakhul. 2010. Kepemimpinan Kepala Sekolah dalam Meningkatkan Prestasi Sekolah Unggulan (Studi Multi Kasus di TK Anak Saleh dan BA Restu I di Kota Malang). Tesis, Jurusan Manajemen Pendidikan Program Pasca Sarjana Universitas Negeri Malang. Pembimbing : (I) Prof. H. Ahmad Sonhadji K.H., M.A., Ph.D., (II) Dr. H. Imron Arifin, M.Pd. Kata kunci : kepemimpinan kepala sekolah, prestasi, sekolah unggulan. Kepemimpinan kepala sekolah adalah segala usaha kepala sekolah dalam mempengaruhi, mendorong, membimbing, mengarahkan dan menggerakkan seluruh staf sekolah dan masyarakat agar dapat bekerja secara efektif dalam rangka merencanakan dan melaksanakan program-program sekolah untuk meningkatkan dan mencapai prestasi. Sehingga perlu dikaji dan diadakan penelitian (research), tentang kepemimpinan kepala sekolah dalam meningkatkan prestasi sekolah unggulan khususnya di Taman Kanak-Kanak. Penelitian ini bertujuan: Pertama, untuk mendeskripsikan dan menjelaskan (explanatory) prestasi yang telah diraih oleh sekolah unggulan, termasuk didalamnya mendeskripsikan sumber-sumber pendukung yang dimanfaatkan untuk mencapai prestasi. Kedua, mendeskripsikan dan menjelaskan kiat kepala sekolah dalam meningkatkan prestasi sekolah unggulan di Taman Kanak-Kanak Anak Saleh Malang dan BA Restu I Malang. Metode penelitian ini menggunakan penelitian studi multi kasus dengan model microetnografi, karena penelitian ini mempunyai latar subjek pada suatu tempat kejadian. Penelitian ini dilakukan dalam tiga tahap : Pertama, orientasi; kedua, tahap pengumpulan data (lapangan) atau tahap eksplorasi; dan ketiga, tahap analisis dan penafsiran data. Obyek penelitian yaitu : TK Anak Saleh Malang dan BA Restu I Malang. Hasil Penelitian menunjukkan bahwa dari segi kualitas prestasi yang diraih TK Anak Saleh Malang relatif lebih baik dibandingkan dengan BA Restu I Malang, khususnya dari segi skala kejuaraan. Tetapi, dari segi kuantitas, kejuaraan BA Restu I Malang relatif lebih baik dibandingkan dengan TK Anak Saleh Malang. Dalam meraih prestasi, kepala sekolah BA Restu I Malang menggunakan kiat kepemimpinan antara lain : bersikap adil, memberikan sugesti, mendukung tercapainya tujuan, katalisator, menciptakan rasa aman, sebagai wakil organisasi, sumber inspirasi dan bersikap menghargai. Sedangkan Kepala Sekolah TK Anak Saleh Malang menggunakan kiat kepemimpinan : bersikap adil, memberikan sugesti, mendukung tercapainya tujuan, katalisator, menciptakan rasa aman, sebagai wakil organisasi, sumber inspirasi, bersikap menghargai, rendah hati dan spiritual transendental.

Pembelajaran integrated model menggunakan bahan ajar IPA terpadu untuk meningkatkan keterampilan berpikir siswa kelas VII SMP Negeri 05 Batu / Lia Widayanti

 

ABSTRAK Widayanti,Lia.2010.Pembelajaran Integrated Model Menggunakan Bahan Ajar IPA Terpadu Untuk Meningkatkan Keterampilan Berpikir Siswa Kelas VII SMP Negeri 05 Batu. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang.Pembimbing (I)Drs.Dwi Haryoto, M.Pd, (II) Dra. Endang Purwaningsih, M.Si. Kata kunci: IPA Terpadu, integrated model, keterampilan berpikir siswa Berdasarkan hasil wawancara dan observasi awal pada kelas VII SMP Negeri 05 Batu ditemukan bahwa pembelajaran IPA sering dilakukan dengan metode ceramah. Rata-rata hasil belajar IPA siswa pada semester sebelumnya 39,19 dan 87,50% siswa mendapatkan nilai di bawah SKM. Kesulitan yang dihadapi oleh guru adalah menyatukan konsep IPA menjadi terpadu, mengaktifkan siswa selama proses pembelajaran, meningkatkan antusiasme siswa terhadap materi yang diajarkan, dan meningkatkan keterampilan berpikir siswa. Untuk mengatasi permasalahan tersebut maka disepakati untuk menerapkan Pembelajaran Integrated Model Menggunakan Bahan Ajar IPA Terpadu. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) yang terdiri atas dua siklus. Rangkaian penelitian dilaksanakan mulai tanggal 18 Januari hingga akhir Mei 2010. Subyek penelitian ini adalah siswa kelas VII SMP Negeri 05 Batu semester genap tahun ajaran 2009/2010 sejumlah 32 siswa. Instrumen yang digunakan terdiri dari instrumen tindakan yaitu RPP dan LKS, serta modul IPA Terpadu dan instrumen pengukuran yaitu lembar observasi pertanyaan dan jawaban siswa, lembar observasi keterlaksanaan RPP, rubrik penskoran jawaban siswa, dan tes. Data penelitan berupa data hasil keterlaksanaan RPP dan keterampilan berpikir siswa. Peningkatan keterampilan berpikir yang dicapai oleh siswa ditandai dengan meningkatnya aktivitas tanya jawab siswa selama proses pembelajaran serta meningkatnya hasil tes siswa tiap akhir siklus. Pembelajaran dilaksanakan menggunakan metode eksperimen, tanya jawab, dan diskusi dengan materi IPA Terpadu. Pelaksanaan pembelajaran integrated model menggunakan bahan ajar IPA Terpadu dengan alokasi waktu 720 menit (3x80 menit perminggu) dengan tema ‘Pemuaian Pada Berbagai Wujud Zat’ menunjukkan hasil sebagai berikut. Keterlaksanaan rencana pelaksanaan pembelajaran 100% aktivitas guru terlaksanakan dan aktivitas siswa meningkat 16,66 %. Persentase aktivitas tanya jawab selama proses pembelajaran meningkat sebesar 28,13% serta meningkatkan keterampilan berpikir siswa kelas VII SMP Negeri 05 Batu sebesar 93,26% pada siklus II. Dampak positif setelah diterapkan tindakan adalah jumlah siswa kelas VII SMP Negeri 05 Batu yang mampu mencapai SKM meningkat dari 12,50% menjadi 93,75% dengan peningkatan sebesar 81,25%. Berdasarkan data tersebut dapat disimpulkan bahwa pembelajaran integrated model menggunakan bahan ajar IPA Terpadu dapat meningkatkan keterampilan berpikir siswa kelas VII SMPN 05 Batu sebesar 93,26% dan jumlah siswa yang berhasil mencapai SKM hingga 81,25%.

Perkembangan Industri Batik Tulis Gedog "Kesatriyan" Desa Margorejo Kecamatan Kerek Kabupaten Tuban Tahun 1995-2003 Oleh Sidik Kurniasih Agustina

 

senib atikm erupakasna lahs atuc in khasb angsaIn donesiyaa ngt etahh idup berabad-ablaardn anyaB. eberapate mpatd i Inclonesiidikenasl ebagadi ierahp enghasil batikd, iantaranyTa uban.B atik relahd ikenald i ruban sejaka bad-I6M . sebagai pusafnaydaa lahk ecamataKne rekt epatnyad i DesaM argorejoS. ebagasiu atuin dustri kecilk, cgiatanp roduksinyad ipengaruhoi lch kondisip eiekonomianie gan. Hal ini nampapka dak urunw aktu l9g7-2002d imanap adak urun waktut ersebitk ondisi perekonomiIannd onesiate rpuruka kibatk risise konomis ertap eristiwab om Bali. . Rumusamn asalayha nga kand i bahasp a

Analisis Produktivitas Keuangan Terhadap Harga Pokok Produksi (Studi Kasus Pada PT.PG. Candi Baru Sidoarjo) Oleh Bagus Permadi

 

Studi komparatif antara hasil belajar melalui paket belajar dan hasil belajar melalui pengajaran biasa para siswa kelas III A2 SMA Negeri 2 Ambon (suatu tinjauan terhadap materi hitung integral) / oleh Tanwey Gerson Ratumanan

 

Hubungan persepsi beban kerja dengan kinerja karyawan PT. Sumber Alfaria Trojaya Tbk. Cabang Malang / Lini Hindrasiwi

 

ABSTRAK Hindrasiwi, Lini. 2015.Hubungan Persepsi Beban Kerja dengan Kinerja Karyawan PT. Sumber Alfaria Trijaya Tbk, Cabang Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (I) Drs. Fattah Hidayat, S.Psi., M.Si (II) Pravissi Shanti, S.Psi., M.Psi Kata Kunci: persepsi beban kerja, kinerja karyawan, PT. SumberAlfariaTrijayaTbk, Cabang Malang. Penelitian ini didasari oleh adanya fakta di lapangan,dalammelakukanpelayanankepadapelanggan, Alfamartmemilikistandarpelayanan yang harusdilakukanolehseluruhkaryawantokoAlfamartbaikkasirataupramuniaga. Namunkenyataannyamasihadakaryawan yang tidakmelakukanstandarpelayanan yang di tetapkanolehperusahaan, tidakmenyapapelanggan yang datang, dantidakmemilikiproduct knowledge yang baik. Selainitukemundurankinerjakaryawanjugadapatdilihatdaribanyaknyakaryawan yang absendaritugasnya dan meningkatnya turnover.Oleh karena itu penelitian ini bertujuan untuk mengetahui hubungan antara persepsi beban kerja dengan kinerja karyawan PT. SumberAlfariaTrijaya Tbk, Cabang Malang. Penelitianinimenggunakanpendekatankuantitatifdenganrancangandeskriptifdankorelasional.Populasisebanyak 342 karyawan dengan jumlah sampel 172 karyawan. Teknik sampling yang digunakan adalah sampling insidental. Menggunakan instrumen penelitian skala persepsi beban kerja dengan reliabilitas 0,944 dan data sekunder berupa penilaian kinerja karyawan PT. Sumber Alfaria Trijaya Tbk, Cabang Malang. Hasil penelitian menunjukkan bahwa karyawan yang memiliki persepsi beban kerja tinggi 52% dan karyawan yang memiliki persepsi beban kerja rendah 48%. Karyawan yang memiliki kinerja tinggi 47% dan karyawan yang memiliki kinerja rendah 53%. Terdapat hubungan negatif signifikan antara persepsi beban kerja dengan kinerja karyawan dengan angka korelasi -0,650 dan p<0,05. Karyawandiharapkanuntukbisamembuatprioritasdalambekerja, dan mengasahlagikemampuan yang dibutuhkansepertimemahamimanajemen waktu, standarpelayanan, mengetahuihandling complain, sertamemilikiproduct knowledge yang baiksehinggakinerjakaryawanakanmeningkat. Pimpinandiharapkandapatmemberikanmotivasidanpelatihan, sepertipelatihanmanajemenwaktu, handling complain, danproduct knowledge, sehinggakaryawanmemilikipengetahuan yang lebihdandapatmeningkatkankemampuankaryawandalammenjalankanpekerjaannya.Penelitianselanjutnya, dapatmenambahjumlahsampel agar sampellebihrefresentatiflagi. Kemudianbagipeneliti yang inginmengetahuilebihdalamtentangvariabelkinerjakaryawan, mungkindapatmenambahvariabelselainpersepsibebankerja, sepertimotivasi, kesediaan, harapanimbalan, kemampuan, lingkungan, dankepuasankerja.

Analisis Metode Variabel Costing Sebagai Dasar Penentuan Harga Poko Produksi Pada Perusahaan Pupuk "SPAT" Purwadadi Pasuruan Oleh H. Suprayitno

 

Harga pokok produksi merupakan pengorbanan ekonomis yang dibutuhkanu ntuk memproduksdi an memperolehb arangh inggab arangt ersebutsiap untuk dipasarkanM. anagemenp erusahaanh arus dapatm enentukanh argapokokp roduksis ecarate pat,k arenah al itu sangabt erpengaruthe rhadapp erolehanlabay angm aksimal. Ada duam etodey angd igunakanu ntukm enetapkahna rgap okokp roduksi,yaiiu metode full costing dan metode vctriahel co.sting. tvtitoOe fuli costingmemperhitungkasne muau nsurb iaya kedalamh argap okok produksib aik tetapmaupunv ariabel.S edangkanm etode variabel costing hanya memperhitunganunsur biaya variabel kedalam harga pokok produksr. Penelitian ini menganalisa metode variabel costing sebagai dasarpenentuahna rgap okok produksiy anga dad i perusahaapnu pukS PATP urwodadiPasuruany aitu terdin dari neraca,l aporanr ugi laba, anggaranp enjualanb, ahanbaku,B OP,b iayap roduksid an PerhitungaHn PP selamat ahun2 001d an 2002. Penelitiani ni bertujuan mengetahuip enerapanm etode variabel costing sertapengaruhnytear hadap erolehalna ba.Penelitiani ni dilakukan di kantor perusahaanp upuk SPAT PurwodadiPasuruanR. ancanganp enelitiany ang digunakana dalahd eskriptif.A nalisish asilpenelitiany angd ipakaia dalahle asts quarem ethodd enganp ersamaaYn : a + bX.Hasil penelitianm enunjukkanb ahwap enetapanm etodev ariabelc ostingsebagadi asarp enetapanh argap okok produksil ebih besarp erolehanla banyad ibandingd enganf ull costing.A pabila perusahaamn enggunakavna riabelc ostingmaka laba yang diperoleha dalahR p 156.395.73u4n tuk tahun 2001 dan Rp416.848.77u4n tukt ahun2 002.A kan tetapijika perusahaamn enggunakamn etodefull costingm aka laba yang diperolehs ebesaRr p 39.433.307u ntuk tahun2 001dan Rp 343.985.297u ntuk tahun2 002.C onstnbusmi arginy ang diperoleht ahun2002l ebihb esard arit ahun2 001.Berdasarkanh asil penelitian ini, dapat disarankana gar perusahaand alammenetapkanh argap okok produksid apatm enggunakamn etodev ariabelc osting.Hal itu dapatm enghasilkalna bay angm aksimal.

Hubungan nilai anak dengan sikap masyarakat terhadap keluarga berencana di Kecamatan Wonorejo Kabupaten Pasuruan / oleh Wijaya Sugianto

 

Pola asuh orang tua dalam pendidikan keluarga membentuk kecerdasan budi pekerti anak (studi deskripsi pada keluarga Ibu Mas) / Ahmad Arif Fanani

 

Fanani, Ahmad Arif. 2014. Pola asuh orangtua dalam pendidikan keluarga membentuk kecerdasan budipekerti anak. Skripsi. Jurusan Pendidikan Luar Sekolah Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Dr. Zulkarnaen, M.pd. (2) Drs. Lasi Purwito, M.S. Kata Kunci: Pola asuh orang tua, pendidikan keluarga, kecerdasan budipekerti.     Pendidikan merupakan tanggung jawab bersama antara keluarga masyarakat dan pemerintah. Sehingga orang tua tidak boleh menganggap remeh bahwa pendidikan anak hanyalah tanggung jawab sekolah. Orangtua sebagai lingkungan pertama dan utama dimana anak berinteraksi sebagai lembaga pendidikan yang tertua, artinya disinilah dimulai suatu proses pendidikan. Sehingga orang tua berperan sebagai pendidik bagi anak-anaknya dalam mencerdaskan akhlak budipekertinya. Lingkungan keluarga juga dikatakan lingkungan yang paling utama, karena sebagian besar kehidupan anak didalam keluarga, sehingga penanaman pendidikan kecerdasan budipekerti dalam keluarga sangat penting untuk masa depan anak menjadi lebih baik.     Penelitian ini dilaksanakan dengan tujuan untuk mengetahui pentingnya pendidikan keluarga membentuk kecerdasan budi pekerti dalam keluarga Ibu Mas di Jalan Musi RT1 RW 2 Ngoro Jombang. Mengetahui Pola Asuh orang tua dalam penanaman pendidikan kecerdasan budipekerti pada anak di keluarga.     Penelitian ini menggunakan rancangan penelitian melalui pendekatan kualitatif studi kasus. Data penelitian yang berupa paparan data dari profil keluarga Ibu Mas. Pengumpulan data di lakukan dengan menggunakan tekhnik wawancara dan observasi. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri. Untuk menjaga keabsahan data, dilakukan kegiatan trianggulasi data. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, dan tahap evaluasi data.     Berdasarkan hasil analisis data tersebut, diperoleh dua simpulan hasil penelitian sebagai berikut. Pertama penerapan pendidikan dalam mencerdaskan akhlak budipekerti pada anak di dalam keluarga sangat penting apalagi penanaman akhlak budipekerti itu diterapkan pada anak masih usia dini sampai anak sudah mempunyai keluarga sendiri. Orang tua meyakini bahwa pentingnya penanaman pendidikan kecerdasan budipekerti anak itu sangat penting karena tanpa akhlak budipekerti yang baik serta agama manusia tidak mempunyai nilai agama yang dapat membuat patokan yang dijadikan petunjuk atau pegangan dalam menjalani kehidupan sehari-hari demi mencapai akhlak yang baik terhadap orang tua.     Kedua, peran orang tua untuk anak dalam mengarahkan, meluruskan, dan mendampingi anak hingga anak tumbuh dewasa dan menjadi lebih sempurna, orang tua memberikan penerapan kecerdasan budipekerti yang baik seperti pendidikan akidah, ibadah, serta juga menghargai dan berbuat akhlakul karimah terhadap kedua orang tua. Karena dalam pendidikan akhidah, ibadah dan akhlak budipekerti itulah kelak anak akan menerapkan kehidupan sehari-harinya di dalam lingkungan keluarga dan masyarkat. Sehingga penerapan pendidikan kecerdasan budipekerti tersebut dilakukan denan benar.    Saran bagi (1) Jurusan PLS, memperluas dan mengembangkan penelitian yang program PLS dimayarakat, agar PLS dapat semakin berkembang dan dikenali oleh masyarakat; (2) orang tua, sebagai pendidik yang pertama dan utama dikeluarga, orang tua agar lebih mengenalkan pendidikan kecerdasan akhlak budipekerti yang baik, serta menanamkan kaidah islam dengan benar. Selain itu orang tua lebih bisa menanamkan nilai agama dengan metode-metode yang menarik untuk anak; (3) peneliti, diharapkan hasil penelitian ini lebih bermakna dan berarti, maka pada penelitian lebih lanjut dan dalam berbagai hal atau aspek kehidupan keluarga lebih diperkaya lagi seiring dengan temuan-temuan lapangan yang telah peneliti hasilkan.

Analisis Metode Penilaian Persediaan Yang Tepat Untuk Penetapan Harga Pokok Penjualan Pada UD. "Morodadi" Di Kecamatan Kembangbahu Kabupaten Lamongan Oleh Abd. Radjak Tranggono

 

Persedraanb arang daganganm erupakane lemen aktrva yang sangatpentlng dalam operasi perusahaand agang,b aik perusaha€lgnr oslr maupunpengecers. tandarA kuntansiK euangan( sAK ) menetapkanb ahwap ersedraanharusd icatatd an dilaporkans ebesahr argap erolehannyaA. pabila hargab arangyang dibeli untuk jenis barang yang sama dalam satu periode berubah-ubah,makap enentuanh argap erolehanp ersediaanse makinr umit. Dalams itr.asih argayang berubah-ubahm, aka peruahaand ihdapkanp ada pemilihan metodepenentuanh arga perolehana tas persediaany ang dimiliki dan harga pokokpenjualana tas barang-barangya ng telah drjual. Ada tiga metodey ang dapatdigunakanu ntuk menilai persediaanb arangd agangany, aitu : Metode t'lFO,Metode LIFO, dan Metode AVERAGE. pemilihan merode FIFO, LIFO, ataupunAVERAGE nantinyaa kanm empunyapi engaruhte rhadapL aba yangd iperoleh Rumusanm asalahd alamp enelitianin i, adalah: l ). Bagaimanap enerapanmetodep enilaianp ersediaanb arangd agangand enganm etodeF IFO, LIFO, danAVERAGE pada UD. MOI{ODADI Kecamatan Kembangbahu KabupatenLamongan.2 ). BagaimanaP enilaianp ersediaanb arangd agangany ang repaqsehingga memperoleh Laba maksimal pada uD. MORODADI kecamatanKembangbahKu abupatenL amongan.Adapun tujuan dari penilaian ini, adalah : l). Untuk mengetahuipenerapanm etodep enilaianp ersediaanb arangd agangand enganm etodeF ll.o,LIFO, dan AVERAGE dalam hubungannyad enganp emerolehanh argap okokpersediaana khir pada UD. Morodadi Kecamatank embangbahuK abupatenLamongan. 2). untuk mengetahui penerapan perhitungan metode penilaianpersediaanb arangd aganganya itu MetodeF IFO, LIFO, dan AVERAGE dalam hubungannyad enganp enentuanh arga pokok penjualanp ada UD. MorodadiKecamatan Kembangbahu Kabupaten Lamongan. Populasi dalam penilaian ini, adalah "Keseluruhan transaksi yangberjaland enganm etodeP enilaianp ersediaanb arangd agangans ejakb erdirinyaPerusahaans ampai sekarang."S edangkanS ampelnya,a dalah "KeseluruhanTransaksi yang berjalan selam satu tahun dengan metode prnilaian persediaanbarangd agangany ang dilakukano leh 'UD. MORODADI" selamas atut ahun( 1 Januaris ampadi engan3 1 Desembe2r 002) . Untuk memperolehd atad alampenelitian ini digunakan teknik Wawarcara, Observasi, dan Dokumentasi,sehinggadatayangdiperolehberupadataandgakna d atanona ngka. TeknikAnalisis Data yang digunakan, adalah Teknik Analisis Deskriptif denganmenggunakanP endekatanA kuntansr, khususnya yang berkaitan denganPenilaianP ersediaan. BerdasarkanA nalisis Data, diperolehK esimpulans ebagabr erikut : 1).Pada saat harga cenderung turun, perhitungan dengan metode LIFOmenghasilkahna rgap okok persediaana khir barangd agangany ang tebih tinggtdaripadam etodeF 1FOm aupunA verage. 2). Padas aath argac enderungtu run,perhitungan dengan metode FIFO menghasilkan harga pokok penlualan yanglebih tinggi daripada metode LIFO maupun Average. .3). Pada saat hargacenderungtu m, perhitungand enganm etode LIFO menghasilkanla ba bersihyang lebih tinggi daripada metode FIFO maupun metode Average. 4).Perusahaans ebaiknyam enerapkanm etodeA veraged alam menilai persediaanbarangd agangank,a renab eradad i antaram etodeF IFO danm etodeL IFO yangjumlahnya tidak terlalu tinggi dan tidak terlalu rendah.

Korelasi Antara Perputaran Piutang Dengan Tingkat Rentabilitas Ekonomis (Studi Kasus Pada KPRI "JUJUR") Kecamatan Sampang Kabupaten Ponorogo Oleh Slamet Riyadi

 

Persaingand unia usahas aat ini semakink etat yaitu denganm eningkatnyakuantitas perusahaan dagang yang hampir semuanya terlayani melalui penjualankedit dengan syarat lunak. Koperasi juga harus dapat melayani penjualan kreditdengan syarat yang terjadi pada dewasa ini agar dapat tetap bisa bersaing denganperusahaalna in didalams ituasiy angb erkembangp adap erusahaadna gangtersebut.Penjualan secara kredit sebenamya banyak mengandung resiko misalnyapiutangt ak tertgih,Jatuhte mpoy angm undurd an lainlain.Usahau ntuk memperkecilresiko adalahd engana danyap engelolaanp iutang yang baik. Salah satu caranyaadalah dengan mempercepat perputaran piutangnya. Apabila hal tersebutdilaksanakan maka kemungkinan piutang tak tertagih akan dapat dihindari, dapatmeninggatkalna ba,a khirnyab erpengarukhe padap eningkatanre ntabilitase konomis. Penelitian ini bertujuan untuk mengetahuis eberapac epat perputaranp iutang,seberapab esart ingkat rentabilitas ekonomis,d an mengetahuia dat idaknya hubunganantaxa perputaran piutang dengan tingkat rentabilitas ekonomis pada KPRI "JUJUR"KecamatanS ampungK abupatenP onorogoT. ahun1 9 92 sampadi engan2 002. Penelitian ini termasuk penelitian Asosiatif yang mempunyai hubungankausal.Variabeble bas(X)d alamp enelitiani ni adalahp erputaranp iutangd anV ariabelterikat (Y) adalahr entabilitase konomisM. etodep engumpuland atad alamp enelitianini adalah metode dokumentasi.Teknikn alisis data menggunakan analisis nonparametrik korelasi Spearmen Rank bekerja dengan data ordinal. Data dalampenelitian ini adalah data rasio, maka data tersebut harus diubah menjadi data ordinal.Ilasil penelitianm enunjukkanb ahwa (1) Rata-ratad ari perputaranp iutangKPRI *ruJUR" adalah1 ,530685d an itu sudahs tabil kerenat iap tahunm engalamipeningkatan yang berarti; (2) Rata-rata dari tingkat rentabilitas ekonomis adalah25,44 dmr sangat stabil peningkatannya sesuat dengan peningkatan pertambahandebet juga pertambahan anggota yang terjadi disetiap awal tahun buku. (3) Adahubungan antara perputaxan piutang dengan rentabilitas ekonomis pada KPRI"ruJLIR" denganti ngkatr entabilitaes konomisd engank oefisien korelasi rho =0,027d N sipifikan p = 0,468.Saran yang dapat diberikan kepada KPRI "JUJUR" adalah (1) Dalammernberikatrne dit kepadaa nggotah endaknyyaa ngs elektif;( 2) Untukm empercepatperputarapni utangh endaknyam emperbaharusyi aratk edit, denganc ashd iscount,kepadyaa ngl unass ebelumja tutrt empo;( 3) Untukl ebihm engfelrifkanp eningkatandan stabilitas rentabilitas ekonomis hendaknya mempercepat perputaran,menstabilkadna nm enghemabti aya-biayao perasional.

Penetapan Harga Pokok Produksi Sebagai Dasar Penentuan Harga Jual Pada Percetakan Dan Setting "Q & R" Di Kota Batu Oleh Triono

 

Biaya bahan Baku, biaya tenaga kerja langsung, dan biaya overhead pabrikmerupakanb iaya-biayap enentuh argap okok produksip adap ercetakand an Seftinge& R di kota Batu.T ujuan ditetapkannyah argap okok dari suatup roduksia ntaral ainuntuk menentukanh argaj ual. Untuk mengetahuai pakahh argaj ual sudaht epat ataubelum tepat maka perlu ditenhrkanb esarnyah arga pokok produksi.S elamai niPercetakand an Setting Q & R di Koa Ba$ belun melakukanp elhitungrrnh argapokok produksi secarat epat dan teliti, serta belum mengadakankl asifikasib iaya kemasing-masingb agian yang ada dalam perusahaany, aitu bagian produksi, baglanadministrasi dan umum sena bagian pemasaran. Penelitian ini bertujual untukmengetahubi iaya-biayay ang menenhrkanh argap okok pada perusahaanp ercetakan.Selama ini perusahaan Percetakan dan Setting Q & R di Kota Batu dalarnmenentukahna rgaj ual berdasarkapne saruud alamm encetakd an tingkatk esulitanpengerJaannyaVariabel yang diteliti dalam penelitian ini adalah biaya produksi dan hargajualdari barangc etak yang dihasilkanm ulai bulan April 2003 - Juni 2003. Penelitianin idilakukand i perusahaanP ercetakand an SettingQ & R di Kota Batu yang beralamatdi JalanW R. SupratmaNno . 12 telepon(0 341)5 l1771.L arrcp enelitiadna rir anggal5 April 2003 sampaid engan2 5 Agustus2 003.D itinjau dari sifatnyap enelitianin i termasujke nisp enelitiand eskriptif. Analisis hasil penelitian yang dipakai adalah yang p€rtama untuk menghitungharga pokok produksi, terlebih dahulu biaya lishilq biaya pemeliharaana lat, biayatistrik, air dan telepon, sewa gedrrngd an penyusutanm esin harus diklasifikasikandengan tepat yaitu ke bagian produksi dan ke bagian administrasi dan umum.Selanjutnyab iaya admuristrasdi an umwn sertab iayap emasarand an penjualanh arusd*eluarkan dari biaya overhead pabrik, sebab biaya-biaya tersebut termasuk biayaoperasi.S etelahb esamyah argap okok produksid iketahui,h argajual dapatd itentukandari besarnyah argap okok produksid itambahb iayao perasid an besamyak eunhrnganyang dilrarapkan. Hasil penelitiani ni menunjukkanb ahwa harga pokok produksi setelaha danyapengklasifikasiabni aya ternyatal ebih rendahj ika dibandingkand enganh argap okokproduksi sebelumd iadakanp eng;klasifrkasiabnia ya. Dalam penilaianb ahanb aku, perusahaanti dak menggunakans istem persediaan,a rtinya setiap pengadaanb ahanbaku selalu disesuaikand enganv olume pesanany ang ada, sehinggab ahan bakulangsungd apatd ipakait anpam enungguu ntuk disimpand i gudang.S edangkadna lamhal penentuanh argaj ual, perusahaamn anggunakamn etodeg ross marginp ricing dan.menghasilkahna rgaju al yangl ebih layakj ika dibandingkand eng;amn etodel ainnya.

Analisis sistem dan prosedur pemberian kredit modal kerja pada PT. Bank Rakyat Indonesia Cabang Malang Martadinata / Ika Yaningtias

 

Seiring dengan kehidupan ekonomi dan perdagangan yang semakin berkembang, bank mempunyai peranan penting dalam melaksanakan distribusi, selain itu bank juga berperan sebagai lembaga intermediasi antara pihak yang memakai dana dengan pihak yang membutuhkan dana. Bank memegang fungsi sebagai perantara keuangan dalam masyarkat. Bank menyalurkan dana pada masyarakat yang membutuhkan dalam bentuk kredit. PT. Bank Rakyat Indonesia adalah salah satu bank yang selain menghimpun dana dari masyarakat juga melayani jasa perkreditan. Salah satu jenis kreditnya adalah Kredit Modal Kerja. Penulisan Tugas Akhir ini bertujuan untuk mendeskripsikan tentang sistem dan prosedur pemberian Kredit Modal Kerja pada PT. Bank Rakyat Indonesia Cabang Malang Martadinata. Metode pemecahan masalah yang dilakukan adalah metode deskriptif kualitatif. Berdasarkan dari hasil pengamatan dan pembahasan Tugas Akhir ini, diperoleh kesimpulan bahwa analisis yang diterapkan dalam prosedur pemberian Kredit Modal Kerja pada PT. Bank Rakyat Indonesia Cabang Malang Martadinata telah sesuai dengan konsep 5C, yaitu analisa character, capacity, capital, collateral,dan condition of economy. Prosedur yang dijalankan juga telah melalui tahap-tahap yang sesuai dengan perjanjian yang telah disepakati sebelumnya antara pihak bank dan debitur. Sistem pengendalian intern yang diterapkan dalam pemberian Kredit Modal Kerja juga telah memenuhi unsur-unsur pokok pengendalian intern. Dari hasil pengamatan ini, disarankan kepada PT. Bank Rakyat Indonesia hendaknya Terus meningkatkan kualitas Sumber Daya Manusia yang ada, hal ini dapat dilakukan dengan melakukan training atapun follow up rutin untuk meningkatkan kinerja para karyawannya. Selain itu, Bank Rakyat Indonesia sebaiknya memperketat kegiatan monitoring terhadap usaha yang dijalankan oleh debitur untuk meminimalisir terjadinya kredit bermasalah. Pihak Bank Rakyat Indonesia juga harus menjalin kerjasama yang lebih baik dengan para debitur. Seperti yang telah diketahui dalam pembahasan bahwa kerjasama yang baik antara bank dengan debitur dapat memperlancar kegiatan bimbingan atau pembinaan terhadap debitur. Karena keberhasilan kredit sepenuhnya tergantung pada kemampuan debitur dalam menciptakan keuntungan. Keuntungan yang diperoleh akan menghasilkan kekuatan bagi debitur untuk memenuhi kewajibannya.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 |