Implementasi pembelajaran kooperatif model PBL (problem based learning) dan konvensional untuk meningkatkan hasil belajar mata pelajaran mengikuti prosedur keamanan, keselamatan dan kesehatan kerja (studi pada siswa kelas X APK SMK Negeri 1 Turen) / Sri Handayani

 

Acceleration of information stream in the globalization era this time demand all field of life to accommodate vision, mission, purpose and strategy in order to suitable with requisities and un up to date. Not except in education world, national education system must be developed suitable with requisities and development that occur not only in local, national but also in global. One of the other government ways to increase quality of education is by establishing new curriculum it is education unity level curriculum which more famous called KTSP. KTSP is the the way to complete curriculum in order to be familiar with teachers, because the teachers are more be involved so they are hope to have much responsibility. Completion curriculum which continued is necessity in order to be national education system always relevant and competitive. Right now, there are still many teachers who use conventional learning. It is because of the teachers still regard that conventional is the most effective learning which used in the learning process. Eventhough, side by side of development era include in education word fineableone of the other learning approximation which is suitable with curriculum that is completed is cooperative learning. One of the other learning models that associated with cooperative learning approximation is Problem Based Learning. Problem Based Learning is a learning approximation that use real world problem as a context for students to study about way to think accurately and skill to solve problem, and also to get knowledge and concept that essentral with material of lesson. This examination is Classroom Action Research with two sicluses and use quality approximation. Technics of data collecting that used in this examination involve observation, interview, field note, documentary study and test. The subject that used in this examination is students of Apk class X State Vocational High School I (SMK N I) Turen that consist of 40 students. From 40 students are divided by two groups that each of group consist of 20 students. The first group use conventional learning and the second group use PBL model learning. Based on this examination result, it showed that use PBL model learning can increase study result of Apk students class X SMK N I Turen. In this case, it can be seen from average of the first ciclus pre test to reach for 58,90 and increase become 71,20 in the post test. Examination result on the second ciclus average pre test to reach for 64,85 and increase become 79,30 on the post test. In the same case occur on the examination result for students who use conventional learning. Based on the first ciclus examination average pre test to reach for 62,35 and increase become 71,05 on the post test. On the second ciclus average pre test is 62,85 and increase become 73,65 on the post test. So it can be said that between PBl model learning and conventional can increase study result of students lesson following safety procedure, salvation and healthy of work. But that make different is which PBL model learning raising level study result of students is higher than conventional learning. Based on examination result the suggestion that proposed are: (1) PBL model learning has been proved can increase study result of students so for the teachers of lesson following safety procedure, salvation and healthy of work and the teachers of the other lesson can use PBL learning, (2) for following researcher can be developed to material beside work procedure, lesson beside following safety procedure, salvation and healthy of work and can be developed for the other school.

Hubungan kebiasaan belajar dengan prestasi belajar siswa pada kelompok mata diklat produktif siswa kelas X di SMK Negeri 2 Malang / Mariana Djo Behi

 

ABSTRAK Djo Behi, Mariana. 2009. Hubungan Kebiasaan Belajar dengan Prestasi Belajar Siswa pada Kelompok Mata Diklat Produktif Siswa Kelas X di SMK Negeri 2 Malang. Skripsi, Program Studi Tata Boga, Bidang Keahlian Usaha Jasa Restoran, Jurusan Teknologi Industri; Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Dr. H. Dwi Agus Sudjimat, ST., M.Pd, (II) Dra. Agus Hery Supadmi I., M.Pd. Kata Kunci: kebiasaan belajar, prestasi belajar. Penelitian ini bertujuan untuk (1) mendeskripsikan kualifikasi kebiasaan belajar siswa di rumah; (2) mendeskripsikan kualifikasi kebiasaan belajar siswa di sekolah; (3) mendeskripsikan kualifikasi prestasi belajar siswa; (4) menganalisis hubungan antara kebiasaan belajar di rumah dengan prestasi belajar; (5) menganalisis hubungan antara kebiasaan belajar di sekolah dengan prestasi belajar; (6) menganalisis hubungan antara kebiasaan belajar di rumah dan di sekolah dengan prestasi belajar. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Teknik penarikan sampel menggunakan total sampling, dengan sampel yang berjumlah sebanyak 68 siswa. Data yang dikumpulkan dengan menggunakan angket dan dokumentasi. Teknik analisis data yang digunakan dalam penelitian ini adalah analisis regresi berganda. Berdasarkan hasil analisis data; (1) Kebiasaan belajar di rumah pada kualifikasi baik, terbukti dengan perolehan persentase sebesar 52,9%; (2) Kebiasaan belajar di sekolah pada kualifikasi baik, terbukti dengan perolehan persentase sebesar 51,5%; (3) Prestasi belajar pada kualifikasi baik, terbukti dengan perolehan persentase 79,41%; (4) Ada hubungan yang signifikan antara kebiasaan belajar di rumah dengan prestasi belajar siswa yaitu sebesar 0,423; (5) Ada hubungan yang signifikan antara kebiasaan belajar di sekolah dengan prestasi siswa yaitu sebesar 0,465; (6) Secara simultan ada hubungan yang signifikan antara kebiasaan belajar di rumah dan kebiasaan belajar di sekolah dengan prestasi belajar. Kesimpulan penelitian ini adalah:(1) Kualifikasi kebiasaan belajar di rumah dengan prestasi belajar pada tingkat baik; (2) Kualifikasi kebiasaan belajar di sekolah pada tingkat baik; (3) Kualifikasi prestasi belajar pada tingkat baik; (4) Ada hubungan kebiasaan belajar di rumah dengan prestasi belajar; (5) Ada hubungan kebiasaan belajar di sekolah dengan prestasi belajar; (6) Secara parsial maupun simultan ada hubungan anatara kebiasaan belajar di rumah dan di sekolah dengan prestasi prestasi belajar. Saran dari penelitian ini adalah (1) Siswa hendaknya tetap mempertahankan kebiasaan belajar di rumah maupun di sekolah agar siswa dapat berprestasi lebih baik lagi; (2) Guru mata diklat hendaknya menciptakan suasana belajar mengajar yang mampu menumbuhkembangkan kegairahan belajar siswa ; (3) Bagi orangtua hendaknya memperhatikan dan mendampingi anak dalam kegiatan belajarnya di rumah sehingga anak termotivasi untuk belajar lebih giat lagi; (4) Peneliti yang akan datang diharapkan penelitian ini untuk ditindaklanjuti dengan variabel yang berbeda dan sampel yang lebih luas.

Studi tentang aspek-aspek yang dipertimbangkan guru dalam penilaian ranah psikomotorik, kognitif, afektif pada pembelajaran pendidikan jasmani, olahraga dan kesehatan di SMP se-kecamatan Kesamben Kabupaten Blitar / Mohamad Ryan Dzul Fahmi

 

ABSTRAK Fahmi, Mohamad Ryan Dzul. 2009. Studi tentang Aspek-aspek yang Dipertimbangkan Guru dalam Penilaian Ranah Psikomotorik, Kognitif, Afektif pada Pembelajaran Pendidikan Jasmani, Olahraga dan Kesehatan di SMP se-Kecamatan Kesamben Kabupaten Blitar. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing (I) Dra. Siti Nurrochmah, M.Kes, (II) Drs. Mulyani Surendra, M.S. Kata kunci : penilaian, ranah psikomotorik, kognitif, afektif. Untuk mengetahui ketercapaian tujuan pendidikan, terutama untuk mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan maka dapat dilakukan dengan cara melaksanakan penilaian. Dimana tujuan dilakukannya penilaian adalah untuk mengetahui seberapa jauh kemampuan siswa dan berhasil tidaknya proses pembelajaran yang dilakukan oleh para pengajar dan siswa. Terutama untuk perubahan-perubahan perilaku siswa yang diharapkan melalui proses belajar. Secara umum, dalam pembelajaran Pendidikan Jasmani, Olahraga dan Kesehatan terdapat 3 ranah yang diharapkan mampu dikuasai oleh siswa sebagai hasil belajar. Ketiga ranah tersebut adalah ranah kognitif, afektif, dan psikomotorik. Dalam penilaian ketiga ranah tersebut, aspek-aspek yang terdapat dalam masing-masing ranah penilaian tentu berbeda-beda. Berdasarkan pengamatan awal yang dilakukan peneliti di Kecamatan Kesamben diperoleh hasil bahwa dalam melaksanaan penilaian guru Pendidikan Jasmani, Olahraga dan Kesehatan di SMP se-Kecamatan Kesamben belum mengetahui aspek-aspek yang seharusnya dipertimbangkan dalam penilaian ranah kognitif, afektif, dan psikomotorik pada pembelajaran Pendidikan Jasmani, Olahraga dan Kesehatan berdasarkan kurikulum tingkat satuan pendidikan (KTSP). Belum sepenuhnya menggunakan sistem penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan yang sesuai dengan kurikulum tingkat satuan pendidikan (KTSP), dan masih ada beberapa aspek yang sebenarnya tidak termasuk dalam kurikulum tingkat satuan pendidikan (KTSP) untuk aspek penilaian ranah kognitif, afektif, psikomotorik digunakan untuk menilai siswa pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan. Oleh karena itu peneliti tertarik untuk mengetahui aspek-aspek apa saja yang dipertimbangkan guru dalam memberikan nilai mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan pada ranah psikomotorik, kognitif, afektif. Rumusan masalah dalam penelitian ini yaitu aspek-aspek apa saja yang dipertimbangkan guru dalam memberikan nilai pada ranah psikomotorik, kognitif, afektif. Penelitian ini bertujuan untuk mengetahui dan mengkaji aspek-aspek yang dipertimbangkan guru dalam memberikan penilaian pada ranah psikomotorik, kognitif, afektif. Penelitian ini dilakukan di seluruh SMP se-Kecamatan Kesamben yang berjumlah 6 SMP. Yang menjadi subyek penelitian adalah guru mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan di SMP se-Kecamatan Kesamben yang berjumlah 9 orang guru. Jenis penelitian ini termasuk penelitian deskriptif, instrumen yang digunakan dalam penelitian ini berupa instrumen angket dan analisis data yang digunakan adalah teknik analisis persentase. Hasil penelitian yang telah dilakukan menunjukkan bahwa aspek-aspek yang dipertimbangkan oleh guru dalam penilaian ranah psikomotorik pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan menurut penelitian ini adalah aspek keterampilan olahraga 100%, kebugaran jasmani 88,9%, dan kelincahan 77,8%. Hasil penelitian yang selanjutnya yaitu aspek-aspek yang dipertimbangkan oleh guru dalam penilaian ranah kognitif pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan menurut penelitian ini adalah aspek pengetahuan pendidikan jasmani dan olahraga 100%, aplikasi teknik 77,8%, dan pengetahuan perilaku hidup sehat 66,7%. Sedangkan hasil penelitian tentang aspek-aspek yang dipertimbangkan oleh guru dalam penilaian ranah afektif pada mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan menurut penelitian ini adalah aspek sikap disiplin dan kerjasama 100%, sportif dan motivasi 88,9%, tanggungjawab dan percaya diri 77,8%, dan kejujuran 55,5%. Berdasarkan penelitian ini dapat diberikan saran kepada guru Pendidikan Jasmani, Olahraga dan Kesehatan dalam melakukan penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan hendaknya berpedoman pada buku panduan penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan pada kurikulum tingkat satuan pendidikan (KTSP), sehingga mengetahui aspek-aspek yang seharusnya dipertimbangkan dalam melakukan penilaian mata pelajaran Pendidikan Jasmani, Olahraga dan Kesehatan serta tidak terkesan seenaknya dalam melakukan penilaian.

Penerapan pendekatan pembelajaran matematika realistik Indonesia (PMRI) untuk meningkatkan prestasi belajar siswa pada materi bangun ruang di kelas VIII SMP Negeri 5 Malang / Hustiawan Adha Cahyono

 

ABSTRAK Cahyono, Hustiawan Adha. 2009. Penerapan Pendekatan Pembelajaran Matematika Realistik Indonesia (PMRI) untuk Meningkatkan Prestasi Belajar Siswa Pada Materi Bangun Ruang di Kelas VIII D SMP Negeri 5 Malang. Skripsi, Program Studi Pendidikan Matematika Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dra. Santi Irawati, M.Si, Ph.D (II) Drs. Rustanto Rahardi, M.Si. Kata Kunci: PMRI, prestasi siswa dan penelitian tindakan kelas Penelitian ini berawal dari keadaan kelas VIII D yang tidak menyukai matematika. Berdasarkan pengamatan langsung yang dilakukan pada waktu PPL (praktek pengalaman lapangan) terlihat bahwa siswa tidak berani bertanya dan kurang motivasi dalam belajar matematika. Hal ini menyebabkan perolehan nilai siswa tidak mencapai KKM (Kriteria Ketuntasan Minimum). Demikian juga berdasarkan hasil wawancara dengan guru mata pelajaran matematika, didapat bahwa banyak siswa yang tidak mencapai KKM pada materi kubus dan balok. Bangun kubus dan balok ini sering dijumpai pada kehidupan sehari-hari sehingga diperlukan pembelajaran yang khusus yaitu PMRI (Pembelajaran Matematika Realistik Indonesia). Berdasarkan pengamatan tersebut perlu dilakukan penelitian untuk meningkatkan prestasi belajar siswa pada materi bangun ruang kelas VIII D dengan menggunakan PMRI. Penelitian merupakan penelitian tindakan kelas yang menggunakan 4 tahap yaitu perencanaan, tindakan, pengamatan dan refleksi. Dalam pelaksanaannya, penelitian ini dilaksanakan menggunakan dua siklus. Pada siklus I dilakukan 5 kali tindakan sedangkan pada siklus II hanya 1 kali tindakan. Sebelum pelaksanaan siklus I diberikan pretes untuk mengetahui kemampuan awal siswa, kemudian diberikan postes setelah akhir siklus I dan siklus II. Postes ini untuk mengetahui ada tidaknya peningkatan prestasi belajar siswa pada bangun ruang kelas VIII D di SMP Negeri 5 Malang. Berdasarkan hasil penelitian diperoleh bahwa prestasi belajar pada materi bangun ruang siswa kelas VIII D SMP Negeri 5 Malang meningkat. Hal ini ditunjukkan oleh nilai rata-rata pretes yaitu 62,74 yang meningkat pada nilai rata-rata postes siklus I yaitu 76,18 menjadi 88,1 pada nilai rata-rata siklus II. Di samping itu juga dilihat dari banyaknya siswa yang tuntas belajar mengalami peningkatan yaitu dari nilai pretes siklus I diketahui 29% siswa tuntas belajar kemudian untuk nilai postes siklus I siswa yang tuntas belajar naik menjadi 74%. Pada siklus II banyak siswa yang tuntas belajar naik lagi menjadi 97%. ABSTRACT Cahyono, Hustiawan Adha. 2009. Application of Indonesia Realistic Mathematics Learning (PMRI) Approach to Increase Students'Learning Achievement on 3D Concept in Class VIII D SMP Negeri 5 Malang. Thesis, Departement of Mathematics Faculty of Mathematics and Sciences State University of Malang. Advisors: (I) Dra. Santi Irawati, M.Si. Ph.D (II) Drs. Rustanto Rahardi, M.Si Key words: PMRI, student achievement and research of class measure This research is started from the students' of VIII D classroom that dislike mathematic lesson. Based on the direct observation that was doing when PPL (Praktek Pengalaman Lapangan), it is shown that the student did not brave to ask and did not have quite motivation in mathematic learning. It could cause that students' achievement can not reach the KKM (Kriteria Ketuntasan Minimum). Moreover, based on the result of interview with mathematic teacher, it is concluded that many students can not reach the KKM on cube and cuboid topics. These cube and cuboid concept are often encountered in daily life so that it is needed a special learning such as Pembelajaran Matematika Realistik Indonesia (PMRI). Based on that observation, it is needed to have a research to increase students' learning achievement on 3D concept for grade VIII D at SMPN 5 Malang by using PMRI. The research is a classroom action research using 4 stages of planning, action, observation and reflection. In implementation, this research is carried out using two cycles. There are performed five actions in cycle I and only one action in cycle II. Before the implementation it was given to determine the students' prior know ledge a pretest prior knowledge, and then a post test in the end of cycle I and cycle II. These post test is given to know the improvementof students' learning achievement in 3D concept in grade VIII D SMP Negeri 5 Malang. Based on research results, it is obtained that the students' learning achievement in 3D concept grade VIII D at SMP Negeri 5 Malang is increased. This is indicated by the average value of pretest 62.74 which is increased at an average value of post test in the cycle I that is 76.18 into 88.1 in cycle II. Beside, the number of students who reached the KKM is increased from 29% (pre test I) into cycle I into 74% (pos test I). In cycle II the number of students who reached the KKM is 97% (post test II).

Pengaruh model pembelajaran TGT (Teams Games Tournament) terhadap hasil belajar geografi di MTs Negeri Pulosari, Ngunut Kabupaten Tulungagung / Titis Nurhayati

 

Pembelajaran merupakan proses interaksi yang terjadi antara guru dengan siswa agar siswa mendapatkan pengalaman belajar dari kegiatan tersebut. Dalam proses pembelajaran, pemilihan suatu metode sangat menentukan kualitas pembelajaran. Seiring dengan proses peningkatan kualitas pembelajaran, maka dalam kurikulum KTSP dianjurkan adanya variasi metode dalam kegiatan pembelajaran agar siswa dapat terlibat aktif di dalamnya. Variasi metode dapat ditunjukkan jika guru menerapkan berbagai model pembelajaran untuk menyampaikan materi, karena di dalam model pembelajaran terdapat beberapa metode yang dapat diterapkan sehingga melibatkan siswa aktif. Salah satu pendekatan pembelajaran yang melibatkan siswa aktif adalah pembelajaran yang bersifat konstruktivis. Dalam pembelajaran konstruktivis ada beberapa model yang dapat diterapkan, salah satunya adalah model pembelajaran TGT (Teams Games Tournament). Dalam model pembelajaran ini pengelompokan siswa berdasarkan prinsip heterogenitas baik dari segi kemampuan akademik, jenis kelamin, maupun ras. Penelitian ini bertujuan untuk mengetahui pengaruh model pembelajaran TGT (Teams Games Tournament) terhadap hasil belajar Geografi siswa kelas VII MTs Negeri Pulosari pada topik Hidrosfer. Penelitian ini termasuk jenis penelitian eksperimen semu (Quasi Eksperiment) dengan mengambil subjek penelitian dua kelas yaitu kelas VII C sebagai kelas eksperimen dan kelas VII A sebagai kelas kontrol. Instrumen penelitian berupa tes untuk prates dan pascates. Teknik analisis yang digunakan adalah uji t tidak berpasangan (Independent Samples Test) yang dapat diselesaikan dengan bantuan SPSS 13.00 for Windows. Hasil penelitian menunjukkan bahwa terdapat perbedaan yang signifikan antara nilai rata-rata kelas eksperimen dankelas kntrol. Dari hasil analisis data diketahui bahwa hasil belajar siswa pada kelas eksperimen memiliki rata-rata sebesar 27,50 sedangkan pada kelas kontrol memiliki rata-rata 23,29 dengan nilai probabilitas (p) 0,009, sehingga ada pengaruh penerapan model pembelajaran TGT terhadap hasil belajar Geografi siswa pada topik Hidrosfer. Disarankan bagi guru Geografi untuk menggunakan model pembelajaran TGT sebagai variasi model pembelajaran karena dapat meningkatkan hasil belajar siswa. Bagi peneliti selanjutnya disarankan untuk menggunakan model ini untuk materi selain topik Hidrosfer.

Implikasi realistic mathematic education (RME) terhadap tingkat pemahaman siswa kelas II sekolah dasar pada materi pembagian / Otik Mulyantiningsih

 

ABSTRAK Mulyantiningsih, Otik. 2009. Implikasi Realistic Mathematics Education (RME) terhadap Tingkat Pemahaman Siswa Kelas II Sekolah Dasar pada Materi Pembagian. Skripsi, Jurusan Matematika, FMIPA, Universitas Negeri Malang. Pembimbing: (I) Dra. Etty Tedjo Dwi C., M.Pd, (II) Drs. H. Imam Supeno, M.S. Kata Kunci: realistic mathematics education, tahapan pemahaman konsep, tes pemahaman konsep. Matematika merupakan salah satu alat untuk menyusun pemikiran yang jelas, tepat, dan taat azas. Dalam pembelajaran matematika perlu dikembangkan materi dan proses pembelajaran matematika yang sesuai dengan kebutuhan, perkembangan kognitif dan keterampilan intelektual siswa sehingga konsep matematika yang bersifat abstrak dapat dipahami dengan mudah dan bermakna. Observasi awal yang dilakukan di SDN Saptorenggo I Pakis Malang pada kelas II menunjukkan bahwa pembelajaran dilakukan dengan cara tradisional, pemahaman konsep siswa masih kurang sehingga sulit memahami materi perkalian, soal latihan yang digunakan adalah soal hitung murni, dan pembelajaran kurang bermakna. Oleh karena itu perlu adanya pembelajaran yang dapat mengaitkan konsep matematika dengan pengalaman anak sehari-hari yaitu dengan menerapkan Realistic Mathematics Education (RME). Dalam penelitian ini, jenis penelitian yang digunakan adalah Deskriptif Kualitatif. Penelitian dilaksanakan pada tanggal 3-21 Maret 2009 dengan banyaknya siswa 43 orang. Hasil penelitian disajikan secara deskriptif. Pembelajaran Matematika Realistik yang diterapkan diawali dengan pemberian masalah kontekstual dengan menggunakan alat peraga. Masalah didiskusikan secara kelompok dan hasil diskusi kelompok disajikan dalam diskusi kelas yang bertujuan untuk mendapatkan kesimpulan dari masalah yang diberikan. Hasil penelitian menunjukkan bahwa Pembelajaran Matematika Realistik meningkatkan kemampuan pemahaman konsep siswa kelas II SDN Saptorenggo I Pakis Malang pada materi pembagian. Untuk penelitian selanjutnya disarankan untuk menerapkan Realistic Mathematics Education (RME) dengan memberikan soal-soal yang mempunyai jawaban terbuka dan pembelajaran kooperatif agar siswa terbiasa bekerja dalam kelompok.

Penerapan model pembelajaran Talking Stick untuk meningkatkan kemampuan membaca pemahaman siswa kelas V SDN Jetis 1 Kabupaten Nganjuk / Zenny Dwi Lutfita

 

Kata Kunci:Model PembelajaranTalking Stick, Membaca Pemahaman, Sekolah Dasar Hasilobservasi yang dilakukanpeneliti di kelas V SDNJetis 1KabupatenNganjukpadapembelajaranBahasa Indonesia materimembacapemahamandidapatkanfaktasebagaiberikut. (1) Siswamasihmengalamikesulitandalammemahamiisibacaan; (2) Saat guru menanyakantentangisibacaan, siswacenderungmenanyakanjawabanpadatemanatau guru tanpamaumembacakembaliteksbacaan; (3) Rata-rata hasilbelajarsiswahanyamencapai 66,7 denganketuntasankelas 45,8%, sedangkanKKM yang ditentukanadalah 70,00 untukhasilbelajardan 75% untukketuntasan belajar klasikal. Untukmeningkatkankemampuanmembacapemahamansiswa kelas V SDN Jetis 1, perludiadakanperbaikanpembelajaran salah satu alternatifnya menerapkan model Talking Stick. Penelitianinibertujuanuntukmendeskripsikanpenerapan model Talking StickpadapembelajaranBahasa Indonesia. Mendeskripsikankemampuanmembacapemahamansiswasetelahmenerapkan model Talking Stickpadakelas V SDN Jetis 1. Penelitianinimenggunakanjenispenelitiantindakankelasdenganpendekatandeskriptifkualitatif model kolaboratif. Subyekpenelitianadalahsiswakelas V SDNJetis 1 KabupatenNganjuk yang berjumlah 24 siswa. Data yang diambil yaitu pelaksanaan pembelajaran menerapkan model Talking Stick dan hasil belajar siswa. Data diperoleh melalui observasi, wawancara, tesdandokumentasi. Hasilpenelitianmenunjukkanbahwapenerapan model Talking Stick yang berlangsungsecaraefektifdanseksamadapatmeningkatkankemampuanmembacapemahamansiswa kelas V SDN Jetis 1. Hal tersebutterbuktidarinilai rata-rata hasilbelajarsiswapadapratindakan 66,7, siklusI 71, sedangkanpadasiklus II meningkatmenjadi85. Ketuntasanbelajarpadapratindakan45,8%, siklus I 66,7%, danpadasiklusII meningkatmenjadi 83,3%. Saran yang dapatdiberikanberdasarkanhasilpenelitianiniantar lain: (1) untukkesempurnaanpenerapan model pembelajaran Talking Stickharusdisediakanalokasiwaktu yang cukup agar tidakmengurangitahapberpikirdanmenjawabsiswa; (2) guru hendaknyamembuatvariasi model pembelajaranmemadukan model pembelajaran Talking Stick denganmetode yang lain; (3) dalampenilaian guru hendaknyamenekankanpemahamansiswapadaaspekkemampuanmembaca yang ditentukan.

The implementation of bilingual education at Klabat University and its outcomes in terms of students' English proficiency and their achievement in subject-matter / Adele Micheline Pattiradjawane

 

ABSTRACT Pattiradjawane, Micheline Adele. 2009. The Implementation of Bilingual Education at Klabat University and Its Outcomes as Seen in Students’ English Proficiency and their Achievement in Subject-matter. Dissertation, English Education Program, Post Graduate Program, State University of Malang. Advisors: (I) Prof. Dr.H. M. F. Baradja, M.A., (II) Prof. Drs. Bambang Yudi Cahyono, M.Pd, M.A., Ph.D., and (III) Prof. Dr. Siusana Kweldju, M.Pd Key words : implementation, bilingual education, English proficiency, achievement in bilingual subject-matter An important change taking place in the educational system of Indonesia is the use of English as medium of instruction for a number of content courses, while Bahasa Indonesia is still maintained as medium of instruction. This phenomenon has aroused attention of educational authorities. The two foci of the study are the implementation of the bilingual program and its outcomes as seen in students’ English proficiency and their achievement in subject-matter. With reference to the first focus, the objective of this study is to describe the implementation of bilingual education at Klabat University (KU). The second objective is to describe the outcomes of bilingual education in terms of students’ English proficiency and their achievement in subject-matter. The investigation into the implementation of bilingual education focused on practices that promoted and impeded the implementation, how English was cultivated in the bilingual program and how bilingual courses were conducted. The investigation on students’ outcomes focused on their English proficiency, their achievement in three bilingual courses, and the relationships between English proficiency and achievement in subject-matter. In order to achieve the objectives above, the research methods were qualitative and quantitative. Being dominantly a qualitative study the design adopted in this study was an emergent design. In order to describe the implementation of the bilingual program, the qualitative method was used. In order to describe the outcomes of bilingual education, the quantitative method was used. In order to describe the relationships between students’ English proficiency and their achievement in subject-matter, the qualitative method was employed. Three sampling procedures were used in the study: (1) snowballing sampling for respondents for the interview on the policies in implementation of bilingual education, (2) purposive sampling for six respondents to the questionnaire on policies and cultivation of English, and (3) proportional purposive sampling for subjects on their English proficiency and achievement in subject-matter. The subjects were students attending bilingual courses at KU. Each subject represented a level of proficiency. Their levels of proficiency were based on their scores on the placement test administered by the KU when they were accepted into the university. The four different levels of proficiencies were beginning English level, lower elementary level, upper elementary level, and intermediate level. Three methods were used to obtain data on the implementation of bilingual education: (1) interviewing respondents who were involved in the implementation of bilingual education, (2) distributing a questionnaire on the implementation of bilingual education to six lecturers from the School of Economics, and (3) observing the implementation of three bilingual courses: Intermediate Accounting II, Business Finance II, and Controllership. Data collection on the outcomes of bilingual education used five methods: administering the English Placement Test to the sample (N=44), administering the Test of English as a Foreign Language to the sample (N=32), obtaining the list of test scores on achievement in subject-matter from the lecturers who conducted the bilingual courses, distributing a questionnaire on students’ self perception of their achievement, and interviewing lecturers on their perception of students’ achievement. Data on the implementation of bilingual education were analyzed by crafting a profile. The quantitative data on students’ scores were analyzed by using descriptive statistics with using the t-test. The perception questionnaire was analyzed by data reduction, coding and categorizing. The findings show that the implementation of bilingual education at KU followed a natural course of events and was dominated by good practices such as complying with the procedures outlined in the university’s constitution, taking creative actions with no dependency on government’s fundings, imposing no pressure on students and teachers to use English thus allowing a comfortable sociolinguistic situation to emerge in which three languages coexists. The cultivation of English was extensive: English was used in academic and non-academic activities. However, the conducting of bilingual courses lacked in aspects of technology. Findings on the outcomes of bilingual education show that, in terms of English proficiency there was no significant difference between students’ scores on entry in the university and students’ second scores on the placement test. However, on analyzes by each level of proficiency, beginning English and lower elementary level students made significant gain in their English proficiency. Students at the upper elementary level gained in proficiency but not significantly, but intermediate students showed no gain in proficiency. It is concluded that students’ English proficiency is adequate for studies at KU. Findings on achievement in subject-matter are students’ achievement was satisfactory. Students’ achievement in subject-matter indicate students employ language knowledge and pragmatic strategies to work on the test tasks in the TLU domain. Achievement in IA II showed that the class is heterogeneous with σ 22.36 and variance of 499.99. Achievement in BF II showed that the class was homogenous with σ 4.42 and variance 19.5. Achievement in the CTR class showed a heterogeneous class with σ 9.37 and variance 87.97. It is concluded that students’ achievement is satisfactory due to an interplay of students’ computation skills, students’ strategies, students’ reading proficiency and students’ academic performance as attributed to having high GPA’s. In addition, there is no relationship between students’ English proficiency and their achievement. The conclusions drawn are that the implementation of bilingual education had practices that promoted the program. This study recommends the continuation of the bilingual education program at KU while working toward students’ graduating with dual certificates.

Studi tentang waktu pembelajaran pendidikan jasmani olahraga dan kesehatan di SMP negeri 19 Malang / Khoirul Insani

 

Insani, Khoirul. 2009. Studi Tentang Waktu Pembelajaran Pendidikan Jasmani Olahraga dan Kesehatan di SMP Negeri 19 Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. M. E. Winarno, M. Pd., (2) Dra. Desiana Merawati, M. S. Kata kunci: Pembelajaran, Pelaksanaan Waktu Belajar, Pendidikan Jasmani. Waktu belajar merupakan bagian yang tak terpisahkan dari tingkat keberhasilan proses belajar mengajar (PBM) suatu mata pelajaran. Pelaksanaan waktu belajar pendidikan jasmani dilakukan untuk mengetahui seberapa besar tingkat keberhasilan pengajaran dilihat dari waktu belajar akademis pendidikan jasmani. Dalam kegiatan pengajaran pendidikan jasmani, penilaian dilakukan terhadap beberapa variabel yaitu: kegiatan awal sebelum pembelajaran, pendahuluan, latihan inti, dan penutup. Tujuan dari penelitian ini adalah untuk mengetahui pelaksanaan waktu belajar pendidikan jasmani dilihat dari kegiatan awal sebelum pembelajaran, pendahuluan, latian inti dan penutup. Permasalahan dari penelitian ini adalah apakah guru sudah melaksanakan waktu belajar pendidikan jasmani yang sudah direncanakan. Rancangan yang digunakan dalam penelitian ini adalah penelitian deskriptif kuantitatif dengan variabel kriteria berdasarkan waktu belajar akademis pendidikan jasmani. Alat ukur yang digunakan dalam pengambilan data berupa panduan observasi. Subyek dalam penelitian ini adalah guru pendidikan jasmani yang ada di SMP Negeri 19 Malang yang berjumlah 2 guru pendidikan jasmani. Diperoleh reliabilitas adalah 0,986 dan objektivitas adalah 0,999. Hasil penelitian menunjukkan bahwa pelaksanaan waktu belajar pendidikan jasmani oleh guru pendidikan jasmani di SMP Negeri 19 Malang tergolong masih kurang maksimal, kegiatan awal pembelajaran 58,3% guru yang menyiapkan perangkat pembelajaran, pada pelaksanaan kegiatan, pada tahap pendahuluan 22,67 menit (283,37%), tahap latihan inti 28,33 menit (42,92%) dan tahap penutup 4,85 menit (80,83%). Secara keseluruhan pelaksanaan waktu pembelajaran pendidikan jasmani 56,43 menit atau 70,53%. Saran-saran dari hasil penelitian adalah sebagai berikut: ditinjau dari setiap variabel, pembelajaran pendidikan jasmani yang dilakukan oleh guru di SMP Negeri 19 Malang kurang efektif. Diharapkan semua guru menyusun perangkat pembelajaran, pendahuluan yang dilakukan masih terlalu lama, sebaiknya dipersingkat agar waktu dapat difokuskan pada tahap inti. Guru diharapkan melibatkan siswa dalam memilih materi yang akan diajarkan dalam satu semester atau satu tahun.

Legenda watugunung sebagai sumber koreografi yang menggali nilai budaya pernikahan sedarah dalam pendidikan moral Jawa / Eko Purwaningsih

 

ABSTRAK Purwaningsih, Eko. 2009. Legenda "Watugunung" sebagai Sumber Koreografi yang Menggali Nilai Budaya Pernikahan Sedarah dalam Pendidikan Moral Jawa. Skripsi Penciptaan Karya Seni, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Drs. Soerjo Wido Minarto, M.Pd, (II) Drs. Supriyono. Kata kunci : Pendidikan Moral, Pernikahan Sedarah, Pembuatan koreografi Legenda "Watugunung". Pendidikan moral merupakan sebuah cara membimbing seseorang yang dilakukan dengan sengaja oleh orang dewasa kepada anak-anak untuk memberikan suatu pelajaran nilai atau norma, baik buruknya suatu perbuatan. Pendidikan moral dapat dilakukan lewat berbagai media, hal ini memberikan kesempatan luas kepada pihak untuk berperan aktif dalam memajukan pendidikan kita. Perkawinan Sedarah atau Incest adalah hubungan badan atau hubungan seksual yang terjadi antara dua orang yang mempunyai ikatan pertalian darah. Dalam hal ini hubungan seksual sendiri ada yang bersifat sukarela dan ada yang bersifat paksaan. Paksaan itulah yang dinamakan perkosaan. Jika itu terjadi antara dua orang yang bertalian darah itulah yang dinamakan Incest. Dan kasus Incest yang lebih banyak diketahui masyarakat adalah perkosaan Incest. Penciptan karya tari dramatik "Watugunung" bertujuan untuk mengetahui proses penciptaan karya sebagai sarana pengenalan budaya pernikahan sedarah dan pendidikan moral. Sebuah koreografi ini ditujukan tidak hanya untuk pelajar tetapi juga masyarakat umum, karena dalam tari ini memberikan sebuah pendidikan moral tentang pernikahan sedarah yang berdampak negatif, dan perlu diperhatikan baik dari masyarakat maupun para pelajar khususnya, sebagai media pendidikan. Semakin berkurangnya nilai-nilai moral dalam era modernitas ini mendorong koreografer untuk melakukan upaya mengembangkan legenda Watugunung sebagai salah satu legenda perkawinan sedarah di Indonesia ke dalam bentuk karya tari, yang membawa pesan dan nilai moral bagi masyarakat luas. Dalam koreografi berjudul Watugunung (dalam wacana Incest) penggarapan koreografi legenda Watugunung sebagai pengenalan budaya dan pendidikan moral, koreografer mencoba untuk bisa menawarkan suatu hal baru dalam sebuah karya tari, baik saat berproses latihan atau pada saat pementasan. Pembawaan gerak tari yang bernuansa baru dikemas dengan teatrikal, dan duet, kemudian lighting, musik, coba di optimalkan pada saat pementasan. Selama proses pembuatan koreografi legenda Watugunung ini banyak sekali bantuan yang diberikan dari tim kreatif dan para penari, berupa dorongan kreatifitas, semangat dan juga data yang menunjang riset, sehingga pelaksanaan pembuatan dan penyusunan koreografi ini berjalan dengan baik. Dari hasil penyusunan koreografi ini, terbagi atas empat adegan. Dengan mengambil tema perkawinan sedarah atau Incest. Judul tari Watugunung berasal dari sebuah legenda yang hidup pada masyarakat Jawa dan Bali, dimana legenda ini menceritakan seorang anak yang menikahi ibunya sendiri dan legenda ini adalah sebagai dasar munculnya hitungan waktu atau wuku pada masyarakat Jawa dan Bali.

Translation analysis in menu of mobile phone: the Indonesian language used in Nokia 3530 / Halim Rosyid

 

This study aimed at analysing the Indonesian translation in the menu of Nokia 3530. In addition, this study focused on examining the translation procedures used to translate menu items in mobile phone Nokia 3530, identifying the degree of message conservation and also suggesting some improvements for the translations. The results of this study showed that the most dominant translation procedure used to translate words was literal translation, used to translate phrases was transposition, used to translate sentences is literal translation. Another result was about the degree of message conservation. Most translations of word, phrase and sentence in menu items of Nokia 3530 were considered as faithful translation. Key words: translation, translation analysis, menu, mobile phone.

Pengembangan media VCD pembelajaran metode permainan (baris bilangan) pada mata pelajaran matematika pokok bahasan operasi bilangan bulat untuk SD kelas IV semester II / Nur Rohmad

 

ABSTRAK Rohmad, Nur. 2009. Pengembangan Media VCD Pembelajaran Metode Permainan ‘Baris Bilangan’ Pada Mata Pelajaran Matematika Pokok Bahasan Operasi Bilangan Bulat Untuk SD Kelas IV Semester II. Skripsi. Jurusan Teknologi Pendidikan FIP Universitas Negeri Malang. Pembimbing : (I) Dr. Imanuel Hitipeuw, MA, (II) Eka Pramono Adi, M.Si. Kata kunci: Pengembangan, Media VCD Pembelajaran, Permaianan Baris Bilangan, Matematika. Media VCD pembelajaran adalah media pembelajaran yang penyampaiannya memadukan unsur audio, visual dalam waktu yang bersamaan sehingga dapat menarik minat pengguna. Matematika merupakan mata pelajaran yang bersifat abstrak, sehingga dituntut kemampuan guru untuk dapat mengupayakan metode yang tepat sesuai dengan tingkat perkembangan mental siswa. Untuk itu diperlukan model dan media pembelajaran yang dapat membantu siswa untuk mencapai kompetensi dasar dan indikator pembelajaran. Salah satu media yang sesuai dengan perkembangan teknologi saat ini adalah media VCD pembelajaran. Tujuan pengembangan VCD pembelajaran ini adalah untuk membuat media VCD pembelajaran metode permainan “Baris Bilangan” pada mata pelajaran Matematika pokok bahasan Operasi Bilangan Bulat untuk Sekolah Dasar kelas IV semester II yang efektif dan dapat membantu proses pembelajaran. Subyek ujicoba dalam pengembangan media CD pembelajaran ini adalah siswa kelas IV SD Laboratorium UM. Jenis data pengembangan ini adalah kualitatif deskriptif. Sedangkan pengumpulan data dilakukan melalui observasi, serta menggunakan instrumen berbentuk angket yang diberikan kepada ahli media, ahli materi, dan siswa. Untuk hasil belajar siswa digunakan evaluasi dalam bentuk pre test dan post test. Analisis data yang digunakan untuk mengolah data hasil validasi ahli media, ahli materi, dan audiens adalah prosentase, sedangkan untuk mengolah hasil belajar siswa digunakan diagram perbandingan. Hasil pengembangan media VCD pembelajaran ini berdasarkan analisis data dari 2 ahli media, 1 ahli materi, dan siswa, kemudian dianalisia berdasarkan atas tabel spesifikasi Sudjana, memenuhi kriteria valid, atau dapat dikatakan ahli media setuju bahwa VCD pembelajaran ini sudah layak untuk diterapkan, dengan hasil yakni ahli media 95 %, ahli materi 92,5 %, audiens 87,89 %. Sedangkan untuk tes hasil belajar menunjukkan media VCD pembelajaran ini memberikan efek positif terhadap hasil belajar siswa, itu dapat membuktikan bahwa meskipun materi sudah pernah diajarkan ternyata media ini efektif. Saran yang diajukan, hendaknya hasil produk media VCD pembelajaran ini dipergunakan dengan sebaik-baiknya dan ditindak lanjuti sehingga dapat memberikan kontribusi yang berarti terhadap pembelajaran di Sekolah Dasar (SD), khususya untuk mata pelajaran matematika.

Pengembangan media compact disc (CD) interaktif pembelajaran bahasa Jerman untuk keterampilan mendengar dan menulis di SMA Negeri I Tumpang / Nina Izati

 

ABSTRAK Izati, Nina. 2009. Pengembangan Media Compact Disc (CD) Interaktif untuk Keterampilan Mendengar dan Menulis di SMA Negeri I Tumpang. Skripsi, Jurusan Pendidikan Bahasa Jerman Fakultas Sastra Universitas Negeri Malang. Pembimbing: (1) Dra. Sawitri Retnantiti, M.Pd, (II)Edy Hidayat, S.Pd, M.Hum,. Kata kunci: pengembangan, media CD interaktif, pembelajaran bahasa Jerman. Media CD interaktif adalah salah satu media yang bisa digunakan dalam pembelajaran bahasa Jerman yang mampu menggabungkan teks, grafis, gambar, foto, audio, video, dan animasi secara terintegrasi. Berdasarkan hasil wawancara dengan guru matapelajaran bahasa Jerman SMA Negeri I Tumpang dan hasil dari angket analisis kebutuhan, diketahui bahwa 1) prestasi belajar bahasa Jerman siswa kelas XI program Bahasa menurun, 2) siswa tidak begitu antusias dalam mengikuti kegiatan pembelajaran bahasa Jerman, 3) siswa mengalami banyak kesulitan dalam mempelajari Grammatik bahasa Jerman, 4) siswa mengalami banyak kesulitan dalam pembelajaran bahasa Jerman keterampilan menulis dan belum pernah mendapatkan kegiatan pembelajaran untuk keterampilan mendengar, dan 5) media CD interaktif belum pernah digunakan dalam kegiatan pembelajaran bahasa Jerman. Pengembangan media yang mampu mengkombinasikan keterampilan mendengar dan keterampilan menulis dianggap efektif untuk mengatasi permasalahan tersebut. Oleh sebab itu, pengembang memilih mengembangkan media CD interaktif, yang dengan kelebihannya mampu mengintegrasikan pembelajaran untuk keterampilan mendengar dan menulis. Tujuan dari penelitian pengembangan ini adalah mengembangkan media CD interaktif pembelajaran bahasa Jerman keterampilan mendengar dan menulis guna memenuhi kebutuhan sekolah akan media. Untuk tujuan penelitian pengembangan ini, pengembang menggunakan pendekatan deskriptif kualitatif. Data kualitatif berasal dari hasil wawancara, angket, observasi, dan hasil tes mendengar dan menulis siswa. Sebelum diujikan di lapangan, produk media ini divalidasi oleh dua ahli, yaitu ahli media dan ahli materi untuk menilai kelayakan media. Subjek uji coba pada penelitian pengembangan ini adalah guru bahasa Jerman dan 29 siswa kelas XI program bahasa SMA Negeri I Tumpang. Angket pada tahap validasi dan uji coba dianalisis dengan menggunakan persentase. Hasil wawancara dan hasil observasi dianalisis secara deskriptif. Adapun nilai siswa dijadikan sebagai data pendukung angket uji coba siswa. Hasil dari penelitian pengembangan ini adalah media CD interaktif dapat digunakan dalam proses pembelajaran dengan sedikit revisi. Menurut pendapat ahli media, dikatakan bahwa media sangat valid dengan persentase sebesar 85%. Pendapat ini didukung oleh ahli materi yang menyebutkan, bahwa media sangat valid dengan persentase sebesar 85%. Adapun menurut guru, media sangat valid dengan persentase sebesar 84%. Dari angket siswa diperoleh hasil, bahwa media cukup valid dengan sedikit revisi, dengan persentase 76.52%. iv AUSZUG Izati, Nina. 2009. Das Entwickeln der Compact Disc (CD) Interaktiv des Deutschunterrichtmediums für die Hör- und Schreibfertigkeit in der SMAN I Tumpang. Diplomarbeit. Deutschabteilung der Literaturwissenschaftlichen Fakultät der Staatlichen Universität Malang. Beraterin (I) Dra. Sawitri Retnantiti, M.Pd,. Berater (II) Edy Hidayat, S.Pd, M.Hum,. Schlüsselwörte: Entwicklung, CD-Interaktiv, Deutschunterricht. CD-Interaktiv ist eines der Medien im Deutschunterricht, das Texte, Grafik, Bild, Fotos, Audio, und eine Animation einbinden kann. Aufgrund des Interviews mit der Deutschlehrerin an der SMAN I Tumpang und der Umfrage der Bedarfanalyse, kann gewusst werden, dass 1) die Lernsergebnises der Schüler von Klasse XI Sprachabteilung im Deutschunterricht abfallen sind, 2) die Schüler wenige Begeisterung um Deutsch zu lernen haben, 3) die Schüler beim Deutschunterricht Probleme um Grammatik zu lernen haben, 4) die Schüler beim Deutschunterricht Probleme in der Schreibfertigkeit haben und noch nie Hörfertigkeit im Deutschunterricht gelernt haben, und 5) CD-Interaktif noch nie im Deutschunterricht benutzt wird. Dann braucht ein Lehrer ein Lehrmedium, das die Hör- und Schreibfertigkeit kombinieren kann. Aus diesem Grund möchte die Verfasserin eine CD Interaktiv entwickeln, denn es ist nützlich für die Hör- und Schreibfertigkeit. Diese Untersuchung hatte das Ziel, interaktive CD des Deutschunterrichtmediums für Hör- und Schreibfertigkeit zu entwickeln, um den Bedarf der Schule von Lehrmedium zu decken. Um die Frage der Untersuchung zu beantworten, wird der qualitative deskriptive Ansatz gebraucht. Die qualitativen Daten wurden aus dem Interviewsergebnis, der Umfrage, der Observation, und den Noten der Schüler genommen. Vor dem Feldversuch, wurde das Lehrmedium vom Mediumexpert und Materialenexpertin validiert, um die Zweckmäßigkeit des Lehrmediums zu bewerten. Das Feldversuchsubjekt dieser Untersuchung sind 29 SchülerInnen von Klasse XI Sprachabteilung und eine Deutschlehrerin in der SMAN I Tumpang. Die Umfrage der Gültigkeit und Die Umfrage der Mediumsprobe werden in Prozentzahl ausgedruckt. Das Interviewergebnis und die Observationsergebnis werden deskriptiv analysiert. Die Noten der Schüler gilt als Unterstützungsdaten des Umfragesergebnises der Schüler. Aus der Untersuchung ergibt sich, dass dieses Medium benutzt werden kann, unter der Voraussetzung, dass es noch mal redigiert werden muss. Nach der Meinung des Mediumexperten, dieses Medium sehr gut ist, mit dem Gültigkeitsgrad 85%. Die Materialenexpertin meint, dass dieses Medium auch sehr gültig ist, nämlich 85%. Die Deutschlehrerin hat auch gleiche Meinung, nämlich dieses Medium ist sehr gültig mit 84%. Die Schüler haben andere Meinung. Sie meinen, dieses Medium ist noch gültig genug, aber die Gültigkeitsgrad ist nicht so hoch, nämlich 76,52%. Deshalb muss es noch mal redigiert werden.

Hubungan antara persepsi terhadap karakteristik pekerjaan dengan stres kerja pada perawat di Rumah Sakit JIwa Sambang Lihum Kalimantan Selatan / Fitriyani

 

ABSTRAK Fitriyani. 2009. Hubungan Antara Persepsi terhadap Karakteristik Pekerjaan dengan Stres Kerja Pada Perawat Di Rumah Sakit Jiwa Sambang Lihum Kalimantan Selatan. Skripsi, Jurusan Bimbingan Konseling dan Psikologi, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Sri Weni Utami, M.Si, (II) Fattah Hidayat, M.Si. Kata Kunci : Persepsi, Karakteristik Pekerjaan, Stres Kerja Dalam menjalankan tugasnya seorang perawat tidak dapat terlepas dari stres, karena masalah stres tidak dapat dilepaskan dari dunia kerja. Dengan semakin bertambahnya tuntutan dalam pekerjaan maka semakin besar kemungkinan seorang perawat mengalami stres kerja, setiap jenis pekerjaan tidak terlepas dari tekanan-tekanan baik dari dalam maupun dari luar yang dapat menimbulkan stres bagi para pekerjanya. Dalam proses bekerja hasil atau akibatnya perawat dapat mengalami stres, yang dapat berkembang menjadikan perawat sakit fisik dan mental, sehingga tidak dapat bekerja secara optimal. Menurut hasil survei dari PPNI tahun 2006, sekitar 50,9 persen perawat yang bekerja di empat provinsi di Indonesia mengalami stres kerja, sering pusing, lelah, tidak bisa beristirahat karena beban kerja terlalu tinggi dan menyita waktu. Tujuan utama penelitian ini adalah untuk mengetahui: (1) persepsi terhadap karakteristik pekerjaan perawat di RSJ Sambang Lihum, (2) stres kerja perawat di RSJ Sambang Lihum, dan (3) hubungan antara persepsi terhadap karakteristik pekerjaan dengan stres kerja perawat di RSJ Sambang Lihum. Desain yang digunakan adalah deskriptif dan korelasional dengan teknik pengambilan sampel purposive sample. Persepsi terhadap karakteristik pekerjaan diukur dengan skala persepsi terhadap karakteristik pekerjaan sebanyak 40 item dengan validitas item antara 0,314-0,695 dan reliabilitas 0,919. Stres kerja diukur dengan skala stres kerja sebanyak 41 item dengan validitas item antara 0,321- 0,705 dan reliabilitas 0,928. Subyek penelitian adalah 60 orang perawat di RSJ Sambang Lihum. Data yang terkumpul dianalisa dengan teknik korelasi Pearson. Hasil penelitian menunjukkan bahwa: (1) persepsi terhadap karakteristik pekerjaan perawat di RSJ Sambang Lihum berada pada tingkat netral, (2) stres kerja perawat di RSJ Sambang Lihum berada pada tingkat sedang, dan (3) terdapat korelasi negatif antara persepsi terhadap karakteristik pekerjaan dengan stres kerja perawat di RSJ Sambang Lihum. Berdasarkan hasil penelitian ini dapat disarankan: 1) Perawat hendaknya lebih mengembangkan persepsi yang positif terhadap karakteristik pekerjaannya sehingga dapat mengurangi kemungkinan untuk terjadinya stres kerja, 2) Pihak RSJ dapat mengendalikan kemungkinan terjadinya stres kerja dengan mengetahui faktor-faktor penyebab agar dapat meminimalisir dampak negatif dan dapat mengambil tindakan pencegahan sehingga dapat mengurangi dan menekan faktor- faktor penyebab terjadinya stres kerja pada perawat, 3) Bagi peneliti berikutnya sebaiknya melakukan penelitian secara berkesinambungan tentang berbagai aspek yang berkaitan dengan persepsi terhadap karakteristik pekerjaan dengan stres kerja perawat di RSJ, menambahkan penggunaan observasi dan wawancara serta menambah populasi dan mengembangkan wilayah penelitian.

Penerapan pembelajaran berbasis masalah (PBM) untuk meningkatkan kemampuan berpikir kritis dan hasil belajar biologi siswa kelas X SMA Negeri 5 Malang / Mariya Ulfah

 

ABSTRAK Ulfah, Mariya. 2009. Penerapan Pembelajaran Berbasis Masalah (PBM) Untuk Meningkatkan Kemampuan Berpikir Kritis dan Hasil Belajar siswa Kelas X SMA Negeri Malang. Skripsi, Jurusan Biologi, Program Studi Pendidikan Biologi, FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Hadi Suwono, M.Si (II) Dr. Fatchur Rohman, M.Si. Kata kunci: pembelajaran berbasis masalah (PBM), berpikir kritis, hasil belajar. Penelitian ini bertolak dari hasil observasi dan wawancara yang telah dilakukan peneliti sehingga ditemukan adanya permasalahan mengenai rendahnya kemampuan berpikir kritis dan hasil belajar dalam mata pelajaran biologi di SMA Negeri 5 Malang khususnya Kelas X-3. Salah satun permasalahan tersebut dapat dilihat dari LKS (Lembar Kerja Siswa) yang biasa digunakan siswa sebagai penuntun kegiatan untuk menguji konsep dalam buku atau informasi yang disampaikan oleh guru. Penelitian ini bertujuan untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas X-3 dengan menerapkan Pembelajaran Berbasis Masalah (PBM) dalam mata pelajaran biologi di SMA Negeri 5 Malang. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang dilaksanakan dengan 2 siklus. Subjek penelitian ini adalah kelas X-3 di SMAN 5 Malang dengan jumlah 32 siswa. Setiap siklus PTK terdiri atas perencanaan tindakan, pelaksanaan, observasi, dan refleksi. Instrumen penelitian yang digunakan adalah lembar wawancara, lembar laporan, catatan lapangan, soal tes, angket dan dokumentasi. Teknik analisis data yang digunakan adalah persentase ketercapaian PBM dan kemampuan berpikir kritis serta hasil belajar siswa (ranah kognitif). Hasil penelitian menunjukkan adanya peningkatan persentase pada kemampuan berpikir kritis setelah tindakan PBM dilakukan dari siklus I sampai siklus II. Persentase kemampuan berpikir kritis pada hasil karya siswa (laporan) mengalami peningkatan sebesar 15% dari siklus I sebesar 49% ke siklus II sebesar 64%. Hasil belajar siswa untuk ranah kognitif juga mengalami peningkatan sebesar 13%. Persentase hasil belajar pada siklus I sebesar 70% dan pada siklus II sebesar 83%. Daya serap klasikal siswa juga mengalami peningkatan sebesar 25%. Pada siklus I daya serap klasikal sebesar 63% dan siklus II sebesar 88%. Berdasarkan hasil penelitian maka dapat dikatakan bahwa Penerapan Pembelajaran Berbasis Masalah (PBM) dapat meningkatkan kemampuan berpikir kritis dan hasil belajar biologi siswa Kelas X SMA Negeri 5 Malang.

Evaluasi kompetensi pedagogik dan profesional guru ekonomi SMA yang telah lulus program sertifikasi di Kabupaten Sumenep / Dewi Sofiatika

 

ABSTRAK Sofiatika, Dewi. 2009. Evaluasi Kompetensi Pedagogik Dan Profesional Guru Ekonomi Sekolah Menengah Atas Yang Telah Lulus Program Sertifikasi Di Kabupaten Sumenep, Skripsi. Program Studi Pendidikan Ekonomi Pembangunan, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Hari Wahyono, M.Pd Pembimbing (II) Imam Mukhlis, SE, MSi Kata kunci: Evaluasi Pembelajaran, Sertifikasi Upaya untuk memperbaiki kualitas pendidikan di Indonesia sangat ditentukan oleh faktor pendidikan. Dimana dalam dunia pendidikan banyak faktor yang mempengaruhinya, tetapi yang paling besar mempengaruhinya adalah keberadaan peran dan fungsi guru. Guru memiliki peran yang penting dalam dunia pendidikan. Untuk meningkatkan mutu pendidikan sangat membutuhkan guru yang berkompetensi dalam bidangnya. Misi pendidikan akan berhasil apabila dilaksanakan oleh guru yang baik atau berprofesional. Tujuan penelitian ini adalah untuk mengetahui kualitas guru mata pelajaran ekonomi SMA yang telah lulus sertifikasi se-Kabupaten Sumenep dalam: (1) penyusunan RPP, (2) pelaksanaan pembelajaran di kelas, dan (3) evaluasi hasil pembelajaran Penelitian ini merupakan penelitian deskriptif kuantitatif. Subjek penelitian dalam penelitian ini adalah guru mata pelajaran ekonomi SMA yang telah lulus program sertifikasi se-Kabupaten Sumenep , yang meliputi enam guru mata pelajaran ekonomi dari Sekolah Menengah Atas Negeri yang meliputi empat sekolah yang ada di Kabupaten Sumenep. Penelitian ini menggunakan instrumen pedoman observasi, wawancara, dan dokumentasi. Data penelitian dianalisis secara deskriptif dengan tabel persentase. Hasil penelitian menunjukkan bahwa (1) kualitas guru mata pelajaran ekonomi SMAyang telah lulus program sertifikasi dalam penyusunan RPP yaitu dari 6 orang guru yaitu 2 orang atau 33,3 persen memiliki tingkat kualitas sangat tinggiatau sangat profesional, dan 4 orang atau 66,7 persen memiliki tingkat kualitas tinggi atau profesional. Maka kualitas guru ekonomi yang telah lulus sertifikasi dalam penyusunan RPP mempunyai kualitas yang tinggi dan merupakan guru yang profesional, (2) kualitas guru mata pelajaran ekonomi SMAyang telah lulus sertifikasi dalam pelaksanaan pembelajaran yaitu dari 6 orang guru yaitu 1 orang atau 16.7 persen memiliki tingkat kualitas sangat tinggi atau sangat profesional, 4 orang atau 66,7 persen memiliki tingkat kualitas tinggi atau profesional, dan 1 orang atau 16,7 memilii tingkat kualitas yang cukup tinggi atau cukup profesional. Maka guru ekonomi SMA yang telah lulus program sertifikasi se-Kabupaten Sumenep merupakan guru yang berkualitas atau profesional dalam melaksanakan pembelajaran dikelas dan (3) kualitas guru mata pelajaran ekonomi SMA yang telah lulus sertifikasi dalam evaluasi hasil belajar yaitu Sth mendapat Skor 35, Bdn mendapat skor 25, Btn mendapat skor 34, Frd mendapat skor 27, Msk mendapat skor 25, dan Amb mendapat skor 32.

Analisis kesalahan dan perbaikan konsep pada buku teks matematika SMA kelas X / Hani' Maria

 

ABSTRAK Maria, Hani’. 2009. Analisis Kesalahan dan Perbaikan Konsep pada Buku Teks Matematika SMA Kelas X. Skripsi, Jurusan Matematika Fakultas matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing: (I) Drs. H. Muchtar Abdul Karim, M. A., (II) Dr. Subanji, S. Pd, M. Si. Kata kunci: kesalahan konsep, buku teks. Matematika memiliki objek kajian yang bersifat abstrak, maka buku teks memiliki peran penting dalam pembelajaran matematika di sekolah. Kualitas buku teks matematika akan mempengaruhi keberhasilan pembelajaran. Adanya kesalahan konsep dalam buku teks mengakibatkan siswa mempunyai pemahaman konsep yang salah dan akan mengalami kesulitan dalam mengembangkan maupun memahami konsep yang lebih luas. Kegiatan utama penelitian ini adalah menganalisis isi buku teks matematika SMA kelas X yaitu dalam hal kesalahan dan perbaikan konsep. Analisis yang dilakukan bertujuan untuk mendeskripsikan dan memperbaiki kesalahan konsep. Buku teks yang digunakan sebagai bahan analisis adalah ERW, ERN, ERS1, ERS2, dan ERT. Kesalahan pengungkapan konsep matematika dalam hal ini adalah ketidaktepatan konsep pada buku teks dengan konsep yang sebenarnya. Hasil analisis ditemukan kesalahan konsep pada masing-masing buku teks, yaitu: ERW sebanyak 10 kesalahan, ERN sebanyak 10 kesalahan, ERS1 sebanyak 3 kesalahan, ERS2 sebanyak 2 kesalahan, dan ERT sebanyak 5 kesalahan. Berdasarkan hasil analisis, ditemukan kesalahan konsep pada buku teks matematika SMA kelas X. Saran-saran yang dapat diberikan sebagai berikut. (1) Guru hendaknya tidak mengikuti sepenuhnya konsep yang disajikan dalam buku teks dan tidak hanya menggunakan satu buku sebagai bahan rujukan dalam membimbing siswa. (2) Siswa hendaknya tidak menggunakan satu buku sebagai acuan dalam belajar dan memilih buku yang berkualitas agar memperoleh konsep materi yang benar. (3) Sekolah hendaknya lebih teliti dalam memilih buku teks matematika yang akan digunakan. (4) Penulis buku teks hendaknya meneliti kembali konsep-konsep yang disajikan pada buku teks dan memperbaiki kesalahan konsep yang ada agar pembaca lebih memahami apa yang mereka pelajari. (5) Penerbit hendaknya merevisi kesalahan konsep yang ada pada buku teks dan agar lebih teliti sebelum menerbitkan buku. (6) Penelitian hendaknya ditingkatkan pada ruang lingkup yang lebih luas. Analisis tidak hanya ditinjau dari aspek konsep materi tetapi diharapkan analisis dikembangkan pada aspek yang lain. ABSTRACT Maria, Hani'. 2009. Analysis Errors in Concept and Correction in Mathematics Text Books for Ten Grade Senior High School. Thesis, Mathematics Department, Faculty of Mathematics and Natural Science. Advisor: (I) Drs. H. Muchtar Abdul Karim, M. A., (II) Dr. Subanji, S. Pd, M. Si. Key Words: errors in concept, textbooks. Mathematics has abstract object of study, and thus textbooks bring an important role in mathematics pedagogical process at school. Quality of mathematics textbooks will certainly influence the success of the learning process. Where there is errors in concept within textbooks, students will obtain misconcepts and eventually experience difficulties in understanding or even applying to broader concepts. This study analyzes the contents of mathematics textbooks for tenth grader in terms of errors in concept and correction. The aims of this analysis are describing and correcting the errors. Textbooks used as the material are ERW, ERN, ERS1, ERS2, and ERT. Errors in mathematics concept explanation analyzed in the current study is misconcepts in the textbooks which are different from the real concepts. The analysis finds errors in each of the textbooks in this following amounts: ERW has 10 mistakes, ERN has 10 mistakes, ERS1 has 3 mistakes, ERS2 has 2 mistakes, and ERT has 5 mistakes. Based on the analysis, mathematics textbooks for ten grade of senior high school contains some mistakes. To cope with that, these following suggestions can be considered. (1) Teachers should not thoroughly follow the concepts available in textbooks and should use more than one textbooks as reference in teaching students. (2) Students should use more than one different textbooks and choose textbooks whose quality is good in order to obtain correct concepts. (3) Schools should be critical in choosing mathematics textbooks used. (4) Textbook writers should re-examine the concepts given in textbooks and correct the mistakes so that readers understand the concepts deeper. (5) Publishers should revise misconcepts in textbooks and to be more accurate before publishing the books. (6) Future researchers should be improved and applied in a broader scope. Not only does analysis observe material concept, it may also observe other aspects of textbooks.

Perancangan bahan ajar CAD 2 dimensi pada mata kuliah CAD/CAM berbasis multimedia di Jurusan Teknik Mesin Universitas Negeri Malang / Anang Wicaksono

 

Abstrak ABSTRAK Wicaksono, Anang. 2008. Perancangan Bahan Ajar Cad 2 Dimensi Pada Mata Kuliah CAD/CAM Berbasis Multimedia di Jurusan Teknik Mesin Universitas Negeri Malang. Pembimbing (1) Dra. Widiyanti, M.Pd., (2) Suprayitno, S.T., M.T Kata kunci: media pembelajaran, multimedia interaktif, cad 2 dimensi. Universitas Negeri Malang adalah sebuah lembaga pendidikan yang bertujuan mencetak tenaga pendidik yang kompeten. Fakultas Teknik UM adalah salah satu fakultas yang ada di Universitas Negeri Malang, memiliki program studi keguruan bertujuan untuk mencetak tenaga pengajar dibidang teknik. Terdapat beberapa jurusan yang dikembangkan yaitu; Teknik Mesin, Teknik Elektro, Teknik Sipil, dan Teknologi Industri. Mata kuliah CAD/CAM merupakan salah satu mata kuliah yang wajib dikuasai dan ditempuh oleh mahasiswa teknik, terutama mahasiswa teknik mesin, baik itu mahasiswa Program Studi Pendidikan Teknik Mesin maupun Diploma 3 Teknik Mesin. Dalam praktikum matakuliah CAD/CAM, peserta didik pada Jurusan Teknik Mesin Fakultas Teknik Universitas Negeri Malang hanya mempunyai waktu yang singkat yaitu 2 minggu untuk menempuh matakuliah CAD/CAM ini, itupun dilakukan dengan sistim blok, jadi setiap hari mereka selalu mendapatkan materi baru untuk mengejar penyampaian materi sampai memenuhi kompetensi. Padahal penguasaan dan pemahanman materi tidak cukup dengan waktu 2 minggu. Jadi waktu mereka untuk benar-benar menguasai materi-materi CAD sangat kurang, akibatnya pada pertemuan selanjutnya masih banyak yang bertanya pada pembimbing tentang materi yang sebelumnya, akhirnya pembimbing mengulang kembali materinya, hal inilah yang menghambat penyampaian materi pada matakuliah CAD/CAM dan akhirnya banyak materi yang dipersingkat supaya memenuhi kompetensi yang menyebabkan peserta didik tidak dapat benar-benar menguasai matakuliah ini dan mendapatkan nilai rata-rata, sehingga diharapkan hasil software ini dapat dipelajari sendiri tanpa memerlukan bantuan orang lain di luar perkuliahan, maka mahasiswa berpeluang besar untuk meningkatkan kemampuan yang berindikasi pada ketrampilan dalam CAD/CAM yang imbasnya pada nilai Model pengembangan yang digunakan dalam proyek ini mengacu pada sistematika metode pengajaran CAD/CAM secara umum dan dipadukan dengan sistematika pengembangan produk multimedia, selain itu perancang produk multimedia interaktif ini menggunakan model pengembangan Dick & Carey yang menggariskan langkah-langkah pengembangan produk secara sistematik. Produk multimedia interaktif ini perlu diuji coba kelayakannya sebagai salah satu bahan ajar yang sesuai dengan kebutuhan Teknik Mesin dalam proses pengajaran matakuliah menggambar komputer. Uji coba dilakukan dengan meminta masukan dari (1) ahli materi, (2) ahli media pembelajaran, (3) dan uji coba kelompok kecil. Kegiatan uji coba telah mendapatkan hasil yang menunjukkan bahwa secara umum produk dapat dikatakan sudah memenuhi kebutuhan pengguna. Pada uji isi materi didapat nilai kelayakan produk BAIK, untuk uji tampilan multimedia dan desain pembelajaran oleh ahli media pembelajaran nilai kelayakan CUKUP BAIK, sedangkan untuk uji coba media pada kelompok kecil mendapatkan nilai kelayakan BAIK. Produk multimedia pembelajaran yang dihasilkan dibuat untuk kebutuhan pengguna saat ini, dalam pemanfaatannya lebih lanjut perlu diadakan revisi berupa penyesuaian kebutuhan pengguna dimasa yang akan datang. Saran dalam pengembangan produk lebih lanjut dapat dilengkapi dengan bahan-bahan yang dianggap dapat memberikan wawasan lebih kepada pengguna dan lebih mengaktifkan peran pebelajar (mahasiswa).

Perbedaan kecerdasan emosional antara mahasiswa bekerja dan tidak bekerja di Fakultas Bahasa Inggris STKIP PGRI Pasuruan / Ayu Dian Pratiwi

 

Mahasiswa sebagai remaja akhir berada dalam satu masa transisi dimana semakin tampak sifat orang dewasa yang diperlihatkan pada keputusan untuk bekerja sambil kuliah. Mahasiswa yang bekerja tentunya berbeda dengan mahasiswa yang rutinitasnya kuliah. Rutinitas sebagai mahasiswa membutuhkan kecerdasan baik intelektual maupun emosi. Alangkah baiknya apabila mahasiswa yang kuliah sambil bekerja ini juga memiliki kecerdasan emosi yang lebih tinggi untuk menyokong prestasi mahasiswa tersebut dalam dunia pendidikan maupun kerja. Kecerdasan emosi itu dapat dilihat dalam kemampuan mengenali emosi diri, mengelola emosi diri, memotivasi diri sendiri, empati, serta kemampuan dalam menjalin suatu hubungan dengan orang lain. Kecerdasan emosi dipengaruhi oleh faktor internal dan eksternal. Penelitian dilaksanakan dengan rancangan deskriptif komparatif pada 68 responden (34 mahasiswa bekerja dan 34 mahasiswa tidak bekerja) yang diambil dengan teknik Purposive Sampling di STKIP PGRI Pasuruan. Data dikumpulkan dengan menggunakan skala kecerdasan emosional dengan validitas ≥ 30 dan α 0,914; kemudian dianalisis dengan teknik analisis deskriptif dan analisis uji Chi Square. Hasil penelitian menunjukkan bahwa dari 34 mahasiswa bekerja rata-rata memiliki kecerdasan emosi yang tinggi yaitu sebanyak 15 orang (44,12%) sedangkan dari 34 mahasiswa tidak bekerja rata-rata memiliki kecerdasan emosi yang sedang yaitu sebanyak 16 orang (47,06%), Ada perbedaan kecerdasan emosional mahasiswa bekerja dan tidak bekerja (chi square = 47,000, sig = 0,042 p < 0,05). Berdasar hasil penelitian disarankan (1) mahasiswa dapat menambah aktivitasnya ketika berada di kampus, seperti mengikuti kegiatan-kegiatan ekstrakurikuler yang telah disediakan oleh pihak perguruan tinggi. Mengikuti kegiatan organisasi dapat membantu mahasiswa untuk mempelajari dinamika kelompok, berkomunikasi dengan baik, dan bertanggung jawab (2) Pihak kemahasiswaan seperti layanan konseling pendidikan pada mahasiswa mampu memberikan materi tentang meningkatkan kecerdasan emosi pada mahasiswa. Selain itu, pihak perguruan tinggi dapat memberikan seminar-seminar khususnya tentang kecerdasan emosi guna membantu menumbuhkembangkan kecerdasan emosi yang dimiliki oleh mahasiswa. (3) Hendaknya peneliti selanjutnya juga mengkaji lebih dalam perbedaan tersebut dengan melihat faktor-faktor yang melatarbelakanginya, mampu menjabarkan perbedaan tersebut, dan hendaknya memasukkan variabel lain seperti problem solving, mengatasi stress, dan lain-lain sehingga hasil penelitian yang diperoleh menjadi semakin detail dan akurat.

Pengaruh pemberian reward dan punishment untuk mengurangi perilaku attenrion deficit hyperactivity disorder / Siti Hartinah

 

ABSTRAK Hartinah, Siti. 2009. Pengaruh Pemberian Reward Dan Punishment Untuk Mengurangi Perilaku Attention Deficit Hyperactivity Disorder (ADHD). Skripsi, Jurusan Bimbingan Konseling dan Psikologi Program Studi Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dra. Endang Prastuti, M.Si., (II) Anies Syafitri, S.Psi, M.Psi, Psikolog. Kata kunci: modifikasi perilaku, ADHD Anak yang memiliki keadaan khusus sehingga membutuhkan penanganan yang khusus pula disebut Anak Berkebutuhan Khusus (ABK). Salah satu jenis anak berkebutuhan khusus (ABK) adalah anak dengan Attention Deficit Hyperactivity Disorder (ADHD). Attention Deficit Hyperactivity Disorder merupakan suatu gangguan yang terdapat pada anak-anak dimana anak memperlihatkan impulsivitas, tidak adanya perhatian dan hiperaktivitas (hyperactivity) yang dianggap tidak sesuai dengan tingkat perkembangan mereka. Anak-anak yang menderita ADHD sering kali menunjukkan gejala tidak adanya konsentrasi, hiperaktif, dan impulsif. ADHD adalah gangguan perkembangan yang mempunyai onset gejala sebelum usia 7 tahun. Reward merupakan hadiah yang diberikan kepada anak ADHD apabila anak tersebut telah melakukan perilaku yang diharapkan dan dapat berupa konsekuensi yang menyenangkan. Sedangkan punishment adalah hukuman yang diberikan ketika anak tidak memunculkan perilaku yang diharapkan. Penelitian ini menggunakan rancangan penelitian eksperimental. Desain penelitian yang digunakan adalah ekaperimental Single-Subject Design atau bisa juga disebut Single Case Experimental Design. Sampel yang digunakan sejumlah dua orang (N=2). Analisis yang digunakan dalam penelitian ini adalah dengan uji t. Uji t memperlihatkan bahwa ada perbedaan frekuensi pada tahap Baseline I (A1) dan Baseline II (A2) maupun pada tahap Baseline II (A2) dan treatment II (B2) pada tingkat signifikansi 0.05 pada masing-masing subyek. Pada subyek 1, perbandingan Baseline I (A1) dan Baseline II (A2) menggunakan uji t sebesar 5,835 dan hasil perbandingan Baseline II (A2) dan treatment II (B2) sebesar 4,754. Pada subyek 2, perbandingan Baseline I (A1) dan Baseline II (A2) sebesar 6,013 dan hasil perbandingan Baseline II (A2) dan treatment II (B2) sebesar 7,425. Hasil perhitungan mean (rata-rata) memperlihatkan bahwa semua subyek mengalami penurunan pemunculan target perilaku pada masing-masing tahap. Berdasarkan perhitungan Mean, subyek 1 rata-rata kemunculan perilaku tahap Baseline I sebesar 8,208, tahap Treatment I sebesar 7,521. Tahap selanjutnya yaitu tahap Baseline II, sebesar 6,830. Tahap Treatment II, sebesar 6,250. Hal serupa juga terjadi kepada Subyek 2 yang mengalami penurunan kemunculan perilaku pada setiap tahap penelitiannya. Tahap Baseline I, rata-rata kemunculan target perilaku sebesar 9,542, tahap Treatment I sebesar 9,291. Tahap Baseline II, sebesar 9,00. Tahap Treatment II, sebesar 8,092. Berdasarkan hasil penelitian, maka dapat diberikan saran kepada beberapa pihak diantaranya: (1) para peneliti selanjutnya, diharapkan penelitian yang akan dilakukan selanjutnya lebih dipersiapkan baik dalam jumlah sampel, program modifikasi perilaku, maupun kontrol lingkungan serta memiliki kepekaan yang tinggi terhadap fenomena yang terjadi di masyarakat. (2) orang tua ABK, diharapkan dapat menerapkan metode modifikasi perilaku dalam pola pengasuhan di rumah. Serta, (3) lembaga terapi, diharapkan dengan pemberian reward dan punishment sebagai salah satu sarana terapi bagi anak ADHD.

Pengaruh identitas visual (Aspek seni arsitektural, kemahasiswaan, dan logo) terhadap reputasi yang terbentuk di kalangan mahasiswa Universitas Negeri Malang (Studi pada Mahasiswa Fakultas ekonomi jurusan Manajemen Angkatan 2006 reguler) / Santi

 

Identitas visual adalah identitas yang berkaitan dengan citra atau image yang dipertahankan oleh organisasi sebagai jembatan untuk menyatukan berbagai konteks, audience, dan bagi organisasi ini. Reputasi Universitas adalah representasi kolektif yang dipegang teguh oleh berbagai stake holder (pemangku kepentingan) universitas tersebut (termasuk media) dari waktu ke waktu. Penelitian ini ditujukan untukmenganalisis : (1) pengaruh signifikan secara simultan antara Aspek Seni Arsitektural, Aspek Kemahasiswaan, Aspek Logo terhadap reputasi, (2) pengaruhsignifikan antara Aspek Seni Arsitektural terhadap reputasi, (3) pengaruh signifikan antara Aspek Kemahasiswaan terhadap reputasi, (4) pengaruh signifikan antara Aspek logo terhadap reputasi yang terbangun di kalangan mahasiswa Fakultas Ekonomi Universitas Negeri Malang. Penelitian dirancang sebagai penelitian deskriptif dengan menggunakananalisis regresi yang dilakukan terhadap 57 mahasiswa Jurusan ManajemenUniversitas Negeri Malang. Instrumen yang digunakan adalah kuesioner denganskala likert untuk mengukur variabel identitas visual terbagi dalam aspek seni arsitektural (X1), aspek kemahasiswaan (X2), aspek logo (X3), dan variabel reputasi (Y). Masing-masing skala variabel identitas visual (aspek seni dan bangunan, aspekkemahasiswaan, serta aspek logo) diwakili dengan 9 foto, sementara variabel reputasi diwakili 12 item pernyataan. Berdasarkan uji validitas dan reliabilitas instrumen, aspek seni dan arsitektural dinyatakan valid dengan koefisien reliabilitas sebesar 0,7173, aspek kemahasiswaan dinyatakan valid dengan koefisien reliabilitas sebesar 0,7368, aspek logo dinyatakan valid dengan koefisien reliabilitas sebesar 0,6195, dan variabel reputasi dinyatakan valid dengan koefisien reliabilitas sebesar 0,7313. Hasil analisis regresi menunjukkan adanya pengaruh searah yang signifikan dari aspek seni arsitektural (b1 = 0, 809; t hit > t tab pada <0,05), aspekkemahasiswaan (b2 = 0, 968; t hit > t tab pada <0,05), dan aspek logo (b3 = 0, 633; t hit > t tab pada <0,05) terhadap reputasi Universitas Negeri Malang. Sedangkansecara simultan aspek seni arsitektural, kemahasiswaan, dan logo berpengaruh searahterhadap reputasi yang terbentuk di kalangan mahasiswa (F hit > F tab pada <0,05) Berdasarkan hasil penelitian hingga tahap penyimpulan, saran yang dapat penulis ajukan adalah sebagai berikut (1) Bagi Universitas Negeri Malang,dibutuhkan strategi komunikasi pemasaran yang terintegrasi (2) Bagi peneliti selanjutnya, penelitian ini menjadi dasar untuk dikembangkan dengan melibatkanberbagai khalayak internal maupun eksternal (3) Bagi mahasiswa, diharapkan turut ambil bagian dalam strategi komunikasi pemasaran yang dilaksakan Universitas Negeri Malang.

Komparasi minat rekreatif dan minat belajar antara siswa laki-laki dan prempuan di SMA Negeri 2 Malang / Riska Febriyanti

 

ABSTRAK Febriyanti, Riska. 2009. Komparasi Minat Rekreatif dan Minat Belajar Antara Siswa Laki-laki dan Perempuan di SMA Negeri 2 Malang. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Drs. H. Widada, M. Si, (2) Dr. Andi Mappiare A.T, M. Pd. Kata kunci: Minat rekreatif, minat belajar, laki-laki, perempuan. Adanya perbedaan tingkah laku antara laki-laki dan perempuan bukanlah semata-mata karena perbedaan jenis kelamin. Mungkin yang dapat membedakan antara laki-laki dan perempuan adalah dalam hal peranan dan perhatiannya terhadap sesuatu pekerjaan, hal ini merupakan akibat pengaruh kultural. Adanya konsep tentang gender yang kadang disamakan dengan konsep jenis kelamin seringkali menimbulkan dampak tertentu bagi kedua jenis kelamin tersebut yang pada akhirnya juga dapat mempengaruhi adanya perbedaan minat antara laki-laki dan perempuan. Tujuan penelitian adalah untuk: (1) memperoleh gambaran mengenai sebaran minat rekreatif siswa laki-laki dan perempuan di SMA Negeri 2 Malang, (2) memperoleh gambaran mengenai sebaran minat belajar siswa laki-laki dan perempuan di SMA Negeri 2 Malang, (3) memperoleh gambaran mengenai perbedaan minat rekreatif antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang dan (4) memperoleh gambaran mengenai perbedaan minat belajar antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang. Rancangan penelitian yang digunakan adalah deskriptif komparatif. Populasi penelitian adalah siswa SMA Negeri 2 Malang kelas X dan XI. Teknik pengambilan sampel menggunakan sampling nonprobabilitas, yaitu sampling kebetulan atau sampling seadanya. Pengumpulan data menggunakan alat ukur angket tertutup dengan klasifikasi untuk angket minat rekreatif berupa option a, b, c, dan d, sedangkan untuk minat belajar dengan klasifikasi selalu, sering, kadang, dan tidak pernah. Teknik analisis data yang digunakan adalah analisis persentase dan Uji-t. Dari hasil penelitian di SMA Negeri 2 Malang menunjukkan bahwa (1) siswa laki-laki memiliki minat rekreatif relatif lebih tinggi dibandingkan dengan siswa perempuan, (2) untuk minat belajar, siswa laki-laki dan perempuan relatif memiliki minat belajar yang hampir sama, (3) hasil analisis Uji-t untuk minat rekreatif diperoleh nilai t-hitung sebesar 3, 184 dengan koefisien probabilitas error (p) 0,000. Dengan nilai p < 0,05 maka Ho ditolak dan H1 diterima yang dapat disimpulkan bahwa ada perbedaan minat rekreatif antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang, dan (4) untuk minat belajar diperoleh nilai t 1,936 dengan koefisien probabilitas error (p) 0,056. Dengan nilai p > 0,05 maka dalam hal ini Ho diterima dan H1 ditolak, yang berarti tidak ada perbedaan minat belajar antara siswa laki-laki dan perempuan di SMA Negeri 2 Malang. Sehubungan dengan hasil penelitian yang telah dilakukan, maka saran yang ingin penulis sampaikan, kepada 1) Konselor, sebagai bahan informasi bagi siswa baik dalam bidang pribadi, sosial, belajar, dan karir, dapat memberikan pengetahuannya dalam hal peningkatan minat belajar sehingga siswa yang memiliki minat belajar rendah dapat termotivasi untuk meningkatkan minat belajarnya, karena pada dasarnya baik siswa laki-laki maupun perempuan memiliki minat belajar yang sama. Selain itu konselor juga dapat memberikan informasi mengenai penyaluran yang tepat sehubungan dengan minat rekreatif yang dimiliki siswa, 2) Guru, selain berusaha untuk menciptakan suasana yang mendukung minat belajar siswa juga perlu memperhatikan minat rekreatif yang mungkin juga dimiliki oleh siswanya sehingga dapat mengerti keadaan siswa dan dapat memberikan pengarahan yang tepat serta metode pembelajaran yang efektif, 3) Siswa, dengan minat rekreatif yang dimilikinya agar berusaha menyalurkannya dengan baik sehingga tidak mengganggu kegiatan belajarnya. Selain itu siswa juga perlu untuk selalu meningkatkan dan mempertahankan minat belajarnya sehingga mampu bersaing untuk memperoleh prestasi yang terbaik, 4) Peneliti lain, yang tertarik untuk melakukan penelitian lanjutan hendaknya memperluas ruang lingkup penelitian yang memiliki latar belakang sekolah yang berbeda seperti SMA, MAN atau SMK.

Pemanfaatan sumber belajar oleh guru dalam hubungannya dengan keefektifan proses belajar-mengajar di Sekolah Dasar Negeri se-Kecamatan Nganjuk Kabupaten Nganjuk / Riza Fauzi Tri Rahayu

 

ABSTRACT Rahayu, Riza Fauzi Tri. 2009. Pemanfaatan Sumber Belajar oleh Guru dalam Hubungannya dengan Keefektifan Proses Belajar-Mengajar di Sekolah Dasar Negeri se-Kecamatan Nganjuk Kabupaten Nganjuk. Thesis, Majors of Education Administration, Faculty of Education,State University of Malang. Tutor: (1) Dra. Mustiningsih, M.Pd, (2) Dr. H. Ali Imron, M.Pd, M.Si. Keyword: exploiting of source learn, effectiveness of teaching and learning process In general, every instructor teacher requiring source learn as supporter process teaching and learning in school. Process teaching and learning in this case representing a process which contains with refer to deed of student and teacher of interrelationship that goes on in educative situation. Problem of which studied in this research is: (1) how exploiting of source learn by teacher in the state elementary school of Nganjuk District in Nganjuk Regency?, (2) how effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency?, (3) there any relation between exploiting of source learn by teacher with effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency?. This research purpose to know: (1) exploiting of source learn by teacher in the state elementary school of Nganjuk District in Nganjuk Regency, (2) effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency, (3) relation between exploiting of source learn by teacher with effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency. This research use descriptive correlational plan. The population is teachers in the state elementary school of Nganjuk District in Nganjuk Regency amounting to 293 teachers from 37 state elementary schools, while sampel the taken is 165 teachers. Intake of sampel in this research use random sampling technique. Gathering instrument the used is enquette. Gathered to be data to be analysed with descriptive technique and product moment correlation. The result of this research indicate that: (1) exploiting of source learn by teacher is included in good category, (2) effectiveness of teaching and learning process is included in very good category, (3) have relation which is significant between exploiting of source learn with effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency. Pursuant to result of this research, writer raise suggestion: shall in course of teaching and learning use source learn by teacher exist in around and according to given Iesson. This matter is done to effectiveness of teaching and learning process in the state elementary school of Nganjuk District in Nganjuk Regency. If have been executed better, headmaster shall can urge instructor teacher to be maintaining it so that reached the target of national education.

Hubungan antara self esteem dengan perilaku asertif siswa kelas X di SMAN 3 Malang / Faolia Arina Hidayati

 

Self esteem merupakan penilaian seorang individu terhadap dirinya sendiri. Penilaian ini meliputi penilaian positif atau negatif. Individu yang memiliki penilaian yang positif terhadap dirinya atau memiliki tingkat self esteem yang tinggi akan mampu memilih dan memilah perilaku mana yang pantas dan perilaku mana yang tidak pantas dilakukan. Mereka lebih percaya diri dalam menentukan sikap apa yang harus dilakukan. Mereka tidak akan mudah terpengaruh oleh lingkungan yang buruk, karena mereka dapat bersikap tegas dan tidak takut mengungkapkan pendapatnya. Dengan bersikap tegas atau asertif seseorang dapat mengekspresikan pikiran, perasaan, dan hak-hak pribadinya tanpa melanggar hak atau merugikan orang lain. Penelitian ini bertujuan untuk: (1) mengetahui tingkat self esteem siswa, (2) mengetahui tingkat perilaku asertif siswa, dan (3) mengetahui hubungan antara self esteem dengan perilaku asertif siswa. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Populasi dalam penelitian ini adalah siswa kelas X SMAN 3 Malang tahun ajaran 2008-2009 yang terdiri dari 8 kelas. Pengambilan sampel dalam penelitian ini dengan menggunakan teknik random sampling. Sampel yang diambil dalam penelitian ini adalah 2 kelas. Penelitian ini menggunakan dua instrumen, yaitu inventori self esteem yang dikembangkan dari teori Coopersmith yang telah diadaptasi oleh Hunty Ilmawati (2008) dan inventori perilaku asertif yang telah dikembangkan oleh Lailina Atiqoh (2008). Analisis data dalam penelitian ini dengan menggunakan teknik persentase dan teknik korelasi product moment. Hasil penelitian menunjukkan bahwa siswa yang memiliki self esteem yang sangat tinggi sebanyak 10 siswa atau sebesar 15,6%, yang memiliki self esteem tinggi yaitu sebanyak 54 siswa atau sebesar 84,4%. Pada perilaku asertif, siswa yang memiliki perilaku asertif yang sangat tinggi sebanyak 9 siswa atau sebesar 14,1%, yang memiliki perilaku asertif tinggi sebanyak 53 siswa atau sebesar 52,8%, yang memiliki perilaku asertif sedang sebanyak 2 siswa atau sebesar 3,1%. Hasil analisis korelasional menunjukkan korelasi sebesar 0,94. Hal ini berarti self esteem siswa mempunyai korelasi positif dengan perilaku asertif siswa. Ini berarti semakin tinggi self esteem siswa, maka semakin tinggi pula perilaku asertifnya. Berdasarkan hasil penelitian, dapat diketahui bahwa tingkat self esteem dan perilaku asertif siswa sudah cukup tinggi. Maka disarankan pada konselor untuk mengembangkannya lagi dengan pemberian motivasi melalui bimbingan kelompok yang dapat dilakukan dengan menggunakan teknik permainan atau pelatihan-pelatihan pemahaman diri. Untuk guru kelas disarankan dapat memotivasi siswa, agar dapat meningkatkan self esteem dan perilaku asertifnya. Hal ini dapat dilakukan dengan menggunakan metode pembelajaran yang mendukung siswa menjadi individu yang memiliki self esteem dan perilaku asertif yang tinggi. Misalnya dengan memberikan reward pada siswa yang memperoleh nilai terbaik waktu ulangan, dan memberikan kesempatan untuk mengungkapkan pendapatnya dalam proses belajar mengajar.

Pembuatan busana pesta wanita dengan menerapkan aplikasi geometris pada bustier / Selfi Triana

 

Manusia memerlukan berbagai macam kebutuhan, baik yang berupa material maupun non material dalam memenuhi keperluan hidupnya. Salah satu kebutuhan material yang harus terpenuhi dalam kehidupan manusia tersebut adalah busana. Busana merupakan kebutuhan pokok manusia di samping makan (pangan) dan perumahan (papan). Seperti yang dikatakan Petra (2007 :1) bahwa: Setiap orang memiliki tingkat dan jenis kebutuhan yang saling berbeda dalam berbusana. Hal ini dapat dipengaruhi oleh pekerjaan, kondisi geografis tempat tinggal, tingkat social masyarakat, dan kondisi ekonomi. Perubahan status juga mempengaruhi cara berpakaian seseorang. Pada wanita misalnya, wanita masa kini cenderung memiliki latar pendidikan yang lebih tinggi dan terbuka pada ide baru, maka wanita menginginkan pilihan yang lebih banyak dalam mode. Priowirjanto (2001) menyebutkan bahwa busana terdiri dari beberapa macam, di antaranya busana kasual, busana kerja, busana pesta, busana dalam dan busana anak. Perkembangan model busana semakin beragam seiring perkembangan zaman. Wanita menginginkan lebih banyak pilihan dalam berbusana. Hal ini dikarenakan perubahan status wanita menjadi lebih modern, sehingga wanita ingin terlihat lebih modis dan anggun. Mereka juga cenderung memilih busana dengan desain berbeda dengan yang dikenakan orang lain. Busana pesta menurut waktu terbagi menjadi tiga yaitu pesta pagi, pesta siang, dan pesta malam. Busana pesta pagi biasanya menggunakan busana dengan warna-warna yang lembut misalnya warna cream, merah muda dan sebagainya, untuk pesta siang menggunakan busana dengan warna-warna cerah misalnya warna merah, hijau muda dan sebagainya, sedangkan untuk pesta malam busana yang sering dikenakan berupa gaun panjang dengan warna gelap

Peningkatan kemampuan representasi matematis siswa kelas VI MI Mambaul Ulum dengan menggunakan pendekatan realistic mathematics education (RME) / Khanifah Nur Rofiqoh

 

ABSTRAK Rofiqoh, Khanifah Nur. 2009. Peningkatan Kemampuan Representasi Matematis Siswa Kelas VI MI Mambaul Ulum dengan Menggunakan Pendekatan Realistic Mathematics Education (RME). Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Ipung Yuwono, M.S., M.Sc.dan (II) Drs. Tjang Daniel Chandra, M.Si, Ph.D. Kata kunci: Peningkatan, Kemampuan Representasi Matematis, RME Siswa kelas VI MI Mambaul Ulum masih mengalami kesulitan dalam menyelesaikan masalah matematika yang kontekstual. Hal diakibatkan siswa tidak biasa menyelesaikan soal dengan menggunakan representasi matematis yang beragam. Representasi bertujuan mempermudah siswa dalam menyelesaiakan masalah matematika yang sifatnya abstrak menjadi lebih nyata bagi siswa. Salah satu alternatif pembelajaran yang memanfaatkan lingkungan nyata siswa adalah Realistic Mathematics Education (RME). Karena itu, dalam penelitian ini akan dikaji pembelajaran dengan pendekatan Realistic Mathematics Education (RME). Penelitian ini bertujuan untuk mendeskripsikanlangkah-langkah pembelajaran dengan pendekatan Realistic Mathematics Education (RME) yang dapat meningkatkan kemampuan representasi matematis siswa kelas VI MI Mambaul Ulum. Penelitian ini adalah penelitian tindakan kelas yang dilakukan di MI Mambaul Ulum dan subyek penelitiannya adalah siswa kelas VI tahun ajaran 2009/2010. Penelitian ini dilaksanakan pada bulan Juli 2009 dalam 2 tahap, yaitu (1) tahap pra tindakan dan (2) tahap tindakan. Tahap tindakan terdiri dari tindakan I dan tindakan II. Hasil penelitian ini dapat disimpulkan bahwa Langkah-langkah pembelajaran dengan Pendekatan Realistic Mathematics Education (RME) yang dapat meningkatkan kemampuan representasi matematis siswa kelas VI MI Mambaul Ulum Malang meliputi, (1) memahami masalah kontekstual, peneliti meminta siswa secara individu untuk memahami soal kontekstual yang ada pada LKS dan meminta siswa untuk mengungkapkan maksud soal kontekstual dengan menggunakan representasi gambar, simbol, atau verbal; (2) menyelesaikan masalah kontekstual, peneliti meminta siswa untuk mengerjakan LKS secara berkelompok dengan menggunakan alat peraga. Siswa saling membantu dan bekerja sama untuk meningkatkan kemampuan representasi konkret, gambar, simbol; (3) membandingkan dan mendiskusikan jawaban, peneliti meminta salah satu kelompok mempresentasikan hasil diskusi kelompok dan kelompok lain membandingkan hasil kerjanya dengan kelompok presentator. Tahap ini kemampuan representasi verbal siswa dilatih, serta (4) menyimpulkan, peneliti bersama siswa menyimpulkan hasil dari diskusi kelas. Kemampuan representasi simbol dan verbal siswa dikembangkan. Hal ini ditunjukkan dengan peningkatan rata-rata skor kemampuan representasi matematis (tes awal 22,27%, tes tindakan I 63,63%, tes tindakan II 77,27%). Hal tersebut diperkuat dengan hasil observasi aktivitas siswa dan guru selama pembelajaran masuk dalam kategori “Baik” . ABSTRACT Rofiqoh, Khanifah Nur. 2009. Improving of Mathematical Representation Skill of the Sixth Graders of MI Mambaul Ulum Using Realistic Mathematics Education (RME)Approach.Mathematics Departement , State University of Malang. Advisors: (I) Prof. Dr. H. Ipung Yuwono, M.S., M.Sc., and (II) Drs. Tjang Daniel Chandra, M.Si, Ph.D. Key Word: Improving, Mathematical Representation Skill, RME The sixth Graders of MI Mambaul Ulum still had difficulties in solving contextual mathematics problems. It was caused by the students who were unusual to use varied mathematical representations in solving their mathematics problems. Representation was aimed to make the students easier in accomplishing their mathematics problems which have abstract characteristic to be more concrete for them. One of the instructional models which uses students’ real environment is Realistic Mathematics Education (RME). Therefore, in this study would be conducted a mathematics Instruction using Realistic Mathematics Education approach. This study was aimed to describe instructional steps using Realistic Mathematics Education approach which can improve mathematical representation skill for the sixth Graders of MI Mambaul Ulum. This study was designed as a Classroom Action Research which was conducted at MI Mambaul Ulum with the subjects of the study was the sixth Graders of 2009/2010 academic year. This study was implemented on July 2009 in two stages: (1) preliminary stage, and (2) action stage. The action stage involved of first action and second action. On the basis of the findings, it could be concluded that instructional steps using Realistic Mathematics Education approach which can improve mathematical representation skill for the sixth Graders of MI Mambaul Ulum including: (1) comprehending contextual problems, the researcher asked students to comprehend contextual problems individually which were provided on Students Work Sheet and asked them to express the meaning of contextual problems using picture representation, symbolic representation, or verbal representation; (2) solving contextual problems, the researcher asked students to do Students Work Sheet in group using manipulative materials. The students helped each other and worked together to improve their skills in term of concrete representation, picture representation, and symbolic representation; (3) comparing and discussing their answers, the researcher asked one group to present the result of group discussion meanwhile other groups comparing their results with presenter group, in this phase, the students’ verbal representation skill was drilled, and (4) concluding, the researcher with the students concluded the result of class discussion. Students’ skill of symbolic and verbal representations was developed. It was indicated by improving the students average score of mathematical representation skill (preliminary study test was 22.27%, first action test was 63.63%, and second action test was 77.27%). In addition, observation result of the students and teacher activities during the instructional process was categorized "Good".

Karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan Universitas Negeri Malang / Rizki Dian Nur Hakiki

 

Perguruan Tinggi (PT) adalah suatu institusi pendidikan di atas tingkat Menengah yang mempunyai misi pokok yaitu pendidikan dan pengajaran, penelitian serta pengabdian kepada masyarakat…yang ketiga misi pokok itu lebih dikenal dengan Tri Dharma PT” Universitas Negeri Malang (2005: 9). Dosen sebagai pelaksana utama dalam melaksanakan misi tersebut menjadi kunci pokok terhadap keberhasilan dan kualitas sebuah PT dimana dosen tersebut bernaung, sehingga karakteristik dosen efektiflah yang dibutuhkan sebuah PT agar setiap misi pokok yang telah direncanakan dapat tercapai. Karena dosen efektif itu berada pada kuadran yang optimal pada aspek kemauan dan kemampuan (Suparlan, 2005: 11). Mahasiswa Jurusan Administrasi Pendidikan (AP) Fakultas Ilmu Pendidikan (FIP) Universitas Negeri Malang (UM) menjadi responden dalam penelitian ini. Sebagai responden, mahasiswa Jurusan AP FIP UM dapat berpendapat atau menggambarkan karakteristik dosen efektif baik dalam menjalankan tugas pendidikan dan pengajaran, penelitian, dan pengabdian kepada masyarakat. Tujuan penelitian secara umum adalah untuk mengetahui karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan AP FIP UM, dan secara khusus adalah untuk mengetahui karakteristik dosen efektif dalam melaksanakan tugas pendidikan dan pengajaran, penelitian, dan pengabdian kepada masyarakat. Pendekatan dan rancangan penelitian dengan menggunakan analisis kuantitatif dan pendekatan survai. Sedangkan metode dan jenis penelitiannya adalah jenis penelitian deskriptif dan metode deskriptif kuantitatif. Dalam menganalisis menggunakan hasil persentase dengan bantuan program komputer SPSS for Windows Version 12.0. Adapun hasil penelitian terhadap karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan AP FIP UM secara umum meliputi: 1) tingkat pendidikan minimal S2. 2) karakteristik dosen efektif dalam melaksanakan tugas pendidikan dan pengajaran, meliputi: a) melaksanakan tugas pendidikan dan pengajaran; b) mempunyai kompetensi dalam dirinya yang meliputi kompetensi pribadi, profesional, spiritual, sosial dan intelektual; dan c) melaksanakan kewajiban menjadi penasehat akademik. 3) karakteristik dosen efektif melaksanakan tugas penelitian yang meliputi: a) melaksanakan tugas penelitian; dan b) tanggung jawab sebagai peneliti. 4) karakteristik dosen efektif melaksanakan tugas pengabdian kepada masyarakat. Karakteristik dosen efektif berdasarkan persepsi mahasiswa Jurusan AP FIP UM secara khusus, meliputi: 1) karakteristik dosen efektif dalam melaksanakan tugas pendidikan dan pengajaran, meliputi: a) melaksanakan tugas pendidikan dan pengajaran selain itu penyelenggaraan sesuai tujuan pembelajaran; memberikan waktu untuk mengikuti seminar; memberikan masukan kepada dosen junior; melaksanakan penelitian sederhana; dosen harus memilih dan mengembangkan bahan perkuliahan; menggabungkan metode mengajar; membuat dan membagikan hand out; memberikan umpan balik; melaksanakan kegiatan akademik response, kolokium dan praktikum; bukan sekedar teori yang diajarkan tapi juga praktek; tidak otoriter; mengerti kondisi/karakteristik mahasiswa; mampu menciptakan suasana belajar yang menyenangkan; dan konsistensi; b) mempunyai kompetensi dalam dirinya yang meliputi kompetensi pribadi, profesional, spiritual, sosial dan intelektual; dan c) melaksanakan kewajiban menjadi penasehat akademik serta melaksanakan bimbingan dan penyuluhan kepada mahasiswa secara personal; bertanggung jawab memberikan informasi/link tentang pekerjaan; memberi motivasi kepada mahasiswa; dan memberikan masukan kepada mahasiswa dalam akademik maupun non akademik. 2) karakteristik dosen efektif melaksanakan tugas penelitian yang meliputi: a) melaksanakan tugas penelitian, intelektual tinggi dan mempunyai pemikiran terbaru; serta b) tanggung jawab sebagai peneliti. 3) karakteristik dosen efektif melaksanakan tugas pengabdian kepada masyarakat adalah dengan melaksanakan tugas pengabdian kepada masyarakat serta bisa bekerjasama dengan pihak lain; menjunjung tinggi nilai kemanusiaan terhadap mahasiswanya; dan bertanggung jawab terhadap semua perkataan dan perbuatan yang dilakukan. Berdasarkan pada hasil penelitian tersebut maka dapat disarankan agar dilakukan penelitian lebih lanjut misalnya pada suatu bidang ilmu tertentu seperti ilmu keolahragaan, kedokteran, hukum dan sebagainya yang mempunyai ciri khusus dalam suatu kajian ilmu tertentu.

Pembuatan gaun pesta dengan perpaduan bustier dan drapery / Novi Dwi Ermawati

 

Busana memegang peranan penting di dalam berpenampilan, sebab selain berfungsi untuk melindungi diri, memenuhi rasa kesusilaan, busana juga berfungsi sebagai alat untuk memperindah tubuh serta menunjukkan gaya hidup seseorang. Menurut kesempatan, busana dibagi menjadi beberapa macam, yaitu busana rumah, busana kerja, busana olah raga, busana rekreasi dan busana pesta. Faktor penting yang membedakan busana dengan berbagai macam kesempatan tersebut adalah di dalam pemilihan desain, bahan, warna, hiasan atau pelengkap busana dan teknik penyelesaian. Pada tugas akhir ini kali ini, penulis membuat Bustier dan Gaun Pesta Drapery untuk wanita dewasa. Menurut Rahayu (2002:3) “Pada usia ini wanita cenderung menonjolkan sifat feminin dan sexy dan meninggalkan gaya remajanya”. Pembuatan gaun pesta siang tersebut perlu memperhatikan faktor-faktor mulai dari model busana pesta tetap harus disesuaikan dengan waktu, kesempatan, usia dan proporsi tubuh sipemakai, serta sifat suatu pesta. Busana pesta dapat dikelompokkan berdasarkan waktu pemakaianya seperti busana pesta siang hari dan busana pesta malam hari. Busana pesta siang hari adalah busana pesta yang dikenakan untuk mengahadiri acara pesta yang diselenggarakan waktu siang hari sampai sore hari. Menurut Harini (2004:8) “Busana pesta siang hari memiliki ciri-ciri seperti model busan sederhana tidak terlalu terbuka, bahan yang digunakan agak lembut dan tidak berkilau seperti sutra, crepe, chiffon atau bahan-bahan lainnya dan warna yang digunakan adalah warna-warna yang agak cerah”.

Hubungan daya tarik interpersonal pasangan dan perasaan cinta terhadap pasangan pada masa dewasa awal / Pramarieditya Ayu Rachmawati

 

ABSTRAK Rachmawati, P. A. 2009. Hubungan Daya Tarik Interpersonal Pasangan dan Perasaan Cinta Terhadap Pasangan Pada Masa Dewasa Awal. Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dr. Fattah Hanurawan M.Si M.Ed (II) Ika Andrini Farida S.Psi M.Psi Kata Kunci : daya tarik interpersonal, perasaan cinta, masa dewasa awal Daya tarik interpersonal merupakan salah satu faktor penentu ketika seseorang ingin berhubungan dengan orang lain. Setiap individu mempunyai tingkat ketertarikan personal dalam memulai membina hubungan sosial. Puncak pengalaman psikososial ini tercapai pada masa dewasa awal, dimana individu mulai mengkristalisasikan hubungan dengan seorang individu yang paling dicintai, dipercaya, ataupun yang telah dibina sebelumnya. Cinta menjadi salah satu tugas perkembangan utama pada perkembangan masa dewasa awal. Daya tarik terhadap satu dengan yang lain pada masa dewasa awal akan membawa pada kedekatan khusus yang disebut pacaran. Penelitian ini bertujuan untuk mengetahui hubungan daya tarik interpersonal pasangan dan perasaan cinta terhadap pasangannya pada masa dewasa awal. Rancangan penelitian yang digunakan adalah deskriptif dan korelasional. Pengambilan sampel menggunakan teknik purposive sampling (sampel bertujuan). Teknik pengumpulan data menggunakan skala daya tarik interpersonal dan skala perasaan cinta. Hasil dari penelitian menunjukkan bahwa mahasiswa menilai daya tarik interpersonal pasangan pada kategori tinggi dengan persentase 52%. Sedangkan perasaan cinta terhadap pasangan juga berada pada kategori tinggi dengan persentase 50%. Hasil analisis r = 0,800 dengan Sig 0,000 < 0,050, menunjukkan bahwa daya tarik interpersonal pasangan mempunyai hubungan dengan perasaan cinta terhadap pasangan pada masa dewasa awal. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa ada hubungan positif yang signifikan antara daya tarik interpersonal dan perasaan cinta pada masa dewasa awal terhadap pasangannya. Maka dari itu daya tarik interpersonal perlu terus dipertahankan dan bila perlu ditingkatkan agar perasaan cinta dapat tetap terjaga. Daya tarik ini tidak hanya sebatas daripada terlihat menarik secara aspek fisik (jasmani) saja tetapi bisa dikembangkan dalam segi aspek emosi, mental, spiritual, maupun kepribadian yang baik. Selain itu diharapkan bagi peneliti lain, agar dapat memperluas penelitian ini dengan menggunakan rancangan penelitian yang berbeda, seperti eksperimen ataupun kualitatif dan untuk meneliti dengan variabel lain yang dapat berpengaruh pada perasaan cinta pada masa dewasa awal.

Pengaruh penerapan pembelajaran kooperatif model dua tinggal dua tamu (twi stay two stray) terhadap hasil belajar geografi sisw kelas VII SMP Negeri 1 Bandung Tulungagung / Ria Titis Susantika

 

ABSTRAK Susantika, Ria Titis. 2009. Pengaruh Penerapan Pembelajaran Kooperatif Model Dua Tinggal Dua Tamu (Two Stay Two Stray) terhadap Hasil Belajar Geografi Siswa Kelas VII SMP Negeri 1 Bandung Tulungagung. Skripsi, Jurusan Geografi, FMIPA Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Edy Purwanto, M.Pd, (II) Dr. Ach. Amirudin, M.Pd. Kata kunci: Pembelajaran Kooperatif, Model Dua Tinggal Dua Tamu (Two Stay Two Stray), hasil belajar. Pendidikan merupakan salah satu ukuran kualitas kehidupan bangsa, karena tingkat pendidikan dapat menunjukkan kualitas sumber daya manusia yang dimiliki. Saat ini pendidikan di Indonesia mengalami perubahan menuju perbaikan. Bentuk usaha tersebut adalah perubahan kurikulum. Perubahan paradigma pembelajaran dari Kurikulum 2004 menjadi KTSP adalah orientasi pembelajaran yang semula berpusat pada guru (teacher centered) beralih berpusat pada murid (student centered). Pembaharuan proses pendidikan umumnya dititikberatkan pada metode mengajar. Pendekatan pembelajaran yang sesuai dengan KTSP adalah pembelajaran konstruktivistik, dimana siswa dituntut berperan aktif dalam pembelajaran dan pendekatan pembelajaran yang berorientasi pada konstruktivis adalah pembelajaran kooperatif. Salah satu model pembelajaran kooperatif adalah Dua Tinggal Dua Tamu (Two Stay Two Stray). Penelitian ini bertujuan untuk mengetahui pengaruh pembelajaran kooperatif model Dua Tinggal Dua Tamu (Two Stay Two Stray) terhadap hasil belajar geografi siswa kelas VII SMP Negeri 1 Bandung Tulungagung. Penelitian ini termasuk penelitian eksperimen semu (Quasi Eksperimental) dengan mengambil subjek penelitian dua kelas yaitu kelas VII-F sebagai kelas eksperimen dan kelas VII-E sebagai kelas kontrol. Instrumen penelitian berupa tes untuk pratest dan pascatest. Teknik analisis yang digunakan adalah uji-t tidak berpasangan yang diselesaikan dengan bantuan komputer program SPSS 13.0 for Windows. Hasil penelitian menunjukkan bahwa terdapat perbedaan yang signifikan antara nilai rata-rata kelas eksperimen dan kelas kontrol. Dari analisis data diketahui bahwa rata-rata hasil belajar siswa pada kelas eksperimen sebesar 19,63 sedangkan pada kelas kontrol sebesar 11,67 dengan nilai probabilitas (sig) 0,000. Dengan demikian nilai probabilitas 0,000 < 0,05, maka Ho ditolak, sehingga dapat disimpulkan bahwa penerapan pembelajaran kooperatif model Dua Tinggal Dua Tamu (Two Stay Two Stray) berpengaruh terhadap hasil belajar geografi siswa kelas VII SMP Negeri 1 Bandung Tulungagung. Disarankan bagi guru geografi dapat menggunakan model Dua Tinggal Dua Tamu (Two Stay Two Stray) sebagai alternatif dalam merencanakan proses pembalajaran karena dapat meningkatkan hasil balajar siswa. Bagi peneliti selanjutnya disarankan untuk mengembangkan penelitian dengan model Dua Tinggal Dua Tamu (Two Stay Two Stray) pada materi selain pola permukiman penduduk, penggunaan lahan dan pola permukiman berdasarkan kondisi fisik permukaan bumi.

Visualisasi garis-garis medan listrik oleh distribusi muatan titik dalam ruang / Dedy Yulianto

 

Gaya Coulomb timbul tanpa adanya persentuhan antara ke dua benda, bahkan gaya Coulomb dapat dirasakan pada jarak tertentu, konsep gaya seperti ini relatif sukar untuk dimengerti sehingga perlu dikenalkan konsep medan listrik. Konsep medan listrik ini lebih mudah dipahami apabila menggunakan bantuan berupa garis-garis medan listrik. Garis-garis medan listrik merupakan garis-garis khayal di dalam medan listrik yang menjadi tempat kedudukan titik-titik yang arah kuat medannya sama dengan arah garis itu Pada umumnya garis-garis medan listrik menggunakan dua muatan, namun ketika muatan tersebut lebih dari dua dan terdistribusi dalam ruang maka konsep medan listrik menjadi sulit dipahami.Kemudian jika besarnya muatan yang terdistribusi tersebut tidak sama maka konsep medan listriknya menjadi tambah sulit lagi sehingga diperlukan suatu visualisasi garis-garis medan listrik untuk kasus semacam itu. Visualisasi ini bertujuan untuk mengetahui sifat medan listrik yang terdistribusi dalam ruang baik muatan yang teratur maupun acak. Pada program ini, untuk menghitung kuat medan listriknya menggunakan persamaan )()(rrE sehingga terlebih dahulu harus menghitung potensial skalarnya )(r. Teknik pemrograman tersebut menggunakan bahasa pemrograman Mathematica 5.1. Hasil dari visualisasi ini adalah pola garis-garis medan listrik yang dihasilkan oleh muatan titik yang terdistribusi dalam ruang yang menggunakan variasi jumlah muatan titik, jenis muatan titik, dan besarnya muatan titik. Pada variasi jumlah muatan titik menggunakan 5, 6, dan 8 dengan jenis muatan yang sejenis. Pada variasi jenis muatan titik menggunakan jumlah muatan yang sama tetapi jenis muatannya tidak sama. Kemudian pada variasi besarnya muatan titik juga menggunakan jumlah muatan yang sama tetapi besarnya muatannya berbeda. Pada muatan yang sejenis, garis-garis medan listriknya terlihat saling menjauh hal ini karena pada muatan yang sejenis gaya listriknya saling tolak menolak. Sedangkan garis-garis medan listrik yang dihasilkan oleh muatan yang tidak sejenis terlihat garis-garis medan listriknya menyambung hal ini karena gaya listriknya saling tarik-menarik. Kemudian ketika jarak muatan yang tidak sejenis itu dekat, terlihat garis-garis medan listriknya lebih rapat hal ini menandakan bahwa kuat medan listrik di sekitar muatan tersebut besar. Pola garis-garis medan listrik pada variasi besarnya muatan titik terlihat menyambung untuk muatan yang tidak sejenis dan garis-garis medan listriknya terlihat rapat hal ini karena kuat medan listrik di sekitar muatan tersebut besar

Pengaruh bauran promosi terhadap keputusan pembelian konsumen pada produk kartu prabayar simpati (studi pada mahasiswa S-1 Jurusan Psikologi Fakultas Ilmu Pendidikan UM) / Harsinta Wiradini

 

ABSTRACT Wiradini, Harsinta. 2009. The Effect of Promotional Mix toward Consumers Purchasing decision on “Kartu Prabayar Simpati” (A Study on Psychology Students of Educational Faculty State University of Malang. Thesis, Management Departement Economy Faculty State University of Malang. Advisor: (1) Drs. M. Arief, M.Si, (II) Rachmad Hidayat S.Pd. Keywords: promotional mix, consumers purchasing decision As the time of competition in business become tighter than before, it results in the importance of selling strategy of the company. In marketing concept, the company needs not only to produce qualified goods and service but also the advertise its product in order to make the customer attracted and finally buy it, therefore, Telkomsel with its product “Kartu Prabayar Simpati” do promotional mix which includes advertisement, personal selling, sales promotion, public relations and direct selling. The population in this research are 164 S-1 Student of Psychology, Education Faculty UM who are the customer of “Kartu Prabayar Simpati”. The questionaire are spread by using accidental sampling technique. The number of sample are 62 people , this number are used through counting the sample by using Slovin Formula. This research used 2 variables. Which are X variable as the promotional mix, this variable is independent which are consist of advertisement, personal selling, sales promotion, public relations and direct selling. While variables Y is consumers purchasing decision, this variables is dependent variables. The data gathered from respondents by using closed questionare. After using data analysis the results are: (1) There are partially significant effect between advertisement and consumers purchasing decision of “Kartu Prabayar Simpati”; (2) There are partially significant effect between sales promotion and consumers purchasing decision of “Kartu Prabayar Simpati”; (3) There are partially significant effect between personal selling and consumers purchasing decision of “Kartu Prabayar Simpati; (4) There are not a significant effect between public relations and consumers purchasing decision of “Kartu Prabayar Simpati; (5) There are partially significant effect between direct selling and consumers purchasing decision of “Kartu Prabayar Simpati; (6) There are simultaneoeously significant effect between promotion mix and consumers purchasing decision of “Kartu Prabayar Simpati; (7) Sub Variables of Promotional Mix which has dominant effect in affecting consumers purchasing decisions on Kartu Prabayar Simpati is the Sales Promotions which has spread Beta Coefficients,in this study is 0,341. Based on the result of this research it can be concluded that the effective Promotions Mix in marketing strategy can increase consumers purchasing decision. Based on the results, the researcher suggest that: (1) Advertisement should be done creatively so that it can attract the consumers; (2) Sales Promotion should be increased so that the consumer will be loyal to use Kartu Prabayar Simpati; (3) Personal Selling should be treated in special way so that it can manage the companys image; (4) Public Relations should be more carefully managed so that the company gets the societys trust; (5) Direct Selling should be carefully handled in order to avoid competition with the distributors.

Penerapan metode role playing pada mata pelajaran IPS untuk meningkatkan minat mempelajari sejarah pada siswa kelas VIII MTs Muallimat Malang tahun ajaran 2008-2009 / Agustin Anik Arti Ashe

 

ABSTRAK Ashe, Agustin Anik Arti. 2009. Penerapan Metode Role Playing Pada Mata Pelajaran IPS (Sejarah) Untuk Meningkatkan Minat Mempelajari Sejarah Pada Siswa Kelas VIII MTs Muallimat Malang. Skripsi. Jurusan Sejarah. Fakultas Sastra. Universitas Negeri Malang. Pembimbing (I) Dra. Siti Malikhah Towaf M.A, Ph.D. Pembimbing (II) Drs. Marsudi, M. Hum Kata Kunci: Metode Role Playing, Minat, IPS (Sejarah) MTs Muallimat Malang merupakan salah satu sekolah atau madrasah yang proses pembelajaran untuk mata pelajaran IPS (Sejarah) di kelas VIII masih menggunakan metode ceramah, pemberian tugas dan diskusi. Dalam proses pembelajaran guru lebih mendominasi setiap aktifitas belajar mengajar, sedangkan siswa bersifat pasif, sehingga proses pembelajaran kurang optimal. Hal ini mengakibatkan turunnya minat belajar siswa kelas VIII terhadap mata pelajaran IPS (Sejarah). Oleh karena itu, kekurangan dari metode ceramah dalam proses pembelajaran mata pelajaran IPS (Sejarah) dapat disempurnakan dengan menggunakan metode role playing. Pembelajaran menggunakan metode role playing dapat memberikan kesempatan kepada siswa untuk lebih aktif dan juga mendapatkan pengalaman sehingga siswa memperoleh ide dan konsep-konsep tentang pelajaran yang sedang diterimanya. Berdasarkan penjelasan tersebut di atas, dirumuskan permasalahan sebagai berikut: 1) Bagaimanakah penerapan metode role playing pada mata pelajaran IPS (Sejarah) untuk siswa kelas VIII MTs Muallimat Malang?; 2) Bagaimanakah peningkatan minat siswa kelas VIII MTs Muallimat Malang pada mata pelajaran IPS (Sejarah) setelah diterapkan metode role playing? Penelitian ini bertujuan untuk: 1) mendeskripsikan penerapan metode role playing pada mata pelajaran IPS untuk siswa kelas VIII MTs Muallimat Malang; 2) Mengetahui peningkatan minat siswa kelas VIII MTs Muallimat Malang pada mata pelajaran IPS setelah diterapkan metode role playing. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK). Populasi dalam penelitian ini adalah siswa kelas VIII MTs Muallimat Malang dengan jumlah 30 siswa. Instrumen penelitian menggunakan lembar observasi, angket, catatan lapangan. Hasil penelitian menunjukkan adanya peningkatan minat siswa yang cukup signifikan di semua aspek, yaitu kualitas pemeranan, kesesuaian peran, analisis pemeranan, ketertarikan, dan merasa senang. Hal itu dapat di lihat pada siklus pertama prosentase rata-rata minat siswa MTs Muallimat Malang kelas VIII terhadap mata pelajaran IPS (Sejarah) sebesar 57,17 %. Sedangkan pada siklus kedua prosentase rata-rata minat siswa MTs. Muallimat Malang kelas VIII terhadap mata pelajaran IPS (Sejarah) sebesar 88,20 %, sehingga dalam hal ini terjadi peningkatan minat belajar sebesar 31,03 %. Mengacu pada hasil analisis dari penelitian yang dilakukan dapat disarankan kepada guru khususnya guru mata pelajaran IPS (Sejarah) kelas VIII Madrasah Tsanawiyah (MTs) untuk lebih berupaya terbuka menerima dan menggunakan metode role playing demi tercapainya tujuan pendidikan nasional yaitu bertujuan untuk mengembangkan potensi peserta didik agar menjadi manusia yang beriman dan bertakwa kepada tuhan Yang Maha Esa, berakhlak mulia, sehat, berilmu, cakap, kreatif, mandiri, dan menjadi warga negara yang demokratis serta bertanggungjawab. Sedangkan bagi peneliti selanjutnya yang ingin melaksanakan penelitian serupa diharapkan mengembangkan dan memperluas pokok bahasan penelitiannya agar dapat mengungkapkan hal-hal yang terkait tentang metode role playing yang belum terungkap dari penelitian ini sehingga hasil penelitiannya dapat lebih relevan dengan fakta pendidikan yang ada.

Korelasi kecerdasan intelektual dan perilaku asertif dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang / Wiwin Widyawati

 

Prestasi belajar seorang anak tidak hanya ditentukan oleh kecerdasan intelektual saja, tetapi juga ditentukan oleh kecerdasan emosional yang salah satu keterampilan praktisnya adalah perilaku asertif. Menurut Winkel (1996:53), proses belajar tidak akan terjadi apabila tidak ada suatu yang mendorong pribadi yang bersangkutan. Dalam proses belajar tersebut, semua kecerdasan yang ada pada diri seseorang baik kecerdasan intelektual maupun kecerdasan emosional (termasuk perilaku asertif) dimanfaatkan atau terefleksi secara maksimal. Dengan kecerdasannya, manusia dapat terus menerus mempertahankan dan meningkatkan kualitas hidupnya yang semakin kompleks, melalui proses berpikir dan belajar secara terus menerus. Penelitian ini bertujuan untuk memperoleh (1) deskripsi objektif tentang tingkat inteligensi siswa SMAN 9 Malang, (2) deskripsi objektif tentang perilaku asertif siswa SMAN 9 Malang, (3) deskripsi objektif tentang prestasi belajar siswa SMAN 9 Malang, (4) untuk mengetahui ada tidaknya korelasi antara kecerdasan intelektual dengan prestasi belajar siswa SMAN 9 Malang, (5) untuk mengetahui ada tidaknya korelasi antara perilaku asertif dengan prestasi belajar siswa SMAN 9 Malang, (6) untuk mengetahui ada tidaknya korelasi antara kecerdasan intelektual dan perilaku asertif dengan prestasi belajar siswa SMAN 9 Malang. Penelitian ini menggunakan metode Expost Facto Correlation dengan mengambil sampel secara menyeluruh (sampel total). Berdasarkan sampel penelitian tersebut, diperoleh sebaran data untuk masing-masing variabel yaitu kecerdasan intelektual, perilaku asertif, dan prestasi belajar siswa kelas X SMA Negeri 9 Malang. Data dijaring melalui angket dan studi dokumentasi. Hasil penelitian menunjukkan: (1) Kecerdasan intelektual siswa kelas X SMA Negeri 9 Malang tahun 2008/2009 secara umum termasuk kategori di atas rata-rata. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan sebagian besar (111 siswa atau 39,50%) memiliki IQ 110-119. (2) Tingkat perilaku asertif siswa kelas X SMA Negeri 9 Malang tahun 2008/2009 secara umum termasuk kategori tinggi. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan sebagian besar (238 siswa atau 84,70%) memiliki rentangan skor 225-272. (3) Prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun 2008/2009 secara umum termasuk kategori cukup. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan sebagian besar (230 siswa atau 81,85%) memiliki rata-rata nilai rapor 65-79. Hasil pengujian hipotesis menunjukkan: (1) Tidak terdapat hubungan yang signifikan antara kecerdasan intelektual dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun ajaran 2008/2009, yang dibuktikan dari hasil uji statistik korelasi tata jenjang, bahwa diperoleh r (0,062 dan 0,083) dengan probabilitas (0,158 dan 0,164) > 0.05. (2) Terdapat hubungan yang signifikan antara perilaku asertif dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun ajaran 2008/2009, yang dibuktikan dari hasil uji statistik korelasi tata jenjang, bahwa diperoleh r (0,114**dan 0,153*) dengan probabilitas (0,009 dan 0,010) < 0.05. (3) Terdapat hubungan yang signifikan antara kecerdasan intelektual dan perilaku asertif dengan prestasi belajar siswa kelas X SMA Negeri 9 Malang tahun ajaran 2008/2009, yang dibuktikan dari hasil analisis korelasi ganda, bahwa probabilitas (0,016 < 0,05 dan F hitung (4,211) > F tabel (3,00). Berdasarkan hasil analisis maka peneliti menyampaikan saran: Konselor hendaknya dapat mengadakan pengembangan terhadap diri siswa dengan mengarahkan layanan BK untuk membantu siswa lebih dapat berperilaku asertif dengan efektif, karena terbukti bahwa perilaku asertif berkorelasi secara signifikan dengan prestasi belajar.

Strategi-strategi react dengan menggunakan aktivitas pemecahan masalah pada pembelajaran materi lingkaran kelas VIIIG SMPN 13 Malang / Ari Kusumastuti

 

Hasil observasi awal yang dilaksanakan dalam penelitian ini mendapatkan informasi bahwa pada materi geometri lingkaran terdapat kendala dalam pengajarannya. Siswa selalu mengalami kesalahan dalam mentranser pemahaman mereka pada aktifitas pemecahan masalah. Metode belajar masih menggunakan pendekatan ceramah. Setting belajar juga masih individual dan siswa terkesan pasif. Penelitian ini berupaya memperbaiki pola pembelajaran yang lama dengan menerapkan strategi-strategi REACT dengan aktifitas pemecahan masalah. Materi yang dipilih adalah lingkaran. Penelitian ini merupakan penelitian tindakan kelas. Penelitian ini terdiri dari 7 tindakan. Ketujuh tindakan ini selanjutnya dibagi dalam dua siklus. Setiap akhir pembelajaran dilakukan wawancara dengan siswa untuk melihat pemahaman akan materi yang telah diberikan. Subjek wawancara dipilih dari 3 siswa yang terdiri dari 1 siswa berkemampuan tinggi, 1 siswa berkemampuan sedang, dan 1 siswa berkemampuan rendah. Teknik pengumpulan data dalam penelitian ini yaitu melalui tes, wawancara, observasi langsung, catatan lapangan, dan jurnal siswa. Tes dilakukan untuk memperoleh data non verbal aktifitas pemecahan masalah. Sedangkan observasi langsung, wawancara, catatan lapang dan jurnal siswa untuk memperoleh data verbal aktivitas bermatematika dan aktifitas pemecahan masalah serta respon siswa terhadap strategi-strategi REACT. Teknik analisis data, untuk data berupa bilangan dianalisis dengan menggunakan analisis prosentase, sedangkan untuk data kualitatif dianalisis sesuai dengan model Milles dan Huberman yang meliputi 3 tahap yaitu: (1) reduksi data, (2) menyajikan data, dan (3) menarik kesimpulan. Implementasi pembelajaran dilaksanakan dalam 3 tahap yaitu tahap awal, inti, dan tahap akhir. Tahap awal guru menjalankan strategi relating dengan mengajukan pertanyaan kontekstual. Tahap inti guru menjalankan strategi experiencing, applying, cooperating dan transferring dengan aktifitas pemecahan masalah. Tahap akhir siswa menyimpulkan dan merefleksi hasil pembelajaran dengan bimbingan guru. Hasil penelitian ini menunjukkan adanya peningkatan aktivitas bermatematika dan aktifitas pemecahan masalah siswa dengan strategi-strategi REACT ini. Peningkatan aktivitas dilihat dari analisis prosentase hasil pengamatan dan catatan lapangan selama proses pembelajaran. Respon siswa terhadap pembelajaran dengan strategi-strategi REACT pada materi lingkaran dalam penelitian ini sangat baik. Hal ini dapat dilihat dari hasil analisis jurnal siswa.

Penerapan metode quantum learning melalui teknik windows untuk pembelajaran keterampilan menulis bahasa Jerman di kelas X SMA Negeri 6 Malang / Rosa Ria Rully Ardian

 

ABSTRAK Ardian, Rosa Ria Rully 2009. Penerapan Metode Quantum Learning Melalui Teknik WINDOWS untuk Pembelajar Keterampilan Menulis Bahasa Jerman di Kelas X SMA Negeri 6 Malang. Skripsi. Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra Rosyidah M.Pd, (II) Sri Prameswari M.Pd Kata Kunci : metode Quantum Learning, Teknik WINDOWS, keterampilan menulis Dalam menulis sebuah karangan diperlukan suasana nyaman dan santai, agar keduabelahan otak dapat berfungsi dengan baik, sehingga siswa mudah mengembangkan ide tulisannya. Pada kenyataannya para guru masih menggunakan metode tradisional yang kaku. Hal ini menyebabkan siswa hanya mempergunakan fungsi otak kirinya saja. Berdasarkan hal tersebut, peneliti menggunakan metode Quantum Learning melalui teknik WINDOWS sebagai metode pengajaran untuk keterampilan menulis agar siswa dapat mengoptimalkan fungsi keduabelahan otaknya. Penelitian ini bertujuan untuk mendeskripsikan: (1) kemampuan menulis siswa kelas X5-8 SMAN 6 Malang sebelum menggunakan teknik WINDOWS, (2) penerapan teknik WINDOWS, dan (3) kemampuan menulis siswa dengan menggunakan teknik WINDOWS. Penelitian ini menggunakan rancangan penelitian kualitatif. Sumber data yang digunakan adalah 17 siswa kelas X5-8 yang mengikuti pelajaran Bahasa Jerman. Data dikumpulkan dengan teknik kuesioner, dokumentasi, pemberian tugas, dan pengamatan aktifitas guru dan siswa. Data dianalisis dalam tiga tahap, yaitu klasifikasi data, pengelompokan data, dan interpretasi data. Hasil penelitian ini: (1) kemampuan menulis siswa sebelum menggunakan teknik WINDOWS adalah kurang dari segi pengembangan topik, cukup dari segi organisasi karangan, kurang dari segi tata bahasa, kurang dari segi kosa kata, dan cukup dari segi ejaan dan tanda baca; (2) pembelajaran Bahasa Jerman dengan menggunakan teknik WINDOWS, yaitu (a) pemberian kata kunci/Schlüsselwort, (b) penuliskan hasil imajinasi dari kata kunci dalam beberapa kata sebagai konsep, (c) penggambaran konsep dalam bentuk lukisan, dan (d) penjelaskan lukisan dalam bentuk karangan. Teknik WINDOWS terbukti memotivasi siswa untuk aktif selama pelajaran berlangsung; dan (3) kemampuan menulis siswa pada penerapan teknik WINDOWS terbukti dapat meningkatkan kemampuan menulis siswa pada segi pengembangan topik dan kosa kata. Dari hasil penelitian ini dapat disimpulkan bahwa penggunaan teknik WINDOWS sebagai metode pengajaran untuk keterampilan menulis dapat membantu siswa mengoptimalkan fungsi keduabelahan otaknya, sehingga siswa bisa lebih aktif di kelas. Oleh karena itu, disarankan kepada guru untuk menggunakan teknik WINDOWS dalam pembelajaran bahasa Jerman. Kepada peneliti selanjutnya, disarankan untuk melakukan penelitian tentang penerapan teknik WINDOWS untuk keterampilan menulis pada tingkatan kelas yang lain atau pada tingkat mahasiswa.

Sifat organoleptik smoked duck dengan perbedaan lama pengasapan / Maftuhah

 

Penelitian ini merupakan penelitian eksperimen pembuatan smoked duck dengan perbedaan lama pengasapan 1 jam, 2 jam dan 3 jam. Masing-masing perlakuan dilakukan 3 kali pengulangan. Tujuan penelitian ini adalah untuk mengetahui sifat organoleptik smoked duck yang meliputi warna, tekstur dan rasa melalui uji mutu hedonik dan uji hedonik. Eksperimen dilakukan pada bulan Juli – Agustus 2009 di Laboratorium Tata Boga gedung H4 lantai 2 Universitas Negeri Malang. Data diperoleh dari panelis agak terlatih sebanyak 20 orang yaitu mahasiswa D3 Tata Boga angkatan 2005-2006 secara acak. Data dianalisis dengan analisis sidik ragam dan Duncan’s Multiple Range Test (DMRT). Hasil analisis menunjukan terdapat perbedaan yang sangat nyata warna, tekstur dan rasa antara smoked duck dengan lama waktu pengasapan 1 jam, 2 jam dan 3 jam. Hasil uji mutu hedonik terhadap warna, tekstur dan rasa smoked duck menunjukan bahwa smoked duck dengan lama pengasapan 1 jam memperoleh nilai tertinggi pada warna dengan nilai rata-rata 3,50. Smoked duck dengan lama pengasapan 2 jam memperoleh nilai tertinggi pada tekstur dengan nilai rata-rata 3,02. Dan smoked duck dengan lama pengasapan 1 jam memperoleh nilai tertinggi pada rasa dengan nilai rata-rata 2,93. Hasil uji hedonik diperoleh data bahwa sebagian kecil panelis (46,67%) menyukai warna smoked duck dengan lama pengasapan 1 jam. Sebagian besar panelis (61,67%) menyukai rasa smoked duck dengan lama pengasapan 1 jam. Sebagian kecil panelis (36,67%) menyukai tekstur smoked duck dengan lama pengasapan 2 jam Kesimpulan dari hasil penelitian ini adalah semakin lama pengasapan smoked duck, maka warna smoked duck semakin coklat, tekstur semakin kering dan rasa semakin getir.

Perbandingan efektivitas penempatan fuse cut out (FCO) terhadap lightning arrester (LA) pada trafo 20 KV / Habibi

 

ABSTRAK Habibi. 2009. Perbandingan Efektivitas Penempatan Fuse Cut Out (FCO) Terhadap Lightning Arrester (LA) Pada Trafo 20 KV. Tugas Akhir, Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Drs. Setiadi C.P., M.Pd., M.T., (II) M. Rodhi Faiz, S.T.,M.T. Kata Kunci : Fuse Cut Out, Lightning Arrester, Transformator 20 KV. Trafo distribusi merupakan komponen yang sangat penting dalam penyaluran tenaga listrik dari gardu distribusi ke konsumen. Kerusakan pada trafo dalam gardu distribusi menyebabkan kontinuitas pelayanan terhadap konsumen akan terganggu. Dengan adanya sistem pengaman yang dapat bekerja dengan baik di dalam gardu distribusi diharapkan gangguan-gangguan yang menyebabkan tegangan lebih dan arus lebih dapat diatasi. Peralatan pengaman yang dipasang pada sisi primer trafo distribusi adalah lightning arrester sebagai pengaman tegangan lebih dan fuse cut out sebagai pengaman arus lebih. Tujuan dari penelitian ini adalah untuk mengetahui macam perancangan penempatan fuse cut out terhadap lightning arrester pada trafo 20 KV. Dan juga untuk mendapatkan perbandingan dan analisis serta kesimpulan dari hasil perancangan. Ada dua macam penempatan fuse cut out terhadap lightning arrester pada trafo distribusi 20 KV yaitu pemasangan setelah dan sebelum lightning arrester. Perancangan dan analisis perbandingan ini dilakukan untuk mengetahui efektivitas penempatan fuse cut out terhadap lightning arester pada trafo 20 KV yang sesuai dengan kebutuhan. Metode yang digunakan untuk mendapatkan perbandingan ini adalah dengan menentukan spesifikasi komponen dan rangkaian perancangan. Kemudian berdasarkan pada data sekunder/simulasi dan menganalisis serta menyimpulkan hasil data tersebut. Penempatan fuse cut out dan lightning arrester bisa dengan menganalisa besar dan frekuensi terjadinya gangguan pada suatu daerah. Dengan menganalisa besar arus gangguan yang dapat terjadi dan memperhatikan karakteristik serta pola seting peralatan pengaman yang terpasang, diharapkan dapat diketahui tingkat keandalan dari peralatan pengaman.

Ekspektasi siswa, guru, dan kepala sekolah terhadap penyelenggaraan layanan bimbingan dan konseling di SMA Negeri 1 Sumenep / Riyanti Utami

 

ABSTRAK Utami, Riyanti. 2009. Ekspektasi Siswa, Guru, Dan Kepala Sekolah Terhadap Penyelenggaraan Layanan Bimbingan Dan Konseling Di SMA Negeri 1 Sumenep. Skripsi, Jurusan Bimbingan Konseling Dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (I) Dr. H. M. Ramli, M.A, (II) Drs.H. Moh. Bisri. M.Si. Kata kunci: Ekspektasi, Siswa, Guru, Kepala Sekolah, Bimbingan dan Konseling Layanan Bimbingan dan Konseling merupakan bagian yang tidak terpisahkan dari keseluruhan program pendidikan. Bimbingan dan Konseling sangat dibutuhkan peranannya dalam rangka membangun pribadi yang utuh melalui pendidikan formal. Maka dari itu peneliti dalam penelitian ini bertujuan (1) untuk mengetahui ekspektasi siswa terhadap penyelenggaraan program layanan bimbingan dan konseling di SMA Negeri 1 Sumenep, (2) ekspektasi guru terhadap penyelenggaraan program layanan bimbingan dan konseling di SMA Negeri 1 Sumenep, (3) ekspektasi kepala sekolah terhadap penyelenggaraan program layanan bimbingan dan konseling di SMA Negeri 1 Sumenep. Rancangan atau desain penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Populasi dalam penelitian ini yaitu siswa, guru, dan kepala sekolah di SMA Negeri 1 Sumenep. Adapun teknik pengambilan sampelnya menggunakan teknik random sampling atas dasar himpunan cluster random sampling. Instrumen pengumpulan data yang dipergunakan dalam penelitian ini adalah angket atau kuesioner (questionnaires). Sebagai alat bantu dalam analisis data, peneliti menggunakan persentase (%). Berdasarkan hasil penelitian diketahui bahwa siswa, guru, dan kepala sekolah mempunyai ekspektasi yang sangat tinggi terhadap penyelenggaraan layanan bimbingan dan konseling di SMA Negeri 1 Sumenep. Dari hasil penelitian ini, maka saran yang dapat peneliti berikan yaitu: (a) kepala sekolah sangat mengharapkan penyelenggaraan layanan bimbingan dan konseling, maka dari itu kepala sekolah hendaknya memberikan dukungan yang serius dan sistematis terhadap penyelenggaraan program bimbingan dan konseling, seperti dalam menyediakan sarana dan prasarana bimbingan dan konseling, karena dengan dukungan aktif kepala sekolah sangat menentukan kelancaran program bimbingan dan konseling, (b) ekspektasi siswa, guru dan kepala sekolah sebagian besar sangat mengharapkan penyelenggaraan layanan bimbingan dan konseling, maka dari itu konselor harus lebih aktif dan kreatif dalam melaksanakan layanan bimbingan dan konseling, macam-macam kegiatan pendukung, dan sarana dan prasarana bimbingan dan konseling, sehingga layanan bimbingan dan konseling benar-benar sesuai dengan kebutuhan siswa, (c) guru sebagian besar mengharapkan penyelenggaraan layanan bimbingan dan konseling, maka dari itu guru hendaknya membantu dalam penyelenggaraan layanan bimbingan dan konseling agar layanan bimbingan dan konseling dapat berjalan dengan lancar.

Survei tentang sarana dan prasarana pendidikan jasmani yang dimiliki sekolah menengah atas negeri (SMAN) se-kota Pamekasan / Jaka Bachtiar Rachman

 

ABSTRAK Rachman, Jaka Bachtiar. 2009. Survei Tentang Sarana dan Prasarana Pendidikan Jasmani yang Dimiliki Sekolah Menengah Atas Negeri (SMAN) se-Kota Pamekasan. Skripsi Fakultas Ilmu Keolahragaan Jurusan Pendidikan Jasmani dan Kesehatan Universitas Negeri Malang. Pembimbing: (1) Dra. Sulistyorini, M.Pd, (2) dr.Hartati Eko Wardani, M.Si.,Med Kata kunci: Survei, sarana, prasarana, pendidikan jasmani. Salah satu unsur penting dalam mencapai tujuan pendidikan jasmani adalah tersedianya sarana dan prasarana yang memadai. Penelitian ini bertujuan untuk mengetahui: (1) bagaimana sarana dan prasarana pendidikan jasmani di SMAN se-Kota Pamekasan, (2) perbandingan prasarana pendidikan jasmani di SMAN se-Kota Pamekasan dengan standar umum prasarana sekolah. Jenis penelitian ini adalah penelitian observasional (survei). Populasi pada penelitian ini adalah SMAN se-Kota Pamekasan yang berjumlah 5 SMA. Sampel yang digunakan yaitu seluruh populasi. Instrumen pada penelitian ini menggunakan lembar observasi. Sedangkan item-item pada lembar observasi didasarkan pada kurikulum pendidikan jasmani tahun 2004. Analisis data menggunakan statistik deskriptif (rata-rata dan persentase). Hasil penelitian dapat disimpulkan sebagi berikut: (1). (a) sarana dan prasarana atletik yaitu 20% memiliki lintasan lari, stopwacth; 40% memiliki bak lompat jauh, balok tumpu, dan meteran; 60% memiliki start block; 80% memiliki matras, tiang dan mistar, lembing; 100% memiliki tongkat estafet, peluru, dan cakram. (b) sarana dan prasarana aktivitas senam dan ritmik yaitu 40% memiliki gedung/aula, peti lompat, dan tape recorder; 60% memiliki matras. (c) sarana dan prasarana permainan yaitu 20% memiliki lapangan sepak bola; 40% memiliki lapangan tenis meja, meja tenis, lapangan bulu tangkis,dan net bulu tangkis; 80% memiliki tiang voli, dan tiang bulu tangkis; 100% memiliki lapangan voli, lapangan basket, bola sepak,peluit, bola voli, net voli,dan bola basket. (d) sarana dan prasarana bela diri yaitu 40% memiliki gedung/aula. (e) sarana dan prasarana akuatik/aktivitas air yaitu SMAN se-Kota Pamekasan tidak memiliki sarana dan prasarana akuatik/aktivitas air. (2) Perbandingan prasarana Pendidikan Jasmani yang dimiliki SMAN se-Kota Pamekasan jika dibandingkan dengan standart umum prasarana sekolah menunjukkan dari 5 sekolah yang ada hanya satu Sekolah yang prasarananya sesuai dengan standar umum prasarana sekolah yaitu SMAN 3 Pamekasan. Hasil penelitian menunjukkan bahwa sarana dan prasarana Pendidikan Jasmani yang dimiliki SMAN se-Kota Pamekasan masih kurang. Untuk itu saran yang dapat diajukan oleh peneliti antara lain: (1) Kepada kepala sekolah SMAN se-Kota Pamekasan. Hendaknya dalam menyediakan sarana dan prasarana perlu diperhatikan untuk kelancaran kegiatan pembelajaran praktek; (2) Guru Pendidikan Jasmani SMAN se-Kota Pamekasan. Jika sekolah tidak memiliki sarana dan prasarana Pendidikan Jasmani hendaknya dapat mencari sarana dan prasarana alternatif sehingga proses pembelajaran praktek dapat terlaksana; (3)SMAN se-Kota Pamekasan. Hendaknya diperhatikan penyediaan Sarana dan prasarana Pendidikan Jasmani dari segi kualitas maupun kuantitas; dan (4) Bagi Sekolah yang tidak mempunyai prasarana Pendidikan Jasmani. Hendaknya menyewa prasarana (lapangan sepak bola, lapangan tolak peluru, lapangan lempar lembing, lapangan lempar cakram, lari, dan kolam renang) di luar sekolah agar proses pembelajaran praktek bisa terlaksana.

Improving the students' speaking ability at Madrasah Aliyah Sunan Drajat Sugio - Lamongan through role-playing technique / Chothibul Umam

 

Abstrak Based on the preliminary study, the researcher found some problems related to the English instructional activities in MA. Sunan Drajat Sugio-Lamongan. Those are the students' low speaking ability, the students' low motivation in learning English, and the monotonous and inappropriate teaching techniques used by the teacher. Therefore, the researcher is greatly motivated to overcome the problem by implementing role-playing technique in teaching speaking. This research is intended to describe how role-playing technique can improve the speaking ability of the eleventh year students of MA. Sunan Drajat Sugio - Lamongan. The researcher employed collaborative classroom action research design, in which the researcher was assisted by a collaborative teacher (a colleague) in conducting the study. The research is conducted in a single class that consists of twenty four students, in which all of the students are taken as the subjects of the study. The procedure of the research consists of four main steps: planning, implementation, observation and reflection. To collect the data, the researcher uses some instruments i.e. observation checklists, field notes, and questionnaire. The finding of this research showed that the students' skill in speaking improved significantly from one cycle to the following cycle. This can be seen from the result of each cycle. The students' speaking performance improved from 41.7% of all students who could reach at least good level at the first cycle to 66.7% of all students in the second cycle. The students' self-confidence also improved from 37.5% of all students who could fulfill 5 of 7 indicators in this study in the first cycle to 62.5% of all the students in the second cycle. The role-playing procedures implemented by the researcher in this study consist of 7 major steps. Those are deciding on the teaching materials, organizing the group of the students, providing the situation and dialogue to be role played, teaching the dialogue for role plays, having the students practice the role plays, having the students modify the situation and dialogue, and having the students perform the dialogue in front of the class. Based on the effectiveness of the implementation of role-playing technique in teaching speaking, it is suggested for the English teachers whose have similar classroom problems, characteristics and situations with MA. Sunan Drajat Sugio-Lamongan to use role-playing technique as an alternative technique to teach speaking skill at SMA/MA level.

Penerapan model pembelajaran direct instruction berbasis pendekatan kontekstual untuk meningkatkan hasil belajar fisika siswa kelas XI IPA 1 SMA Laboratorium Universitas Negeri Malang / Ahmad Azhar

 

ABSTRACT Azhar, Ahmad. 2009. The Application of Direct Instruction Method Based on Contextual Approach to Improve Students’ Achievement of Grade XI IPA1 in SMA Laboraturium UM. Thesis, Physics Education, Physics Department, State University of Malang. Advisors: 1) Dra. Endang Purwaningsih, M.Si. 2) Drs. Purbo Suwasono, M.Si. Keywords: Direct Instruction Model, Contextual, Achievement. SMA Laboraturium UM applies Direct Instruction method in teaching and learning process as stated in the lesson plan for physics. However, based on the researcher observation, instead of using Direct Instruction method, the school use lecturing method that provides one-way communication. This made the students as passive learners since they rarely did experiments. As result, the students have some difficulties in stringing up the equipment, collecting the data, and analyzing the data. Furthermore, students’ achievement in cognitive aspect are also low that can be proved by the students’ score. Out of the numbers, only two students can achieve the minimum completeness standard. Therefore, this present research want to know the application of direct instruction method based on contextual approach to improve students’ achievement of grade XI IPA1 in SMA Laboraturium UM. This research used classroom action research (CAR) methodology that consists of two cycles. Each cycle comprises of four steps that are planning, implementation, analysis, and reflection. First and second cycle is the application of lesson plan using direct instruction method such as building knowledge, joint construction, feedback and evaluation, and the last is individual exercises. The instruments used in this study are lesson plan, worksheet, pre test and post test, and observation sheet. The result of the study shows that cognitive, affective, and psychometric aspects increase after applying direct instruction method. The cognitive aspect increases on the normalization gain score from 0,31 in the first cycle up to 0,49 in the second cycle. The affective aspect on the teamwork increases from 58,7% in the first cycle up to 75% in the second cycle, students’ activeness increases from 65,7% in the first cycle up to 86,5% in the second cycle, punctuation of submit-ting the assignments increases from 60,3% in the first cycle up to 87,5% in the second cycle. The psychometric aspect increases on the result of the experiments from 82,7% in the first cycle up to 94,7% in the first cycle, carefulness of measurement increases from 72% in the first cycle up to 89,3% in the first cycle, cleanliness and tidiness increases from 72% in the first cycle up to 81,3% in the first cycle, and filling the worksheet increases from 94,6% in the first cycle up to 100% in the first cycle.

Pengembangan paket pembelajaran IPA terpadu berbasis konstruktivisme dengan tema kebakaran hutan untuk siswa SMP negeri 1 Turen / Cahyono

 

ABSTRAK Cahyono. 2009. Pengembangan Paket Pembelajaran IPA Terpadu Berbasis Konstruktivisme dengan Tema Kebakaran Hutan untuk siswa SMP Negeri 1 Turen. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Supriyono Koes H, M.Pd, MA, (II) Drs. Triastono Imam P., M.Pd Kata kunci : Paket IPA Terpadu, Konstruktivisme, Tema Kebakaran Hutan. Peraturan Menteri Pendidikan Nasional nomor 22 tahun 2006 tentang standar isi secara tegas menyatakan bahwa substansi mata pelajaran IPA pada SMP/MTs merupakan IPA Terpadu. Hasil survey terbatas pada guru-guru IPA SMP/MTs di Jawa Timur dalam beberapa pelatihan PAKEM (Pembelajaran Aktif, Kreatif, Efektif, dan Menyenangkan) yang diselenggarakan oleh proyek MBE tahun 1996 menunjukkan bahwa sebagian besar guru (92 dari 118 orang atau 79%) mengalami kesulitan untuk merancang pembelajaran IPA Terpadu berdasarkan standar isi untuk kurikulum IPA. Oleh sebab itu, hampir semua guru SMP belum melaksanakan pembelajaran secara terpadu (Koes dkk, 2008), termasuk di SMP Negeri 1 Turen. Berdasarkan hal tersebut maka dikembangkan Paket Pembelajaran IPA Terpadu yang dapat membantu pelaksanaan pembelajaran IPA Terpadu. Pengembangan ini bertujuan untuk mengetahui kelayakan paket pembelajaran IPA Terpadu berbasis konstruktivisme dengan tema kebakaran hutan untuk siswa SMP Negeri 1 Turen. Metode pengembangan paket pembelajaran IPA Terpadu yang digunakan dalam penelitian ini adalah pengembangan menurut Borg dan Gall yaitu: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal produk, (4) penilaian produk, dan (5) revisi produk (Borg dan Gall, 2003, dalam Koes H., 2008). Instrumen penelitian yang digunakan berupa kuesioner kelayakan paket pembelajaran IPA Terpadu berbasis konstruktivisme dengan tema kebakaran hutan dan panduan pelaksanaannya yang diisi oleh tim penelaah. Jenis data berupa data kualitatif dan kuantitatif. Data kualitatif berupa tanggapan, saran, dan kritik dari tim penelaah, sedangkan data kuantitatif diperoleh dari analisis nilai rata-rata kuesioner skala likert. Hasil uji kelayakan dari tim penelaah menyatakan bahwa paket pembelajaran IPA Terpadu yang dikembangkan layak digunakan namun perlu direvisi, dengan nilai rata-rata untuk paket IPA Terpadu adalah 3,57 dan nilai rata- rata untuk panduan pelaksanaannya adalah 3,59. Berdasarkan hasil pengembangan, disarankan agar dilakukan penelitian lebih lanjut terhadap paket Pembelajaran IPA Terpadu ini dengan melakukan eksperimen terhadap paket Pembelajaran IPA Terpadu dan panduan pelaksanaannya agar diketahui tingkat efektif dan efisiensinya dalam pembelajaran IPA Terpadu. i

Hubungan antara fanatisme terhadap idola dengan konsep diri siswa kelas X dan XI SMAN 3 Malang / Raj Fajariayah Rahmawati

 

ABSTRAK Rahmawati, Fajariyah. 2009. Hubungan antara Fanatisme terhadap Idola dengan Konsep Diri Siswa Kelas X dan XI SMAN 3 Malang . Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Drs. H. IM Hambali, M. Pd (2) Drs. Djoko Budi Santoso Kata kunci: fanatisme terhadap idola, konsep diri, realistis. Masa remaja merupakan masa transisi yang di dalamnya terdapat proses pencarian jati diri. Dalam proses pencarian jati diri tersebut remaja cenderung memiliki sosok idola yang dikaguminya, sehingga dapat mengidentifikasi sikap dan tingkah laku idola tersebut. Namun tak jarang mereka ingin menjadi identik seperti idolanya tanpa berpikir kritis dan rasional, maka remaja tersebut dapat menjadi seseorang yang bukan dirinya atau tidak realistis. Dapat dikatakan remaja tersebut telah kehilangan jati dirinya atau memiliki konsep diri yang rendah, sehingga mereka tidak mampu menempatkan dirinya secara realistis dan tidak dapat memahami keadaan diri sebagaimana adanya. Tujuan penelitian adalah untuk: (1) mengetahui tingkat fanatisme siswa SMAN 3 Malang terhadap idola, (2) mengetahui tingkat konsep diri siswa SMAN 3 Malang, dan (3) untuk mengetahui hubungan antara fanatisme idola dengan konsep diri siswa SMAN 3 Malang. Rancangan penelitian yang digunakan adalah deskriptif korelasional, dengan populasi penelitian adalah siswa SMAN 3Malang kelas X dan XI. Teknik pengambilan sampel menggunakan random sampling. Pengumpulan data menggunakan instrumen inventori, data dianalisis dengan menggunakan teknik korelasi product moment dari Pearson. Hasil penelitian menunjukkan bahwa secara umum siswa memiliki tingkat fanatisme terhadap idola yang rendah dengan prosentase 78,63% .Adapun dalam kategori lainnya yaitu siswa yang memiliki tingkat fanatisme yang tinggi terhadap idola dengan persentase 21,37%, sedangkan dalam kategori sangat tinggi dan sangat rendah memiliki persentase yang sama yaitu 0 % atau tidak ada siswa yang memiliki tingkat fanatisme dalam klasifikasi tersebut. Secara umum siswa kelas X dan XI SMAN 3 Malang memiliki tingkat konsep diri yang tergolong dalam kategori tinggi dengan persentase 73,50%, sedangkan dalam kategori sangat tinggi dengan persentase 16,24%, kemudian dalam kategori rendah memperoleh persentase 10,26%. Namun tidak terlihat adanya siswa yang memiliki tingkat konsep diri yang sangat rendah. Berdasarkan hasil penelitian dengan menggunakan program komputer SPSS diketahui bahwa r hitung lebih besar daripada r tabel yaitu -0,545 > 0,180. Dengan demikian dapat dijelaskan bahwa H1 diterima secara signifikan. Hal ini menunjukkan bahwa ada hubungan negatif yang signifikan antara fanatisme terhadap idola dengan konsep diri siswa kelas X dan XI SMAN 3 Malang. Berdasarkan hasil penelitian ini, dapat disarankan ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang rendah dan konsep diri tinggi hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengembangan, misalnya layanan informasi. Sebaliknya, ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang tinggi dan konsep diri rendah hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengentasan, diantaranya memberikan layananan informasi, bimbingan dan konseling kelompok, konferensi kasus dan home visit. ABSTRAK Rahmawati, Fajariyah. 2009. Hubungan antara Fanatisme terhadap Idola dengan Konsep Diri Siswa Kelas X dan XI SMAN 3 Malang . Skripsi, Jurusan Bimbingan Konseling dan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Drs. H. IM Hambali, M. Pd (2) Drs. Djoko Budi Santoso Kata kunci: fanatisme terhadap idola, konsep diri, realistis. Masa remaja merupakan masa transisi yang di dalamnya terdapat proses pencarian jati diri. Dalam proses pencarian jati diri tersebut remaja cenderung memiliki sosok idola yang dikaguminya, sehingga dapat mengidentifikasi sikap dan tingkah laku idola tersebut. Namun tak jarang mereka ingin menjadi identik seperti idolanya tanpa berpikir kritis dan rasional, maka remaja tersebut dapat menjadi seseorang yang bukan dirinya atau tidak realistis. Dapat dikatakan remaja tersebut telah kehilangan jati dirinya atau memiliki konsep diri yang rendah, sehingga mereka tidak mampu menempatkan dirinya secara realistis dan tidak dapat memahami keadaan diri sebagaimana adanya. Tujuan penelitian adalah untuk: (1) mengetahui tingkat fanatisme siswa SMAN 3 Malang terhadap idola, (2) mengetahui tingkat konsep diri siswa SMAN 3 Malang, dan (3) untuk mengetahui hubungan antara fanatisme idola dengan konsep diri siswa SMAN 3 Malang. Rancangan penelitian yang digunakan adalah deskriptif korelasional, dengan populasi penelitian adalah siswa SMAN 3Malang kelas X dan XI. Teknik pengambilan sampel menggunakan random sampling. Pengumpulan data menggunakan instrumen inventori, data dianalisis dengan menggunakan teknik korelasi product moment dari Pearson. Hasil penelitian menunjukkan bahwa secara umum siswa memiliki tingkat fanatisme terhadap idola yang rendah dengan prosentase 78,63% .Adapun dalam kategori lainnya yaitu siswa yang memiliki tingkat fanatisme yang tinggi terhadap idola dengan persentase 21,37%, sedangkan dalam kategori sangat tinggi dan sangat rendah memiliki persentase yang sama yaitu 0 % atau tidak ada siswa yang memiliki tingkat fanatisme dalam klasifikasi tersebut. Secara umum siswa kelas X dan XI SMAN 3 Malang memiliki tingkat konsep diri yang tergolong dalam kategori tinggi dengan persentase 73,50%, sedangkan dalam kategori sangat tinggi dengan persentase 16,24%, kemudian dalam kategori rendah memperoleh persentase 10,26%. Namun tidak terlihat adanya siswa yang memiliki tingkat konsep diri yang sangat rendah. Berdasarkan hasil penelitian dengan menggunakan program komputer SPSS diketahui bahwa r hitung lebih besar daripada r tabel yaitu -0,545 > 0,180. Dengan demikian dapat dijelaskan bahwa H1 diterima secara signifikan. Hal ini menunjukkan bahwa ada hubungan negatif yang signifikan antara fanatisme terhadap idola dengan konsep diri siswa kelas X dan XI SMAN 3 Malang. Berdasarkan hasil penelitian ini, dapat disarankan ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang rendah dan konsep diri tinggi hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengembangan, misalnya layanan informasi. Sebaliknya, ketika konselor menghadapi siswa yang memiliki tingkat fanatisme yang tinggi dan konsep diri rendah hendaknya memberikan layanan-layanan bimbingan dan konseling dengan fungsi bimbingan yang bersifat pengentasan, diantaranya memberikan layananan informasi, bimbingan dan konseling kelompok, konferensi kasus dan home visit.

Penerapan model pembelajaran learning cycle 5 E berbantuan media pembelajaran komputer untuk meningkatkan hasil belajar kimia pada materi pokok larutan elektrolit dan non elektrolit siswa kelas X SMAN 3 Malang / Uliyatid Dayyinati

 

ABSTRAK Dayyinati, Uliyatid. 2009. Penerapan Model Pembelajaran Learning Cycle 5 E Berbantuan Media Komputer untuk Meningkatkan Hasil Belajar Kimia pada Materi Pokok Larutan Elektrolit dan Non Elektrolit Siswa Kelas X MAN 3 Malang. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Dosen Pembimbing: (I) Drs. I Wayan Dasna, M.Si., M.Ed., Ph.D. (II) Drs. Mahmudi M.Si. Kata kunci: learning cycle, media pembelajaran komputer, konsep mikroskopis, larutan elektrolit dan non elektrolit, hasil belajar kimia Pembelajaran kimia mencakup pemahaman konsep secara mikroskopis dan makroskopis. Berdasarkan penelitian, pemahaman siswa belum optimal dalam penggambaran mikroskopis materi elektrolit dan non elektrolit. Pada kegiatan pembelajaran, konsep yang abstrak tersebut memerlukan media yang dapat membantu pemahaman siswa. Konsekuensi penerapan KTSP adalah pembelajaran berdasarkan pandangan konstruktivisme. Penelitian ini mengkaji penerapan model learning cycle 5 E berbantuan media komputer dengan tujuan penelitian (1) mengetahui perbedaan hasil belajar siswa yang dibelajarkan dengan model learning cycle 5 E berbantuan media komputer dibandingkan siswa yang dibelajarkan dengan model learning cycle 5 E tanpa bantuan media komputer, (2) mengetahui pemahaman siswa yang dibelajarkan dengan model learning cycle 5 E berbantuan media komputer dibandingkan pada siswa yang dibelajarkan dengan model learning cycle 5 E tanpa bantuan media komputer pada konsep mikroskopis larutan elektrolit dan non elektrolit, dan (3) mengetahui tanggapan siswa terhadap pembelajaran yang menerapkan model learning cycle 5 E berbantuan media komputer. Pada penelitian ini digunakan rancangan penelitian eksperimen semu yang melibatkan satu kelas kontrol dan satu kelas eksperimen. Populasi penelitian adalah siswa kelas X MAN 3 Malang dengan sampel dua kelas dari kelas X. Kelompok kontrol adalah kelas X-D dengan jumlah 36 siswa dan kelas eksperimen adalah kelas X-C 36 siswa. Instrumen yang digunakan diantaranya instrumen perlakuan berupa silabus, rencana pembelajaran dan lembar kerja siswa dan instrumen pengukuran hasil perlakuan berupa tes, lembar observasi dan angket tanggapan siswa terhadap pembelajaran yang menerapkan model learning cycle 5 E berbantuan media komputer. Data yang diperoleh dianalisis dengan tenik inferensial komparasi menggunakan uji-t. Cara menganalisis data dapat dibedakan menjadi dua yaitu analisis data statistik pada data nilai tes kognitif dan analisis data deskriptif pada data nilai angket dan lembar observasi kelas. Berdasarkan dari nilai uji-t, tidak terdapat perbedaan prestasi belajar yang signifikan antara siswa yang dibelajarkan dengan model learning cycle 5 E berbantuan media komputer dengan siswa yang dibelajarkan dengan model pembelajaran learning cycle 5 E (nilai Sig. (0,726) > 0,05. dan thitung (0,352) < ttabel (1,994)). Nilai rata – rata hasil belajar kelompok kontrol 76,4 dan kelompok eksperimen sebesar 77,2. Tidak terdapat perbedaan hasil belajar ini disebabkan pembelajaran yang menerapkan model pembelajaran learning cycle 5 E berbantuan media komputer mirip dengan pembelajaran yang menggunakan model pembelajaran learning cycle 5 E tanpa bantuan komputer dan penerapan model pembelajaran learning cycle 5E telah memfasilitasi siswa untuk belajar dan membangun pengetahuannya sendiri. Namun, pemahaman konsep mikroskopis larutan elektrolit dan non elektrolit pada siswa kelas eksperimen lebih tinggi dibandingkan pada siswa kelas kontrol. Berdasarkan hasil angket, siswa memberi-kan respon sangat positif terhadap penerapan model pembelajaran learning cycle 5 E berbantuan media pembelajaran komputer yakni 80,1% . Rata-rata hasil penilaian media oleh siswa sebesar 82,5% dengan kriteria layak. Artinya penggunaan media ini efektif dalam meningkatkan motivasi dan hasil belajar siswa. Hal ini dapat dilihat dari nilai kuis, nilai afektif dan psikomotor siswa kelas eksperimen lebih tinggi daripada kelas kontrol.

Pengembangan komik pembelajaran sebagai alternatif media pembelajaran sains kelas III di SDN 2 Gladag Kabupaten Banyuwangi / Fuad Muttaqin

 

ABSTRAK Muttaqin, Fuad. 2009. Pengembangan Komik Pembelajaran sebagai Alternatif Media Pembelajaran Sains Kelas III di SDN 2 Gladag Kabupaten Banyuwangi. Skripsi, Jurusan Teknologi pendidikan FIP Universitas Negeri Malang. Pembimbing: (I) Dr. Imanuel Hitipeuw, M.A. (II) Dr. Anselmus J.E. Toenlioe, M.Pd. Kata Kunci: komik, pembelajaran sains, pengembangan media, hasil belajar. Pengembangan ini bertujuan untuk mengetahui keefektifan pengembangan komik pembelajaran sebagai alternatif media dalam pembelajaran sains kelas III di SDN 2 Gladag. Acuan materi yang digunakan adalah Sains pokok bahasan makhluk hidup, dengan sub pokok bahasan cir-ciri makhluk hidup. Metode pengembangan yang digunakan adalah modifikasi prosedur pengembangan media pendidikan Sadiman dengan langkah-langkah yaitu identifikasi kebutuhan, perumusan tujuan, pengembangan materi, perumusan alat pengukur keberhasilan, proses produksi pengembangan media komik, evaluasi, revisi, dan media siap untuk digunakan dalam pembelajaran. Untuk mengetahui keefektifan media komik terhadap pembelajaran sains, maka dilakukan analisis berdasarkan data uji coba dengan menggunakan rumusan presentase. Sedangkan untuk mengetahui keefektifan media komik terhadap hasil belajar, maka dilakukan pretest dan post tes dan dihitung rata-ratanya. Sementara itu, untuk melengkapi data angket dan tes, maka pengembang melakukan wawancara dan observasi. Hasil uji coba kelayakan pengembagan media komik pada ahli pembelajaran menunjukkan hasil 92,5% dengan kriteria valid. Data hasil uji coba kelayakan pengembagan media komik pada ahli media menunjukkan hasil 90,2% dengan kriteria valid. Sedangkan, data hasil uji coba kelompok kecil terhadap kelayakan pengembagan media komik pada siswa menunjukkan hasil 85% dengan kriteria valid. Sementara itu, hasil uji coba kelompok kecil untuk rata-rata kelas pada post test mencapai nilai 70 lebih tinggi dari nilai rata-rata pre test yaitu 55. Sedangkan hasil uji coba lapangan untuk rata-rata kelas pada post test mencapai nilai 82,5 lebih tinggi dari nilai rata-rata pre test yaitu 68,5. Berdasarkan hasil tersebut, dapat disimpulkan bahwa media komik yang dikembangkan sesuai dan layak diterapkan di SDN 2 Gladag Kabupaten Banyuwangi. Peneliti menyarankan agar komik pembelajaran dapat diterapkan tidak hanya pada matapelajaran sains, tetapi juga pada matapelajaran lain. Khususnya matapelajaran yang dianggap sulit oleh siswa.

Survei tentang tingkat kapasitas oksigen maksimal (VO2maks) wasit sepakbola Pengcab PSSI Gresik ditinjau dari tingkat lisensi dan usia / Fajar Nurfitranto

 

Perkembangan sepakbola masa kini sangat populer dan digemari di seluruh dunia tetapi sekarang sepakbola tidak hanya dipengaruhi oleh kualitas teknik dan permainan suatu tim sepakbola, tetapi juga dipengaruhi oleh beberapa faktor seperti kualitas wasit sebagai pemimpin pertandingan yang baik. Seorang wasit sepakbola harus mampu menguasai peraturan permainan dan memiliki keterampilan perwasitan yang baik dan mengerti penerapannya di lapangan. Wasit sepakbola itu sendiri berdasarkan lisensi yang mereka punya terbagi menjadi tiga yaitu C1, C2, dan C3 dengan usia yang bervariasi antara 21-48 tahun. Selain harus mampu menguasai peraturan permainan, wasit sepakbola juga harus memiliki kondisi fisik atau kesegaran jasmani yang baik sebagai salah satu sarat untuk dapat mencapai kesuksesan dalam memimpin pertandingan. Komponen kondisi fisik yang penting adalah kesegaran jasmani seorang wasit dalam hal ini adalah tingginya konsumsi oksigen maksimal atau biasa disebut dengan VO2 maks. Walaupun VO2 maks bukan satu-satunya, namun hal ini nampaknya kurang disadari dan cenderung diabaikan. Penelitian ini ingin mengungkap tingkat VO2 maks wasit sepakbola pengcab PSSI Gresik agar dalam memimpin suatu pertandingan tidak ada kendala dan bisa berjalan dengan lancar sampai akhir pertandingan. Penelitian ini merupakan penelitian deskriptif kuantitatif dengan subyek 28 wasit. Subyek dalam penelitian ini diambil dari wasit sepakbola Pengcab PSSI Gresik yang aktif dalam kompetisi di cabang sampai nasional, sedangkan pengumpulan data dilakukan dengan tes lari multitahap yang dikonversi pada tabel prediksi VO2 maks serta di kategorikan berdasarkan lisensi dan usia. Berdasarkan hasil penelitian menunjukkan rata-rata VO2 maks wasit sepakbola pengcab PSSI Gresik keseluruhan dalam kondisi sedang dengan rata-rata sebesar 35,4 ml/kg/min. Sedangkan rata-rata VO2 maks menurut lisensi juga dalam kodisi sedang yang terdiri dari lisensi C1 sebesar 33,5 ml/kg/min, lisensi C2 sebesar 37,7 ml/kg/mnt, dan lisensi C3 sebesar 32,9 ml/kg/mnt. Sedangkan rata-rata VO2 maks menurut usia dalam kondisi sedang yang terdiri dari usia 21-29 tahun sebesar 38,2 ml/kg/mnt, usia 30-39 tahun sebesar 33,4 ml/kg/mnt, dan usia 40-49 tahun sebesar 30,7 ml/kg/mnt. Oleh karena itu disarankan kepada komisi wasit pengcab PSSI Gresik agar mengetahui kesegaran jasmani anak didiknya sebagai kelayakan menjadi seorang wasit sepakbola dan untuk meningkatkan VO2 maks para wasit sehingga dapat mencapai standar VO2 maks pemain sepakbola atau minimal mencapai standar VO2 maks untuk wasit sepakbola.

Efektivitas penerapan pembelajaran metode problem posing-STAD terhadap prestasi belajar dan motivasi belajar fisika siswa SMP Negeri 8 Malang / Nor Eka Fitrianti

 

ABSTRAK Fitrianti, Nor Eka. 2009. Efektivitas Penerapan Pembelajaran Metode Problem Posing-STAD Terhadap Prestasi Belajar dan Motivasi Belajar Fisika Siswa SMP Negeri 8 Malang. Skripsi, Jurusan Fisika FMIPA, Universitas Negeri Malang. Pembimbing: (I) Drs. Mudjihartono, (II) Drs.Sumarjono. Kata Kunci: metode Problem Posing-STAD, prestasi belajar, motivasi belajar. Pembelajaran kooperatif adalah metode pembelajaran yang cukup efektif untuk meningkatkan motivasi maupun prestasi belajar siswa. Salah satu model pembelajaran kooperatif yang paling sederhana yaitu STAD. Model pembelajaran ini dipadukan metode Problem Posing, yang dalam proses kegiatannya memba-ngun struktur kognitif siswa dalam rangka siswa merumuskan (membuat) soal. Pada penelitian terdahulu didapatkan kesimpulan bahwa hasil belajar pada kelom-pok yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada hasil belajar kelompok yang pembelajarannya menggunakan meto-de tanpa Problem Posing-STAD. Akan tetapi, jumlah pertemuan pada kelompok eksperimen dan kelompok kontrol berbeda, selain itu juga variabel yang diukur hanya pada hasil belajar. Oleh sebab itu, dilakukan penelitian serupa dengan jum-lah pertemuan pada kedua kelompok disamakan karena yang membedakan peneli-tian seharusnya hanya pada metode dan rencana pembelajaran. Sedangkan varia-bel terikat yang diukur tidak hanya hasil atau prestasi belajar, tetapi juga motivasi belajar karena motivasi belajar mempengaruhi tinggi rendahnya keterlibatan siswa dalam kegiatan akademik dan hasil kegiatan belajar yang merupakan faktor ter-penting bagi prestasi siswa. Penelitian ini dilaksanakan pada semester 1 tahun ajaran 2008/ 2009 yaitu pada bulan Desember, bertempat di SMP Negeri 8 Malang. Penelitian ini bertuju-an untuk yaitu:1) mengetahui apakah prestasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada siswa yang pembelajarannya menggunakan metode ceramah, 2) mengetahui apakah motivasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada siswa yang pembelajarannya menggunakan metode ceramah. Rancangan penelitian yaitu dengan tipe perbandingan kelompok statis. Populasi penelitian yaitu siswa SMP Negeri 8 Malang. Teknik pengambilan sampel yaitu dengan cara purposive sampling. Sedangkan sampelnya yaitu kelas VIII C sebagai kelompok eksperimen diberi perlakuan metode Problem Posing-STAD dan VIII D sebagai kelompok kontrol diberi perlakuan metode ceramah. Pengumpulan data dilakukan dengan menggunakan tes prestasi belajar, tes motivasi belajar dan lem-bar pengamatan. Dari hasil analisis data uji hipotesis disimpulkan bahwa prestasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD sama dengan siswa yang pembelajarannya menggunakan metode ceramah, akan tetapi motivasi belajar siswa yang pembelajarannya menggunakan metode Problem Posing-STAD lebih baik daripada siswa yang pembelajarannya menggunakan metode ceramah. Sehingga pembelajaran dengan metode Problem Posing-STAD dapat digunakan dalam pembelajaran untuk meningkatkan motivasi belajar siswa.

Marhaenisme (analisa terhadap pemikiran Soekarno) / Firmansyah

 

Ciri pokok hubungan kolonial pada dasarnya berpangkal pada prinsip dominasi, eksploitasi, diskriminasi dan dependensi. Ciri tersebut tidak lepas dari semangat kolonialisme dan imperialisme yang pada dasarnya merupakan proses ekspansi bangsa-bangsa Eropa untuk mendapatkan bahan- bahan (rempah- rempah dan produksi tropis), yang pada waktu itu sedang menjadi komoditi penting di pasar Eropa. Inilah babak baru dari proses interaksi para pelaku sejarah yang menggoreskan warna-warni sejarah dalam suatu zaman yang penuh dengan pergeseran nilai-nilai. Kita sadar atau tidak, pergeseran nilai itu terasa dan terlihat sampai detik ini.

Penerapan metode simulasi untuk meningkatkan aktivitas dan hasil belajar biologi pokok bahasan ekosistem pada siswa kelas X SMA negeri 1 Pakong Pamekasan Madura / Misli Mulyadi

 

Penelitian ini dilatar belakangi oleh skor nilai rata-rata yang didapat siswa kelas I SDN karangsentul I dalam meningkatkan kemampuan menulis permulaan melalui media kartu huruf yang hanya mencapai nilai 5,8. Hal ini disebabkan karena kurangnya minat siswa terhadap kemampuan menulis permulaan dan metode yang digunakan oleh guru dalam menyampaikan materi pembelajaran tidak sesuai serta cenderung masih menggunakan metode ceramah sehingga aktiftas siswa kurang dan siswa hanya sebagai pendengar saja. Dalam penelitian ini, peneliti mencoba menerapkan penggunaan media kartu huruf dengan tujuan: (1) Untuk meningkatkan hasil belajar siswa kelas 1 di SDN karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan, (2) Untuk mendiskripsikan media kartu huruf dapat meningkatkan kemampuan menulis permulaan di kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan. Jenis penelitian yang dilakukan adalah Penelitian Tindakan Kelas (PTK). Subjek penelitian adalah siswa kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan dengan jumlah 50 siswa. Adapaun pelaksanaan penelitian dilakukan sebanyak 2 siklus setiap siklus terdiri dari: (1) Penggunaan kartu huruf dalam pembelajaran menulis permulaan, (2) Hasil belajar dalam pembelajaran menulis, (3) Hasil analisa dan, (4) Refleksi. Hasil penelitian menunjukkan bahwa dengan penggunaan kartu huruf diperoleh pra tindakan 5,8, siklus I diperoleh nilai 74, siklus II diperoleh nilai 92: (1) Hasil belajar siswa dalam penggunaan kartu huruf meningkat ditandai dengan peningkatan aktifitas siswa dalam kerja kelompok, berani dalam mengutarakan pendapat dan dapat menyelesaikan masalah, (2) Siswa dalam penguasaan menggunaan kartu huruf meningkat terbukti diperolehnya skor bila rata-rata kelas mencapai 92. Kendala dalam menggunakan media kartu huruf: Tidak adanya media pembelajaran, daya ingat siswa yang berbeda-beda, latar belakang sosial ekonomi orang tua yang berbeda, cara penyampaian materi dan guru ke siswa yang hanya teori saja tidak menggunakan media pembelajaran. Di sarankan kepada guru untuk membiasakan menerapkan penggunaan kartu huruf dalam meningkatkan kemampuan menulis permulaan. Guru perlu memperhatikan hal-hal yang mendukung peningkatan hasil belajar dan aktifitas belajar. Kepada Kepala Sekolah agar dapat menyediakan yang diperlukan dalam penggunaan kartu huruf.

Perbedaan self esteem antara remaja yang tinggal di panti asuhan dan remaja yang tinggal bersama keluarga di Kecamatan Mojoroto Kediri / Dita Widyawati

 

Penelitian ini bertujuan untuk mengetahui (1) bagaimana gambaran self esteem remaja yang tinggal di panti asuhan, (2) bagaimana gambaran self esteem remaja yang tinggal bersama keluarga, (3) perbedaan self esteem antara remaja yang tinggal di panti asuhan dan remaja yang tinggal bersama keluarga. Rancangan yang digunakan dalam penelitian ini adalah deskriptif komparatif. Populasi penelitian adalah seluruh remaja yang bertempat tinggal di panti asuhan Kecamatan Mojoroto Kediri. Sampel dalam penelitian ini adalah 30 orang siswa yang tinggal di panti asuhan. Adapun pengambilan sampel dengan purposive sampling. Analisis penelitian menggunakan Chi Square. Hasil penelitian ini menunjukkan bahwa sebanyak 17 orang atau 56,67% remaja yang tinggal dalam panti asuhan memiliki self esteem sedang dan sebanyak 16 orang atau 53,33 % remaja yang tinggal bersama keluarga memiliki self esteem tinggi. Terdapat perbedaan self esteem antara remaja yang tinggal di panti asuhan dan remaja yang tinggal bersama keluarga ( hitung = 36,67 > tabel = 36,415). Berdasarkan hasil penelitian disarankan kepada: (1) para pengasuh di panti asuhan mengajak berdiskusi menyampaikan perasaan, pikiran, permasalahan yang sedang dihadapi dan membantu dalam penyelesaian masalah sehingga anak asuh akan mengembangkan perasaan bahwa dirinya berarti, (2) remaja yang tinggal di panti asuhan melihat gambaran diri secara keseluruhan dengan meminta masukan bersifat positif dari teman dan pengasuh di panti asuhan sehingga akan menimbulkan perasaan bangga, (3) pihak sekolah mendorong dan memberi kesempatan kepada siswa yang tinggal di panti asuhan untuk mencapai prestasi sehingga dapat meningkatkan self esteem, (4) peneliti selanjutnya dapat meneliti variabel-variabel lain yang berhubungan dengan self esteem.

Studi kelayakan tentang bengkel/workshop bangunan pada SMK di Kota Malang ditinjau dari peralatannya sebagai tempat uji kompetensi / Isa Rosidin

 

mengetahuai ketersediaan, kondisi, pengaturan penyimpanan, dan perawatan alat-alat pada bengkel/workshop bangunan SMK di kota Malang sebagai Tempat Uji Kompetensi. Rancangan penelitian ini menggunakan rancangan Survey, dengan subyek penelitian adalah 6 bengkel/workshop bangunan pada 3 SMK di Kota Malang yaitu SMK N 6 Malang, SMK Nasional dan SMK PU. Instrumen pengumpulan data menggunakan cheklist yang mengacu pada Pedoman Pelaksanaan Uji Kompetensi (PPUK). Analisis data yang digunakan adalah teknik diskriptif dengan menggunakan prosentase untuk menggambarkan tingkat kelayakan bengkel/workshop bangunan di Kota Malang ditinjau dari peralatannya sebagai Tempat Uji Kompetensi. Kesimpulan dari penelitian ini menunjukkan bahwa:(1) ketersediaan alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 83,333% layak digunakan sebagai Tempat Uji Kompetensi, sedangkan yang lainnya yaitu 16,667% tidak layak digunakan sebagai Tempat Uji Kompetensi (2) kondisi alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 100 % adalah layak digunakan sebagai Tempat Uji Kompetensi. (3) Pengaturan Penyimpanan alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 100% layak digunakan sebagai Tempat Uji Kompetensi (4) Perawatan alat pada bengkel/workshop bangunan SMK di Kota Malang sebagai Tempat Uji Kompetensi 100% layak digunakan sebagai Tempat Uji Kompetensi. Sehingga, walaupun demikian untuk menunjang keberhasilan pembelajaran di masa yang akan datang, kelayakan peralatan harus ditingkatkan sesuai dengan perkembangan dan kemajuan teknologi.

Survei tentang daya tahan kardiovaskuler (VO2maks) dan kelincahan pada tim bolabasket putri porprov Kabupaten Malang tahun 2009 / Aulia Perwira Sari

 

Hubungan pola asuh authoritative orang tua dengan secure attachment anak prasekolah / Nasliyatul Ula

 

Anak yang baru mengenal sekolah atau anak yang memasuki peralihan jenjang, misalnya dari play group ke TK atau dari TK ke SD biasanya rewel dan menangis sehingga ibu atau pengasuhnya harus selalu terlihat oleh sang anak. Pada umumnya problem tersebut dialami oleh anak-anak ketika mereka menghadapi situasi, lingkungan, atau orang yang baru. Sikap orang tua yang terlalu melindungi anak serta kasih sayang berlebih yang ditunjukkan oleh orang tua pada anak (terutama ibu) dapat menyebabkan berkembangnya ketergantungan emosional pada anak, sehingga anak merasa kurang aman dan gelisah saat menghadapi situasi atau lingkungan baru. Orang tua yang mengasuh anak dengan intensitas komunikasi yang tinggi, akan membuat anak merasa diperhatikan, dihargai serta dapat menumbuhkan keyakinan terhadap penerimaan lingkungannya. Ketika anak merasa yakin dengan penerimaan lingkungan, anak akan mengembangkan secure attachment dan akan mengembangkan rasa percaya tidak saja pada orang tua (khususnya ibu) tapi juga pada lingkungannya, sehingga ini akan berdampak positif untuk perkembangannya. Penelitian ini bertujuan untuk: (1) mengetahui gambaran pola asuh authoritative orang tua, (2) mengetahui gambaran secure attachment anak prasekolah, (3) mengetahui apakah ada hubungan pola asuh authoritative orang tua dan secure attachment anak prasekolah. Penelitian ini menggunakan rancangan penelitian deskriptif dan korelasional. Penelitian ini dilakukan di TK Pancamurni Al-Usman Kertosono. Subyek dalam penelitian ini adalah ibu dari anak prasekolah yang tercatat sebagai siswa TK Pancamurni Al-Usman Kertosono, yang berjumlah 153 orang. Pengambilan sampel dilakukan menggunakan teknik purposive insidental sampling, sejumlah 40 orang. Data pola asuh authoritative dikumpulkan dengan instrumen skala pola asuh authoritative, yang memiliki reliabilitas (α) 0,876 dan data secure attachment dikumpulkan dengan instrumen skala secure attachment, yang memiliki reliabilitas (α) 0,827. Teknik analisis data yang digunakan adalah teknik persentase dan teknik korelasi. Hasil analisis data menggunakan teknik persentase menunjukkan, sebagian besar subyek merupakan orang tua authoritative dalam klasifikasi sedang (sebanyak 70%) dan sebagian besar orang tua memiliki anak prasekolah dengan secure attachment dalam klasifikasi sedang (sebanyak 67,5%). Pengujian hipotesis dalam penelitian ini menggunakan product moment pearson (taraf signifikansi 5%), dan diperoleh koefisien r sebesar 0,276 (p>0,05), yang berarti tidak signifikan. Berdasarkan uji hipotesis tersebut, dapat dikatakan bahwa tidak ada hubungan pola asuh authoritative orang tua dengan secure attachment anak prasekolah. i Bagi orang tua diharapkan menunjukkan kasih sayang, kehangatan, kepedulian pada anak prasekolah, disamping mendorong untuk mandiri agar anak prasekolah dapat mengembangkan kelekatan pada orang tua dan memiliki rasa aman dalam mengeksplorasi lingkungannya. Bagi peneliti selanjutnya yang ingin mengembangkan penelitian tentang secure attachment hendaknya memperhatikan faktor lain yang diduga memberi kontribusi lebih terhadap secure attachment anak selain pola asuh authoritative, seperti temperamen, adanya figur lekat selain orang tua (teman sebaya dan guru), suasana dalam keluarga, serta menambah instrumen penelitian berupa observasi, wawancara dan dokumentasi, sehingga diharapkan data yang diperoleh lebih baik dan akurat.

Pengembangan paket IPA terpadu dengan tema pestisida untuk siswa kelas VII semester 2 di SMP Negeri 1 Wajak Kabupaten Malang / Amalia Marianti

 

ABSTRAK Marianti, Amalia. 2009. Pengembangan Paket IPA Terpadu Tema Pestisida di SMP Negeri 1 Wajak. Skripsi, Jurusan Fisika Program Studi Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Eddy Supramono, (II) Drs. Triastono Imam P., M.Pd Kata kunci : Paket Pembelajaran, IPA Terpadu, Pestisida Dalam Peraturan Menteri Pendidikan Nasional nomor 22 Tahun 2006 menyatakan bahwa substansi mata pelajaran IPA di SMP/MTs merupakan IPA Terpadu. Tetapi pembelajaran di SMP Negeri 1 Wajak belum melaksanakan pembelajaran IPA secara terpadu dan masih terpisahpisah antara fisika, kimia, dan biologi. Salah satu cara untuk mengatasinya yaitu dengan mengembangkan bahan ajar yaitu paket pembelajaran IPA terpadu dalam melaksanakan pembelajaran IPA terpadu. Tujuan dari pengembangan paket pembelajara IPA terpadu ini adalah untuk mengetahui kelayakan paket pembelajaran IPA terpadu dengan tema pestisida untuk siswa kelas VII di SMP Negeri 1 Wajak dan panduan pelaksanaan untuk guru. Metode pengembangan yang digunakan pada penelitian ini menggunakan model yang disarankan Gall dan Brog, yaitu: (1) studi pendahuluan, (2) perencanaan, (3) pengembangan bentuk awal produk, (4) penilaian produk, (5) revisi produk. Instrument yang digunakan dalam penelitian ini berupa angket/kuesioner kelayakan untuk para penilai. Jenis data adalah kuantitatif dan kualitatif. Data kuantitatif diperoleh dari nilai rata-rata kuesioner, sedangkan data kualitatif berupa tanggapan, saran, dan kritik dari dua orang dosen dan dua orang guru IPA SMP Negeri 1 Wajak selaku penilai atau evaluator. Berdasarkan uji kelayakan, paket IPA terpadu diperoleh skor ratarata 3,56 dengan persentase 89%, sedangkan untuk panduan pelaksanaan diperoleh skor rata-rata 3,58 dengan persentase 89,37%. Semua itu artinya bahwa paket IPA terpadu layak untuk digunakan. Paket Pembelajaran ini mempunyai kelebihan, yaitu: (a)Produk yang dihasilkan sesuai dengan KTSP, (b)memadukan materi fisika, kimia, dan biologi, (c)dilengkapi dengan panduan guru sehingga memudahkan guru untuk melaksanakan pembelajaran, (d)Berisi kegitan-kegiatan siswa berbasis kerja ilmiah, (e)evaluasi berlangsung dalam konteks yang alami, kolaboratif, dan berorientasi pada perkembangan intelektual siswa serta lingkungannya. Dalam pelaksanaan penelitian pengembangan ini disarankan agar dilakukan penelitian lebih lanjut terhadap paket IPA terpadu untuk mengetahui tingkat efektifitas dan efisiensi. Pengembangan paket pembelajaran IPA terpadu dan panduan pelaksanaan pembelajaran dapat dilakukan dengan mengambil tema yang berbeda-beda.

Perancangan media iklan dalam rangka promosi album kompilasi "Rock Mblesat" / Luqman Almalani

 

Komunitas Rock Mblesat merupakan salah satu dari sekian banyak Komunitas di Kota Malang yang memiliki konsep musik yang berbeda. Dengan semakin banyaknya pesaing komunitas yang baru maupun yang lama komunitas Rock Mblesat tersadar bahwa dengan media iklan sebagai promosi sangatlah penting untuk memperkenalkan, sampai tahap fanatik terhadap komunitas Rock Mblesat dibandingkan komunitas lainya. Lebih dari itu komunitas Rock Mblesat dapat mengangkat citra positif yang lebih baik melalui media yang matang. Salah satu solusi untuk mendapatkan suatu posisi dalam persaingan tersebut adalah melalui perencanaan media iklan baik secara konseptual maupun visual. Maka pokok permasalahan dalam perancangan ini adalah jenis media komunikasi visual apakah yang sesuai dengan konsep. Metode pengumpulan data dilakukan melalui (1) wawancara (2) observasi (3) kuisioner. Teknik analisis yang digunakan adalah SWOT ( Streght, weakness, Opportunity, Threat) dengan membandingkan data yang diperoleh melalui wawancara, observasi dan hasil penyebaran kuisioner yang kemudian ditarik kesimpulan. Adapun fokus penelitian ini yaitu: (1) konsep perancangan komunikasi visual (2) proses perancangan (3) bentuk perancangan media komunikasi visual. Penelitian ini dilaksanakan melalui beberapa tahapan, yakni (1) tahap persiapan (2) tahap pelaksanaan (3) dan tahap penyusunan laporan penelitian. Hasil konsep desain mempunyai gaya dan kesan yang kuat, kebersamaan, persaudaraan dan baru. Membawa pesan verbal menyampaikan isi album kompilasi Rock Mblesat, yaitu “United and Brotherhood” yang diangkat dari rasa dan semangat anggota komunitas Rock Mblesat yang menjunjung tinggi kebersamaan dan persaudaraan. Hasil media dari konsep perancangan berupa Backdrobe, Cover CD, Iklan Cetak, Web Banner, Poster, Leaflet, XBanner, merchandise (Kaos, Stiker, Pinup), kartu nama, Booklet cetak dan digital. Kesimpulan dari perancangan ini adalah perancangan media promosi yang lebih kreatif, inovatif dapat memperkenalkan dan meningkatkan jumlah penggemar komunitas Rock Mblesat. Tujuan promosi mengandung misi komunikasi yang tidak hanya dapat memperkenalkan dan meningkatkan jumlah penggemar dan penjualan album tetapi juga untuk menarik minat para pelaku pasar industri musik untuk mengkontrak komunitas Rock Mblesat dalam pembuatan album, mempromosikan mereka melalui radio, dan segala macam bentuk kegiatan komersil dalam industri musik. Selanjutnya saran yang dapat diberikan adalah berdasarkan kelemahan dan kelebihan yang dimiliki dalam perancangan media promosi ini diharapkan dapat digunakan sebaikbaiknya bagi klien untuk kemajuan komunitas Rock Mblesat.

Pengaruh NPM, EVA dan MVA terhadap return saham (studi kasus pada perusahaan makanan dan minuman yang listing di BEI periode 2006-2007) / Heppy Permanasari

 

ABSTRAK Permanasari, Heppy. 2009. Pengaruh NPM, EVA dan MVA Terhadap Return Saham (Studi Kasus Pada Perusahaan Makanan dan Minuman yang Listing di BEI Tahun 2006-2007). Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Tuhardjo, S.E, M.Si, Ak, (II) Drs. H. Sumadi, S.E, M.M. Kata kunci: NPM, EVA, MVA, Return Saham Tujuan penelitian ini adalah untuk mengetahui: return saham; kinerja perusahaan makanan dan minuman tahun 2006-2007 dilihat dari konsep NPM, EVA dan MVA; pengaruh parsial antara NPM, EVA dan MVA terhadap return saham dan pengaruh simultan antara NPM, EVA dan MVA terhadap return saham perusahaan makanan dan minuman tahun 2006-2007. Metode penelitian yang digunakan adalah analisis regresi berganda dengan independen variabel adalah nilai NPM, MVA dan EVA, sedangkan dependen variabel adalah return saham. Sampel diambil secara purposive sampling dan jumlah dua puluh Perusahaan Makanan dan Minuman yang listing di BEI tahun 2006 – 2007. Hasil penelitian menujukkan bahwa return saham perusahaan sangat dipengaruhi oleh harga saham dan jumlah saham yang beredar. Kinerja keuangan perusahaan dengan konsep NPM dipengaruhi oleh rasio perubahan laba bersih dan penjualan. Nilai MVA lebih banyak dipengaruhi oleh harga saham dan jumlah saham yang beredar. Konsep EVA dipengaruhi oleh selisih laba bersih dengan beban pajak penghasilan, jumlah modal yang tersedia dan jumlah modal tertimbang. Semua komponen kinerja keuangan (NPM, MVA dan EVA) tidak berpengaruh signifikan terhadap perubahan return saham, hal ini terlihat dengan ditolaknya hipotesis yang diajukan (H1) baik secara simultan maupun parsial, demikian juga dengan koefisien determinannya yang hanya mampu menjelaskan 12,5 % (2006) dan 0,5 % (2007). Implikasi kebijakan yang harus dilakukan adalah untuk meningkatkan return saham, perusahaan harus mampu meningkatkan laba bersih, sehingga pembagian dividen akan lebih besar yang pada akhirnya dapat meningkatkan daya tarik investor. Untuk meningkatkan nilai NPM dapat dilakukan dengan cara meningkatkan jumlah penjualan dan beban penjualan diturunkan. Untuk meningkatkan nilai MVA, perusahaan harus mampu meningkatkan laba bersih, sehingga pembagian dividen akan lebih besar yang pada akhirnya dapat meningkatkan daya tarik investor. Untuk meningkatkan nilai EVA, perusahaan sebaiknya konsisiten terhadap dan tetap fokus pada bisnis inti dan karakter perusahaan juga harus mendukung dalam memberikan nilai bagi perusahaan. ABSTRACT Permanasari, Heppy. 2009. The Effect of NPM, EVA, and MVA Toward Seurities Return (A Case Study on Food and Beverage Industry listed on BEI in the year of 2006 - 2007). Undergraduate Thesis. Accounting Department. Economic Faculty, State University of Malang. Advisors (I) Dr. H. Tuhardjo, S.E., M.Si., Ak., (11) Drs. H. Sumadi, S.E., M.M. Keywords: NPN, EVA, MVA, Securities Return The aims of this research is to know the securities return, the performance of food and beverage industry in 2006 - 2007 analyzed from the NPM, EVA, and MVA concepts; partial effect of NPM, EVA, and MVA toward securities return, and simultaneous effect of NMP. EVA, and MVA toward securities return of food and beverage industry in 2006 - 2007. The method on analysis used in this research is multiple regressions which takes the value of NPM, EVA, and MVA as its independent variables; while the dependent variable is the securities return. The sample is gathered using purposive sampling method, and takes twenty industries of food and beverage listed in BEI in the year of 2006-2007. The result shows that the securities return is highly affected by the securities price and the amount of released securities. The industry's financial performance using NPM concept is influenced by the ratio between the changing of nett profit and sales. The MVA value is much determined by the securities price and the amount of the released securities. Besides, the EVA value is more influenced by the discrepancy between the net profit and the tax of earning, the total available capital, and the total weighted capital. All of tne financial performance components (NPM, MVA, and EVA) do not have a significant influence on the changing of securities return; it is shown by the refusal of the :proposed hypothesis (Hi) both simultaneously or partially. Moreover] the [ determinant coefficient is only able tc explain 12.5% (2006) and 0.5% (2007)/ The implication on what a decision should be taken is enhancing the securities return, those industries must be able to level up their net profit, therefore the dividend sharing will be higher, which at the end will bring more on investors' interest. To level up the NPM value, they can enlarge their sales rate and decrease their sales cost. To enhance the MVA, that industries must be able to enhance their nett profit, which will make a greater dividend sharing, then gain more investors' interest. To improve the EVA value, those industries should be consistent and focus on their core business, also the company's character should be able to support in adding the corporate value.

Penggunaan media gambar untuk meningkatkan kemampuan berbicara anak kelompok A TK. Dharma Wanita Persatuan I Kejayan Pasuruan / Mulyatin

 

Kata kunci : media gambar, kemampuan berbicara. Penelitian ini berlatar belakang pada kurang lancarnya kemampuan berbicara anak kelompok A TK Dharma Wanita Persatuan I Kejayan. Hal ini di sebabkan karena media pembelajaran yang digunakan selama ini menggunakan media papan tulis sehingga anak merasa bosan tidak tertarik lagi terhadap pembelajaran. Penelitian ini bertujuan : 1). Mendeskeripsikan penerapan penggunaan media gambar untuk meningkatkan kemampuan berbicara anak kelompok A di TK Dharma Wanita Persatuan I Kejayan Pasuruan. 2). Mendeskripsikan peningkatan kemampuan berbicara anak setelah menggunakan media gambar.Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam 2 (dua) siklus. Masing-masing siklus terdiri atas empat tahapan : Perencanaan, Pelaksanaan, Observasi, dan Refleksi. Subyek penelitian ini adalah anak kelompok A di TK Dharma Wanita Persatuan I Kejayan Pasuruan sebanyak 20 anak. Teknik pengumpulan data yang digunakan adalah observasi secara langsung terhadap kegiatan anak. Peningkatan kemampuan berbicara anak melalui media gambar di TK Dharma Wanita Persatuan I Kejayan Pasuruan. Terbukti dari hasil belajar yang di peroleh anak sebelum menggunakan media gambar, siklus I, siklus II, yang mengalami peningkatan yaitu pra tindakan terdapat 6 anak 30% telah mencapai keberhasilan belajar, 14 anak 70% belum mencapai keberhasilan. Pada siklus I nilai rata-rata adalah 60,65 dengan keberhasilan belajar 55% dan meningkat menjadi 90% dengan nilai rata-rata 81,25 pada siklus II. Saran yang disampaikan pada guru yaitu agar dapat menerapkan penggunaan media gambar untuk meningkatkan kemampuan berbicara anak maupun kemampuan yang lain. Metode pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan penelitian-penelitian lain sebagai bahan perbadingan, sehingga dikemudian hari menjadi lebih baik.

Isolasi, karakterisasi, identifikasi minyak atsiririmpang jahe (zingiber officinale rosc.) serta uji aktivitasnya sebagaianti bakteri dan tabir surya secara in vitro oleh Nurul Fitriah

 

Rimpangja he merupakanta namany angt elahb anya\ dikenalo leh masyarakaste bagabi umbum asak,o batb atuk,p eluruhk eringat,p encegamh ual, melancarkapne ncernaadna nm erangsannga fsum akan.K omponenu tamam in),-ak atsiri rimpang jahe pada umumnya berupa senyawa terpena dan terpenoid yang didugaberfungssi ebagatia bir suryad ana ntibakteriP. enelitiani ni bertujuan untukm engisolasmi, engidentifikasdi anm engujia ktivitasm inyaka tsirir impang jahe sebagaai ntibakterdi ant abir surya. Penelitianb ersifate ksperimentayla ngd ilakukand i Laboratorium PenelitianJ urusanK imia FMIPA UM, LaboratoriumM ikrobiologi Jurusan Biologi FMIPA UM danL abomtoriumK imia OrganikJ urusanK imia UGM. lsolasim inyaka tsirir impangja he dilakukand enganm etoded estilasir rap-alr. ldentifikasis enyawap enyusunm inyaka tsiri rimpangja he dilakukan menggunakamne todeK romatografGi as-SpektromeMtrai ssaU. ji aktivitas sebagatia bir suryad ilakukans ecarain vifro. Pengujianm inyaka tsiri rirnpang jahe sebagatia bir suryad ilakukand enganm etodes peklrofotometrui ltraviolet sedangkaenv aluasinydaid asarkapna dan ilaip erhitungapne rsentr ansuriseir iterna danp ersentr ansmispi igmentasPi.e ngujiand ayaa ntibaktermi inyaka tsiri rimpangja he dilakukant erhadapb akteriE scherichiuc oli danB aciiluss uhtilis melaluip engukurand iameterz onah ambatank oloni bakterit ersebut. Hasil penelitian menur{ukkan bahwa rendemen minyak atsiri rimpang jahe adalah0 ,142%P. adas uhu2 0"Cm inyaka tsirir impangja hem empunyaini deks biasr ata-rata1 , 479d anb eratj enis 0,890g /ml-. Didugas enyawap enyusun minyaka tsirir impangja hea dalah2 ,2-dimetil-3-metilen-bisiklo[2,2,1]heptana atauk amfena(1 6,59%)3, ,7-dimetil-2,6-oktadien-la-toal uc r.s-gerani(o2l1 ,14%), (/i,lr)-2 ,6-nonadien(a3l9 ,65%)(,f -7,11-dimetil-3m etilen-1,6,10-dodekatriena (2,760/0d)a n( E)-7,1l-dimetil-m3 etilen-1,6,10-dodekatri(e3n,8a5 %)P. ada konsentrasIi x lOap pm minyaka tsiri rimpangja he mempunyaai ktivitass ebagai tabir suryak arenar nempunyani ilai 0/oTp igmentasli0 ,4A2o/yoa ngb erartim ampu mengurangri adiasis inaru ltravioletp adap anjangg elombang3 22,5-372,5n m sebesa8r 9,598%m, eskipunb elumd apatd ikategorikans ebagasi untanm aupun sunblock.M inyak atsiri rimpangja he bersifata ntibakterbi aik terhadap Esclrcrichiac crllm aupunB acilluss ubtilisid engank onsentrashi ambatanm inimal (I11C-s) ebesatr% "

Hubungan prestasi belajar mata diklat kewirausahaan terhadap minat berwirausaha siswa kelas XII di SMK Kartika IV-1 Malang / Kristina Rahayu

 

ABSTRACT Rahayu, Kristina, 2009. The connection of studying achievement of entrepreneurship lesson to the business interest of the third grade students in Kartika IV-1 Vocational High School Malang. Thesis, Departement of Industry Technology of School Engineering in Malang University. The counselors: (I) Dra. Nurul Aini, M. Pd, (II) Dra. Agus Hery Supadmi, M. Pd. Password : The studying achievement of entrepreneurship and business interest. The purpose of this research is to know about studying achievement of the students in entrepreneurship lesson, the business interest and the connection of studying achievement about entrepreneurship lesson to the business interest of the thiro grade student in Kartika IV-1 Vocational High School Malang. The population of this research is the third grade students of fashion and restaurant management in 2008/2009 in Kartika IV-1 Vocational High School Malang. Amount of the population is a hundred (100) student. The sample is taken from seventy eight (78) students by using a random sampling technique with Nomogram Herry King’s table. The collecting of variable data is done by using documentation and quizioner. The collecting of studying achievement data about entrepreurship lesson (x) uses documentation and the business interest (y) uses quizioner. The quizioner validity is done by using internal validity of product moment formula. For reability test is 0.957 for the entrepreneur interest. The data analysis uses product moment correlation. From the result of data analysis is know correlation coefisien (r) is 0.379. After be consultated with “r” table to db=78 with 5% error (95% significant standard). In fact “r” arithmetic is bigger than r table that is 0.379 > 0.318. So, there is a positive and significant connection is 0.379 between the achievement of studying entrepreneurship lesson to the business interest of the third grade students of Kartika IV-1 Vocational High School Malang. The closeness level of the connection is medium. It is supported with the result t test for db=N-2=76 with 5%, it is proven t arithmetic is bigger than t table or 37.307 > 0.01, so hypotesis alternative (Ha) is accepted as a result of sample research and it is also valid for all of population. The hypotesis of this research is “There is positive connection between studying achievement of entrepreneurship lesson to the business interest of the third grade student in Kartika IV-1 Malang”. It is de clored that the thesis is proven or accepted. In this case, an entrepreneurship teacher is expected to raise business interest by using practice approach, bring up a resource person, comparative study and coordination with interrelated instances, for instance, Departement of trading ad industy, Departement of corporation, UKM and KADIN. So, teaching is not only a teacher transfers knowledge but also teaching can move student to run a business well.

Perancangan media komunikasi visual grand opening O La La Crepes Malang / Dyanningrum Pradhikta

 

ABSTRAK Pradhikta, Dyanningrum. 2009. Perancangan Media Komunikasi Visual Grand Opening O La La Crepes Malang. Tugas Akhir, Program Studi Desain Komunikasi Visual Jurusan Seni Desain Fakultas Sastra Universitas Negeri Malang. Pembimbimg: Pranti Sayekti, S.Sn, M.Si dan Moh. Sigit, S.Sn Kata kunci: perancangan, media komunikasi visual, grand opening, promosi. O La La Crepes adalah salah satu usaha yang bergerak di bidang makanan, dengan menawarkan crepes sebagai menu utamanya yang memiliki bermacam-macam varian rasa yang mampu bersaing dengan produk lain, O La La Crepes menjangkau masyarakat kalangan menengah ke atas, dan mendapat respon yang baik dari para konsumen. Namun keberadaan akan produk crepes yang ditawarkan oleh O La La Crepes yang hanya berlokasi di daerah Tlogomas belum banyak diketahui masyarakat. Dari permasalahan diatas dapat kita lihat bahwa dibutuhkan media yang dapat membantu mempromosikan dan mengenalkan produk O La La Crepes. Media yang tepat digunakan adalah media komunikasi visual ’Grand Opening’ O La La Crepes, sebagai media promosi. Untuk menghasilkan media tersebut digunakan pendekatan ilmiah yaitu mendapatkan data-data literatur untuk perancangan, dan media yang dibuat haruslah sesuai dengan karakteristik O La La Crepes. Perancangan yang dibuat menggunakan model perancangan prosedural. Prosedur perancangan yang dilakukan adalah pertama yaitu melakukan observasi dengan melakukan pencarian data melalui internet hingga buku sumber yang ada dan selanjutnya adalah melakukan wawancara terhadap pemilik dan juga beberapa konsumen O La La Crepess. Hasil perancangan ini terdiri atas media utama dan media pendukung. Media utama berupa media lini atas. Media lainnya yang digunakan adalah media lini bawah dan no line media yang juga berfungsi mempromosikan media utamanya yaitu berupa katalog menu, brosur, poster crepes, x-banner, standing menu, hanging flag, counter O La La, seragam karyawan, kemasan, kaos merchandise, pin, stiker, tas merchandise, merchandise piring saji kue, gantungan kunci crepes. Diharapkan hasil perancangan tersebut dapat berguna sebagai referensi serta motivasi kepada O La La Crepes untuk meningkatkan promosi dan pengenalan produk serta peningkatan kualitas pada bahan dan rasa crepes demi kemajuan dan peningkatan kualitas O La La Crepes.

Uji coba komik fisika berjudul bunyi karya istianah qudsi FT sebagai media pembelajaran IPA SMP kelas VIII / Widya Prindani

 

Abstrak Prindani, Widya. 2009. Uji Coba Komik Fisika Berjudul Bunyi Karya Istianah Qudsi FT sebagai Media Pembelajaran IPA SMP Kelas VIII. Skripsi, Jurusan Pendidikan Fisika FMIPA Universitas Negeri Malang. Pembimbing: (I) Drs. Subani (II) Drs. Eddy Supramono Kata kunci: uji coba, komik fisika, bunyi, media Untuk mengoptimalkan hasil pembelajaran fisika banyak faktor yang harus diperhatikan, salah satunya penggunaan media pembelajaran. Pembelajaran yang menggunakan media dapat memberikan pengalaman yang lebih berarti bagi anak didik serta dapat membawa anak didik ke pengalaman yang lebih konkrit. Salah satu media mengajar tersebut adalah komik fisika. Komik fisika berjudul Bunyi yang dikembangkan oleh Istianah Qudsi FT belum sampai pada tahap uji coba komik sebagai media pembelajaran, oleh karena itu komik fisika tersebut diterapkan dalam pembelajaran IPA kelas VIII di SMP Negeri 1 Kraksaan Probolinggo. Tujuan penelitian ini adalah untuk mengetahui bahwa komik fisika berjudul Bunyi menarik dan efektif sebagai media pembelajaran IPA kelas VIII, serta untuk mendapatkan bahan pada bagian mana saja komik tersebut perlu direvisi. Penelitian ini merupakan penelitian eksperimen semu. Subjek penelian adalah siswa kelas VIII-B dan kelas VIII-C SMP Negeri 1 Kraksaan. Subjek penelitian dipilih berdasarkan kemampuan yang hampir sama, dilihat dari rata-rata kelas nilai ulangan harian (materi gaya dan Hk. Newton) yang hampir sama atau seimbang. Perlakuan antara kedua kelas tersebut berbeda, yaitu siswa kelas VIII-C (kelas eksperimen) diajar dengan menggunakan komik fisika, sedangkan siswa kelas VIII-B (kelas kontrol) diajar dengan menggunakan buku paket IPA. Waktu dan materi yang diberikan pada kedua kelas sama. Dalam pembelajaran tersebut diajar oleh satu guru yang sama. Dari hasil perhitungan uji hipotesis dengan analisis nonparametric (Uji Mann-Whitney) hasil belajar siswa kedua kelas diperoleh nilai Exact Sig. [2*(1- tailed Sig.)] sebesar 0,003 dan α = 0,05. Karena 0,003 < 0,05 maka H0 ditolak dan H1 diterima, jadi komik fisika berjudul Bunyi efektif sebagai media pembelajaran fisika SMP kelas VIII. Selain hasil di atas, berdasarkan jawaban siswa terhadap angket yang disebar, diperoleh persentase daya tarik siswa terhadap komik fisika berjudul Bunyi sebesar 87,1%. Kriteria dari hasil persentase tersebut adalah sangat baik. Karena hasil tersebut lebih dari 60%, maka komik fisika berjudul Bunyi dapat dikatakan menarik. Saran untuk pengembang komik Bunyi tersebut adalah melakukan revisi kembali terhadap komik khususnya pada sub bab resonansi. Hal ini dikarenakan siswa merasa kurang jelas dengan penjelasan resonansi pada komik. Selain itu ada beberapa tulisan di dalam komik yang ukurannya sangat kecil, sehingga siswa kesulitan saat membaca. Revisi komik dilakukan untuk mendapatkan komik yang benar-benar berkualitas sebagai media pembelajaran fisika.

Pengaruh persepsi karyawan tentang pelaksanaan program pelatihan terhadap kinerja karyawan bagian produksi (studi pada PT. Kemas Super Indonesia) / Zainul Hakim

 

Pelatih, Materi Pelatihan, Metode Pelatihan, Kinerja Perkembangan suatu negara tidak terlepas dari kualitas sumber daya manusia sebagai pengelolah aset yang berupa teknologi maupun sumber daya alam (natural resources). Faktor produksi seperti tenaga kerja, modal, dan skill seringkali diabaikan oleh perusahaan atau organisasi, padahal seluruh aspek yang terdapat pada suatu perusahaan pasti membutuhkan keterlibatan sumber daya manusia sebagai penggerak (pengelola) semuanya. Perusahaan merupakan akar perekonomian suatu negara sudah sepantasnya memiliki kemampuan untuk mengelola sumber-sumber daya secara terencana terutama sumber daya manusia sebagai tenaga pelaksana operasional perusahaan, maka perlu ditingkatkan kualitasnya dengan melakukan program pengembangan SDM melalui pelaksanaan pelatihan supaya dapat mempertahankan keuntungan yang diperoleh, tetapi juga dapat mempertahankan eksistensinya dalam dunia usaha. Setiap karyawan yang bekerja mempunyai kebutuhan yang harus dipenuhi oleh pimpinan maupun instansinya, seperti halnya kebutuhan terhadap pelatihan kerja untuk pengembangan sumber daya manusia. Karena dengan pemenuhan kebutuhan tersebut dapat memacu kinerja mereka, dan dengan pelaksanaan program pelatihan yang sesuai kebutuhan mereka, maka hasil kerja para karyawan dapat meningkat sehingga tujuan perusahaan cepat tercapai. Dengan tercapainya tujuan perusahaan dan terpenuhinya kebutuhan karyawan melalui pelatihan, tentu saja peningkatan kinerja akan tercapai yang mana secara langsung berdampak pada produktifitas perusahaan. Penelitian ini bertujuan untuk mengetahui pengaruh dari adanya pelaksanaaan suatu program pelatihan terhadap kinerja karyawan bagian produksi pada PT. Kemas Super Indonesia. Subjek dalam penelitian ini adalah karyawan pada bagian produksi PT. Kemas Super Indonesia yang berjumlah 136 orang, sedangkan sampelnya diambil sebanyak 102 orang dan teknik pengambilan sampel menggunakan Proportional Sampling. Dalam penelitian ini mempunyai variabel bebas yaitu pelatih (X1), materi pelatihan (X2), metode pelatihan (X3), dan variabel terikat kinerja karyawan (Y). Analisis data yang dipakai adalah analisis regresi linear berganda untuk mengetahui pengaruh pelatih (X1), materi pelatihan (X2), metode pelatihan (X3) terhadap kinerja karyawan (Y). Sedangkan untuk mendeskripsikan kondisi pelaksanaan program pelatihan (X) dan kinerja karyawan (Y), maka juga digunakan teknik analisis statistik deskriptif. Hasil penelitian ini menunjukkan bahwa pengaruh dari masing-masing variabel pelatihan secara parsial, yaitu: pengaruh pelatih sebesar 0,553, pengaruh materi pelatihan sebesar -0,166, dan pengaruh metode pelatihan sebesar 0,743 terhadap terhadap kinerja karyawan. Dari hasil penelitian ini juga dapat diketahui: (1) terdapat pengaruh positif yang signifikan antara pelatih terhadap kinerja karyawan yang ditunjukkan dengan β = 0,553 dan sig t sebesar 0,005 < 0,05. (2) tidak terdapat pengaruh signifikan antara materi pelatihan pelatihan terhadap kinerja karyawan yang ditunjukkan dengan β = -0,166 dan sig t sebesar 0,337 > 0,05. (3) terdapat pengaruh positif yang signifikan antara metode pelatihan terhadap kinerja karyawan yang ditunjukkan dengan β = 0,743 dan sig t sebesar 0.000 < 0,05. dari Hasil uji parsial diketahui bahwa variabel bebas yang mempunyai pengaruh paling besar dominan terhadap variabel terikat kinerja karyawan adalah variabel metode pelatihan yang menunjukkan nilai sig t jauh di bawah 0,05 yaitu sig t 0,000. Sumbangan efektif metode pelatihan terhadap kinerja karyawan adalah sebesar 20,29 %. Secara simultan, variabel pelatih, materi pelatihan, dan metode pelatihan memiliki pengaruh yang signifikan terhadap kinerja karyawan bagian produksi pada PT. Kemas Super Indonesia, karena terbukti nilai sig F 0,000 < 0,05. Kinerja karyawan dipengaruhi oleh pelatih, materi pelatihan, dan metode pelatihan sebesar 27,9% dan sisanya 72,1% dipengaruhi variabel lain yang tidak dijelaskan dalam penelitian ini. Namun dalam penelitian masih menggunakan alternatif model dengan mereduksi X2 (materi pelatihan) yang tidak memiliki pengaruh signifikan secara parsial terhadap Y (kinerja karyawan), sehingga memiliki nilai Adjusted R Square 0,280 yang menunjukkan bahwa kinerja karyawan dipengaruhi oleh pelatih dan metode pelatihan sebesar 28%. Berdasar hasil penelitian ini dapat disarankan agar PT. Kemas Super Indonesia lebih memperhatikan setiap pola pengembangan sumber daya manusia (karyawan). Seperti halnya pelaksanaan program pelatihan yang harus dilakukan pada karyawan PT. Kemas Super Indonesia khususnya bagian produksi, yang mampu mendorong karyawan untuk selalu meningkatkan kinerjanya dan nantinya juga akan meningkatkan produktifitas perusahaan. Adanya keinginan bagi karyawan untuk meningkatkan kinerjanya dalam menjalankan tugas atau pekerjaan, dapat dimotivasi dengan kebijakan perusahaan untuk memahami kebutuhan karyawan akan pengembangan kualitas sumber daya manusia

Perancangan CD profil topeng Malang Kedungmonggo / Siti Cholifah

 

ABSTRAK Cholifah, Siti. 2009. Perancangan CD Profil Topeng Malang Kedungmonngo. Skripsi, Program Studi Desain Komunikasi Visual Jurusan Seni dan Desain Fakultas Sastra Universitas Negeri Malang. Pembimbing (I): Drs. Imam Muhadjir, Pembimbing (II): M. Abdul Rahman, M.Sn Kata kunci : Perancangan, CD Profil, Topeng Malang, Kedungmonggo Topeng Malang atau Wayang Topeng Malang merupakan kesenian drama tari topeng khas Malang dengan sumber cerita seputar kisah-kisah Panji, yaitu suatu cerita yang mengisahkan perjalanan Raden Panji Asmorobangun saat mencari kekasihnya yang bernama Dewi Sekartaji, kisah ini cukup populer dikalangan masyarakat, khususnya Jawa Timur. Kedungmonggo adalah sebuah dusun yang berada di wilayah Desa Karangpandan, Kecamatan Pakisaji, Kabupaten Malang yang merupakan salah satu sentra topeng yang ada di Malang. Adanya buku-buku yang membahas mengenai Topeng Malang sepertinya belum mampu memberikan solusi untuk permintaan masyarakat modern mengenai informasi Topeng Malang yang lengkap, sehingga diperlukan adanya sebuah media yang mampu menampung seluruh informasi secara lengkap (baik berupa teks, audio dan video dalam satu paket) mengenai Topeng Malang. Maka dari itu diperlukan perancangan multimedia interaktif mengenai Topeng Malang yang berbentuk CD Profil tentang Topeng Malang Kedungmonggo. Multimedia interaktif merupakan salah satu media komunikasi visual yang makin diminati saat ini karena mampu menggabungkan teks, grafis, audio, gambar bergerak (video dan animasi) dengan menggabungkan link yang memungkinkan pemakai melakukan navigasi dan berinteraksi. CD Profil merupakan bagan dari CD interaktif, yaitu suatu media yang menegaskan sebuah format multimedia interaktif dapat dikemas dalam sebuah CD (Compact Disk) dengan tujuan aplikasi interaktif di dalamnya. CD profil berisi data-data yang biasanya merupakan sebuah profil dari suatu perusahaan/lembaga/organisasi, yang nantinya dapat digunakan sebagai media promosi atau hanya digunakan sebagaai profil semata. Model perancangan ini merupakan model perancangan deskriptif diawali dari penulisan latar belakang, pengidentifikasian tujuan, dilanjutkan dengan pengumpulan data terdiri dari klien, kegiatan wawancara, observasi dan dokumentasi. Perancangan untuk media utama yaitu perancangan CD Profil Topeng Malang Kedungmonggo dan disertakan alternatif media komunikasi visual pendukung dalam bentuk visual, antara lain: Brosur, Kalender, Note Book, Postcard, Leaflet, Stiker, Poster, dan Display Rack. Perancangan ini ditujukan agar menghasilkan sebuah media yang potensial dalam menyampaikan informasi mengenai Topeng Malang kepada target audience modern yang membutuhkan informasi tentang Topeng Malang Kedungmongo secara lengkap dan menyenangkan.

Studi tentang tingkat kesegaran jasmani peserta ekstrakurikuler olahraga di SMA Negeri 6 Malang tahun ajaran 2008/2009 / Muhammad Afik Andriono

 

ABSTRAK Andriono, M. Afik. 2009. Studi Tentang Tingkat Kesegaran Jasmani Peserta Ekstrakurikuler Olahraga di SMA Negeri 6 Malang Tahun Ajararan 2008/2009. Skripsi, Jurusan Pendidikan Jasmani Kesehatan Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing: (1) Dr. Roesdiyanto, M. Kes, (2) Drs. Mardianto, M. Kes. Kata kunci : kesegaran jasmani, siswa, ekstrakurikuler. Kesegaran jasmani yang berkaitan dengan siswa merupakan aspek penting yang harus dijaga dan dipertahankan. Untuk mempertahankan kesegaran jasmani siswa dituntut untuk dapat menjaga kebugarannya dengan cara latihan olahraga secara teratur. Dengan begitu siswa memiliki tingkat kesegaran jasmani yang tinggi agar dapat menggunakan pikirannya dengan baik untuk belajar tekun dan bersemangat. Untuk itulah kesegaran jasmani sangat menunjang keberhasilan belajar siswa. Selama praktek pengalaman mengajar (PPL), peneliti melihat kenyataan dilapangan bahwa pelaksanaan kegiatan ekstrakurikuler olahraga di SMA Negeri 6 Malang telah berjalan dengan baik. Melihat kondisi yang seperti itu dan didasari rasa keingintahuan peneliti, maka peneliti akan mencoba mendiskripsikan keadaan kesegaran jasmani siswa peserta ekstrakurikuler olahraga di SMA Negeri 6 Malang apakah telah berhasil dalam pelaksanaan kegiatan ekstrakurikulernya. Dalam hal ini, tingkat kesegaran jasmani yang baik sangat dibutuhkan oleh setiap peserta ekstrakurikuler olahraga di SMA Negeri 6 Malang agar dapat mencapai prestasi yang setinggi-tingginya. Tujuan dari penelitian ini adalah untuk mengetahui tingkat kesegaran jasmani siswa peserta ekstrakurikuler olahraga di SMA Negeri 6 Malang tahun ajaran 2008/2009. Dari masing-masing cabang ekstrakurikuler olahraga yaitu (a) siswa peserta ekstrakurikuler olahraga bola basket, (b) siswa peserta ekstrakurikuler olahraga bola voli, (c) siswa peserta ekstrakurikuler olahraga bulu tangkis. Penelitian ini menggunakan rancangan penelitian studi yang termasuk dalam jenis penelitian deskriptif dengan pendekatan kuantitatif. Penelitian dilaksanakan mulai bulan maret – mei 2009. Instrumen yang digunakan dalam penelitian ini yaitu: Tes Kesegaran Jasmani Indonesia untuk sekolah menengah tingkat atas kelas 1, 2 dan 3 umur 16 sampai dengan 19 tahun. Untuk dapat membedakan dan mengklasifikasikan tingkat kesegaran jasmani seseorang, diperlukan satu tolak ukur yang baku yang mempunyai norma. Tes Kesegaran Jasmani merupakan salah satu tolak ukur tersebut. Berdasarkan hasil penelitian, dapat diketahui dari jumlah 115 siswa peserta ekstrakurikuler olahraga dengan tingkat kesegaran jasmani terbanyak pada kategori sedang dengan jumlah 51 siswa (45%), tingkat kesegaran jasmani kategori baik 35 siswa (30%), tingkat kesegaran jasmani kategori kurang 24 siswa (21%), tingkat kesegaran jasmani kategori baik sekali 5 siswa (4%), tingkat kesegaran jasmani kategori kurang sekali tidak ada. Berdasarkan data tersebut, sebagian besar memiliki tingkat kesegaran jasmani dalam kategori sedang. Dengan diketahui hasil penelitian ini maka peneliti menyarankan untuk lebih meningkatkan kesegaran jasmani siswa peserta ekstrakurikuler olahraga di SMA Negeri 6 Malang maka perlu sering diadakan kompetisi-kompetisi dibidang olahraga untuk meningkatkan semangat siswa dalam meraih prestasi serta untuk meningkatkan kesegaran jasmaninya. Selain itu, guru pendidikan jasmani perlu menambah aktivitas melalui kegiatan ekstrakurikuler yang mengarah pada peningkatan kesegaran jasmaninya.

Perbedaan penggunaan metode latihan terpusat dan metode latihan tersebar dalam pembelajaran konstruktivis untuk meningkatkan prestasi belajar akuntansi pada siswa kelas X semester X Program Keahlian Akuntansi SMK PGRI 2 Malang / Resti Khoirotul Fajri

 

Pemilihan pendekatan dan metode pembelajaran yang tepat merupakan salah satu factor ang sangat penting dalam menentukan kualitas pembelajaran. Metode latihan merupakan salah ata metode yang dapat digunakan dalam proses belajar mengajar. Metode latihan adalah cara emberi materi melalui suatu kegiatan untuk melakukan hal-hal yang sama secara berulang- lang dan bersungguh-sungguh. Metode ini merupakan salah satu metode mengajar yang emungkinkan siswa berperan aktif dalam proses belajar mengajar. Latihan yang berkali-kali trhadap apa yang dipelajari akan mempermudah menguasai materi yang dipelajari. Menurut Latihan dapat dibedakan menjadi 2 yaitu latihan terpusat (massed pratice) dan latihan tersebar distributed practice). Tujuan dalam penelitian ini adalah: (1) Untuk mengetahui prestasi belajar kuntansi siswa yang menerapkan metode latihan terpusat, (2) Untuk mengetahui prestasilajar akuntansi siswa yang menerapkan metode latihan tersebar, (3) Untuk mengetahui apakahada perbedaan prestasi belajar akuntansi antara siswa yang diterapkan metode latihan terpusatdan metode latihan tersebar. Penelitian ini dilaksanakan di SMK PGRI 2 Malang pada bulan November-Desember2008. Rancangan penelitian yang digunakan adalah eksperimen semu (quasi eksperimen).Populasi dalam penelitian ini adalah siswa kelas X semester 1 SMK PGRI 2 Malang yang terdiridari enam kelas. Sampel yang ditetapkan terdiri dari 2 kelas yaitu kelas X Ak 1 sebagai kelaseksperimen dan kelas X Ak 2 sebagai kelas kontrol. Kelas eksperimen adalah kelas yang diberi mtode latihan tersebar, sedangkan kelas kontrol adalah kelas yang diberi metode latihantersebar. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa (1) Prestasi belajar iswa kelas kontrol yang menerapkan metode latihan terpusat lebih rendah dari prestasi belajar siswa pada kelas eksperimen yang menerapkan metode latihan tersebar. (2) Prestasi belajarsiswa kelas eksperimen yang menerapkan metode latihan tersebar lebih tinggi dari prestasibelajar siswa pada kelas kontrol yang menerapkan metode latihan terpusat. (3) Terdapaterbedaan yang signifikan pada kemampuan dan prestasi siswa pada pembelajaran yang enerapkan metode latihan terpusat dan yang menerapkan metode latihan tersebar pada embelajaran beracuan konstruktivis. Hal ini ditunjukkan dengan adanya perbedaan varian data aint score yang signifikan antara metode latihan terpusat dan tersebar (mean gain score kelas ksperimen 6,4477 > mean gain score kelas kontrol 1,2955), selain itu juga terbukti dari hasilanalisis uji-t yang menunjukkan t hitung (2,812) > nilai t tabel (2,201). Saran yang dapat diajukan adalah sebaiknya sebelum menerapkan pembelajaran konstruktivis ini, guru harus benar-benarmenyesuaikan waktu yang tersedia dengan banyaknya materi yang harus disampaikan agarsemua tahapan pembelajaran konstruktivis dapat dilakukan dengan baik karena pembelajarankonstruktivis ini membutuhkan waktu yang lebih banyak, dan untuk memperoleh gambaranyang lebih jelas metode latihan tersebar atau terpusat yang lebih efektif digunakan dalam pembelajaran akuntansi, perlu dilakukan penelitian pada ruang lingkup yang lebih luas.

Penerapan model jigsaw pada pokok bahasan kalor untuk meningkatkan motivasi dan prestasi belajar siswa kelas VII-H SMP Negeri 2 Pandaan tahun pelajaran 2009/2010 / Ummi Chusniyah

 

Program Studi Pendidikan Dasar Konsentrasi Pendidikan IPA SMP, Fakultas Pasca Sarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Drs. Suhadi Ibnu M.A., Ph.D (II) Dr. Arif Hidayat, M.Si. Kata Kunci: model Jigsaw, motivasi, prestasi belajar fisika. Pendidikan IPA diharapkan dapat menjadi wahana bagi peserta didik untuk mempelajari diri sendiri dan alam sekitar, serta prospek pengembangan lebih lanjut dalam menerapkannya di dalam kehidupan sehari-hari. Siswa memiliki motivasi belajar yang rendah terlihat pada respons mereka untuk mengikuti pembelajaran dan rendahnya ketertiban kelas pada saat pembelajaran berlangsung. Prestasi belajar siswa masih menunjukkan nilai yang kurang dari KKM yaitu hasil rata-rata nilai UAS 60,86. Pembelajaran kooperatif model Jigsaw ini mempunyai tujuan untuk memperkaya pengalaman siswa dalam menyelesaikan permasalahan. Pembelajaran kooperatif ini menuntut siswa agar dapat mengembangkan daya pikir, daya inisiatif dan kreativitas sesuai dengan karakteristik IPA. Penelitian ini bertujuan mengetahui peningkatan motivasi dan prestasi belajar siswa kelas VII-H SMP Negeri 2 Pandaan dengan menerapkan model Jigsaw pada materi kalor. Rancangan penelitian yang digunakan adalah penelitian tindakan kelas. Subyek penelitian adalah siswa kelas VII-H SMP Negeri 2 Pandaan sebanyak 29 siswa. Penelitian ini menggunakan dua siklus, pada siklus I ada empat pertemuan dan pada siklus II ada tiga pertemuan. Penelitian ini berusaha mengkaji dan merefleksikan secara mendalam tentang beberapa aspek dalam kegiatan belajar mengajar, yaitu keaktivan siswa ketika bereksperimen, berdiskusi dalam kelompok, mengajukan pertanyaan dalam diskusi kelas. Hasil penelitian menunjukkan strategi pembelajaran kooperatif model Jigsaw dapat meningkatkan motivasi siswa pada materi peran kalor pada suatu benda dan aplikasinya dalam kehidupan sehari-hari sebesar 7,71% hasil angket siswa, serta 9,09% dari hasil observasi yang dilakukan oleh observer. Pembelajaran kooperatif model Jigsaw dapat meningkatkan prestasi belajar siswa pada materi kalor pada rerata nilai pretes sebesar 6,67 dan rerata nilai postes sebesar 7,59. Pada siklus I masih terdapat 18 siswa yang nilai prestasi belajarnya di bawah KKM, sedangkan pada siklus II hanya ada dua siswa yang nilai prestasi belajarnya di bawah KKM selanjutnya dilakukan remedial pada kedua siswa tersebut. Berdasarkan hasil penelitian yang telah dilakukan diharapkan guru memberikan dorongan yang positif agar siswa memiliki motivasi tinggi dengan memberikan metode pembelajaran yang menarik bagi siswa. Guru seharusnya senantiasa membimbing pada tiap tahap keterlaksanaan model Jigsaw agar hasil penelitian sesuai rencana yang telah disusun. Bagi siswa, diharapkan memiliki pemikiran yang positif terhadap pelajaran fisika dan aktif dalam mengikuti kegiatan yang dapat meningkatkan kemampuanya dalam belajar fisika.

Studi pelaksanaan kesehatan dan keselamatan kerja (K3) pada laboratorium busana di SMK Negeri 5 Malang / Atik Wardiningsih

 

Wardiningsih, Atik. 2009. Study of Health and safety at Work in the Clothing Laboratory of Public Vocational High School 5 Malang. Thesis, Education of Clothing Department State University of Malang. Advisor: (I) Dra. Agus Hery Supadmi, M.Pd (2) Dra. Nur Endah Purwaningsih, M.Pd Keywords: health and safety at work (K3), laboratory Health and safety at work (K3) is a preventive action in minimalizing occupational hazards. This was mostly needed in practical work at clothing laboratory due to the involvement of machinery and some other supporting equipment. Laboratory was a space in which practical work for learning process was conducted; therefore, every sub‐space in the laboratory had distinctive facilities based on their function. Of course, those machinery facilities at the clothing laboratory had distinctive procedure for each in order that the safety system was well understood. By giving some materials in related to the health and safety at work maximally, it was expected that zero point of accident in clothing laboratory could be achieved. This, at one hand, was expected to give some preparation for Vocational High School students in facing the real industry world. This study employed the design of descriptive quantitative study which the subject of the study was all students 10thgrade majoring in clothing department 2008/2009 of Public Vocational High School 5 Malang. The data collecting technique employed was using questionnaire which had already passed validity and reliability test by using percentage analysis. While, the type of the sample used was population sample. The objective of this study was to know the students’ knowledge of health and safety at work, the needed equipments for K3 at the clothing laboratory, the understanding of signs of K3 and the environment state of affair of clothing laboratory at Public Vocational High School 5 Malang. The result of the study showed that (1) the knowledge of students about health and safety at clothing laboratory at this public school was included in the high category which is in the interval 47‐55; that is 34,8%. Yet, the improvement was still needed especially for the regulation of the health and safety at work, the discipline in obeying the rules at the clothing laboratory, the knowledge about sewing equipment especially in how used them in the correct and safe manner, the ability in preventing infection and decease due to the sitting method; (2) the outfit of health and safety at clothing laboratory in this public school was high—in the interval 50‐60 with percentage 40%,‐‐ yet the betterment was still needed in the term of utilizing hand protective equipment, understanding about the use of light extinguisher (APAR) and medicine in the first aid box (PPPK); (3) signs of health and safety at the clothing laboratory showed good result which is 50% for the interval 38‐41—this only for recognizing labels or dangerous signs; however, for the goal of establishing the health and safety poster in the clothing laboratory was still needed for improvement; (4) the environment state affair was also high which was 55.55% in the interval 42‐48—yet the improvement in the aspect of air circulation, organizing the placement of the machines and equipments and the cleanliness of the laboratory. Based on the result of the study, it was suggested that teachers must make improvement in the scope of the teaching materials about health and safety at work correspond to the development of the technology. Those materials included regulations, equipments of the health and safety at laboratory and their usage. Students were expected more open toward the large knowledge by reading and learning from some references about health and safety at laboratory.

Analisis kesalahan konsep siswa kelas XI SMA Negeri 2 Kediri pada materi kesetimbangan kimia / Muhammad Alfan Effendy

 

ABSTRACT Effendy, Muhammad Alfan. 2009. Chemical Equilibrium Misconceptions Analysis of Public Senior High School 2 Kediri Students. Sarjana’s thesis, Departement of Chemistry, Mathematic and Science Faculty, State University of Malang. Advisor: (I) Dra. Nazriati, M.Si, (II) Drs. Ida Bagus Suryadharma, M.S Keywords: misconception, chemical equilibrium, Public Senior High School 2 Kediri. Science is a combination of knowledge and process, that’s why science doesn’t merely studying about the concepts, principals but also the process that yield science products. Science can be divided into fields, one of them is chemistry than need special handle in teaching because chemistry is abstact. In general, chemistry concepts is stage concepts So it is essential to complete the basic concepts to learn the next concepts. One of the abstract concept is chemical equilibrium given to second grade senior high school students .This abstract concepts makes difficulty in learning chemistry. The purpose of this experiment is to know the percentage of students who experience misconceptions in learning equilibrium constant and the factors affecting equilibrium shift, and also to know what kind of misconceptions experienced by students. This is an descriptive experiment. The steps in this experiment are: (1) instrument arrangement, (2) validation, (3) instrument’s test, (4) collecting the data, and (5) data processing. Sample of this experiment is students of Public Senior High School 2 Kediri Second Grade Students year 2008/2009, it consists of 7 classes and each class consists of 30 students. It is known from the test before that average score of each class is almost the same, so random sampling is used.The result is chosen XI A-6 and XI A-7 class as the sample. Instrument’s test has been done in XI A-7 class, and experiment is done in XI A-6 class. The instrument of this experiment is objective test consists of 28 valid questions with 0,9404 coefitient reliability. Descriptive analysis data taken from determining percentage students misconceptions. Experiment results show the percentage of students in understanding is: (1) equilibrium constant Kc 29,55%, (2) equilibrium constant Kp 34,33%, (3) the relationship of equilibrium constant of a reaction with another reaction 6,7%. For the percentage of students in understanding the factors affecting equilibrium shift is: (1) concentration 48%, (2) temperature 39%, (3) pressure 38%, (4) volume 43,3%. Misconceptions found in this experiment are:Kesalahan: (1) the concentration of all substances in equilibrium state are the same, (2) addition of concentration in a substance will shift equilibrium toward the substance, (3) jika if temperature raised, the equilibrium will shift towards exothermic reaction, (4) adding or reducing concentration won’t shift the equilibrium.

Pengaruh modernitas individu dan latar belakang sosial ekonomi orang tua terhadap prestasi belajar siswa SMK Muhammadiyah 3 Singosari / Eryanti Setyoning Khaque

 

ABSTRAK Setyoning K., Eryanti. 2009. Pengaruh Modernitas Individu dan Latar Belakang Sosial Ekonomi Orang Tua Terhadap Prestasi Belajar Siswa SMK Muhammadiyah 3 Singosari. Jurusan Akuntansi, Program Studi S1 Pendidikan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang, Pembimbing (I) Dra. Hj. Sutatmi S.E, M.Pd, M.Si, Ak (II) Helianti Utami, S.E, M.Si, Ak Kata Kunci : Modernitas Individu, Latar Belakang Sosial Ekonomi Orang Tua, Prestasi Belajar Modernitas individu adalah rangkaian sikap, nilai dan perilaku yang menjadi ciri-ciri kepribadian yang ditunjukkan oleh seorang siswa yang modern. Latar belakang sosial ekonomi orang tua adalah persepsi atau pandangan siswa terhadap keadaan sosial orang tua yang dapat dilihat dari tingkat pendidikan serta jenis pekerjaan orang tua dan keadaan ekonomi orang tua yang dapat dilihat dari tingkat pendapatan dan jumlah tanggungan orang tua dan partisipasi orang tua terhadap belajar anak. Dengan peningkatan pengetahuan siswa terhadap kemajuan ilmu pengetahuan dan teknologi mampu membantu siswa untuk lebih berprestasi. Selain itu, dengan tersedianya sarana dan prasarana yang memadai baik di rumah maupun di sekolah dapat berpengaruh terhadap prestasi belajar siswa. Maka tujuan penelitian ini adalah untuk mengetahui pengaruh modernitas individu siswa dan latar belakang sosial ekonomi orang tua terhadap prestasi belajar siswa baik secara parsial maupun simultan Penelitian ini termasuk jenis penelitian deskriptif (deskriptif korelasional). Pengumpulan data dalam penelitian ini menggunakan metode angket dan dokumentasi. Sampel yang digunakan dalam penelitian ini adalah siswa jurusan akuntansi Kelas XI 1 dan 2 SMK Muhammadiyah 3 Singosari, yang diwakili oleh sampel 58 siswa. Teknik pengambilan data dalam penelitian ini menggunakan teknik Purposive Sampling. Analisis hasil penelitian yang dipakai adalah regresi berganda dengan uji menggunakan uji t dan uji F. Berdasarkan analisis data diperoleh kesimpulan bahwa (1) terdapat pengaruh modernitas individu siswa terhadap prestasi belajar siswa secara parsial, hal ini terbukti dengan didapatnya T hitung 7,218 sedangkan signifikan t 0,000 dengan tingkat probabilitas 95%. (2) terdapat pengaruh latar belakang sosial ekonomi orang tua terhadap prestasi belajar siswa secara parsial, hal ini terbukti dengan didapatnya T hitung 4,031 sedangkan signifikan t 0,000 dengan tingkat probabilitas 95%. (3) terdapat pengaruh modernitas individu siswa dan latar belakang sosial ekonomi orang tua terhadap prestasi belajar siswa secara simultan, hal ini dibuktikan dengan didapatnya R Square sebesar 54,6%. Berdasarkan hasil penelitian ini saran yang dapat diajukan kepada pihak sekolah dan orang tua siswa sebagai upaya peningkatan prestasi belajar siswa adalah: (1) mengadakan penambahan dan pemanfaaatan yang lebih baik (sarana dan prasarana) yang mendukung kegiatan belajar mengajar.(2) siswa diharapkan untuk lebih memanfaatkan waktu luang dan lebih aktif untuk mencari informasi terbaru.

Pengaruh keterampilan mengajar guru produktif terhadap prestasi belajar menjahit dengan mesin siswa kelas X dan XI SMKN 1 Batu / Naning Rahayu

 

Ketrampilan adalah suatu kemampuan yang di miliki oleh seseorang dalam suatu pekerjaan tertentu. Ketrampilan guru merupakan kemampuan untuk elaksanakan perannya sebagai guru di dalam pembelajaran sehingga tujuan embelajaran dapat tercapai. Mengajar erupakan suatu proses yang kompleks yang dak hanya menyampaikan informasi dari guru kepada siswa, melainkan banyak hal yang harus di kerjakan selain hal tersebut. Jika mengajar hanya diartikan dengan enyampaian materi saja maka proses pembelajaran akan lebih di dominasi oleh guru ehingga lebih bersifat verbalisme. Mengajar adalah segala upaya yang dilakukan ecara sengaja dalam rangka memberikan kemungkian bagi siswa untuk terjadinya roses belajar sesuai dengan tujuan yang telah di rumuskan. Mengajar adalah enyampaikan atau menularkan pengetahuan dan pandangan yang mana baik guru aupun murid harus mengerti bahan yang akan dibicarakan sehingga tercipta proses elajar mengajar. Aktifitas yang menonjol dalam pengajaran adalah siswa, akan tetapi ukan berarti keberadaan guru tersisihkan, uru tidak berperan sebagai satu-satunya enyampai informasi melainkan guru sebagai pengarah dan pemberi fasilitas untuk teradinya proses belajar. Ketrampilan dasar mengajar seorang guru adalah kemampuan yang dimiliki oleh eorang guru dalam melaksanakan perannya dalam proses pembelajaran yang erupakan syarat mutlak agar guru dapat mengimplementasikan berbagai strategi embelajaran sesuai tujuan yang telah ditetapkan. Prestasi elajar erupakan stilah untuk menunjukkan suatu pencapaian ingkat keberhasilan dari usaha yang dilakukan. Prestasi merupakan hasil yang telah icapai, dilakukan, dikerjakan, dapat disimpulkan bahwa prestasi belajar adalah erubahan tingkah laku yang dicapai melalui proses belajar. Prestasi belajar pada enelitian ini, diidentifikasikan pada nilai akhir pencapaian kompetensi siswa. Prestasi belajar merupakan hasil belajar yang di ukur dalam bentuk perubahan engetahuan, sikap dan ketrampilan dimana perubahan tersebut lebih baik dibandingkan dengan sebelumnya. Prestasi belajar merupakan penilaian hasil usaha kegiatan belajar mengajar yang dapat dinyatakan dalam bentuk symbol, angka, huruf maupun kalimat yang dapat mencerminkan hasil yang sudah dicapai oleh setiap anak dalam periode tertentu. Berdasarkan beberapa pengertian tersebut prestasi belajar merupakan hasil dari perubahan belajar untuk menentukan sebuah tingkat dan penguasaan prestasi belajar yang ditunjukkan dengan nilai akhir atau angka yang diberikan oleh seorang guru. Prestasi dari suatu kegiatan belajar di SMK lebih di identifikasikan pada tingkat pencapaian suatu kompetensi. Tingkat kompetensi. tersebut terdiri dari kompetensi dasar, standar serta kompetensi lulusan. Prestasi merupakan pencapaian pemahaman dan penguasaan materi pelajaran yang mempengaruhi cara bertindak dan perilaku dalam kehidupan sehari-hari. Prestasi belajar pada penelitian ini lebih condong pada prestasi belajar siswa yang mana merupakan hasil belajar yang telah dicapai siswa selama proses pembelajaran. Aspek kognitif lebih diutamakan pada proses penilaian prestasi belajar karena aspek tersebut berkaitan dengan kemampuan siswa dalam pengetahuan atau ingatan, pemahaman, aplikasi, analisis sintesa dan evaluasi. Prestasi tidak hanya perubahan penguasaan ilmu pengetahuan akan tetapi juga perubahan tingkah laku, ketrampilan dan kecakapan. Sehingga jika seseorang telah menyelesaikan suatu rangkaian materi yang telah dipelajari maka baru dapat dilihat apakah seseorang tersebut berprestasi. Prestasi belajar akan tercapai jika seluruh komponen yang mendukung mampu memberikan motivasi, dalam hal ini bisa orang tua, guru, teman ataupun dalam diri individu tersebut. Penelitian ini menggunakan penelitian kuantitatif dengan metode pengumpulan datanya menggunakan angket tertutup. Jumlah populasi pada penelitian ini terdiri dari 62 orang sehingga penelitian ini menggunakan sampel populasi atau penelitian populasi karena seluruh siswa digunakan sebagai sampel. Populasi yang digunakan pada penelitian ini adalah siswa kelas X dan XI jurusan Tata Busana SMK Negeri 01 Batu. Hasil penelitian di SMKN 01 Batu yang dilaksanakan dengan menggunakan metode angket yang disebarkan kepada 62 responden menyatakan adanya beberapa klasifikasi prosentase ketrampilan mengajar guru produktif mata pelajaran menjahit dengan mesin. Hasil penelitian menyatakan bahwa ketrampilan mengajar guru produktif memiliki tingkatan yang tinggi dengan prosentase sebesar 3,2 % kemudian tingkatan cukup dengan prosentase sebesar 69,4 % serta tingkatan kurang dengan prosentase sebesar 27,4% dan pada tingkatan sangat kurang terdapat 0 %. Tingkatan atau kriteria ketrampilan mengajar guru dapat di kategorikan berdasarkan rentangan angka dalam prosentase disimpulkan bahwa tingkatan tinggi berarti guru yang telah menguasai dasar-dasar ketrampilan mengajar seperti membuka pelajaran sampai dengan mengevaluasi kegiatan pembelajaran pada rentangan 51%-100%, sedangkan tingkatan cukup berarti seorang guru yang menguasai ketrampilan mengajar akan tetapi aplikasi pembelajarannya masih kurang atau berada pada tingkat pemahaman 26%-50%, jika guru yang memiliki tingkatan kurang berarti guru memahami ketrampilan mengajar akan tetapi belum menguasai atau pada kisaran pemahaman sebesar 0%-25% dan jika guru memiliki ketrampilan mengajar sangat kurang dapat dikategorikan guru tersebut belum memiliki ketrampilan mengajar. Kedudukan ketrampilan mengajar guru produktif pada penelitian tersebut rata-rata pada posisi ketrampilan mengajar yang cukup, hal ini mampu menjelaskan bahwa kompetensi dasar maupun standar guru produktif mata pelajaran menjahit dengan mesin SMKN 01 Batu masih belum maksimal dimana guru mengetahui, memahami dan memilki ketrampilan mengajar akan tetapi aplikasinya masih kurang sehingga peningkatan sumber daya manusia khususnya tenaga pendidik perlu ditingkatkan baik kualitas akademisnya maupun komponen-komponen pendukung yang lain. Berdasarkan penelitian dengan bantuan metode angket yang disebarkan kepada 62 responden, didapat hasil penilaian ketrampilan mengajar guru, sedangkan variabel Y atau prestasi belajar berupa hasil rekap nilai semester akhir pada mata pelajaran Menjahit dengan Mesin. Hasil penelitian menjelaskan bahwa kedudukan prestasi belajar siswa pada mata pelajaran Menjahit dengan Mesin sebesar 35,49 % pada criteria tinggi, 54,83 % pada kriteria cukup, 9,68 % pada kriteria kurang dan kriteria sangat kurang terdapat 0 %. Sehingga prestasi belajar siswa tersebut rata-rata pada kriteria cukup. Dampak yang ditimbulkan dengan adanya ketrampilan mengajar guru produktif, berdasarkan penelitian sangat berpengaruh terhadap prestasi siswa pada mata pelajaran Menjahit dengan Mesin menghasilkan nilai koefisien determinasi sebesar 0.619. Semua variabel independen atau variabel bebas berpengaruh secara signifikan terhadap variabel terikat atau dependen sebesar 0.619, yang artinya pengetahuan ketrampilan mengajar guru produktif berpengaruh sebesar 61.9 % terhadap prestasi belajar siswa kelas X dan XI jurusan Tata Busana pada mata pelajaran Menjahit dengan Mesin. Sisanya sebesar 38.1 % dijelaskan dari variabel lain selain variabel yang digunakan di dalam penelitian. Nilai koefisien determinasi sebesar 0.619 atau pengaruh pengetahuan ketrampilan mengajar guru produktif sebesar 61.9 % menyebabkan prestasi belajar siswa lebih beragam, hal ini terjadi karena terdiri dari beberapa faktor, antara lain faktor intrinsik atau dari dalam diri pendidik dan faktor ekstrinsik atau dari luar atau lingkungan yang mempengaruhinya.

Implementasi metode pembelajaran berbasis masalah (problem based learning) untuk meningkatkan hasil belajar siswa pada mata pelajaran bekerjasama dengan kolega dan pelanggan (studi pada siswa administrasi perkantoran kelas XII SMK Sriwedari Malang) / Darraja Pasha

 

Kata kunci: Pembelajaran Berbasis Masalah dan Hasil Belajar Siswa. Salah satu masalah yang dihadapi dunia pendidikan kita sekarang adalah masalah lemahnya proses pembelajaran. Proses pembelajaran yang ada selama ini ternyata hanya membuat siswa sangat terbebani dengan materi dan tugas yang diberikan oleh guru, sehingga siswa merasa bosan di dalam kelas. Dalam pembelajaran di kelas telah banyak pendekatan-pendekatan yang dilakukan oleh guru tetapi sampai saat ini belum mendapatkan hasil yang memuaskan, ini ditunjukkan dengan hasil-hasil ujian siswa baik ujian nasional maupun ujian sekolah serta keterampilan individu siswa itu sendiri. Dari pihak sekolah sendiri juga belum berdaya untuk menciptakan suasana belajar yang memungkinkan siswa berpikir kritis, kreatif, bertanggung jawab, dan memberi peluang bagi siswa untuk menjelajahi idenya yang imajinatif. Oleh sebab itu perlu adanya sebuah model pembelajaran untuk membangkitkan semangat peserta didik agar aktif dalam proses pembelajaran. Dalam penelitian ini mencoba menerapkan model pembelajaran berbasis masalah (Problem Based Learning). Pembelajaran berbasis masalah merupakan bentuk pembelajaran kooperatif dimana siswa dilatih untuk memecahkan suatu masalah yang ada di dunia nyata Fokus penelitian ini adalah: 1) Untuk mendeskripsikan penerapan pembelajaran berbasis masalah (Problem Based Learning), pada pokok bahasan bekerja dalam tim, 2) untuk mengetahui peningkatan hasil belajar siswa melalui penerapan pembelajaran berbasis masalah (Problem Based Learning), 3) untuk mengetahui kendala-kendala dan solusi apa saja yang dihadapi peneliti dalam proses tindakan berlangsung dan 4) untuk mengetahui respon siswa dalam pelaksanaan pembelajaran berbasis masalah (Problem Based Learning). Subyek penelitian adalah siswa kelas XII APK di SMK SRIWEDARI Malang dengan jumlah 20 siswa. Jenis penelitian ini adalah penelitian kualitatif, yang dirancang dengan desain Penelitian Tindakan Kelas (PTK). Data penelitian dikumpulkan melalui 1) tes, 2) lembar observasi, 3) wawancara, 4) angket, 5) dokumentasi dan 6) catatan lapangan. Jenis penelitian ini merupakan penelitian tindakan kelas yang dilaksanakan dalam 2 siklus. Setiap siklus mencakup 4 tahap kegiatan yaitu: 1) perencanaan, 2) pelaksanaan tindakan, 3) pengamatan, dan 4) refleksi. Analisis data dalam penelitian ini dilakukan secara deskriptif. Hasil penelitian menunjukkan bahwa pembelajaran berbasis masalah (Problem Based Learning) secara umum telah dilaksanakan dengan baik. Siswa saling membantu, saling berinteraksi tatap muka, berdiskusi dengan guru dan teman, menyumbangkan skor untuk kelompok, tenggang rasa, sopan dan mandiri. Hal ini dapat dilihat dari hasil observasi keterampilan kooperatif siswa. Pada pelaksanaan siklus1 berdasarkan perbandingan dari kedua pengamat menunjukkan taraf keberhasilan. Penerapan model pembelajaran Problem Based Learning pada kelas XII APK SMK SRIWEDARI Malang sudah baik. Hal ini ditunjukkan dengan peningkatan dari siklus I sebesar 75 % menjadi sebesar 90 % pada siklus II. Peningkatan sebesar 15% tersebut sudah menunjukkan ketuntasan belajar yaitu dari siklus I yang hanya 15 siswa yang tuntas belajar meningkat menjadi 18 siswa yang tuntas belajar. Meskipun dalam pelaksanaan tindakan banyak kekurangan dan kelemahan pada siklus I maka peneliti mencoba memperbaiki pada siklus II. Berdasarkan hasil penelitian maka dapat disimpulkan bahwa penerapan pembelajaran berbasis masalah (Problem Based Learning) dapat meningkatkan hasil belajar mata pelajaran Bekerjasama dengan Kolega dan Pelanggan pada pokok bahasan Bekerja dalam tim. Hal ini dapat dilihat dari kedua aspek yaitu aspek kognitif dan afektif yang meningkat setiap siklusnya. Beberapa saran yang dapat peneliti sampaikan yaitu:1) Bagi guru mata pelajaran Bekerjasama dengan Kolega dan Pelanggan dapat menggunakan model pembelajaran berbasis masalah (Problem Based Learning) untuk meningkatkan hasil belajar siswa. 2) Bagi siswa hendaknya mengikuti pembelajaran tersebut dengan sungguh-sungguh, karena pembelajaran tersebut akan melatih siswa berpikir kritis, dapat memecahkan suatu permasalahan dan dapat meningkatkan hasil belajar siswa. 3) Penelitian ini hendaknya dapat diteruskan oleh peneliti selanjutnya dengan kelas serta sekolah yang berbeda, serta dengan model pembelajaraan kooperatif yang lain sehingga kemampuan dan hasil belajar siswa lebih meningkat. 4) Bagi Pemerintah hendaknya lebih meningkatkan mutu pendidikan, dalam proses pembelajaran siswa yang sangat aktif guru hanya sebagai fasilitator saja.

Peningkatan kemampuan menulis permulaan melalui media kartu huruf di kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan / Sofeyah

 

Penelitian ini dilatar belakangi oleh skor nilai rata-rata yang didapat siswa kelas I SDN karangsentul I dalam meningkatkan kemampuan menulis permulaan melalui media kartu huruf yang hanya mencapai nilai 5,8. Hal ini disebabkan karena kurangnya minat siswa terhadap kemampuan menulis permulaan dan metode yang digunakan oleh guru dalam menyampaikan materi pembelajaran tidak sesuai serta cenderung masih menggunakan metode ceramah sehingga aktiftas siswa kurang dan siswa hanya sebagai pendengar saja. Dalam penelitian ini, peneliti mencoba menerapkan penggunaan media kartu huruf dengan tujuan: (1) Untuk meningkatkan hasil belajar siswa kelas 1 di SDN karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan, (2) Untuk mendiskripsikan media kartu huruf dapat meningkatkan kemampuan menulis permulaan di kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan. Jenis penelitian yang dilakukan adalah Penelitian Tindakan Kelas (PTK). Subjek penelitian adalah siswa kelas I SDN Karangsentul I Kecamatan Gondangwetan Kabupaten Pasuruan dengan jumlah 50 siswa. Adapaun pelaksanaan penelitian dilakukan sebanyak 2 siklus setiap siklus terdiri dari: (1) Penggunaan kartu huruf dalam pembelajaran menulis permulaan, (2) Hasil belajar dalam pembelajaran menulis, (3) Hasil analisa dan, (4) Refleksi. Hasil penelitian menunjukkan bahwa dengan penggunaan kartu huruf diperoleh pra tindakan 5,8, siklus I diperoleh nilai 74, siklus II diperoleh nilai 92: (1) Hasil belajar siswa dalam penggunaan kartu huruf meningkat ditandai dengan peningkatan aktifitas siswa dalam kerja kelompok, berani dalam mengutarakan pendapat dan dapat menyelesaikan masalah, (2) Siswa dalam penguasaan menggunaan kartu huruf meningkat terbukti diperolehnya skor bila rata-rata kelas mencapai 92. Kendala dalam menggunakan media kartu huruf: Tidak adanya media pembelajaran, daya ingat siswa yang berbeda-beda, latar belakang sosial ekonomi orang tua yang berbeda, cara penyampaian materi dan guru ke siswa yang hanya teori saja tidak menggunakan media pembelajaran. Di sarankan kepada guru untuk membiasakan menerapkan penggunaan kartu huruf dalam meningkatkan kemampuan menulis permulaan. Guru perlu memperhatikan hal-hal yang mendukung peningkatan hasil belajar dan aktifitas belajar. Kepada Kepala Sekolah agar dapat menyediakan yang diperlukan dalam penggunaan kartu huruf.

Pengaruh injeksi air terhadap posisi air tanah pada pemodelan dengan menggunakan metode geolistrik konfigurasi Shlumberger / Kholifatul Khusnia

 

Air tanah merupakan salah satu air yang mudah didapatkan dan relatif murah, tetapi tidak semua daerah dapat mendapatkan air tanah dengan mudah karena masyarakat tidak memiliki informasi di mana dan pada kedalam berapa potensi air tanah itu berada. Untuk itu telah dilakukan penelitian guna mengidentifikasi keberadaan air tanah dengan menggunakan metode geolistrik. Metode yang digunakan dalam penelitian ini adalah metode geolistrik konfigurasi Schlumberger dengan teknik sounding-mapping. Proses pengambilan datanya adalah menentukan titik-titik elektroda arus dan potensial, serta membuat formasi lapisan batuan dengan susunan pasir, dan tanah dengan injeksi air. Pasir ditempatkan pada balok ukuran 0,6x0,6x1,2 meter dan tanah ditanamkan pada tengah-tengah medium pasir. Kemudian, mengalirkan tegangan dan menginjeksikan arus beberapa kali dengan jarak tertentu. Setelah itu, diulangi lagi pengambilan data dengan membentuk formasi yang sama dengan menginjeksikan air sebanyak 0,5 liter. Penginjeksikan kedua setelah setengah jam kemudian dengan jumlah yang sama. Ini dilakukan untuk mendapatkan nilai beda potensial, arus dan Self Potensial (SP) yang mana tujuannya untuk mendapatkan perbedaan nilai resistivitas. Kemudian menginterpretasikan data penggukuran untuk memperkirakan keberadaan air tanah dengan menggunakan Software Res2divn. Hasil dari penelitian ini adalah nilai resisivitas semu diperoleh langsung dari data primer seperti yang terdapat pada lampiran. Penelitian dengan mengunakan konfigurasi shlumberger sounding-mapping dapat teridentifikasi keberadaan air tanah yakni pada titik pengukuran 0,59 meter, injeksi pertama pada kedalaman 0,064-0,124 meter dengan nilai resistivitas lebih keci dari 336 ohm meter. Sedangkan pada injeksi kedua air tanah teridentifikasi pada kedalaman 0,064-0,198 meter dengan resistivitas lebih kecil dari 309 ohm meter sesuai dengan kedalaman penginjeksian air yakni pada 0,10 meter. Semakin banyak air yang masuk kedalam tanah posisi air tanah semakin melebar dan dalam, resistivitasnya juga semakin kecil

Pengaruh masa kerja, beban mengajar, dan iklim organisasi terhadap kinerja profesionalisme dosen jurusan akuntansi Fakultas Ekonmi Universitas Negeri Malang / Etika Dhewi Rahmawati

 

ABSTRAK Rahmawati, Etika Dhewi. 2009. Pengaruh Masa Kerja, Beban Mengajar, dan Iklim Organisasi terhadap Kinerja Profesionalisme Dosen Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) DR. Bambang Sugeng, SE., M.A.,M.M.,Ak. (II) Hj. Yuli Widi Astuti, S.E.,M.Si.,Ak. Kata Kunci: Masa Kerja, Beban Mengajar, Iklim Organisasi, Kinerja Profesionalisme Dosen Pendidikan merupakan faktor penting dalam proses kemajuan suatu bangsa. Pendidikan diharapkan mampu menghasilkan sumber daya manusia (SDM) berkualitas sehingga dapat mengembangkan segala potensi yang dimiliki oleh suatu bangsa.Dosen sebagai salah satu komponen yang memegang peranan penting dalam proses pembelajaran diharapkan memiliki kinerja profesionalisme yang tinggi, sehingga mampu menghasilkan manusia yang memiliki SDM berkualitas tinggi. Masa kerja, beban mengajar, dan iklim organisasi merupakan tiga faktor di antara beberapa faktor yang mempengaruhi kinerja profesionalisme dosen. Masa kerja adalah lama dosen bekerja sebagai dosen yang dihitung sejak SK pengangkatan dosen hingga penelitian ini dilakukan. Beban mengajar merupakan jumlah pekerjaan yang wajib dilakukan oleh dosen dalam hal pengajaran (tatap muka di kelas) terhadap mahasiswa. Iklim organisasi adalah suatu karakteristik-karakteristik yang dimiliki oleh sebuah organisasi yang membedakan dengan organisasi lainnya. Karakteristik ini terlihat dari situasi dan kondisi lingkungan kerja yang dirasakan secara subjektif oleh para anggota organisasi yang terlibat dalam hal ini adalah dosen serta berpengaruh terhadap sikap dan perilaku mereka Penelitian ini bertujuan untuk mengetahui pengaruh masa kerja, beban mengajar, dan iklim organisasi terhadap kinerja profesionalisme dosen Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Penelitian ini merupakan penelitian eksplanasi dengan pendekatan survey. Variabel dalam penelitian ini adalah Masa Kerja (X1), Beban Mengajar (X2), Iklim Organisasi (X3) dan Kinerja Profesionalisme Dosen (Y). Subjek penelitian ini adalah Dosen Jurusan Akuntansi FE-UM. Instrumen yang dipakai dalam penelitian ini adalah dengan menggunakan angket/kuesioner tertutup, yang diuji dengan uji validitas dan reliabilitas. Analisis data yang digunakan untuk menguji hipotesis adalah analisis regresi ganda. Berdasarkan hasil penelitian dapat diketahui bahwa masa kerja berpengaruh secara positif terhadap kinerja profesionalisme dosen jurusan akuntansi FE-UM, hal ini dapat dilihat dari koefisien regresi variabel masa kerja sebesar 0,695. Beban mengajar berpengaruh secara negatif terhadap kinerja proesionalisme dosen, hal ini dapat dilihat dari koefisien regresi variabel beban mengajar sebesar -1,797. Iklim Organisasi berpengaruh secara positif terhadap kinerja profesionalisme dosen, hal ini dapat dilihat dari koefisien regresi variabel iklim organisasi sebesar 0,424.. Sumbangan variabel masa kerja terhadap kinerja sebesar 36,28%, sumbangan variabel beban mengajar sebesar 27,72%, dan sumbangan variabel iklim organisasi sebesar 29,47%. Persentase sumbangan pengaruh variabel independen (X1, X2, dan X3) terhadap variabel dependen (Y) dilihat dari adjusted R Square sebesar 92,6% dan sisanya dipengaruhi oleh faktor lain yang tidak diteliti dalam penelitian ini. Dari hasil penelitian dapat disimpulkan bahwa masa kerja, beban mengajar, dan iklim organisasi berpengaruh terhadap kinerja profesionalisme dosen jurusan akuntansi FE-UM. Saran yang dapat diajukan dari hasil penelitian ini adalah (1) Bagi dosen yang senior hendaknya meningkatkan aktivitas dalam membimbing dosen yang lebih yunior, (2) Bagi pihak fakultas hendaknya tidak menerima mahasiswa baru jalur mandiri dalam jumlah sangat besar agar beban mengajar dosen tidak terlalu tinggi, (3) Bagi pihak jurusan hendaknya mengatur beban mengajar secara proporsional agar bidang penelitian dan pengabdian pada masyarakat masih longgar, (4) Bagi dosen jurusan akuntansi hendaknya menjaga dengan baik hubungan dengan sesama dosen dan dengan pimpinan, (5) Bagi para peneliti selanjutnya yang tertarik untuk meneliti tema yang serupa hendaknya memperluas cakupan subjek penelitiannya yaitu seluruh dosen akuntansi baik PTN maupun PTS, selain itu hendaknya juga menambah variabel independen lainnya di luar variabel masa kerja, beban mengajar, dan iklim organisasi, seperti tingkat pendidikan, kualitas perguruan tinggi, kepuasan kerja, dan lain-lain.

Kuat lentur papan partikel berbahan dasar serbuk gergajian kayu sengon dengan variasi persentase penambahan eceng gondok / Triana Rakhmawati

 

Kayu mempunyai peranan penting dalam kehidupan sehari-hari, mulai dari keperluan sederhana sebagai perabot rumah tangga, bahan baku pulp kertas, bahan bakar, bahan konstruksi bangunan dan lain sebagainya. Untuk meminimkan penggunaan bahan kayu maka dilakukan pengolahan limbah kayu dengan membuat produk turunan kayu seperti papan partikel. Papan partikel ini termasuk komposit yang terbuat dari serbuk gergaji kayu sengon didapat dari daerah Junrejo Kota Batu-Jawa Timur sebagai matriks dan enceng gondok yang digunakan berasal dari desa Ngrowo Kota Bojonegoro-Jawa Timur sebagai serat untuk perkuatan. Ide penambahan serat kedalam matriks telah dilakukan pada beton, yaitu dengan penambahan serat baja. Penambahan serat ke dalam matriks bertujuan meningkatkan sifat fisik dan sifat mekanik. Dari penelitian ini diharapkan mengetahui adanya pengaruh penambahan persentase serat eceng gondok 0%, 10%, 20%, 30% terhadap kerapatan, kadar air, daya serap air, pengembangan tebal dan kuat lentur papan partikel yang berbahan dasar serbuk gergaji kayu sengon Penelitian yang dilakukan merupakan penelitian eksperimen, dimana variabel bebasnya adalah variasi persentase serat eceng gondok, variabel terikatnya adalah kuat lentur, sedangkan variabel kontrolnya adalah perekat urea formaldehyde sebanyak 15% dan berat jenis yang direncanakan 0,6gr/cm³. Pedoman yang digunakan dalam pengujian kerapatan, kadar air, daya serap air, pengembangan tebal dan kuat lentur papan partikel yaitu SNI-03-2105-2006. Teknik analisa data untuk mengetahui pengaruh variasi persentase penambahan serat eceng gondok terhadap kuat lentur papan partikel dari serbuk kayu sengon menggunakan analisa regresi. Dari uji hipotesis diperoleh hasil bahwa penambahan eceng gondok berpengaruh terhadap MOR dan MOE. Diskripsi nilai kerapatan sudah memenuhi standar FAO yaitu antara 0,40-0,80 gr/cm³, pada pengujian kadar air termasuk dalam standart SNI 03-2105-2006 dimana batasan nilai tidak lebih dari 14%. Pada pengujian daya serap air diperoleh hasil 186,97-233,86%, jadi melebihi standar FAO dengan batasan nilai 20-75%. Sedangkan pada pengujian pengembangan tebal, nilai rata-rata antara 72,31-95,70%, jadi melebihi standar FAO dengan batasan nilai 5-15%. Hasil MOR tertinggi pada perbandingan persentase (70:30) sebesar 52,509kg/cm², jadi tidak memenuhi standar FAO dengan batasan nilai 100-500 kg/cm2. Sedangkan untuk hasil MOE yang memenuhi standar FAO dengan nilai 10.000-50.000 kg/cm2 adalah hanya pada papan partikel dengan perbandingan persentase (70:30) sebesar 10285,472 kg/cm2. Dari hasil penelitian ini disarankan agar dilakukan penelitian lanjutan dengan komposisi campuran antara serbuk gergajian kayu sengon dan eceng gondok.

Studi pelaksanaan pekerjaan kuda-kuda baja pada pembangunan show room mobil di Jalan Ahmad Yani No. 73 Blimbing Malang / Yonesthon Austhin Sihombing

 

ABSTRAK Sihombing, Austhin Yonesthon. 2009, Studi Pelaksanaan Pekerjaan Kuda-Kuda Baja Pada Pembangunan Show Room Mobil Di Jalan Ahmad Yani No. 73 Blimbing Malang. Proyek Akhir, Program Studi DIII Teknik Sipil dan Bangunan, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: Drs. Prijono Bagus Susanto, ST.,M.T. Kata Kunci: single beam, baja profil, pelaksanaan, RAB Bangunan memegang peranan penting dalam kehidupan kita di dalam segala bidang, termasuk pada dunia konstruksi yang menuntut kenyamanan dan biaya yang ekonomis. Pelaksanaan merupakan pengerjaan bangunan dilapangan sesuai dengan prosedur yang telah ditentukan. Permasalahannya adalah bagaimana cara mendirikan suatu bangunan sesuai dengan prosedur yang benar. Pelaksanaan pekerjaan konstruksi kuda-kuda baja single beam sering menyimpang dari apa yang telah distandarkan sehingga penyimpangan ini dapat menghambat waktu pelaksanaan dan menurunkan kualitas kuda-kuda baja single beam. ketelitian dalam perhitungan RAB juga sangat penting karena berhubungan dengan dana, kesalahan perhitungan RAB sedikit saja maka akan menyebabkan kerugian. Kuda-kuda merupakan struktur bagian atas yang berfungsi untuk menahan beban struktur atas ke pondasi. Maka dari itu dalam mendirikan bangunan memerlukan metode dan pengawasan yang ketat. Studi lapangan ini bertujuan untuk mengetahui metode pelaksanaan serta perhitungan RKS konstruksi kuda-kuda baja single beam. Pada studi ini diharapkan dapat menambah ilmu dan wawasan tentang pelaksanaan pekerjaan baja khususnya pekerjaan konstruksi kuda-kuda baja single beam. Studi ini dilakukan di proyek Pada Pembangunan Show Room Mobil Jl. Ahmad Yani No. 73 Blimbing Malang. Metode pengumpulan data yang digunakan yaitu dengan wawancara, observasi, dan dokumentasi. Analisis data dilakukan dengan cara memeriksa kelengkapan data. Hasil studi lapangan tentang pelaksanaan pekerjaan kuda-kuda baja single beam adalah sebagai berikut, profil baja yang digunakan adalah baja IWF 198 x 99 dengan panjang bentang bangunan 11.34 meter, panjang 1 kuda-kuda single beam penuh adalah 12 meter dengan sudut 20°. Tahap pemasangan kuda-kuda baja single beam ada beberapa tahap yaitu, pengukuran profil, pemotongan profil, dan perakitan pada tempat yang telah ditentukan. Volume kuda-kuda baja single beam adalah 1.310.4 kg yang diperoleh dari Table Profil Konstruksi Baja, volume plat simpul adalah 52 kg, volume plat pengaku rafter adalah 39.2 kg, volume plat ikatan angin adalah 35.1 kg, volume plat gording adalah 87.75 kg, dan baut 180 pcs. Menurut analisa perhitungan kontraktor biaya yang dibutuhkan untuk pekerjaan kuda-kuda baja single beam adalah sebesar Rp 23.295.450, sedangkan analisa berdasarkan Tabel Profil Konstruksi Baja biaya yang dibutuhkan untuk pekerjaan kuda-kuda baja adalah Rp 20.906.700, jadi perbedaan biaya adalah Rp 2.388.750.

Kajian kesalahan konsep geometri pada buku teks matematika SMP / Septina Ika Wenny Puspita Sari

 

ABSTRAK W.P, Septina Ika. 2009. Kajian Kesalahan Konsep Geometri Pada Buku Teks Matematika SMP. Skripsi, Jurusan Matematika Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Negeri Malang. Pembimbing (I) Drs. Muchtar Abdul Karim, M.A., Pembimbing (II) Drs. Askury, M.Pd. Kata Kunci: kesalahan konsep, geometri, buku teks. Salah satu faktor yang mempengaruhi kesuksesan pembelajaran matematika di sekolah adalah kualitas buku teks matematika yang digunakan. Dari beberapa penelitian terungkap bahwa buku teks yang beredar selama ini memiliki beberapa kekurangan, diantaranya: isi yang kurang, urutan materi yang tidak sesuai dengan kurikulum, penggunaan konsep yang tidak konsisten, terdapat bahasan yang berulang, memuat kekeliruan pengungkapan objek matematika dan kekeliruan strategi penyajian materi. Serta ditemukan banyak kesalahan dalam memahami suatu konsep matematika (miskonsepsi), terutama pada pokok bahasan geometri. Buku teks yang digunakan pada penelitian ini diperoleh dengan cara bertanya kepada beberapa siswa SMP di Malang tentang buku teks matematika apa yang mereka gunakan di sekolah. Dari hasil observasi tersebut diperoleh lima buku teks matematika yang digunakan di beberapa SMP di Malang, yaitu: MG, GE, EL, YD, dan BS. Penelitian ini bertujuan untuk mendeskripsikan kesalahan konsep geometri pada buku teks matematika SMP. Kekeliruan pengungkapan konsep matematika dalam hal ini adalah ketidaktepatan konsep pada buku teks dengan konsep yang sebenarnya. Kegiatan utama penelitian ini adalah mengkaji isi buku teks dalam hal pengungkapan kesalahan konsep geometri. Kajian isi adalah suatu cara penelitian untuk memeriksa isi dokumen secara objektif dan sistematis. Dari pengkajian yang dilakukan ditemukan kesalahan konsep pada masing-masing buku teks, yaitu pada MG, GE, EL, YD, dan BS berturut-turut 5 kesalahan, 1 kesalahan, 1 kesalahan, 10 kesalahan, dan 2 kesalahan. Berdasarkan hasil pengkajian ini, ditemukan kesalahan konsep geometri pada buku teks matematika SMP. Saran-saran yang dapat diberikan sebagai berikut. Pertama, bagi guru agar memeriksa terlebih dahulu konsep-konsep dalam buku teks yang akan dijadikan sebagai rujukan untuk memberikan bimbingan kepada siswa. Kedua, siswa hendaknya tidak menggunakan satu buku sebagai acuan dalam belajar dan memilih buku yang berkualitas agar memperoleh konsep materi yang benar. Ketiga, sekolah hendaknya lebih teliti dalam memilih buku teks matematika yang akan digunakan. Keempat, penulis buku teks hendaknya meneliti kembali konsep-konsep yang disajikan pada buku teks dan memperbaiki kesalahan konsep yang ada agar pembaca lebih memahami apa yang mereka pelajari. Kelima, penerbit hendaknya merevisi kesalahan konsep yang ada pada buku teks dan agar lebih teliti sebelum menerbitkan buku. Keenam, kepada peneliti selanjutnya diharapkan untuk mengkaji aspek-aspek yang lain.

Perbedaan antara pola sistem J.H.C. meyneke dan sistem dressmaking terhadap tingkat kenyamanan pemakai pada pembuatan kebaya modifikasi / Kustin Andriyanti

 

“Tata busana adalah kegiatan atau pekerjaan mewujudkan suatu busana atau pakaian, yang diawali dengan proses pemilihan model, pemilihan bahan atau tekstil, pengambilan ukuran, pembuatan pola sampai ke teknik menjahit dan menyelesaikannya” (Pratiwi, 2001:1). Setiap tahap dalam proses pembuatan busana tersebut saling berhubungan satu dengan yang lainnya. Masalah yang sering muncul dalam pemilihan busana adalah antara busana dengan si pemakai kurang serasi atau kurang pas di badan. Masalah tersebut disebabkan oleh: kurang tepatnya desain, mode atau bahan dengan bentuk busana, proporsi tubuh pemakai, jatuhnya busana pada tubuh atau badan pemakai kurang tepat sehingga mempengaruhi kenyamanan pemakai, misalnya: letak garis pinggang, penempatan atau pemindahan kupnat yang tidak sesuai, maupun terjadi kerut atau menggelembung.

Variasi berat jenis papan partikel berbahan dasar serbuk gergaji kayu sengon dengan penambahan anyaman bambu terhadap sifat fisik dan sifat mekanik / Nuzul Laili Hidayani

 

ABSTRAK Hidayani, Nuzul Laili. 2009. Variasi Berat Jenis Papan Partikel Berbahan Dasar Serbuk Gergaji Kayu Sengon dengan Penambahan Anyaman Bambu terhadap Sifat Fisik dan Sifat Mekanik . Skripsi, Jurusan Teknik Sipil FT Universitas Negeri Malang. Pembimbing: (I) Drs. Karyadi, S.Pd, M.P., M.T., (II) Drs. Boedya Djatmika, S.T., M.T. Kata kunci: papan partikel, anyaman bambu, sifat fisik, sifat mekanik. Dalam kehidupan sehari-hari, kayu memegang peranan yang penting, mulai dari keperluan sederhana sebagai bahan bakar, perkakas rumah tinggal sampai kebutuhan yang sangat besar seperti pembuatan alat transportasi air, bahan konstruksi bangunan, kayu lapis, papan serat,dan lain sebagainya. Sebagian besar limbah yang berupa serbuk gergajian dibuang sebagai bahan timbunan dan pemanfaatannya masih belum optimal. Untuk itu, sesuai dengan limbah yang dihasilkan, diperlukan suatu usaha peningkatan efisiensi pemakaian kayu dengan cara memanfaatkan limbah kayu menjadi produk yang lebih bermanfaat, misalkan dimanfaatkan sebagai papan partikel. Papan partikel ini terbuat dari serbuk gergaji kayu sengon yang didapatkan dari limbah industri kayu CV. Multi Mandiri, Junrejo-Batu, Jawa Timur. Anyaman bambu menggunakan bambu apus. Perekat yang digunakan adalah Urea formaldehida dan NH4Cl. Penelitian ini difokuskan pada usaha untuk memperoleh data sifat fisik dan sifat mekanik dari variasi berat jenis papan partikel dengan penambahan anyaman bambu. Untuk itu perlu dilakukan uji sifat fisik papan partikel yang meliputi kerapatan, kadar air, daya serap air dan pengembangan tebal papan partikel. Sedangkan uji sifat mekanik hanya ditinjau pada uji kuat lentur saja. Acuan yang digunakan dalam pengujian sifat fisik dan sifat mekanik papan partikel yaitu SNI-03-2105-2006. Teknik analisa data menggunakan statistik regresi. Dari hasil penelitian yang telah dilakukan, hasil pengujian kerapatan nilainya adalah 0,45-0,67 gr/cm³, menurut standar FAO hasil kerapatan tersebut termasuk dalam tipe sedang yaitu antara 0,40-0,80 gr/cm³. Pada pengujian kadar air dihasilkan kadar air kesetimbangan yaitu 12,05-13,14% yang telah memenuhi SNI-03-2105-2006, yang menyatakan bahwa kadar air papan partikel tidak boleh lebih dari 14%. Sedangkan pada pengujian daya serap air, nilainya adalah 190,24-220,93%, hasil tersebut tidak memenuhi standar FAO yaitu 20-75%. Pada pengujian pengembangan tebal nilai yang dihasilkan adalah 42,86-76,47%, hasil tersebut tidak memenuhi standar FAO yaitu 5-15%. Pada pengujian sifat mekanik kuat lentur, standard FAO untuk MOR 100-500 kg/cm2 dan untuk MOE 10.000-50.000 kg/cm2. Pada pengujian kuat lentur nilai MOR yang dihasilkan adalah 26,466-45,874 kg/cm2 dan nilai MOE adalah 1281,283-8542,814 kg/cm2. Dari hasil penelitian ini perlu dilakukan penelitian lebih lanjut dengan variasi berat jenis yang berbeda dengan pengujian sifat fisik dan sifat mekanik yang lain seperti kuat tarik sejajar permukaan, kuat tarik tegak lurus permukaan/kuat rekat, dan kuat cabut sekrup.

Penggunaan informasi akuntansi diferensial dalam keputusan investasi penambahan kendaraan pada perusahaan travel "Surya" Malang oleh Sri hartati

 

PerusahaaTnr avel" SURYA'Malang merupakanp erusahaayna ng bergerakd alamb idangj asa transportasbi erupat ravel yang melayanit iga jurusan, yaituY ogyakarta,S emarangd, an DenpasarJ. umlahp ermintaany ang diterima lebihb esard arijumlahk endaraand engank apasitasy angt ersedias, ehingga Perusahaaank ank ehilangank esempatanm tuk memanfaatkanp eluangp asar, tidak dapatm empertahankakne langsunganh idup (survivaf, dan tertinggald ari persaingajnik a tidak memenuhip ermintaant ersebut.O leh karenai tu, Perusahaan perlum engadakanp erluasanu saham elalui investasip enambahank endaraan. Penelitiani ni bertujuanm enganalisisk elayakani nvestasip enambahank endaraan denganm emanfaatkanin formasi akuntansid iferensials esuaik riteria penilaian investasi. Rancangapne nelitiany angd igunakana dalahp enelitiand eskriptifd engan tekniks tudik asusP. enelitianin i mengambidl atat ahun1 998-2002,berupdaa ta kualitatifd ank uantitatif.M etodep engumpuland atayangd igunakana dalah metodes tudi kepustakaand an metodel apangand engant eknik wawancara, dokumentasdi,a no bsewasi. Dari hasil analisisd ata,d iketahuib ahwaP erusahaanp erlu menambah4 buahk endaraanI.n formasi akuntansid iferensial,b erupaa ktiva diferensials ebesar Rp 487.200.000,00A.k tiva tersebudt ibiayaid ari modals endirid anm odala sing denganp erbandingan5 6,90%: 43,10%Mo.o dal sendirim empunyaki esempatan untuk mendapatkanb unga7 o/op r tahvn,d an modal asingb erupap embelian angsurand alamj angka waktu 3 tahund enganb wtga lTVod ari saldoh utang. Kendaraante rsebudt iperkirakanm emiliki nilai sisaR p 320.000.000,0s0e telah dimanfaatkans elama3 tahun.B iaya depresiasdi ihitung denganm enggunakan metodeg arisl urus.P ajakp enghasilasne suadi engank etentuanp ajakp enghasilan untuk badan. Biayad iferensiasl ebesaRr p 382.846.31 8,80u ntukt ahun2 003, Rp 516.710.763,u8n0t ukt ahun2004d, anR p 695.101.213,1u0n tukt ahun2 005; sertap endapatadni ferensiasl ebesaRr p 656.024:678,0u0n tukt ahun2 003' Rp 863.793.402,2u0n tukt ahun2004d, anR p 1.114.195.640,u0n0t ukt ahun2 005. Earninga fter tax yangd ihasilkans ebesaRr p 144.721.518,1u0n tukt ahun2 003, Rp 203.516.029,6u0n tukt ahun2004d, anR p 262.186.255,4u0n tukt ahun2 005' Cashi nflow sebesaRr p 200.454.851,4u0n tukt ahun2 003,R p259.249.362,90 untukt ahun2 OO4d, anRp6 37.919.588,7u0n tukt ahun2 005. l l Berdasarkanin formasi akuntansid iferensialt ersebut,d iproleh pay-back period selama2 tahun1 5h ari, averager ate ofreturn sebesa8r 4oh,1 25Vo,dan 251%on,e tp resentv alueb ernilaip ositifsebesaRr p 388.565.856,10in, ternalr ate of return 42,72%, dan profitability ratio 1,80. Hasil tersebut menunjukkan bahwa rencanain vestasip enambahank endaraanla yak untuk dijalankan. Dengana danyak ondisi ketidakpastianm asay ang akand atangy ang tidak dapatd iprediksi denganm enggunakanp erhitunganm atematis,m akad alam mengambikl eputusanin vestasdi iperlukanm etodel ain dengan mempertimbangkafna ktor yang bersifat kualitatil misalnyap endapatk onsumen, agenp emasaranp, endapapt emilik perusahaanm, aupunp araa hli, sehingga keputusanle bih akuratd anr ealistis.S elaini tu, dalamm enganalisikse layakan investasip erlu dipertimbangkana spekt eknis, organisasi,m anagenald, an sosial budaya.P erusahaajnu ga perlu melakukanp erbaikand an penyempurnaanku alitas pelayanans ecarat erusm enerusu ntuk mempertahankand an meningkatkan permintaan.

Pengaruh penggunaan catalytyc converter dengan filter butiran zeolite terhadap kadar gas buang CO dan HC pada motor 4 langkah / Silvanus Pri Hantoro

 

ABSTRAK Pri Hantoro, Silvanus. 2009. Pengaruh Penggunaan Catalytic Converter dengan Filter Butiran Zeolite Terhadap Kadar Gas Buang CO dan HC pada Motor 4 langkah.Skripsi, Jurusan Teknik Mesin Fakultas Teknik Universitas Negeri Malang. Pembimbing: (1) Dra. Anny Martiningsih, M.Kes, (2) Drs. H. Darmadji AS., M.Pd. Kata kunci: catalytic converter, putaran mesin, kadar gas buang co dan hc Perkembangan teknologi dibidang otomotif dan perindustrian yang cukup pesat telah memberikan kemudahan kepada manusia dalam pemenuhan hidupnya, tetapi dampak negatif yang ditimbulkan tetap ada terutama polusi udara. Pencemaran lingkungan yang disebabkan oleh polusi telah memberikan dampak yang cukup signifikan terhadap kelangsungan hidup manusia. Polusi udara merupakan masalah yang sangat meresahkan saat ini karena polusi udara dapat menimbulkan berbagai macam penyakit seperti gangguan pernapasan dan kanker kulit. Dampak lain dari polusi udara yaitu sebagai sebab penipisan lapisan ozon yang berfungsi sebagai filter radiasi sinar matahari. Hasil penelitian catalytic converter dengan filter butiran zeolite diharapkan dapat mengurangi kadar emisi gas buang yaitu CO dan HC. Penelitian ini mempunyai tujuan sebagai berikut: Mendeskripsikan interaksi antara penggunaan catalytic converter standart, catalytic converter dengan filter butiran zeolite dan kenaikan RPM dari 1500, 2000, 2500, 3000, dan 3500 terhadap kadar gas buang CO dan HC. Penelitian dilakukan di Laboratorium Motor Bakar Universitas Brawijaya Malang tanggal 26 Mei 2009. Objek penelitian menggunakan mesin bensin Datsun 4 langkah berpendingin air dengan perbandingan kompresi 9:1. Analisis data menggunakan Anova dua jalan dengan taraf signifikansi 0,01 menggunakan fasilitas software SPSS 14 for windows Evaluation. Hasil penelitian ini menunjukkan bahwa catalytic converter dengan filter butiran zeolite berpengaruh terhadap kandungan gas buang bensin. Pada saat menggunakan catalytic converter dengan filter butiran zeolite, kadar emisi CO (0.80 % vol pada 3500 rpm) dan HC (83 ppm vol pada 3500 rpm) lebih rendah jika dibandingkan dengan menggunakan catalytic converter standart, kadar emisi CO (0.222 % vol pada 3500 rpm) dan HC (98 ppm vol pada 3500 rpm) dan kadar emisi CO2 dan O2 hanya sebagai indikator terjadi pembakaran sempurna. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa jenis catalytic converter, variasi putaran mesin dan interaksi antara jenis catalytic converter dan putaran mesin mempengaruhi kadar emisi CO dan HC. Dapat disarankan agar dilakukan penelitian lebih lanjut misalnya pengaruh catalytic converter dengan filter butiran zeolite terhadap daya putaran mesin.

Implementasi strategi penetapan harga sewa dalam upaya menghadapi persaingan pada Mal Olympic Garden Malang / Dayu Setyo Hartono

 

ABSTRAK Hartono, Dayu Setyo. 2008. Implementasi Strategi Penetapan Harga Sewa Dalam Upaya Menghadapi Persaingan Pada Mal Olympic Garden (MOG) Malang, Jurusan Manajemen, Program D-III Manajemen Pemasaran Universitas Negeri Malang. Pembimbing Agus Hemawan. Kata Kunci: Strategi Penetapan, Harga, Persaingan Praktikum Manajemen Pemasaran III yang ditujukan bagi mahasiswa D-III Manajemen Pemasaran ini diselenggarakan tanggal 1 September sampai 21 Oktober 2008 bertempat di Mal Olympic Garden Malang, Mal Olympic Garden Malang merupakan perusahaan yang bergerak di bidang jasa yang melayani konsumen dengan tujuan memuaskan konsumen. Agar Mal Olympic Garden Malang dapat memberikan harga yang terbaik pada konsumen perusahaan menggunakan strategi penetapan harga. Harga merupakan satu-satunya unsur bauran pemasaran yang memberikan pemasukan dan dampak dari perubahan harga dapat dirasakan langsung oleh konsumen yang mampu memberikan pemasukan atau pendapatan bagi perusahaan. Strategi pemasaran yang dikenal dengan sebutan ”Marketing Mix” terdiri dari empat unsur yaitu strategi produk, strategi distribudi, strategi promosi, dan strategi harga. Dari keempat strategi pemasaran tersebut menyebabkan timbulnya biaya produksi (pengeluaran), harga adalah faktor yang perlu dipertimbangkan dengan bijaksana karena keputusan mengenai harga adalah keputusan yang paling signifikan diantara unsur lainnya. Disamping itu harga bersifat fleksibel, artinya dapat diubah dengan cepat. Berbeda halnya dengan karakteristik produk atau komitmen terhadap saluran distribusi. Kedua hal terakhir tidak dapat dirubah atau disesuaikan dengan mudah dan cepat, karena biasanya menyangkut keputusan jangka panjang. Tujuan dari penulisan tugas Akhir ini adalah untuk mendiskripsikan Implementasi Strategi Penetapan Harga Sewa Dalam Upaya Menghadapi Persaingan antara lain: (1) untuk mengetahui strategi penetapan harga yang diterapkan pada Mal Olympic Garden (MOG) Malang. (2) Untuk mengetahui faktor-faktor yang dipertimbangkan oleh Mal Olympic Garden (MOG) Malang dalam menetapkan harga. (3) Mengetahui tujuan dari penetapan harga jual pada Mal Olympic Garden (MOG) Malang. (4) Untuk mengetahui upaya-upaya yang dilakukan oleh Mal Olympic Garden (MOG) Malang dalam upaya menghadapi persaingan. Berdasarkan hasil kegiatan selama PKL antara lain dapat mengetahui harga-harga produk yang ada di Mal Olympic Garden Malang. Ada beberapa kesimpulan dan saran yang dapat yang dapat meningkatkan pelaksanaan strategi penetapan harga sewa dalam upaya menghadapi persaingan yaitu (A) Kesimpulan: Faktor-faktor yang perlu dipertimbangkan dalam penetapan harga di Mal Olynpic Garden (MOG) antara lain : segmen pasar yang dituju, biaya, daya beli konsumen, permintaan, laba yang diinginkan, pesaing. (B) Saran: Harga sewa kavling yang terlalu mahal dari pada pesaing, alangkah baiknya jika harga sewa kavling diturunkan sama dengan pesaing.

Meningkatkan kemampuan siswa dalam menyelesaikan soal-soal penalaran dan komunikasi pada materi segiempat melalui pembelajaran kooperatif tipe think-pair-share (TPS) / Miftakhul Khoiroh

 

Penelitian ini bertujuan untuk meningkatkan kemampuan siswa dalam mengerjakan soal-soal penalaran dan komunikasi melalui pembelajaran kooperatif tipe think-pair-share pada materi segiempat Penelitian yang dilakukan adalah penelitian tindakan kelas. Penelitian ini dilakukan di SMP Negeri 1 Singosari Malang pada bulan Mei-Juni 2009. Penelitian dilaksanakan dalam 2 siklus. Masing-masing siklus terdiri dari 4 tahap, yakni menyusun rencana tindakan, melakukan tindakan, observasi/ pengamatan, dan refleksi. Dari penelitian ini dapat disimpulkan bahwa pembelajaran matematika yang dapat meningkatkan kemampuan siswa dalam menyelesaikan soal-soal penalaran dan komunikasi pada siswa kelas VIID SMP Negeri 1 Singosari adalah dengan menerapkan metode pembelajaran kooperatif tipe Think-Pair-Share. Dengan rincian tindakan sebagai berikut: (1) pada tahap Think, siswa diminta untuk memikirkan jawaban dari lembar Kerja Siswa yang dibacakan oleh guru, (2) Pada tahap Pair, siswa diminta untuk mendiskusikan jawaban dari Lembar Kerja Siswa tersebut dengan teman sebangkunya, dan (3) pada tahap Share, guru memanggil satu kelompok secara acak untuk mepresentasikan hasil diskusinya di ddepan kelas, selanjutnya guru juga meminta jawaban atau tanggapan dari beberapa kelompok lainnya. Peningkatan kemampuan siswa dalam menyelesaikan soal-soal penalaran dan komunikasi diperoleh dari hasil kuis yang dikerjakan oleh siswa di akhir siklus. Dari hasil kuis siklus I, hanya 20 siswa yang dikatakan tuntas belajar atau memperoleh nilai lebih dari atau sama dengan Kriteria Ketuntasan Minimal 66, 7 dengan ketuntasan kelas mencapai 57, 14 % dan rata-rata nilai kuis I adalah 68, 04. Meskipun rata-rata nilai kuis lebih dari KKM dan dari lembar observasi aktivitas siswa termasuk dalam kategori “baik”, namun karena ketuntasan kelas belum mencapai 80%, maka disimpulkan bahwa siklus I belum berhasil. Penelitian dilanjutkan ke siklus II. Pada siklus II, rata-rata nilai kuis mencapai 72, 3 dengan ketuntasan kelas mencapai 80%. Karena dari lembar observasi aktivitas siswa termasuk dalam kategori “baik”, maka siklus II dikatakan berhhasil dan tidak dilanjutkan ke siklus selanjutnya. Berdasarkan hasil wawancara diperoleh bahwa respon siswa cukup positif terhadap pembelajaran matematika dengan model think-pair-share.

Pengaruh lingkungan keluarga dan pemanfaatan fasilitas belajar di rumah terhadap prestasi belajar siswa kelas X pada mata pelajaran ekonomi di SMA N 1 Bululawang / Bahrul Fuad Asmawan

 

Lingkungan keluarga merupakan salah satu aspek yang mempunyai peranan penting dalam menentukan tingkat prestasi belajar siswa. Keluarga merupakan pusat pendidikan yang utama dan pertama, hal ini disebabkan karena keluarga merupakan orang-orang terdekat bagi seorang anak. Selain lingkungan keluarga, fasilitas belajar di rumah merupakan salah satu aspek yang tidak kalah penting dalam menentukan tingkat prestasi belajar siswa. Dengan dukungan dari keluarga dan terpenuhinya fasilitas belajar di rumah akan memudahkan anak dalam mencapai prestasi belajar yang diinginkan. Adapun rumusan masalah dalam penelitian ini, yaitu: (1) Bagaimana keadaan lingkungan keluarga Siswa Kelas X Pada Mata Pelajaran Ekonomi Di SMA N 1 Bululawang (2) Bagaimana pemanfaatan fasilitas Di Rumah Siswa Kelas X Pada Mata Pelajaran Ekonomi Di SMA N 1 Bululawang (3) Bagaimana tingkat prestasi belajar Siswa Kelas X Pada Mata Pelajaran Ekonomi Di SMA N 1 Bululawang (4) Apakah terdapat pengaruh antara lingkungan keluarga terhadap prestasi belajar Siswa Kelas X Pada Mata Pelajaran Ekonomi Di SMA N 1 Bululawang (5) Apakah terdapat pengaruh antara pemanfaatan fasilitas belajar di rumah terhadap prestasi belajar Siswa Kelas X Pada Mata Pelajaran Ekonomi Di SMA N 1 Bululawang (6) Apakah terdapat pengaruh antara lingkungan keluarga dan pemanfaatan fasilitas belajar di rumah terhadap prestasi belajar siswa kelas X pada mata pelajaran ekonomi di SMA Negeri 1 Bululawang Malang. Penelitian ini bertujuan untuk mengetahui pengaruh lingkungan keluarga dan pemanfaatan fasilitas belajar di rumah terhadap prestasi belajar Siswa Kelas X Pada Mata Pelajaran Ekonomi Di SMA N 1 Bululawang. Dalam pengumpulan data, penelitian ini menggunakan metode angket atau kuesioner dan dokumentasi atau nilai ulangan harian. Populasi dalam penelitian ini adalah semua Siswa Kelas X Di SMA N 1 Bululawang Malang yang terdiri dari tiga kelas dengan total 116 siswa. Sedangkan pengambilan sampel dalam penelitian ini masing kelas diambil perwakilan 15 siswa untuk kelas X1, 16 siswa untuk kelas X2, dan 15 siswa untuk kelas X3. Total keseluruhan sampel adalah 46 siswa. Pengambilan sampel dilakukan secara proporsional random sampling yaitu pengambilan sampel dari anggota populasi secara acak tanpa memperhatikan tingkatan dalam anggota populasi. Lokasi penelitian dilakukan di SMA Negeri 1 Bululawang Malang Jl. Raya Bululawang. Penelitian ini dilaksanakan April-Mei 2009. Data penelitian dianalisis dengan analisis regresi berganda. Hasil analisis menunjukkan pada taraf signifikansi t = 0,000 < 0,05 untuk variabel X1 diperoleh hasil sebesar 0,507 dan dikuadratkan menjadi 0,257 atau 25,70% hal ini menjelaskan bahwa faktor lingkungan keluarga berpengaruh signifikan terhadap prestasi belajar. Pada variabel X2 diperoleh signifikansi t = 0,002 < 0,05 untuk variabel x2 diperoleh hasil 0,447 setetelah dikuadratkan menjadi 0,1998 atuu 19,98% yang berarti terdapat pengaruh yang signifikan antara fasilitas belajar di rumah terhadap prestasi belajar siswa kelas X pada mata pelajaran ekonomi di SMA Negeri 1 Bululawang Malang. Dari hasil analisis regresi diperoleh nilai F = 0,482, hipotesis yang menyatakan bahwa terdapat pengaruh yang signifikan dari lingkungan keluarga (X1) dan fasilitas belajar di rumah (X2), terhadap prestasi belajar (Y) SMA Negeri 1 Bululawang Malang dapat diterima. Kesimpulan dari penelitian ini adalah terdapat pengaruh yang signifikan antara lingkungan keluarga dan pemanfaatan fasilitas belajar di rumah terhadap prestasi belajar siswa kelas X pada mata pelajaran ekonomi di SMA Negeri 1 Bululawang Malang. Berdasarkan hasil penelitian maka saran yang dapat disampaikan adalah bagi orang tua diharapkan dapat meningkatkan perhatian kepada anaknya dengan cara mendidik anaknya agar selalu rajin belajar, memantau perkembangan dan kemajuan belajar anaknya, memperhatikan kebutuhan sekolah anaknya berupa buku-buku pelajaran, alat tulis menulis, serta sarana prasarana belajar di rumah diharapkan dapat dipenuhi oleh orang tua, sehingga prestasi belajar anak dapat meningkat.

Studi tentang pelaksanaan pembelajaran program adaptif dan program produktif pada program keahlian teknik mekanik otomotif di SMK Negeri 6 Malang tahun 2009 / Agung Wicaksono

 

ABSTRAK Wicaksono, Agung. 2009. Studi Tentang Pelaksanaan Pembelajaran Program Adaptif dan Pembelajaran Program Produktif pada Program Keahlian Teknik Mekanik Otomotif SMK Negeri 6 Malang. Skripsi, Program Studi Pendidikan Teknik Mesin Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Drs. H. Kusdi, S.T., M.T. (II) Drs. H. Wakidi. Kata kunci: pembelajaraan, program adaptif, program produktif, SMK. Penelitian dengan judul Studi Tentang Pelaksanaan Pembelajaran Program Adaptif dan Pembelajaran Program Produktif pada Program Keahlian Teknik Mekanik Otomotif SMK Negeri 6 Malang memiliki tujuan penelitian (1) Mendiskripsikan sinkronisasi isi mata pelajaran program adptif terhadap program produktif pada keahlian mekanik otomotif, (2) Mendiskripsikan penjadwalan dan penyesuaian isi program adaptif pada keahlian mekanik otomotif, (3) Mendiskripsikan kompetensi pendidik program adaptif dan produktif, (4) Mendiskripsikan kendala-kendala yang dihadapi oleh guru program adaptif SMK Negeri 6 Malang dalam mensinkronisasikan dengan pembelajaran program produktif, (5) Mendiskripsikan alternatif solusi yang ditempuh untuk mengatasinya. Penelitian ini dilakukan di SMK Negeri 6 Malang yang terletak di Jl. Ki Ageng Gribig 28, Madyopuro, Malang. Pendekatan penelitian yang digunakan adalah penelitian kualitatif dengan jenis penelitian studi kasus. Prosedur pengumpulan data dalam penelitian ini menggunakan metode pengamatan, wawancara, dan dokumentasi. Analisis data dilakukan secara bertahap melalui metode mereduksi data, menyajikan data, dan penarikan kesimpulan. Dari penelitian ini didapatkan: (1) Sinkronisasi isi mata pelajaran program adptif terhadap program produktif dilaksanakan berdasarkan kebutuhan pelajaran produktif, dan berpedoman penuh pada kurikulum yang dipakai yaitu KTSP; (2) Penjadwalan dan penyesuaian isi program adaptif terhadap program produktif berpedoman penuh pada KTSP dan dalam pelaksanaanya disesuai dengan kebutuhan pembelajaran yang ada; (3) Kualifikasi pendidik yang mengajar di SMK Negeri 6 Malang sudah memenuhi kriteria PP No 19 tahun 2005 dan permen diknas no 16 tahun 2007; (4) Kendala-kendala yang dihadapi oleh guru program adaptif SMK Negeri Malang dalam mensinkronisasikan dengan pembelajaran program produktif antara lain sarana prasarana, Siswa, kebudayaan (kultur), dan DU/DI; (5) Alternatif solusi yang ditempuh untuk mengatasin kendala pembelajaran dengan cra mengajukan pengadaan sarana prasarana, pemberian motivasi kepada siswa, dan membaurkan siswa dari berbagai kultur.

Pelaksanaan pembelajaran pada jurusan tata boga di SMK Negeri 3 Malang sebagai rintisan sekolah berstandar internasional / Melchiorita Yosiana Hallatu

 

Penelitian ini dilakukan di Sekolah Menengah Kejuruan Negeri (SMKN) 3 Malang dengan fokus penelitian pelaksanaan pembelajaran, terkait dengan kesiapan guru produktif jurusan Tata Boga menyiapkan perangkat mengajar, mulai dari pembuatan silabus dan Rencana Pelaksanaan Pembelajaran. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Metode yang digunakan dalam penggumpulan data adalah wawancara, observasi/pengamatan dan dokumentasi. Hasil dari penelitian menunjukkan proses pembelajaran terkait dengan kesiapan guru jurusan Tata Boga dalam menyiapkan perangkat mengajar sesuai dengan Standar Nasional Pendidikan, dan masih separuh menjalankan standar RSBI mengingat sekolah ini telah menyandang predikat RSBI. Kurikulum yang digunakan adalah Kurikulum Tingkat Satuan Pendidikan (KTSP), Silabus mengacu pada Standar Kompetensi Kerja Nasional (SKKNI), Rencana Pelaksanaan Pembelajaran (RPP) yang meliputi: materi pelajaran, metode mengajar, media belajar dan sumber belajar. Materi pelajaran disesuaikan dengan kebutuhan industri, karena diharapkan siswa yang sudah lulus dapat bekerja di dunia industri. Metode mengajar yang digunakan adalah ceramah dan demonstrasi, hal ini tidak sesuai dengan karakteristik pembelajaran yang digunakan pada sekolah RSBI. Media pembelajaran didalam salah satu persyaratan sekolah RSBI adalah menggunakan ICT dalam Kegiatan Belajar Mengajar (KBM), hal ini belum sepenuhnya dilaksanakan guru Tata Boga dalam KBM. Media pembelajaran yang seringnya digunakan adalah alat/bahan itu sendiri, LCD dan laptop sebagai alat untuk menayangkan slide powerpoint, dan sumber belajar guru umumnya mengambil dari buku-buku boga, majalah, internet. Kesimpulan dari penelitian ini adalah SMK Negeri 3 Malang, belum dapat melaksanakan sekolah RSBI dengan baik. Ini terbukti hampir seluruh standar sekolah RSBI belum dilaksanakan. Sedangkan untuk kesiapan guru jurusan Tata Boga dalam menyiapkan perangkat mengajar yang meliputi pembuatan Silabus dan Rencana Pelaksanaan Pembelajaran, dapat dikatakan guru Tata Boga siap, hanya karena tidak adanya dukungan yang berarti dari pihak-pihak terkait sehingga guru Tata Boga belum sepenuhnya melaksanakan standar-standar sekolah RSBI. Saran dari penelitian ini kepada pihak sekolah dan guru adalah agar pada saat penerimaan siswa dapat dilakukan seleksi ketat, dan juga mengadakan berbagai macam pelatihan metode mengajar untuk guru.

Alat pengemas biogas ke dalam tabung LPG 3kg / Dimas Bagus Setyawan

 

Sumber daya energi mempunyai peran yang sangat penting bagi kebanyakan orang, karena sumber daya energi digunakan dalam berbagai bidang antara lain untuk pertumbuhan kegiatan industri, jasa, perhubungan, dan rumah tangga. Dalam jangka panjang, peran energi akan lebih berkembang khususnya guna mendukung pertumbuhan sektor industri dan kegiatan lain yang terkait. Indonesia memiliki sumber daya energi yang melimpah misalnya: minyak bumi atau gas alam cair lainnya yang biasanya sering disebut dengan istilah BBM (Bahan Bakar Minyak). Meskipun Indonesia adalah negara penghasil minyak dan gas tetapi pada saat ini sumber energi terus menipis dikarenakan banyaknya permintaan yang disebabkan populasi penduduk yang terus meningkat. Seperti yang telah kita ketahui BBM termasuk sumber energi yang tidak dapat diperbaharui, jika BBM dikonsumsi terus menerus maka cadangan BBM akan habis. Menurut data DESDM (2006) cadangan minyak Indonesia hanya tersisa sekitar 9 milliar barel. Apabila terus dikonsumsi tanpa ditemukannya cadangan minyak baru, diperkirakan cadangan minyak ini akan habis dalam dua dekade mendatang.

Analisis pengaruh good corporate governance terhadap kinerja perusahaan (studi pada perusahaan yang terdaftar di BEI tahun 2005-2006) / Nining Farida

 

ABSTRAK Farida, Nining. 2009. Analisis Pengaruh Good Corporate Governance terhadap Kinerja Perusahaan Studi pada Perusahaan yang Terdaftar di BEI tahun 2005-2006. Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Drs. H. Sumadi ,SE.MM . (II) Dra. Hj. Sutatmi, SE, M.Si, M.Pd, Ak. Kata Kunci : Good Corporate Governance, Kinerja Perusahaan. Keberadaan good corporate governance dalam suatu perusahaan tidak hanya mampu menjadi daya tarik bagi para investor, melainkan juga mampu menjadi jembatan penghubung yang mampu mengakomodasi hubungan antara investor atau pemilik modal (principal) dengan pihak manajemen perusahaan (agent). Dengan adanya penerapan prinsip good corporate governance tersebut, diharapkan konflik kepentingan antara agen dan prinsipal dapat dikurangi sehingga kepentingan perusahaan merupakan prioritas, dimana peningkatan kinerja perusahaan secara keseluruhan menjadi fokus utama. Beberapa penelitian yang telah dilakukan menunjukkan bahwa corporate governance mempunyai hubungan dengan peningkatan kinerja perusahaan. Penelitian ini bertujuan untuk mengetahui apakah tingkat penerapan good corporate governance mempunyai pengaruh terhadap kinerja perusahaan yaitu kinerja pasar dan kinerja operasional perusahaan publik di Indonesia. Penelitian mengenai pengaruh good corporate governance terhadap kinerja perusahaan menggunakan komposisi aktiva, kesempatan pertumbuhan dan ukuran perusahaan sebagai variabel kontrol dan kinerja perusahaan sebagai variabel independen diproksikan oleh Tobin’s Q untuk kinerja pasar perusahaan dan ROA untuk kinerja operasional perusahaan.Teknik pengambilan sample yang digunakan adalah purposive sampling dengan model judgement sampling, yaitu teknik pengambilan sampel dengan menggunakan pertimbangan-pertimbangan tertentu. Kriteria dalam pemilihan sampel penelitian ini adalah (1) perusahaan public yang listing di BEI pada tahun 2005-2006 yang bersedia untuk berpartisipasi dalam survey Corporate Governance Perseption Index (CGPI) pada tahun 2005 dan 2006, (2) perusahaan tersebut masuk ke dalam level pengelompokkan hasil survei CGPI. Berdasarkan kriteria tersebut survey tahun 2005-2006, 7 perusahaan mengikuti survey tahun 2005 dan 2 perusahaan yang mengikuti survey tahun 2006 sehingga jumlah total observasi adalah 35. Metode analisis statistik dalam penelitian ini adalah model regresi linier berganda, karena penelitian ini dirancang untuk meneliti faktor-faktor yang berpengaruh dari variabel bebas terhadap variabel terikat. Penelitian ini menggunakan variabel kontrol komposisiny aktiva, kesempatan pertumbuhan dan ukuran perusahaan. Hasil analisis data menunjukkan bahwa model regresi pertama pada semua variabel tidak terdapat pengaruh secara signifikan.Sedangkan pada model regresi kedua, hanya size yang mempunyai pengaruh signifikan terhadap kinerja operasional perusahaan. Sedangkan kedua variabel lainnya aktiva dan ukuran perusahaan tidak mempunyai pengaruh signifikan.

Modul sebagai alternatif pembelajaran matematika pada pokok bahasan sistem persamaan linear dua variabel untuk siswa SMP kelas VIII / Linda Dwi Khurin Inayati

 

Berdasarkan kenyataan di lapangan, sampai saat ini masih banyak siswa yang menganggap bahwa matematika merupakan pelajaran yang sulit. Di lain pihak, masih banyak juga guru yang menerapkan pembelajaran konvensional dibanding metode-metode pembelajaran yang baru. Apalagi ditambah hasil wawancara dengan beberapa siswa yang menyatakan bahwa buku pelajaran yang dimiliki siswa cenderung monoton dan kurang menarik sehingga siswa menjadi cepat bosan dan malas belajar. Dari ketiga hal tersebut, penulis terdorong untuk mengembangkan alternatif pembelajaran matematika dengan menggunakan modul. Dengan modul siswa dituntun untuk belajar membangun pemahamannya tentang suatu konsep materi yang akan dipelajari. Dengan begitu, konsep suatu materi yang telah mereka pelajari akan lebih melekat di ingatan mereka dalam jangka waktu yang lama dibandingkan dengan hanya menerima dari gurunya. Dalam pembelajaran ini, guru hanya berfungsi sebagai motivator dan pembimbing. Model pengembangan modul ini menggunakan model prosedural. Adapun unsur-unsur modul ini terdiri dari petunjuk untuk guru, petunjuk untuk siswa, daftar isi, standar kompetensi dan kompetensi dasar, lembar kegiatan siswa, lembar kerja siswa, kunci jawaban lembar kerja siswa, lembar tes, lembar tes remidi, kunci jawaban lembar tes beserta pedoman penilaiannya, kunci jawaban lembar tes remidi beserta pedoman penilaiannya, daftar pustaka. Sebelum diuji cobakan ke siswa, modul divalidasi terlebih dahulu ke satu dosen, satu guru, dan satu teman sejawat. Setelah itu modul diuji cobakan pada 5 siswa dalam 3 pertemuan. Pertemuan pertama siswa mengerjakan lembar kegiatan siswa, pertemuan kedua siswa mengerjakan lembar kerja siswa, dan pertemuan ketiga siswa mengerjakan soal tes. Berdasarkan hasil validasi perorangan, modul perlu perbaikan pada lembar kegiatan siswa, lembar tes dan lembar tes remidi. Sedangkan hasil uji coba kelompok kecil, nilai tes semua siswa sudah memenuhi standar ketuntasan belajar yang dibuat penulis. Akan tetapi, berdasarkan angket yang disebarkan ke siswa perlu adanya perbaikan kalimat pada petunjuk untuk siswa. Kesimpulan yang dapat diambil dari hasil uji coba modul ini adalah modul cukup menarik dan dapat diterima oleh siswa. Adapun saran pemanfaatan modul ini adalah sebaiknya digunakan pada siswa yang berkemampuan rata-rata ke atas karena rangkaian aktivitasnya tidak terlalu menuntun siswa tetapi siswa dituntun untuk memecahkan masalah melalui pertanyaan-pertanyaan yang konstruktif. Sedangkan untuk pengembangan lebih lanjut, modul ini dapat digunakan di sekolah sebagai alternatif pembelajaran matematika pada pokok bahasan sistem persamaan linear dua variabel.

Pengembangan media pembelajaran kimia berbasis komputer untuk materi pokok termokimia / Muhammad Hubbi

 

ABSTRAK Hubbi, Muhammad. 2008. Pengembangan Media Pembelajaran Kimia Berbasis Komputer Untuk Materi Termokimia. Skripsi, Jurusan Pendidikan Kimia FMIPA Universitas Negeri Malang. Pembimbing (I) Drs. I Wayan Dasna, M.Si., M.Ed., Ph.D., (II) Drs. Ida Bagus Suryadharma, M.S. Kata Kunci: media pembelajaran, media pembelajaran berbasis komputer, termokimia. Pembelajaran kimia meliputi tiga aspek penting yaitu aspek makroskopis, mikroskopis dan simbolik. Ketiga apek tersebut harus dibelajarkan kepada siswa agar tidak mengalami kesalahan konsep. Namun kenyataannya pengajar masih jarang menyampaikan matari kimia sampai pada aspek mikroskopis. Hal ini terjadi karena pengajar mengalami kesulitan dalam menyampaikan materi hingga aspek mikroskopis. Sehingga kebanyakan siswa masih sering mengalami kesalahan konsep. Salah satu sarana yang dapat digunakan oleh pengajar kimia dalam menyampaikan materi pelajaran hingga aspek mikroskopis adalah dengan menggunakan media pembelajaran berbasis komputer. Media pembelajaran ini dapat menyajikan animasi-animasi di tingkat molekuler dengan lebih mudah dan lebih jelas. Penelitian ini bertujuan untuk mengembangkan media pembelajaran berbasis komputer yang menarik, interaktif, dan mudah dipahami pada materi termokimia. Pengembangan media pembelajaran ini menggunakan model Dick and Carrey dengan beberapa penyesuaian yang diperlukan. Pengujian validitas media hasil pngembangan menggunakan instrumen berupa angket/ kuisioner tertutup. Pengujian validitas meliputi uji validitas konten dan uji terbatas. Validator pada uji validitas isi adalah dua dosen kimia UM, satu guru kimia SMAN 1 Malang dan satu guru kimia MA. Ma’arif 7 Lamongan. Sedangkan pada uji terbatas dilakukan terhadap 20 siswa MA. Ma’arif 7 Lamongan kelas XI. Setelah melalui tahap validasi, media pembelajaran diperbaiki berdasarkan saran-saran yang diberikan validator. Hasil penelitian pengembangan ini berupa media pembelajaran termokimia yang dikemas dalam CD. Media pembelajaran yang dirancang dapat digunakan sebagai alat bantu mengajar atau sebagai sumber belajar mandiri. Hasil validasi konten menunjukkan bahwa media yang dihasilkan memiliki tingkat validitas 84,40%. Sedangkan hasil uji terbatas pada siswa MA. Ma’arif 7 menunjukkan tingkat validitas 89,69. Dengan demikian media ini telah layak digunakan sabagai perangkat pembelajaran untuk materi pokok termokimia di SMA kelas XI. Namun demikian efektivitas penggunaan media ini masih perlu diteliti lebih lanjut melalui kegiatan empiris di kelas.

A semiotics analysis of longfellow's the tide rises, the tide falls / Avizena Elfazia Zen

 

Abstract Zen, Avizena Elfazia. 2009. The Tide Rises The Tide Falls: A Semiotics Analysis. Thesis. English Literature, Faculty of Letter, State University of Malang. Advisor: Drs. Sigit Selandono Keywords: Semiotics, Poetry, Sign, Interpretation In literary communication, especially poetry, author communicates what he means through certain symbols which mostly are not easy to interpret. The problem mostly occurs in the classes of poetry interpretation. The theory that will help the students to cope the problem is the theory of semiotics. The students need the theory of semiotics to be able to give explanation about their thought. They need the theory of semiotics also, to understand the references of the signs, the author, the message, and themselves as readers. Thus, analyzing poetic signs in literature, especially poetry, becomes the focus of this study. The writer believes that the study of semiotics will help her, other literature students, and readers to cope with the problem of subjectivity and lack of reasons in interpretation. By using poetry as the object of the study, she believes that she will be able to apply the theory of semiotic; the writer believes that she will be able to share the knowledge with others and understand poetry in a better platform. The writer uses one of Longfellow’s poems, The Tide Rises The Tide Falls as a representative of the poetry genre. The writer sees that Longfellow represents the modern poets. The poem itself is also an entity built on significations of conventional signs. The writer believes that semiotics will help her to reveal the use of the signs in the point of view of the terms and the functions. Through research, the writer analyzes the way semiotics works in the sign analysis of the poem. The writer analyzes the system of signs in the poem, which is built on the referential relationship among each sign internally and between signs and their convention. Then, the writer analyzes the characteristic of the signs; interpret the meaning of the signs intertextually. The result of the research is that the poem’s system of sign is the use of intertextual relationship by understanding of poem’s sign. The poem is built on the combination of signs and develop new signs that support the main theme of this poetry.

Pengaruh pemberian tugas menulis matematika terhadap hasil belajar bangun ruang siswa kelas VIII SMP negeri 18 Malang / Dyah Primasari

 

ABSTRAK Primasari, Dyah. 2009. Pengaruh Pemberian Tugas Menulis Matematika Terhadap Hasil Belajar Bangun Ruang Siswa Kelas VIII Smp Negeri 18 Malang. Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. Drs. Gatot Muhsetyo, M.Sc, (II) Drs. Ir. Herutomo, M.Pd. Kata kunci: tugas menulis matematika dan hasil belajar. Praktek Pengalaman Lapangan (PPL) di SMP Negeri 18 Malang memberikan informasi bahwa pelaksanaan pembelajaran matematika masih berpusat pada guru. Guru berperan sebagai pemberi informasi dengan menjelaskan materi matematika, memberikan contoh-contoh permasalahan dan memberikan latihan soal-soal. Akibatnya penguasaan siswa terhadap konsep matematika menjadi kurang maksimal. Sebagai solusi dalam pembelajaran matematika sehingga penguasaan konsep matematika siswa menjadi lebih baik adalah pembelajaran dengan tugas menulis matematika. Tugas menulis matematika membuat siswa lebih banyak mengkonstruk sendiri pengetahuan matematikanya, mengajak siswa lebih aktif, mengajak siswa lebih mandiri, dan membuat siswa selalu berusaha untuk menemukan pengertian, pemahaman dan kebenaran baru. Alasan inilah yang melatar belakangi penelitian pemberian tugas menulis matematika dalam pembelajaran bangun ruang. Tujuan penelitian ini adalah untuk menggambarkan proses pelaksanaan pembelajaran dengan pemberian tugas menulis matematika dan untuk mengetahui apakah hasil belajar siswa yang mendapatkan pembelajaran tugas menulis matematika lebih baik dibandingkan dengan siswa yang mendapatkan pembelajaran tanpa pemberian tugas menulis matematika. Rancangan penelitian yang digunakan yaitu rancangan penelitian eksperimen semu dan rancangan penelitian deskriptif. Populasi dalam penelitian ini adalah siswa-siswa kelasVIII SMP Negeri 18 Malang tahun ajaran 2008-2009. Sedangkan sampel dalam penelitian ini diambil dengan teknik sampling acak kelompok atau cluster random sampling. Dalam penelitian ini, data diperoleh dengan cara tes untuk mengetahui hasil belajar oleh siswa dan angket siswa untuk kelas eksperimen untuk mengetahui respon siswa terhadap pembelajaran dengan pemberian tugas menulis matematika, serta lembar observasi. Selanjutnya data pengujian hipotesis dianalis dengan bantuan MINITAB 14 for Windows. Berdasarkan hasil penelitian diperoleh pelaksanaan pembelajaran dapat dikategorikan berjalan dengan baik. Rata-rata hasil belajar siswa adalah 77,6 untuk kelas ekperimen dan 71,6 untuk kelas kontrol. Berdasarkan pengujian hipotesis hasil belajar dan motivasi belajar siswa diperoleh P-Value = 0,039 < 0,05 yang berarti H0 ditolak dan H1 diterima. Dengan demikian, pemberian tugas menulis matematika memberikan pengaruh positif terhadap hasil belajar matematika siswa yaitu hasil belajar siswa yang mendapatkan pembelajaran dengan pemberian tugas menulis matematika lebih baik dibandingkan dengan hasil belajar siswa tanpa mendapatkan pembelajaran tanpa pemberian tugas menulis matematika

Pengaturan motor servo untuk robot berkaki heksa_dizz / Fadly Arif

 

ABSTRAK Arif, Fadly. 2009. Pengaturan Motor Servo Untuk Robot Berkaki Hesa_Dizz. Tugas Akhir. Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Siti Sendari, S.T., M.T., (II) Ilham Ari Elbaith Zaeni, S.T. Kata kunci: Motor Servo, Robot, Bahasa C Upaya untuk mengembangkan dan menerapkan teknologi elektronika adalah dengan diadakannya suatu kontes robot cerdas Indonesia (KRCI), yang terdiri beberapa kategori yaitu beroda dan berkaki. Oleh karena itu, peningkatan tingkat kecerdasan robot melalui gerak-gerak yang digunakan serta kontrol yang pengaturannya menggunakan pemrograman bahasa C yang sesuai akan banyak menghasilkan gerakan robot yang cukup bervariasi. Untuk pergerakan kaki dalam tugas akhir ini menggunakan motor servo. Motor servo adalah sebuah motor dengan sistem umpan balik tertutup di mana posisi dari motor akan diinformasikan kembali ke rangkaian kontrol yang ada di dalam motor servo. Motor servo ini akan dikomunikasikan serial dengan sensor ultrasonik sebagai fungsi gerak dari robot. Kontrol utama yang digunakan adalah ATMega 16, sedangkan bahasa pemrogramannya menggunakan bahasa C. Kemudian hasilanya akan ditampilkan dalam LCD dalam bentuk angka. Dari hasil pengujian gerak motor servo sebagai sendi robot bahwa desain mekanis robot sangat menentukan dari putaran penuh dari PWM motor servo

Penggunaan metode investigasi kelompok untuk meningkatkan kemampuan menulis teks berita siswa kelas VIII SMP Unggulan Nahdlatul Ulama Mojoagung Kabupaten Jombang / Rina Maskuriyah

 

ABSTRAK Maskuriyah, Rina. 2009. Penggunaan Metode Investigasi Kelompok untuk Meningkatkan Kemampuan Menulis Teks Berita Siswa KelasVIII SMP Unggulan NU Mojoagung, Kabupaten Jombang. Skripsi, Prodi Bahasa, Sastra Indonesia, dan Daerah, Jurusan Sastra Indonesia Fakultas Sastra Universitas Negeri Malang. Pembimbing: Drs. Dwi Saksomo, M.Si Kata kunci: metode investigasi kelompok, menulis teks berita Pada Kurikulum Tingkat Satuan Pendidikan (KTSP) pelajaran Bahasa Indonesia untuk SMP disebutkan bahwa kemampuan menulis teks berita wajib dikuasai oleh siswa kelas VIII SMP. Tujuannya agar siswa dapat mengenal, memahami, dan mampu menulis teks berita. Untuk meningkatkan kemampuan siswa dalam menulis teks berita diperlukan sebuah metode pembelajaran yang tepat. Dalam penelitian ini, metode yang digunakan adalah metode investigasi kelompok. Dengan metode ini, siswa dapat belajar menulis teks berita. Dalam meningkatkan kemampuan menulis teks berita dilakukan melalui tiga tahap, yaitu tahap pramenulis, tahap menulis, dan tahap pascamenulis. Masalah umum dalam penelitian ini, adalah bagaimana gambaran umum tentang peningkatan kemampuan menulis teks berita dengan metode investigasi kelompok pada siswa kelas VIII SMP Unggulan NU Mojoagung Kabupaten Jombang pada tahap pramenulis, tahap menulis, dan tahap pascamenulis. Adapun tujuan penelitian adalah untuk mendeskripsikan peningkatan kemampuan menulis teks berita siswa melalui penggunaan metode investigasi kelompok bagi siswa kelas VIII SMP Unggulan NU pada tahap pramenulis, tahap menulis, dan tahap pascamenulis. Penelitian ini merupakan penelitian kualitatif dengan jenis Penelitian Tindakan Kelas (PTK). Penelitian dilaksanakan dalam dua siklus, masing-masing siklus dilaksanakan dalam tiga pertemuan yang dilaksanakan secara berkelanjutan dan berurutan. Penelitian ini meliputi beberapa tahap, yaitu: studi pendahuluan, perencanaan tindakan, pelaksanaan tindakan, observasi, evaluasi, dan refleksi. Penelitian pada siklus I dilaksanakan pada tanggal 10 November 2008, 12 November 2008 dan 17 November 2008, sedangkan siklus II dilaksanakan tanggal pada 19 November 2008, 21 November 2008 dan 24 November 2008. Subjek penelitian ini adalah siswa kelas VIII-C SMP Unggulan NU Mojoagung yang berjumlah 23 anak. Sumber data penelitian adalah siswa kelas VIII-C SMP Unggulan NU Mojoagung, Kabupaten Jombang. Data penelitian meliputi data verbal berwujud tuturan lisan selama proses dan hasil tertulis peningkatan keterampilan menulis teks berita. Data nonverbal berupa rekaman tindakan siswa yang ditranskripsikan pada catatan lapangan. Data diperoleh melalui instrumen utama, yaitu peneliti sendiri dibantu guru dan teman sejawat, sedangkan instrumen penunjang berupa pedoman wawancara guru dan siswa, lembar kerja siswa, dokumentasi, dan catatan lapangan untuk mengetahui proses dan hasil keterampilan menulis teks berita siswa. Berdasarkan hasil analisis data proses peningkatan keterampilan menulis teks berita siswa dengan menggunakan metode investigasi kelompok dapat ditarik kesimpulan berikut. Proses peningkatan keterampilan menulis teks berita dengan menggunakan metode investigasi kelompok pada tahap pra menulis dilakukan dengan mengidentifikasi topik, perencanaan kooperatif, dan implementasi. Pada tahap menulis dilakukan analisis dan sintesis data investigasi, kemudian menulis teks berita. Pada tahap pasca menulis, metode investigasi kelompok untuk meningkatkan kemampuan menulis teks berita dilakukan dengan kegiatan penyuntingan, presentasi kelompok, dan evaluasi. Berdasarkan analisis hasil penggunaan metode investigasi kelompok, keterampilan yang berkembang pada tahap pra menulis yaitu keterampilan menyusun kerangka teks berita dengan menentukan topik ,judul dan unsur berita. Pada tahap menulis, penggunaan metode investigasi kelompok dapat; (1) meningkatkan kemampuan siswa dalam menuliskan kelengkapan isi berita berdasarkan unsurnya yaitu 5W+1H; (2) meningkatkan kemampuan siswa dalam menuliskan sistematika berita pada teras berita yang ditulis dengan singkat, padat jelas dan menyatakan waktu yang tepat, pada tubuh berita yang ditulis dengan informasi yang ringkas, jelas dan sangat proporsional; dan (3) pada tahap revisi, meningkatkan keterampilan penggunaan ejaan dan tanda baca dengan baik yang ditandai dengan rendahnya kesalahan penggunaan ejaan dan tanda baca yang dilakukan oleh siswa (tidak lebih dari 15 kesalahan). Pada tahap pasca menulis, penggunaan metode investigasi kelompok dapat meningkatkan keterampilan menyunting yang memungkinkan siswa untuk mengoreksi hasil karangan temannya, sehingga siswa juga mengetahui kesalahan dan kekurangan pada hasil teks berita mereka, serta memublikasikan teks berita mereka dengan cara presentasi kelompok di depan kelas dan melakukan evaluasi. Berdasarkan hasil penelitian ini, disarankan kepada guru Bahasa Indonesia untuk menggunakan metode investigasi kelompok dalam meningkatkan kemampuan menulis teks berita siswa. Kepada penulis buku ajar disarankan untuk menjadikan temuan ini sebagai alternatif strategi pembelajaran menulis teks berita. Kepada peneliti selanjutnya, hasil penelitian ini diharapkan dapat bermanfaat sebagai acuan dan gambaran mengenai masalah yang sejenis, dan disarankan agar mengembangkan penggunaan metode investigasi kelompok ini pada kompetensi pembelajaran berbahasa yang lain.

Penerapan pendekatan sains teknologi masyarakat (STM) dalam meningkatkan hasil belajar siswa mata pelajaran IPA kompetensi dasar proses daur air dan kegiatan yang mempengaruhinya di kelas V SDN Gadang I Kota Malang / Septiana Dyah Winanty

 

ABSTRAK Winanty, Septiana Dyah. 2009. Penerapan Pendekatan Sains Teknologi Masyarakat (STM) dalam Peningkatan Hasil Belajar Siswa Pada Pembelajaran IPA Kompetensi Dasar Proses Daur Air Dan Kegiatan Yang Mempengaruhinya Di Kelas V SDN Gadang I Kota Malang. Skripsi, jurusan Kependidikan Guru Sekolah Dasar, Fakultas Ilmu Pendidikan Universitas Negeri Malang. Pembimbing: (1) Dra Hj. Sukamti, M.Pd., (II) Drs. Ir. Endro Wahyuno, M.Si. Kata kunci: Pendekatan STM, hasil belajar IPA Berdasarkan hasil pengamatan yang dilakukan pada 2 Februari 2009 pada pembelajaran IPA pada materi Gaya di SD Gadang I, diketahui pembelajaran tersebut belum menunjukkan hasil belajar IPA menunjukkan nilai ketuntasan. Selain itu, adanya kondisi lingkungan di sekitar sekolah yang merupakan daerah industri yang padat penduduk, mengharuskan siswa peka terhadap lingkungan sekitar.Tujuan penelitian ini yaitu: (1) mendiskripsikan pelaksanaan pendekatan STM dalam pembelajaran IPA kompetensi dasar proses daur air dan kegiatan yang mempengaruhinya di kelas V SDN Gadang I kota Malang; (2)mendiskripsikan peningkatan hasil belajar dengan pengunaan pendekatan STM dalam pembelajaran IPA kompetensi dasar proses daur air dan kegiatan yang mempengaruhinya di kelas V SDN Gadang I kota Malang. Rancangan yang digunakan dalam penelitian ini adalah menggunakan rangangan Penelitian Tindakan Kelas (PTK). Dalam PTK ini dilaksanakan 2 siklus, siklus I dilaksanakan dalam 3 × pertemuan dan siklus ke II dilaksanakan dalam 1× pertemuan. Subyek penelitian ini adalah siswa kelas V SDN Gadang I Kota Malang dengan jumlah siswa. Instrumen yang digunakan adalah lembar observasi, wawancara dan tes. Evaluasi yang dilakukan menggunakan tes hasil dan proses. Dari hasil penelitian ini diperoleh bahwa hasil belajar siswa pada pra tindakan hanya mencapai 13 % (belum mencapai kriteria keberhasilan 75%) dan rata-rata kelas hanya 56.21 dengan kriteria ketuntasan minimal secara individu 70. Sedangkan setelah pemberian tindakan meningkat menjadi 100% pada akhir siklus II dan rata-rata kelas mencapai 76.69. Dengan demikian pemberian tindakan pada siklus II telah berhasil. Kesimpulan dari penelitian ini adalah penerapan pendekatan STM pada pokok bahasan daur air dan kegiatan yang mempengaruhinya dapat meningkatkan hasil belajar pada aspek kognitif, afektif dan psikomotor Selanjutnya peneliti menyarankan pada pihak guru agar dapat menerapkan pendekatan STM dalam pembelajaran IPA agar siswa lebih peka terhadap masalah-masalah yang ada di sekitar lingkungan dengan menggunakan laboratorium. Pada siswa juga lebih peka terhadap lingkungan sekitar dan menerapkan teknologi dalam memecahkan masalah yang berkaitan dengan masalah lingkungan. Penelitian ini sebagai bahan bandingan dikemudian hari terdapat penelitian dengan model STM yang lebih sempurna lagi

Penerapan pembelajaran berbasis masalah berpijak pada Arends pada materi bangun ruang sisi datar kelas VIII SMP Negeri 10 Malang / Eka Junaedi

 

ABSTRAK Junaedi, Eka. 2009. “Penerapan Pembelajaran Berbasis Masalah Berpijak Pada Arends Pada Materi Bangun Ruang Sisi Datar Kelas VIII SMP Negeri 10 Malang”. Skripsi, Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (1) Dr. Cholis Sa’dijah,M.Pd., M.A., (2) Drs Eddy Budiono, M.Pd. Kata kunci: Penerapan, Pembelajaran Berbasis Masalah, Bangun Ruang Sisi Datar Dalam kegiatan pembelajaran dikelas, guru matematika SMP Negeri 10 Malang mengajak siswa untuk menemukan sendiri konsep yang dipelajari. Kegitan tersebut dilakukan guru dengan memberikan lembar kerja dan meminta siswa secara mandiri menyelesaikan lembar kerja tersebut. Metode tersebut baik untuk diterapkan. Tetapi pada kenyataannya masih ada siswa yang bingung ketika pelaksanaan pembelajaran. Siswa tersebut merasa sulit untuk memahami materi matematika yang dipelajari. Untuk mengatasi hal itu diperlukan suatu perubahan dalam kegiatan pembelajaran. Salah satu pembelajaran yang dapat digunakan adalah pembelajaran berbasis masalah. Suatu pembelajaran yang mengajak siswa membangun pengetahuan melalui kegiatan pemecahan masalah. Penelitian ini bertujuan untuk mendeskripsikan prosedur penerapan pembelajaran berbasis masalah berpijak pada Arends pada materi bangun ruang sisi datar kelas VIII dan mengetahui respon siswa terhadap penerapan pembelajaran berbasis masalah. Penelitian ini merupakan penelitian deskriptif dan pendekatan yang digunakan adalah pendekatan kualitatif. Penelitian dilakukan di SMP Negeri 10 Malang dengan subjek penelitian yaitu 40 siswa kelas VIII G SMP Negeri 10 Malang tahun 2008/2009. Teknik pengumpulan data dilakukan dengan observasi selama pembelajaran, catatan lapangan, tes, angket, wawancara dan studi dokumen. Data yang diperoleh dianalisis secara kualitatif. Hasil penelitian menunjukkan bahawa penerapan pembelajaran berbasis masalah pada materi bangun ruang sisi datar dilakukan melalui langkah-langkah berikut. (1) Orientasi siswa dalam menghadapi masalah yaitu menyampaikan tujuan, pemberian apersepsi, motivasi serta pemberian masalah. (2) Mengorganisasi siswa dalam melakukan pengamatan, yaitu membantu siswa mendefinisiskan permasalahan, mengorganisasikan tugas belajar serta meminta siswa untuk berbagi tugas dalam penyeleaian masalah. (3) Membimbing siswa dalam melakukan pengamatan atau investigasi, proses dimana penyelesaian masalah dilakukan. (4) Mengembangkan dan menyajikan hasil karya atau presentasi hasil kerja siswa, dilakukan dari satu kelompok ke kelompok lain.(5) Melakukan analisa dan evaluasi proses penyelsaian masalah. Pembelajaran dilakukan dengan berkelompok. Penerapan pembelajaran berbasis masalah menunjukkan hasil yang positif, yaitu dari aktivitas siswa yang tergolong baik dan hasil nilai rata-rata kelas siswa setelah diberi tes yaitu 72,56 dan 77,16. Selain itu respon positif juga ditunjukkan siswa terhadap pembelajaran yang dilakukan. Berdasarkan hasil penelitian, disarankan sebaiknya pembelajaran berbasis masalah dapat dijadikan alternatif dalam pembelajaran karena menunjukkan hasil yang positif. Selain itu penentuan masalah yang digunakan dalam pembelajaran sangat menentukan keterlaksanaan pembelajaran.

Evaluasi pelaksanaan RDTRK (1995-2009) di Kota Tulungagung / Neni Wahyuningtyas

 

ABSTRAK Wahyuningtyas, Neni. 2009. Evaluasi Pelaksanaan RDTRK (1995-2009) di Kota Tulungagung. Skripsi, Jurusan Pendidikan Geografi FMIPA UM. Pembimbing (1) Drs. Didik Taryana, M. Si, (II) Prof. Dr. Sumarmi, M. Pd. Kata Kunci: RDTRK, kota Tulungagung, evaluasi. Penataan ruang merupakan salah satu aspek yang semakin penting dalam kegiatan pembangunan daerah sebagai alat pengendali pembangunan fisik kota (lewat perijinan lokasi dan ijin mendirikan bangunan). Hal ini terjadi karena berbagai permasalahan yang timbul di daerah dan menuntut penyelesaian dari segi penataan ruang. Selain itu, semakin disadari bahwa pembangunan yang terarah lokasinya akan memberikan hasil yang lebih besar secara keseluruhan. Untuk itu berbagai usaha telah dilakukan oleh Pemerintah Daerah untuk menata ruang secara lebih intensif. Wilayah kota termasuk wilayah yang mempunyai perkembangan yang relatif pesat. Oleh karena itu perlu dilakukan pemantauan dan evaluasi terhadap perkembangan kota, agar perkembangan yang terjadi dapat lebih terarah. Penelitian ini bertujuan (1) mengevaluasi kesesuaian pelaksanaan pembangunan fisik kota dan fungsinya di Kota Tulungagung berdasarkan RDTRK 1995-2009, (2) mengetahui faktor-faktor penyebab penyimpangan pelaksanaan pembangunan fisik kota dan fungsinya di Kota Tulungagung sekarang dengan RDTRK 1995-2009. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Adapun prosesnya dengan mengumpulkan data sekunder yang berupa peta RDTRK Tulungagung tahun 1995-2009 skala 1:5000 dan data primer berupa peta penggunaan lahan dengan skala 1:5000. Hasil penyimpangan diperoleh dengan overlay antara peta RDTRK dengan peta eksisting dibuat bedasarkan hasil observasi dan pengukuran di lapangan, sedangkan alasan penyimpangan diperoleh dari hasil wawancara dengan pemilik lahan maupun pihak yang terkait seperti BAPPEDA, Dinas Tata Kota, BPN. Hasil penelitian menunjukkan pelaksanaan pembangunan fisik dan fungsi di kota Tulungagung mengalami penyimpangan seluas 353 Ha atau 19,13% dari luas keseluruhan 1.845,5 Ha dengan penyimpangan terbesar yaitu kawasan perdagangan dan jasa menjadi pemukiman (141 Ha). Dengan kata lain pelaksanaan pembangunan fisik dan fungsi di kota Tulungagung belum sesuai dengan rencana tata ruang yang ditetapkan dan tidak harus merevisi sebagian dari rencana tata ruang yang ada. Adapun penyebab penyimpangan penggunaan lahan adalah kurangnya pengetahuan masyarakat terhadap rencana penggunaan lahan sebagai akibat kurangnya sosialisasi dari instansi terkait, perilaku masyarakat yang membangun tanpa melalui proses permohonan IMB yang sesuai prosedurnya. Berdasarkan hasil penelitian, dapat disarankan perlu adanya penertiban lewat jalur IMB yang sesuai prosedur terhadap pelaksanaan pembangunan, penyusunan RDTRK harus melibatkan masyarakat melalui aspirasi mereka yang diwakilkan DPRD dan perlu dukungan dari perangkat hukum yang tegas guna menindak pelanggaran yang terjadi.

Studi tentang pelaksanaan program kerja UKS di SDN Panggungrejo 04 Kepanjen sebagai juara harapan 1 lomba UKS tingkat propinsi tahun 2008 / Wahyu Pujianto

 

ABSTRAK Pujianto, Wahyu.2009. Studi tentang Pelaksanaan Program Kerja UKS di SDN Panggungrejo 04 sebagai Juara Harapan I Lomba UKS Tingkat Propinsi Tahun 2008. Skripsi. Program Studi Pendidikan Jasmani dan Kesehatan Fakultas Ilmu Keolahragaan Universitas Negeri Malang. Pembimbing (I) Drs. Mulyani Surendra, M.S, (II) dr. Hartati Eko Wardani, M.Si.Med. Kata kunci: pelaksanaan, program kerja Usaha Kesehatan Sekolah. Kesehatan merupakan salah satu hal sangat dibutuhkan dalam kehidupan manusia, sehat merupakan modal utama untuk meningkatkan sumber daya manusia yang berkualitas, produktif dan mempunyai etos kerja yang tinggi. Salah satu upaya pemerintah adalah memasukkan pendidikan kesehatan di sekolah, mulai dari tingkat dasar sampai tingkat lanjutan dengan membentuk kebiasaan hidup sehat para siswa melalui kegiatan Usaha Kesehatan Sekolah (UKS). UKS yang baik diawali dengan perencanaan, pengorganisasian, pelaksanaan, dan evaluasi. Jika salah satu program tidak terlaksana maka akan mempengaruhi program yang lainnya. Program kerja UKS meliputi pendidikan kesehatan, pelayanan kesehatan dan pembinaan lingkungan sekolah sehat. Agar kegiatan UKS tetap terlaksana, maka diadakanlah lomba UKS. Tujuan diadakannya penelitian ini secara umum yaitu untuk mengetahui pelaksanaan program kerja UKS di SDN Panggungrejo 04 Kepanjen, sedangkan secara khusus yaitu untuk mengetahui pelaksanaan program pendidikan kesehatan di SDN Panggungrejo 04 Kepanjen, untuk mengetahui pelaksanaan program pelayanan kesehatan di SDN Panggungrejo 04 Kepanjen dan untuk mengetahui pelaksanaan program pembinaan lingkungansekolah sehat di SDN Panggungrejo 04 Kepanjen. Penelitian ini tergolong jenis penelitian deskriftif kuantitatif karena hasilnya berupa angka-angka yang menggambarkan terlaksananya program kerja UKS ataukah tidak. Penelitian ini dilaksanakan di SDN Panggungrejo 04 Kepanjen pada bulan Juni 2009, dengan responden: 8 pembina UKS, 50 anggota Kader Tiwisada dan 38 siswa. Untuk mendapatkan data maka penelitian ini menggunakan instrumen dalam bentuk angket. Untuk menarik kesimpulan penelitian maka data yang telah terkumpul dianalisis dengan menggunakan teknik analisis persentase Berdasarkan hasil penelitian dapat ditarik kesimpulan bahwa pelaksanaan program UKS di SDN Panggungrejo 04 Kepanjen secara umum termasuk kategori baik, sedangkan pelaksanaan program UKS di SDN Panggungrejo 04 Kepanjen secara khusus yaitu pendidikan kesehatan termasuk kategori baik, pelayanan kesehatan termasuk kategori baik dan pembinaan lingkungan sekolah sehat termasuk dalam kategori baik. Dengan diketahuinya hasil penelitian ini maka peneliti menyarankan kepada pembina UKS, anggota Kader Tiwisada dan siswa di SDN Panggungrejo 04 Kepanjen untuk lebih meningkatkan pelaksanaan program kerja UKS melalui pengembangan program kerja UKS agar menjadi lebih baik, dan melaksanakan program-program kerja UKS yang masih belum terlaksana agar di tahun-tahun berikutnya tetap bisa mengikuti lomba UKS baik di tingkat Kabupaten, Propinsi bahkan Nasional.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 |