Laporan study exurci boma stork Pasuruan,Prosida Jember, pabrik kertas Basuki Rahmat Banyuwangi
disusun oleh Mugianto

 

Hubungan kemampuan hasil belajar dengan pemanfaatan hasil belajar calistung dalam kehidupan sehari-hari oleh warga belajar keaksaraan dasar di Labsite UPT SKB Gudo Kabupaten Jombang / Era Dewanti Saputri

 

ABSTRAK Saputri, Era Dewanti.HubunganHasilBelajarCalistungdenganPemanfaatandalamKehidupanSehari-hariolehWargaBelajarKeaksaraanDasardiLabsiteUPTD SKB GudoKabupatenJombang.Skripsi, JurusanPendidikanLuarSekolah, FakultasIlmuPendidikan, UniversitasNegeri Malang. Pembimbing: (1) Dr. Hardika, M.Pd, (2) Drs. Nurhadi, M.Pd. Kata Kunci: kemampuan, pemanfaatanhasilbelajar, keaksaraandasar Penelitiankemampuanhasilbelajarcalistungdenganpemanfaatanhasilbelajardalamkehidupansehari-hariolehwargabelajarkeaksaraandasardi labsite UPTD SKB GudoKabupatenJombangdilakukanuntukmengetahuihubunganhasilpembelajarankeaksaraandasardenganpemanfaatanhasilbelajar.Keaksaraandasarmerupakanpembelajarantingkatawalyaitucalistungatausingkatandarimembaca, menulis, danberhitung. Penelitianinibertujuanuntukmendeskripsikan (1) kemampuanhasilbelajarcalistung, (2) pemanfaatanhasilcalistung, dan (3) hubunganantarakemampuanhasilbelajarcalistungdenganpemanfaatanhasilbelajarcalistung. Populasidansampeldalampenelitianiniadalahwargabelajar program keaksaraanfungsionaltingkatdasar yang berjumlah 40 orang.Instrumen yang digunakanadalahdokumenpribadidanangket, teknikanalisis data yang digunakanadalahprosentasedankorelasi yang diolahmenggunakankomputer program SPSS. Hasilanalisismenunjukkanbahwa (1) kemampuanhasilbelajarcalistung yang dimilikiwargabelajarkeaksaraandasarinidalamtingkatansangatbaiksejumlah45% (2) pemanfaatanhasilbelajarcalistungwargabelajarmenyatakankadang-kadangdimanfaatkansejumlah55%, dan (3) terdapathubungan yang signifikanantarakemampuanhasilbelajardengan pemanfaatan hasilbelajarcalistungdalamkehidupansehari-haridikarenakan0,550 > 0,05 maka Ha diterimadan Ho ditolak yang berartiadanyahubunganantarakemampuanhasilbelajarcalistungdenganpemanfaatanhasilbelajarcalistungdalamkehidupansehari-hariolehwargabelajarKeaksaraanDasar di UPTD SKB GudoKabupatenJombang. Saran ditujukan (1) bagiwargabelajarKeaksaraanFungsional Tingkat Dasar UPTD SKB GudoJombanguntukterusmelanjutkankegiatanmembacamenulisdanberhitungwalaupunsudahmendapatkan SUKMA, (3) bagipenyelenggara program keaksaraandasarhendaknyamemberikanbimbingankepada tutor maupunwargabelajar, agar terusmengikutipendidikankeaksaraantingkatlanjutuntukbekalpendidikansepanjanghayatnya, (4) bagipenelitiselanjutnya yang mengembangkanpenelitiansejenishendaknyadikembangkandenganruanglingkup yang lebihluasbaik variable ataupunpopulasinyademikiandapatdijadikanacuanpenelitidimasa yang akandatang, (5) bagijurusanPendidikanLuarSekolahhasilpenelitianinidapatdijadikankontibusidalampengembanganpembelajaranfungsional.

Laporan kerja praktek pembengunan/perliasan wisma proyek Brantas jalan besar Ijen 52 Malang
disusun oleh Moch. Hasan

 

Pengaruh atribut produk terhadap loyalitas pelanggan melalui citra merek dan keputusan pembelian (studi pada santri pengguna laptop di Pesantren Mahasiswa Al-Hikam Malang) / Fahrurrozi Rahman

 

ABSTRAK Rahman, Fahrurrozi. 2015. Pengaruh Atribut Produk Terhadap Loyalitas Pelanggan Melalui Citra Merek Dan Keputusan Pembelian (Studi Pada Santri Pengguna Laptop Di Pesantren Mahasiswa Al-Hikam Malang). Tesis. Program Studi Manajemen, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Ery Tri Djatmika R.W.W., M.A., M.Si, (II) Dr. I Wayan Jaman Adi Putra, M.Si. Kata Kunci: Loyalitas Pelanggan, Citra Merek, Keputusan Pembelian, Atribut Produk. Dewasa ini tingkat persaingan antara perusahaan satu dengan yang lainnya semakin ketat. Hal ini disebabkan banyaknya perusahaan yang ada serta munculnya produk-produk baru yang beredar di pasaran. Kondisi ini membuat perusahaan berlomba-lomba untuk dapat memasarkan produknya agar mendapat pangsa pasar yang besar sehingga dapat memenangkan persaingan. Atribut produk merupakan salah satu hal penting yang perlu diperhatikan oleh perusahaan. Tujuan penelitian ini adalah 1) mengetahui pengaruh atribut produk terhadap loyalitas pelanggan melalui citra merek; 2) mengetahui pengaruh atribut produk terhadap loyalitas pelanggan melalui keputusan pembelian; 3) mengetahui pengaruh citra merek terhadap loyalitas pelanggan melalui keputusan pembelian; 4) mengetahui pengaruh atribut produk terhadap keputusan pembelian melalui citra merek. Penelitian ini menggunakan pendekatan kuantitatif dan teknik pengujianya menggunakan analisis jalur (path analysis). Pengujian ini bertujuan untuk mengetahui hubungan kausal secara langsung dan tidak langsung seperangkat variabel bebas (eksogen) terhadap variabel terikat (endogen). Instrumen yang digunakan peneliti adalah kuesioner. Populasi dalam penelitian ini adalah Santri Pesantren Mahasiswa Al-Hikam Malang yang menggunakan produk Laptop Acer, Toshiba dan Asus selama 2 tahun berturut-turut (kelas II, III dan kelas IV akhir) yang berjumlah 109 santri. Pengambilan sampel menggunakan teknik proportional random sampling dan diperoleh sampel penelitian sebesar 85 responden. Hasil penelitian menunjukkan bahwa 1) citra merek tidak memediasi pengaruh atribut produk terhadap loyalitas pelanggan, dalam hal ini atribut produk berpengaruh positif signifikan terhadap citra merek dan loyalitas pelanggan, namun citra merek tidak berpengaruh terhadap loyalitas pelanggan, 2) keputusan pembelian tidak memediasi pengaruh atribut produk terhadap loyalitas pelanggan, dalam hal ini atribut produk berpengaruh positif signifikan terhadap keputusan pembelian dan loyalitas pelanggan, namun keputusan pembelian tidak berpengaruh terhadap loyalitas pelanggan, 3) keputusan pembelian tidak memediasi pengaruh citra merek terhadap loyalitas pelanggan, 4) citra merek memediasi pengaruh atribut produk terhadap keputusan pembelian.

Pengembangan komik sebagai media informasi bahaya merokok bagi siswa SMP / Sri Wahyuni

 

Kata kunci : pengembangan, komik, informasi bahaya merokok. Keberadaan rokok menjadi dilema bagi bangsa Indonesia, di satu sisi mendatangkan dampak positif, dan di sisi lain menimbulkan dampak negatif. Perokok bukannya tidak tahu mengenai dampak negatif merokok, karena dampak negatif merokok telah dicantumkan secara jelas di setiap bungkus rokok. Hampir seluruh tingkatan usia dapat mengkonsumsi rokok, mulai dari anak-anak hingga lanjut usia, termasuk siswa SMP. Oleh karena itu dalam upaya pembentukan generasi muda yang sehat jasmani maupun rohani, dikembangkanlah komik sebagai media informasi bahaya merokok bagi siswa SMP. Komik dipilih sebagai media karena bacaan ini bersifat ringan, imajinatif, menyenangkan, dan disukai oleh siswa. Dengan media ini, pesan bimbingan yang ingin disampaikan diharapkan dapat diterima oleh siswa. Konselor dapat menggunakan komik sebagai alternatif media dalam pelaksanaan layanan informasi, sehingga bimbingan dapat terlaksana secara efektif. Tujuan pengembangan ini adalah untuk menghasilkan Komik Bahaya Merokok yang berguna, tepat, jelas, dan menarik bagi siswa SMP. Penelitian ini merupakan penelitian pengembangan yang mengadaptasi langkah-langkah pengembangan dari Borg & Gall (1989) yang terdiri dari tahap perencanaan, tahap penyusunan produk, dan tahap validasi. Subyek uji coba adalah ahli media, ahli bimbingan konseling, dan calon pengguna produk. Data dikumpulkan menggunakan format penilaian ahli dan calon pengguna produk. Data kuantitatif dianalisis dengan analisis rerata, dan data kualitatif dianalisis dengan analisis deskriptif. Produk pengembangan ini telah dinilai oleh dua ahli dan dua calon pengguna produk. Secara kuantitatif, hasil penilaian dari para ahli untuk spesifikasi produk memperoleh nilai rerata 3,26 yang berarti produk ini sangat berguna, tepat, jelas, efektif, terlaksana, dan menarik. Sedangkan untuk penilaian terhadap pedoman pelaksanaan layanan informasi memperoleh nilai rerata 3,12 yang berarti buku pedoman pelaksanaan layanan informasi ini sangat jelas sehingga mudah dilaksanakan. Dengan demikian menurut para ahli, komik dapat digunakan sebagai media dalam pelaksanaan layanan informasi bahaya merokok bagi siswa SMP. Selanjutnya, hasil penilaian dari calon pengguna produk untuk spesifikasi produk memperoleh nilai rerata 3,37 yang berarti produk ini sangat berguna, tepat, jelas, efektif, terlaksana, dan menarik. Sedangkan untuk penilaian terhadap pedoman pelaksanaan layanan informasi memperoleh nilai rerata 3,21 yang berarti buku pedoman pelaksanaan layanan informasi ini sangat jelas sehingga mudah dilaksanakan. sesuai dengan tahap-tahap pelaksanaannya. Dengan demikian menurut para calon pengguna produk, komik dapat digunakan sebagai media dalam pelaksanaan layanan informasi bahaya merokok bagi siswa SMP. Berdasarkan hasil penilaian ahli dan calon pengguna produk, dapat disimpulkan produk yang dihasilkan dari pengembangan ini yang berupa buku pedoman pelaksanaan layanan informasi bahaya merokok dengan menggunakan media komik, dan komik bahaya merokok untuk siswa SMP dapat diterima (acceptable) secara teoritis. ( Word to PDF Converter - Unregistered ) http://www.Word-to-PDF-Converter.net Berdasarkan hasil penelitian tersebut, maka saran yang diberikan adalah konselor harus memahami prosedur dan materi bimbingan sehingga proses bimbingan dapat berjalan secara efektif dan siswa dapat mencapai tujuan bimbingan yang dikehendaki. Selain itu, konselor harus kreatif dalam mengatur waktu untuk pelaksanaan bimbingan, mengingat minimnya jam tatap muka untuk bimbingan dan konseling di sekolah. Bagi peneliti selanjutnya, perlu diadakan uji lapangan yang melibatkan siswa, agar diketahui keberterimaan produk secara teoritis dan praktis.

Laporan praktek otomotif III
oleh Isman

 

Penerapan metode simulasi untuk meningkatkan motivasi dan hasil belajar biologi siswa kelas XI IPA MAN Kebonsari Mojoagung Jombang / Mukhlisotur Roudloh

 

Kata Kunci : metode simulasi, hasil belajar, motivasi belajar Berdasarkan hasil observasi yang dilakukan pada bulan Nopember 2009 di MAN Kebonsari Mojoagung Jombang, diketahui bahwa metode pembelajaran yang sering digunakan adalah ceramah, diskusi kelas, dan praktikum. Metode tersebut belum sepenuhnya dapat mengaktifkan siswa secara keseluruhan. Guru jarang menggunakan metode lain yang lebih dapat mengaktifkan siswa. Rendahnya motivasi juga berdampak pada rendahnya hasil belajar. Nilai Ujian Akhir Semester Ganjil Tahun Pelajaran 2009-2010 menunjukkan hanya 3 siswa yang tuntas belajar. Untuk mengatasi masalah tersebut diperlukan metode yang dapat meningkatkan motivasi belajar siswa sehingga akan dapat meningkatkan hasil belajar. Salah satu metode yang dapat mengaktifkan siswa adalah metode simulasi. Metode simulasi adalah suatu metode pembelajaran dimana siswa mempelajari suatu fakta, konsep atau prinsip melalui kegiatan bermain peran. Penelitian ini bertujuan untuk meningkatkan motivasi dan hasil belajar (kognitif, afektif dan psikomotor) siswa kelas XI IPA MAN Kebonsari Mojoagung Jombang. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang dilaksanakan dalam dua siklus. Masing-masing siklus terdiri dari 2 pertemuan. Subyek penelitian ini adalah siswa kelas XI IPA MAN Kebonsari Mojoagung Jombang Semester Genap Tahun Pelajaran 2009-2010 berjumlah 24 orang. Hasil belajar kognitif diukur dari peningkatan rata-rata skor tes dan persentase ketuntasan belajar klasikal; motivasi dan hasil belajar afektif siswa diukur dari peningkatan persentase klasikal yang diperoleh dari angket; hasil belajar psikomotor diperoleh dari persentase klasikal yang diperoleh dari hasil observasi. Hasil penelitian menunjukkan bahwa penerapan metode simulasi dapat meningkatkan motivasi dan hasil belajar siswa. Motivasi belajar siswa pada siklus I sebesar 79% (baik) menjadi 85% (sangat baik) pada siklus II. Hasil belajar kognitif siklus I sebesar 76,79 dengan persentase klasikal 58,33% (kurang baik) menjadi 82,04 dengan persentase klasikal 91,67% (sangat baik) pada siklus II, hasil belajar afektif siswa pada siklus I sebesar 64% (baik) menjadi 78% (baik) pada siklus II, hasil belajar psikomotor siswa pada siklus I sebesar 63% (baik) menjadi 90% (sangat baik) pada siklus II.

Laporan praktek kerja mekanis di workshop PT Rothmas of Spall Mall Indonesia Malang 8 Juni s.d. 4 Agustus 1987
oleh Toton Rachmanto

 

Hubungan antara kematangan emosi dengan prestasi belajar praktikum siswa kelas X Jurusan Teknik Mesin di SMK Nasional Malang / Abdul Rochim

 

Kata Kunci: Kematangan emosi, Prestasi belajar praktikum siswa SMK Seiring dengan perkembangan jaman, maka perkembangan ilmu pengetahuan dan teknologi akan semakin berkembang. Pendidikan memiliki peranan penting dalam memperbaiki mutu sumber daya manusia dan kemajuan suatu bangsa hanya bisa dicapai melalui penataan pendidikan yang baik. Upaya peningkatan mutu pendidikan diharapkan dapat meningkatkan harkat serta martabat manusia Indonesia. Keberhasilan belajar di sekolah biasanya ditunjukkan dari prestasi yang membanggakan. Berhasil baik atau tidaknya belajar, tergantung kepada bermacam-macam faktor. Adapun faktor-faktor itu dapat dibedakan menjadi dua golongan yaitu faktor internal dan faktor eksternal. Permasalahan yang dikaji dalam penelitian ini adalah (1) bagaimana tingkat kematangan emosi siswa kelas X Jurusan Teknik Mesin di SMK Nasional Malang, (2) bagaimana prestasi belajar praktikum siswa kelas X Jurusan Teknik Mesin di SMK Nasional Malang, dan (3) apakah ada hubungan yang signifikan antara kematangan emosi dengan prestasi belajar praktikum siswa kelas X Jurusan Teknik Mesin Di SMK Nasional Malang Subjek dalam penelitian ini berjumlah 87 orang. Variabel yang dikaji dalam penelitian ini adalah kematangan emosi (X), dan prestasi belajar (Y). Alat pengumpulan data yang digunakan adalah angket, dan dokumentasi. Data yang dikumpulkan dianalisis dengan teknik persentase dan analisis regresi sederhana. Hasil penelitian ini menunjukkan bahwa dari 87 subyek penelitian terdapat 16 responden atau 18,39% yang mempunyai tingkat kematangan emosi dalam kategori sangat matang, 41responden atau 47,2% yang mempunyai tingkat kematangan emosi dalam kategori matang, 26 responden atau 29,9% yang mempunyai kematangan emosi kategori kurang matang, sedangkan responden yang mempunyai kematangan emosi kategori tidak matang berjumlah 4 responden atau 4,59%. Sedangkan untuk prestasi belajar, menunjukkan bahwa 74 siswa atau 85% mempunyai prestasi cukup baik, 6 responden atau 6,9% mempunyai prestasi baik, sedangkan responden yang mempunyai prestasi sangat baik sebanyak 7 responden atau 8,1%. Berdasarkan hasil uji parsial untuk variabel kematangan emosi (X) diperoleh thitung = 22,176 dengan sigifikansi sebesar 0,000 < 0,05. Hal ini berarti bahwa kematangan emosi merupakan faktor yang signifikan berpengaruh terhadap prestasi belajar praktikum siswa kelas X jurusan teknik mesin SMK Nasional Malang. Dilihat dari koefisien beta sebesar 0,853 menunjukkan bahwa kontribusi variabel kematangan emosi terhadap prestasi belajar mencapai 85,3%. Dengan demikian terbukti bahwa asumsi dalam penelitian ini ada hubungan yang signifikan antara kematangan emosi ii dengan prestasi belajar praktikum siswa kelas X jurusan teknik mesin di SMK Nasional Malang. Berdasarkan hasil penelitian ini, dapat disarankan hendaknya pihak sekolah memperhatikan kondisi psikologi siswa khususnya masalah kematangan emosi siswa, untuk memacu prestasinya, sehingga menghasilkan lulusan berkualitas baik dalam aspek kognitif, afektif, dan psikomotorik.

Perbedaan hasil belajar kognitif dan motivasi belajar antara siswa yang dibelajarkan dengan model pembelajaran cooperative learning tipe Two Stay Two Stray (TSTS) dan ekspositori pada materi larutan penyangga / Dyas Anggraini Paramutika

 

ABSTRAK Paramutika, Dyas A. 2015. Perbedaan Hasil Belajar Kognitif dan Motivasi Belajar antara Siswa yang Dibelajarkan dengan Model Pembelajaran Cooperative Learning Tipe TSTS (Two Stay Two Stray) dan Ekspositori pada Materi Larutan Penyangga. Skripsi, Jurusan Kimia, FMIPA Universitas Negeri Malang. Pembimbing: (I) Prof. Dra. Srini M. Iskandar, M.Sc., Ph.D. (II) Dr. Suharti, S.Pd., M.Si. Kata Kunci: hasil belajar kognitif, motivasi belajar, Two Stay Two Stray (TSTS), Larutan Penyangga Model pembelajaran ekspositori dengan menggunakan metode ceramah yang diterapkan dalam pembelajaran materi larutan penyangga di sekolah belum mencapai hasil yang maksimal. Hal ini terbukti dari hasil wawancara yang dilakukan, yaitu sebanyak 50% siswa memiliki nilai hasil belajar di bawah KKM. Oleh karena itu perlu dilakukan upaya modifikasi model pembelajaran yang dapat meningkatkan keterlibatan aktif siswa dalam proses pembelajaran. Salah satu model pembelajaran yang dapat dipilih adalah model pembelajaran kooperatif tipe Two Stay Two Stray (TSTS). Tujuan penelitian ini adalah untuk mengetahui: keterlaksanaan pembelajaran, perbedaan hasil belajar kognitif antara siswa yang dibelajarkan dengan model pembelajaran kooperatif tipe Two Stay Two Stray (TSTS) dengan model pembelajaran ekspositori, dan motivasi belajar siswa. Rancangan penelitian yang digunakan adalah Quasy Experimental post-tes only design dengan dua kelas eksperimen. Populasi penelitian adalah siswa kelas XI SMA Negeri 7 Malang tahun ajaran 2014/2015. Pengambilan sampel dalam penelitian ini menggunakan teknik cluster random sampling, didapatkan kelas XI MIA 1 sebagai kelas eksperimen yang dibelajarkan dengan model pembelajaran kooperatif tipe Two Stay two Stray (TSTS) dan kelas XI MIA 2 sebagai kelas kontrol yang dibelajarkan dengan model pembelajaran ekspositori. Instrument yang digunakan adalah berupa instrument perlakuan (silabus, RPP, handout (bahan ajar), worksheet ) dan instrument pengukuran (lembar observasi, angket motivasi belajar siswa dan tes hasil belajar). Analisis data dilakukan dengan uji t pada nilai a = 0,05 dan analisis deskriptif. Hasil penelitian menunjukkan bahwa: (1) Pembelajaran kooperatif tipe Two Stay Two Stray (TSTS) dan ekspositori terlaksana dengan sangat baik dengan rata-rata persentase keterlaksanaan RPP masing-masing adalah 92,32% dan 92,50%. (2) Ada perbedaan hasil belajar kognitif siswa yang dibelajarkan dengan model pembelajaran kooperatif tipe Two Stay Two Stray (TSTS) (rata-rata 77,88) dan yang dibelajarkan dengan model pembelajaran ekspositori (rata-rata 70,75). (3) Motivasi belajar siswa yang dibelajarkan dengan model pembelajaran kooperatif tipe Two Stay two Stray (TSTS) (rata-rata 76,3%) lebih tinggi daripada model pembelajaran ekspositori (rata-rata 73,8%).

Laporan praktek kerja di PINDA Tosana unit pabrik mesin & konstruksi Sumber Mas Malang
oleh Suradi

 

Pengaruh struktur modal (DAR, DER, dan LDER) terhadap ROE pada perusahaan manufaktur size besar dan kecil yang listing di Bursa Efek Indonesia tahun 2009 / Redy Khoirianto

 

Kata Kunci: Debt to Assets Ratio, Debt to Equity Ratio, Longterm Debt to Equity Ratio, Return On Equity, dan Size Perusahaan. Setiap perusahaan pada dasarnya didirikan untuk menghasilkan laba atau profit. Perusahaan dapat terus menjalankan kegiatan operasionalnya dan dapat bertahan dalam ketatnya persaingan, apabila perusahaan tersebut memiliki profitabilitas yang tinggi. Profitabilitas ini dicerminkan dari Return on Equity. Return on Equity menggambarkan kemampuan suatu perusahaan dengan modal sendiri yang bekerja di dalamnya untuk menghasilkan keuntungan. Apabila ROE suatu perusahaan rendah, maka kegiatan operasional perusahaan akan terganggu. Jika hal ini berlangsung terus-menerus, bukan tidak mungkin perusahaan akan mengalami kebangkrutan. Selain itu jika tingkat profitabilitas perusahaan tersebut rendah akan berpengaruh terhadap berkurangnya kepercayaan dari pihak-pihak eksternal perusahaan terutama kreditor. Tujuan penelitian ini adalah: untuk mengetahui kondisi ROE yang dicerminkan oleh DAR, DER, dan LDE, untuk mengetahui pengaruh secara simultan dan parsial variabel DAR, DER, dan LDER terhadap ROE. Data yang digunakan adalah data sekunder berupa data laporan keuangan. Populasi penelitian ini adalah laporan keuangan tahun 2009, sebanyak 118 perusahaan. Pengambilan sampel dilakukan dengan purposive kuota sampling dan dihasilkan 30 perusahaan size besar dan 30 perusahaan size kecil yang memenuhi syarat untuk ditetapkan sebagai sampel penelitian. Penggolongan sampel ke dalam size besar dan kecil berdasarkan total aktiva perusahaan. Analisis data yang digunakan adalah uji regresi linier berganda. Hasil penelitian ini menunjukkan kondisi DAR, DER, LDER, dan ROE pada perusahaan size besar dan kecil berklasifikasi rendah. Untuk perusahaan size besar, secara parsial Debt to Assets Ratio (DAR) tidak berpengaruh signifikan terhadap ROE, sedangkan Debt To Equity Ratio (DER), dan Long Term Debt To Equity Ratio (LDER) berpengaruh signifikan terhadap ROE. Secara simultan Debt to Assets Ratio (DAR), Debt To Equity Ratio (DER), dan Long Term Debt To Equity Ratio (LDER) berpengaruh signifikan terhadap ROE. Untuk perusahaan size kecil, secara parsial Debt to Assets Ratio (DAR), Debt To Equity Ratio (DER), dan Long Term Debt To Equity Ratio (LDER) tidak berpengaruh signifikan terhadap ROE. Secara simultan Debt to Assets Ratio (DAR), Debt To Equity Ratio (DER), dan Long Term Debt To Equity Ratio (LDER) tidak berpengaruh signifikan terhadap ROE. Berdasarkan hasil penelitian, dapat disarankan bagi perusahaan size besar lebih mengefektifkan hutang yang akan mereka gunakan karena dengan mengefektifkan hutang akan memperbesar ROE perusahaan. Untuk perusahaan size kecil diharapkan dapat menciptakan kombinasi yang menguntungkan antara penggunaan sumber dana dari ekuitas dengan dana yang berasal dari hutang, sehingga kedepannya akan dicapai laba yang maksimal. Bagi kreditor yang akan mengambil keputusan berinvestasi dan rasio ROE yang dijadikan pertimbangan, dapat melihat rasio DAR, DER, dan LDER sebagai bahan pertimbangan. Hal ini hanya berlaku untuk perusahaan size besar, tapi untuk perusahaan size kecil tidak berlaku. Untuk perusahaan size kecil menggunakan rasio selain DAR, DER, dan LDER untuk pertimbangan rasio ROE. Bagi penelitian selanjutnya sebaiknya menambah variabel-variabel lain yang potensial dalam memberikan kontribusi terhadap perubahan variabel ROE. Selain itu, dapat juga menggunakan sampel perusahaan sektor usaha tertentu dan menambah periode observasi sehingga dapat memberikan hasil yang lebih signifikan.

Laporan kerja praktek di perusahaan daerah Aneka Jasa dan Permesinan unit Sumber Mas Malang
disusun oleh Muhammad Agus Salim

 

Analisis faktor-faktor yang mempengaruhi perkembangan industri batik Madura di Pamekasan (studi kasus pada industri batik di Dusun Banyumas, Desa Klampar, Kecamatan Proppo, Kabupaten Pamekasan) / Nunun Tis' Aini

 

Kata Kunci: Batik Madura, modal, pemasaran, SDM, kewirausahaan Industri tekstil merupakan industri yang menyerap tenaga kerja yang cukup besar serta mempunyai kontribusi terhadap perekonomian nasional. Pada 2 Oktober 2009 Batik diakui oleh UNESCO sebagai kekayaan budaya dunia (world cultural heritage) sehingga industri batik di seluruh tanah air mulai dilirik dan mendapat perhatian dari pemerintah. Begitu juga pada industri batik Madura khususnya di Pamekasan. Batik dijadikan sebagai icon Kabupaten Pamekasan sehingga dicanangkan “Pamekasan Kota Batik”. Sebagai langkah selanjutnya untuk mengembangkan industri batik di Pamekasan, Pemerintah Kabupaten Pamekasan bekerjasama dengan pihak-pihak lainnya melakukan pemberdayaan home industri untuk industri batik khususnya batik tulis di Pamekasan yang meliputi aspek permodalan, pemasaran, SDM, dan kewirausahaan. Masalah dalam penelitian ini adalah (1) Faktor-faktor apakah yang mempengaruhi perkembangan industri batik Madura di Desa Klampar, Kecamatan Proppo, Kabupaten Pamekasan ? (2) Bagaimana usaha pemerintah dalam mengembangkan industri batik di wilayah Pamekasan? Sedangkan tujuan dari penelitian ini adalah (1) untuk menganalisis faktor-faktor yang mempengaruhi perkembangan industri batik Madura di Desa Klampar, Kecamatan Proppo, Kabupaten Pamekasan, (2) untuk mengetahui peran serta pemerintah dalam mengembangkan industri batik di wilayah Pamekasan. Penelitian ini menggunakan pendekatan deskriptif kualitatif untuk lebih dalam menjelaskan perkembangan industri batik Madura di Desa Klampar, Kecamatan Proppo, Kabupaten Pamekasan melalui analisis keempat faktor utama yaitu modal, pemasaran, SDM, dan kewirausahaan dan serta kebijakan pemerintah di dalam perkembangan industri batik di Pamekasan. Teknik pengumpulan data menggunakan teknik wawancara, dokumentasi, dan observasi, data dengan jalan mencatat, merekam, mengumpulkan, wawancara yang telah diperoleh dan informasi-informasi yang telah dipublikasikan oleh instansi-instansi terkait. Sedangkan analisis data menggunakan analisis triangulasi sumber untuk menguji kebenaran dan keabsahan data yang diperoleh untuk kemudian dianalisis dan ditarik kesimpulannya. Penelitian ini menggunakan data dari hasil wawancara dengan pengrajin batik di Desa Klampar dan pihak pemerintah yakni dengan aparatur pemerintah Kabupaten Pamekasan (Bappeda dan Disperindag) sebagai data primer, dan dokumen serta artikel dari media massa sebagai data sekunder. Berdasarkan analisis triangulasi yang digunakan, maka peneliti telah memperoleh hasil bahwa secara umum pemerintah telah membantu tumbuhnya   industri batik Madura yang terdapat di Pamekasan hanya saja masih memiliki keterbatasan khususnya dalam segi anggaran. Dalam aspek permodalan pemerintah telah memberikan bantuan berupa pinjaman dengan bunga yang rendah bagi pengrajin (tetapi tidak semua pengrajin yang mendapatkan), dalam aspek pemasaran pemerintah membantu dengan penyediaan Pasar Batik, pembangunan Pasar 17 Agustus dan promosi batik melalui pameran kebudayaan dan pameran industri, kebijakan pemakaian batik, serta penghiasan jalan dan bangunan pemerintahan dengan ornament batik, dalam aspek SDM pemerintah telah memberikan pelatihan untuk pengrajin dalam meningkatkan skill para pengrajin, dalam aspek kewirausahaan pemerintah juga telah memberikan pelatihan khususnya mengenai pengelolaan usaha kepada para pengrajin yang terpilih. Dari hasil penelitian dapat disimpulkan bahwa secara umum perkembangan industri batik di Pamekasan ini dipengaruhi oleh pengrajin batik yaitu kreatifitas pengrajin batik, produk batik Madura yang mempertahankan kualitas yang baik, dan kepedulian pengrajin untuk melestarikan batik. Selain itu, dukungan pemerintah dalam mengembangkan industri batik yang ada di Pamekasan, dalam aspek permodalan, pemasaran. SDM, dan kewirausahaan. Selain faktor yang berasal dari pelaku industri batik, terdapat faktor yang bersifat operasional yakni dalam pemasaran batik Madura telah menggunakan fasilitas internet dan pemerintah juga aktif dalam mempromosikan batik Pamekasan sehingga batik Pamekasan dikenal baik oleh masyarakat khususnya di luar Madura, untuk produksi tersedianya bahan baku membatik yang mudah diperoleh juga mendukung perkembangan industri batik di Pamekasan serta ketersediaan tenaga kerja pembatik yang banyak di Pamekasan menjadikan permintaan akan batik Pamekasan terpenuhi, dan budaya di dalam kehidupan keluarga pengrajin batik yang akan menurunkan ketrampilan dan keahlian membatiknya kepada generasi berikutnya, serta perhatian pemerintah dan budayawan dalam melestarikan dan mengembangkan kesenian batik ikut mendorong perkembangan industri batik di Pamekasan. Sedangkan saran yang dapat diberikan untuk perkembangan industri batik Madura yang terdapat di Pamekasan adalah; para pengrajin hendaknya dapat secara aktif dapat bekerjasama dengan pemerintah dan BUMN agar mendapat tambahan modal yang diperlukan untuk usahanya, para pengrajin yang telah mendapatkan kemajuan setidaknya dapat membagi pengalamannya kepada para pengrajin yang ingin mengembangkan usahanya yang masih kecil, ABBP (Asosiasi Batik dan Bordir Pamekasan) diharapkan tidak hanya mewadahi para pengrajin yang menjadi anggotanya akan tetapi juga dapat menampung aspirasi para pengrajin seluruh daerah yang terdapat di Pamekasan, pihak pemerintah hendaknya mengusahakan penetapan suatu kebijakan pemerintah atau strategi-strategi yang mempengaruhi perkembangan industri batik untuk menumbuhkembangkan perekonomian daerah, seperti misalnya menyederhanakan prosedur administrasi (birokrasi) khususnya terkait dengan pengurusan ijin usaha yang terlalu panjang, dan pemerintah juga diharapkan dapat menciptakan pasar yang menyediakan bahan baku yang dibutuhkan oleh industri batik di Pamekasan.

Laporan kerja praktek di perusahaan daerah Aneka Jasa dan Permesinan unit pabrik mesin konstruksi dan pengecoran Sumber Mas Malang
oleh Made Bambang Hariyanto

 

Pengaruh earning per share dan income smoothing terhadap harga saham pada perusahaan manufaktur yang listing di BEi tahun 2006-2008 / Herti Yesi

 

Kata Kunci: Earning Per Share, Income Smoothing, Harga Saham Saham merupakan salah satu jenis investasi yang dipilih oleh investor yang dapat memberikan berbagai penawaran dengan tingkat keuntungan yang menarik. Sebelum menentukan saham mana yang akan dipilih untuk dijadikan investasi, para investor tentunya telah mempertimbangkan berbagai aspek. Salah satunya adalah nilai laba yang terkandung dalam tiap lembar saham atau Earning Per Share (EPS). Selain itu, ada tidaknya Income Smoothing dalam penyajian laba perusahaan juga dapat digunakan sebagai bahan pertimbangan dalam melakukan investasi. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh secara parsial dan simultan antara Earning Per Share dan Income Smoothing terhadap Harga Saham pada perusahaan manufaktur yang listing di BEI tahun 2006-2008. Teknik analisis data yang digunakan adalah analisis regresi berganda dengan independen variabel adalah Earning Per Share dan Income Smoothing, sedangkan dependen variabel adalah Harga Saham. Populasi dalam penelitian ini adalah perusahaan manufaktur yang listing di BEI tahun 2006-2008, Hasil penelitian ini menunjukkan bahwa secara parsial variabel Earning Per Share berpengaruh terhadap Harga Saham, sedangkan variabel Income Smoothing tidak mempengaruhi Harga Saham. Secara simultan variabel Earning Per Share dan Income Smoothing mempunyai pengaruh terhadap Harga Saham, hal ini terlihat dari koefisien determinannya yang mampu menjelaskan keragaman dari variabel dependen Harga Saham yaitu sebesar 73 %. Berdasarkan penelitian ini maka sebaiknya perusahaan tidak melakukan perataan laba dan memberikan informasi keuangan apa adanya sesuai dengan kondisi perusahaan. Bagi investor sebaiknya memilih perusahaan yang tidak melakukan praktik perataan laba karena informasi yang diberikan lewat laporan keuangan lebih akurat.

Laporan kerja praktek di perusahaan insdustri daerah (Pinda) Tosana Pabrik mesin dan konstruksi Sumber Mas
oleh Slamet Riyadi

 

Laporan praktek kerja di PD Aneka Jasa & permesinan unit Sumber Mas Malang
disusun oleh Rusik

 

Laporan praktek kerja di perusahaan jawatan kereta api Malang - Jawa Timur
oleh Gerardus Lalu

 

Laporan kerja praktek di perusahaan daerah aneka jasa dan permesinan unit pabrik mesin konstruksi dan pengecoran sumber mas Malang
oleh Sunawi

 

Perencanaan bagian turbin uap
tugas akhir pilihan
oleh Bejo Sofianto

 

Perencanaan motor bensin empat langkah
oleh Samsu Ismail

 

Perencanaan pompa centrifugal
oleh Andoko

 

Perencanaan konstruksi kap baja
tugas
oleh Suherman

 

Perencanaan perangkat roda gigi
tugas akhir pilihan
oleh Moh. Guntur Sayekti

 

Sintesis dan karakterisasi sabun zink dari minyak jarak pagar (Jatropha curcas Linn) melalui reaksi trans-saponifikasi dengan zink sulfat / Dia Irma Indawati

 

Kata kunci: sabun zink, minyak jarak pagar, trans- saponifikasi, zink sulfat Sabun dalam kehidupan sehari-hari dikenal sebagai agen pembersih. Seiring dengan berkembang ilmu pengetahuan, berkembanglah pula konsep tentang sabun. Logam alkali yang biasanya digunakan dalam pembuatan sabun diganti dengan logam lain yaitu zink sehingga menghasilkan sabun zink. Sabun zink memiliki fungsi dan sifat yang berbeda dari sabun alkali. Pada penelitian sebelumnya telah berhasil dilakukan sintesis sabun alumunium. Keberhasilan sintesis sabun alumunium melalui reaksi trans-saponifikasi dan uji potensi sabun alumunium sebagai pengental pelumas, mendorong untuk dilakukan penelitian tentang sintesis sabun zink. Penelitian ini bertujuan untuk mensintesis sabun zink dari minyak jarak pagar dengan zink sulfat. Penelitian ini merupakan survai laboratoris dengan metode eksperimen yang dilakukan dengan 5 tahap, yaitu: (1) sintesis sabun natrium dari reaksi minyak jarak pagar dengan natrium hidroksida, (2) reaksi trans-saponifikasi sabun natrium dengan zink sulfat menghasilkan sabun zink, (3) pemurnian senyawa hasil sintesis dengan pencucian aquades berulang-ulang, (4) karakterisasi sabun zink hasil sintesis meliputi penentuan titik lebur, uji kelarutan, degradasi senyawa hasil sintesis dengan asam nitrat dan asam klorida, analisis kualitatif ion zink dan sulfat, serta analisis kuantitatif zink dan natrium dengan AAS, (5) identifikasi gugus fungsi sabun zink hasil sintesis dengan metode spektrofotometri inframerah. Hasil penelitian ini menunjukkan bahwa sabun zink dapat disintesis dari minyak jarak pagar melalui reaksi saponifikasi yang dilanjutkan dengan reaksi trans-saponifikasidengan zink sulfat. Sabun zink hasil sintesis berupa serbuk putih dengan rentang titk lebur 68,0-80,0°C, larut dalam kloroform (0,004 g/mL), benzena (0,003 g/mL),dan pernis (0017 g/mL) serta tidak larut dalam air dingin, air panas, etanol absolut, aseton, petroleum eter, n-heksana, dan oktanol. Sabun zink terdegradasi pada pH 1,2,dan 3.

Hubungan persepsi beban kerja dengan kinerja karyawan PT. Sumber Alfaria Trojaya Tbk. Cabang Malang / Lini Hindrasiwi

 

ABSTRAK Hindrasiwi, Lini. 2015.Hubungan Persepsi Beban Kerja dengan Kinerja Karyawan PT. Sumber Alfaria Trijaya Tbk, Cabang Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (I) Drs. Fattah Hidayat, S.Psi., M.Si (II) Pravissi Shanti, S.Psi., M.Psi Kata Kunci: persepsi beban kerja, kinerja karyawan, PT. SumberAlfariaTrijayaTbk, Cabang Malang. Penelitian ini didasari oleh adanya fakta di lapangan,dalammelakukanpelayanankepadapelanggan, Alfamartmemilikistandarpelayanan yang harusdilakukanolehseluruhkaryawantokoAlfamartbaikkasirataupramuniaga. Namunkenyataannyamasihadakaryawan yang tidakmelakukanstandarpelayanan yang di tetapkanolehperusahaan, tidakmenyapapelanggan yang datang, dantidakmemilikiproduct knowledge yang baik. Selainitukemundurankinerjakaryawanjugadapatdilihatdaribanyaknyakaryawan yang absendaritugasnya dan meningkatnya turnover.Oleh karena itu penelitian ini bertujuan untuk mengetahui hubungan antara persepsi beban kerja dengan kinerja karyawan PT. SumberAlfariaTrijaya Tbk, Cabang Malang. Penelitianinimenggunakanpendekatankuantitatifdenganrancangandeskriptifdankorelasional.Populasisebanyak 342 karyawan dengan jumlah sampel 172 karyawan. Teknik sampling yang digunakan adalah sampling insidental. Menggunakan instrumen penelitian skala persepsi beban kerja dengan reliabilitas 0,944 dan data sekunder berupa penilaian kinerja karyawan PT. Sumber Alfaria Trijaya Tbk, Cabang Malang. Hasil penelitian menunjukkan bahwa karyawan yang memiliki persepsi beban kerja tinggi 52% dan karyawan yang memiliki persepsi beban kerja rendah 48%. Karyawan yang memiliki kinerja tinggi 47% dan karyawan yang memiliki kinerja rendah 53%. Terdapat hubungan negatif signifikan antara persepsi beban kerja dengan kinerja karyawan dengan angka korelasi -0,650 dan p<0,05. Karyawandiharapkanuntukbisamembuatprioritasdalambekerja, dan mengasahlagikemampuan yang dibutuhkansepertimemahamimanajemen waktu, standarpelayanan, mengetahuihandling complain, sertamemilikiproduct knowledge yang baiksehinggakinerjakaryawanakanmeningkat. Pimpinandiharapkandapatmemberikanmotivasidanpelatihan, sepertipelatihanmanajemenwaktu, handling complain, danproduct knowledge, sehinggakaryawanmemilikipengetahuan yang lebihdandapatmeningkatkankemampuankaryawandalammenjalankanpekerjaannya.Penelitianselanjutnya, dapatmenambahjumlahsampel agar sampellebihrefresentatiflagi. Kemudianbagipeneliti yang inginmengetahuilebihdalamtentangvariabelkinerjakaryawan, mungkindapatmenambahvariabelselainpersepsibebankerja, sepertimotivasi, kesediaan, harapanimbalan, kemampuan, lingkungan, dankepuasankerja.

Perancangan katalog kebaya modern melalui penerapan fotografi desain sebagai media promosi "Laras Salon dan Butik" Malang / Jati Prianggoro

 

Kata kunci: Perancangan, Promosi, Katalog, Kebaya Modern, Fotografi, Laras Salon dan Butik. Indonesia memiliki kekayaan seni dan budaya yang beragam. Salah satu kebudayaan Nasional yang terkenal adalah pakaian tradisionalnya, yakni Kebaya. Seiring perkembangan waktu dan teknologi, kebaya kini hadir dengan memadukan unsur Barat dalam desainnya dan sering disebut sebagai kebaya Modern. Salah satu butik yang memproduksi kebaya modern di Kota Malang adalah Laras Salon dan Butik. Laras Salon dan Butik membutuhkan suatu media promosi untuk memasarkan kebaya produksinya. Perancangan ini bertujuan untuk menghasilkan suatu rancangan media promosi berbentuk katalog untuk memperkenalkan dan memasarkan kebaya modern produksi Laras Salon dan Butik. Katalog yang dirancang berbasis pada ilustrasi fotografi. Ilustrasi jenis ini digunakan agar mampu menampilkan produk secara lebih nyata dan menampakkan detail-detail dari setiap kebaya. Teknik fotografi yang digunakan adalah teknik fotografi indoor, disesuaikan dengan kebutuhan dan konsep lighting fashion. Perancangan katalog kebaya modern untuk Laras Salon dan Butik ini menggunakan model perancangan deskriptif. Model perancangan tersebut diterapkan dimulai dari penulisan mengenai permasalahan pokok yang menjadi latar belakang perancangan sampai dengan hasil desain media secara prosedural, untuk menghasilkan desain yang baik, artinya desain yang efektif, efisien, estetik dan tepat sasaran. Dalam perancangan ini menghasilkan sebuah katalog kebaya modern berupa media cetak dengan dimensi 21 x 29,7 cm portait, menggunakan teknik fotografis dan pencahayaan yang mampu menampilkan detail-detail kebaya. Warna yang digunakan dalam perancangan ini adalah warna-warna yang mewakili ciri khas Laras Salon dan Butik yaitu warna hitam, merah, dan putih. Media pendukung yang dihasilkan adalah pertama poster dengan ukuran 160 x 60 cm berjumlah 4 buah. Kedua adalah brosur memiliki ukuran A4 (21x 27,9 cm), berbahan artpaper 150 gram dan dilipat menjadi 3 bagian. Bagian depan brosur menampilkan visual model dengan kebaya modern, pada bagian dalam ditampilkan beberapa jenis kebaya produksi Laras Salon dan Butik, sedangkan bagian belakang berisi informasi lokasi dan contact person Laras Salon dan Butik. Ketiga adalah kemasan produk berupa kotak kebaya memiliki dimensi 37 x 26 x 6,5 cm, bagian tutup dibuat terdiri dari 2 bagian dan saat ditutup akan membentuk garis emas. Kemasan ini didesain secara khusus untuk mengemas kebaya pesanan konsumen. iii

Uji kualitas mikrobiologi jus alpukat di Kota Malang berdasarkan angka lempeng total kolni bakteri / Dwi Retno Sulistyo Putri

 

ABSTRAK Putri, D. R. S. 2015. Uji Kualitas Mikrobiologi Jus Alpukat di Kota Malang Berdasarkan Angka Lempeng Total Koloni Bakteri. Skripsi, Jurusan Biologi, Fakultas Matematikan dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Dra. Utami Sri Hastuti, M. Pd. (II) Sitoresmi Prabaningtyas, S. Si, M. Si. Kata Kunci: Jus Alpukat, ALT Koloni Bakteri, Sanitasi, Higiene Jus alpukat merupakan salah satu minuman yang disukai oleh masyarakat karena mengandung nutrisi dan dapat menyegarkan badan akibat cuaca yang panas dan kering. Jus alpukat dapat terkontaminasi oleh bakteri apabila pedagang kurang memperhatikan sanitasi dan higiene dalam proses pembuatannya. Penelitian ini bertujuan untuk: 1) menentukan ALT koloni bakteri dalam jus alpukat yang dijual oleh beberapa PKL dan beberapa pedagang di depot makan di Kota Malang; 2) menentukan kelayakan konsumsi jus alpukat yang dijual oleh beberapa PKL dan beberapa pedagang di depot makan di Kota Malang berdasarkan ALT koloni bakteri; 3) membahas secara deskriptif faktor-faktor yang dapat mempengaruhi kualitas mikrobiologi jus alpukat yang diteliti berdasarkan hasil observasi. Penelitian ini merupakan penelitian deskriptif observasional. Penelitian dilaksanakan di Laboratorium Mikrobiologi Jurusan Biologi Universitas Negeri Malang mulai bulan Januari 2015 s.d Juni 2015. Sampel yang digunakan adalah jus alpukat yang dijual oleh 5 orang PKL dan 5 pedagang di depot makan di lima kecamatan di Kota Malang. Pengambilan sampel dilakukan sebanyak tiga kali dengan interval waktu 1 minggu. Data penelitian hasil perhitungan ALT koloni bakteri dirujuk pada batas maksimum ALT koloni bakteri yang ditetapkan oleh BPOM RI Nomor HK.00.06.1.52.4011 tahun 2009 untuk sari buah dan sari sayuran. Hasil penelitian menunjukkan: 1) rerata ALT koloni bakteri sampel jus alpukat yang dijual oleh PKL di Kecamatan Kedungkandang (3,7 x 109 cfu/ml), Blimbing (2,5 x 109 cfu/ml), Sukun (1,4 x 109 cfu/ml), Lowokwaru (2,1 x 108 cfu/ml), dan Klojen (1,3 x 107 cfu/ml ) dan rerata ALT koloni bakteri sampel jus alpukat yang dijual oleh pedagang di depot makan di Kecamatan Klojen (1,1 x 109 cfu/ml), Blimbing (1,0 x 109 cfu/ml), Kedungkandang (6,9 x 107 cfu/ml), Sukun (2,0 x 107 cfu/ml), dan Lowokwaru (6,9 x 106 cfu/ml ); 2) semua sampel jus alpukat yang dijual oleh PKL maupun pedagang di depot makan kurang layak dikonsumsi berdasarkan ALT koloni bakteri merujuk pada batas maksimum ALT yang ditetapkan BPOM RI tahun 2009, yaitu 1 x 104 cfu/ml; 3) faktor sanitasi dan higiene, seperti kebiasaan mencuci tangan; memakai celemek dan sarung tangan, kebersihan peralatan, kebersihan bahan, kebersihan tempat berjualan jus buah yang kurang diperhatikan dapat mempengaruhi kualitas mikrobiologi sampel jus alpukat.

Pengembangan simukator robot line follower / Brammuda Darwan Pradana

 

ABSTRAK Pradana, Brammuda Darwan. 2014. Pengembangan Simulator Robot Line Follower. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Kata kunci: Simulator, Line Follower, Robot. Proses pembuatan robot line follower digital memiliki beberapa tahapan, pertama perancang robot harus mengamati lintasan, kemudian mendesain robot line follower yang sesuai dengan lintasan. Robot line follower digital memerlukan pemrograman, maka perancang harus memprogram sistem kendali robot. Setelah siap maka robot diujicobakan pada lintasan. Jika pergerakan robot tidak sesuai dengan lintasan, maka perancang harus mengulang proses tersebut. Hal ini akan membuang banyak waktu dan biaya. Untuk menghindari kerugian maka diperlukan simulator. Dengan menggunakan simulator perulangan dalam pengubahan desain hardware dan software robot dapat diminimalisir. Robot line follower yang sesungguhnya biasanya memiliki sensor 2, 4, 8, atau 16 serta memiliki dua motor sebagai aktuator. Simulator yang dikembangkan memiliki fitur untuk menentukan banyak sensor, sensor tersebut juga dapat ditata penempatannya di body robot. Robot line follower dalam simulator memiliki dua buah roda dengan sistem differential steering. Sistem kendali yang digunakan untuk menggerakkan robot adalah file Dynamic Link Library (DLL). Bahasa pemrograman yang digunakan untuk memprogram sistem kendali robot dalam simulator yang dikembangkan adalah C/C++. Simulator robot line follower yang dikembangkan memiliki asumsi bahwa pergerakan robot dalam simulator, merupakan hasil dari robot yang sempurna. Dalam dunia nyata sering ditemui robot line follower yang mengalami kerusakan karena malfungsi, misal korsleting ataupun roda/ban yang selip. Dalam simulator hal-hal semacam ini tidak akan dijumpai. Simulator robot line follower yang dikembangkan telah diuji coba oleh ahli media, ahli materi dan pengguna. Hasil uji validasi dari ahli media, ahli materi dan pengguna adalah 100%, sehingga dapat disimpulkan bahwa simulator robot line follower yang dikembangkan ini layak digunakan untuk mensimulasikan robot line follower.

Hubungan kondisi kelas dengan minat belajar siswa kelas XI Teknik Kendaraan Ringan di SMK Negheri 6 Malang / Ikrom Nur Wahid Saputra

 

ABSTRAK W.S Ikromnur 2015.HubunganKondisiKelasDenganMinatBelajarSiswaKelas XI TeknikKendaraanRingandi SMK Negeri 6 Malang.Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. H. Mardji, M.Kes, (2) Drs. H.AgusSholah, M.Pd. Kata Kunci: kondisikelas, minatbelajar, TKR, SMK Kondisikelasmerupakanhal yang sangatberpengaruhpada proses pembelajarandidalamruangan. Kondisikelasbukanhanyamengenaikelengkapanfasilitas yang adadidalamruangankelas.Kondisikelasjugameliputikondisisuhu, ventiliasi, cahaya, kelembabandansuara.Dimanahaltersebutsangatmemilikiperanuntukmenimbulkankenyamanandanminatbelajarsiswasaat proses pembelajaranberlangsung. Tujuanpenelitianuntukmengetahui(1) Bagaimanakondisikelas XI TKR di SMK Negeri 6 Malang. (2) Bagaimanaminatbelajarsiswakelas XI di SMK Negeri 6 Malang. (3) Apakahadahubungankondisikelasdenganminatbelajarsiswakelas XI TKR di SMK Negeri 6 Malang. Subjekdalampenelitianiniadalahsiswakelas XI TKRdi SMK Negeri 6 Malang.Diambilduakelaseksperimendenganketentuankondisitataletak yang berbedanpadakelas XI TKR diSMK Negeri 6 Malang Penelitianinimerupakanpenelitiandiskriptifkuantitatif.Teknikpengumpulan data menggunakancaraobservasidanmenggunakankuisionerangket. Hasilpenelitianmenunjukan: (1) Secaradiskriptifdiketahuikondisikelas XI TKR 1 mempunyaikondisikondisi suhu dan ventilasi memiliki klasifikasi yang sangat baik, sedangkan kondisi cahaya, kelembaban dan suara memiliki klasifikasi yang baik.PadakondisikelasXI TKR 2 mempunyaikondisikondisi kondisi suhu dan cahaya memiliki klasifikasi yang baik. Pada kondisi ventilasi dan kelembaban memiliki klasifikasi yang baik, sedangkan kondisi suara memiliki klasifikasi yang kurang baik.(2) Berdasarkan hasil penyebaran angket pada kelas XI TKR 1 diketahui sebanyak 19 siswa klasifikasi yang sangat baik. Sedangkan penyebaran angket pada kelas XI TKR 2 sebanyak 7 siswa memiliki klasifikasi yang sangat baikpadaminatbelajar. (3) Dengan perhitungan uji-t menggunakan bantuan SPSS 16.0 diperolehnilai rata-rata 46,81 pada kelas XI TKR 1 dan 44,14 pada kelas XI TKR 2dengan nilai signifikansi sebesar 0,018 dimana hasil tersebut<0,050terbukti bahwa terdapathubungan yang signifikan antarakondisikelas,denganminatbelajaryang ditinjaudarikondisikelasberbeda. Kesimpulan: Dari penelitianinidapat ditarik kesimpulan adanya hubungankondisikelasdenganminatbelajarsiswa kelas XI TKR di SMK Negeri 6 Malang. Berdasarkanhasilpenelitian yang diperoleh, diharapkanhasilpenelitianinidapatdijadikandasardanbahanreferensiuntukpenelitiansejenis. Namun, alangkahbaiknyajikadalampenelitianselanjutnyaditambahdenganvariabellain, misalnyaprestasibelajar, hasilbelajar, kosentrasi, dan lain-lain.

Laporan kerja praktek di CV Logika Karya Pasuruan
oleh Bambang Junaidi

 

Pengaruh stress terhadap prestasi belajar mahasiswa (suatu kajian terhadap mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Prabowo Heri Susanto

 

Seiring perkembangan ilmu pengetahuan dan teknologi diiringi juga dengan semakin kompleksnya sistem interaksi dan pola hidup manusia. Di sisi lain prsoses kerja dan informasi semakin simpel, mudah, dan cepat, namun disisi lain besarnya tuntutan yang dibebankan kepada manusia juga semakin bertambah. Kondisi inilah yang memunculkan masalah yang sering dihadapi oleh manusia moderen sekarang ini yaitu suatu istilah yang biasa disebut dengan stress. Stress dapat muncul dimana saja, kapan saja, dan dapat menyerang siapa saja tanpa terkecuali mahasiswa selaku peserta didik yang sedang menuntut ilmu di bangku Perguruan Tinggi. Pada kenyataannya stress merupakan fenomena pada manusia yang dapat memberikan dampak positif ataupun negatif dengan melihat kadar dari stress itu sendiri. Stress dalam penelitian ini terdiri dari empat aspek yaitu gejala psikologis, gejala fisik, gejala perilaku, dan gejala interpersonal. Stress bukanlah hal yang harus sepenuhnya dihindari, tetapi akan lebih baik lagi setiap orang mampu menyadari keberadaan stress tersebut dan mampu mengontrol atau mengelolanya sebagai sesuatu yang mampu memberikan dampak positif terhadap pribadi yang mengalaminya. Tujuan penelitian ini adalah untuk mengetahui: kondisi stress yang dialami oleh mahasiswa Fakultas Ekonomi Universitas Negeri Malang, pengaruh stress (X) baik secara parsial maupun simultan terhadap prestasi belajar mahasiswa (Y). Serta untuk mengetahui aspek stress yang dominan mempengaruhi prestasi belajar mahasiswa. Variabel bebas dalam penelitian ini terdiri dari gejala psikologis (X1), gejala fisik (X2), gejala perilaku (X3), dan gejala interpersonal (X4), dan variabel terikatnya adala prestasi belajar mahasiswa (Y). Jenis dari penelitian ini adalah deskriptif korelasional. Populasi dalam penelitian ini adalah seluruh mahasiswa Fakultas Ekonomi Universitas Negeri Malang yang pada waktu penelitian dilakukan yaitu semester gasal tahun akademik 2007/2008 yang telah melakukan registrasi akademik kecuali mahasiswa angkatan tahun 2007 dengan alasan bahwa mahasiswa angkatan tahun 2007 tidak memiliki data IPK sebagai variabel prestasi belajar. Adapun total jumlah seluruh populasi adalah 4.477 orang. Penentuan jumlah sampel menggunakan rumus Slovin dari buku Metode Penelitian Membimbing Dan Mengantar Kesuksesan Anda Dalam Dunia Penelitian dengan menggunakan  = 10%, sehingga diperoleh sampel sejumlah 98 orang. Teknik sampling dalam penelitian ini menggunakan multy stage sampling. Tahap pertama yaitu Proportional Sampling yaitu untuk menentukan jumlah sampel yang dibutuhkan dalam penelitian untuk lingkup Fakultas, Jurusan, dan Program Studi. Tahap kedua yaitu Accidental Sampling yaitu menentukasn sampel berdasarkan kebetulan. Kuesioner dalam penelitian ini termasuk dalam bentuk kuesioner tertutup menggunakan skala Likert 5 options. Analisis data yang digunakan adalah analisis deskriptif, regresi linier berganda dengan uji asumsi klasik. Untuk menguji kelayakan instrumen dilakukan uji validitas dan uji reliabilitas dengan sampel uji coba berjumlah 30 reponden. Proses pengolahan data menggunakan software SPSS for Windows versi 12.0. Teknik pengumpulan data dalam penelitian ini menggunakan kuesioner, dokumentasi, dan wawancara. Hasil penelitian ini adalah: (1) 31 responden (31,62%) menyatakan jarang mengalami gejala psikologis, (2) 36 responden (36,73%) menyatakan jarang mengalami gejala fisik, (3) 49 responden (50%) menyatakan tidak pernah mengalami gejala perilaku, (4) 32 responden (32,65%) menyatakan jarang mengalami gejala interpersonal. Terdapat pengaruh gejala psikologis (X1), gejala fisik (X2), gejala perilaku (X3), dan gejala Interpersonal (X4) secara parsial terhadap prestasi belajar mahasiswa (Y) dengan nilai B1 = 0,014 dan nilai t1 = 0,000; B2 = -0,008 dan nilai t2 = 0,119; B3 = 0,015 dan nilai t3 = 0,005; B4 = -0,001 dan nilai t4 = 0,764. Terdapat pengaruh gejala psikologis (X1), gejala fisik (X2), gejala perilaku (X3), dan gejala Interpersonal (X4) secara simultan terhadap prestasi belajar mahasiswa (Y) dengan nilai Fhitung sebesar 18,975 dengan tingkat signifikansi F adalah 0,000. Sub variabel stress yang memberikan pengaruh dominan adalah gejala psikologis dengan nilai sumbangan efektif sebesar 18,66%. Selain itu diketahui Adjusted R Square = 0,426 yang berarti korelasi atau hubungan antar variabel bebas adalah kuat. Berdasarkan penelitian ini dapat disimpulkan bahwa: (1) stress dengan gejala psikologis, sebagian besar responden menyatakan jarang mengalami, (2) stress dengan gejala fisik, sebagian besar responden menyatakan jarang mengalami, (3) stress dengan gejala perilaku, sebagian besar responden menyatakan tidak pernah mengalami, (4) stress dengan gejala intepersonal, sebagian besar responden menyatakan jarang mengalami. Secara parsial ada pengaruh positif yang signifikan gejala psikologis terhadap prestasi belajar mahasiswa, ada pengaruh negatif yang signifikan gejala fisik terhadap prestasi belajar mahasiswa, ada pengaruh positif yang signifikan gejala perilaku terhadap prestasi belajar mahasiswa, ada pengaruh negatif yang signifikan gejala interpersonal terhadap prestasi belajar mahasiswa. Sedangkan secara simultan dapat disimpulkan bahwa ada pengaruh positif yang signifikan gejala psikologis, gejala fisik, gejala perilaku, dan gejala interpersonal terhadap prestasi belajar mahasiswa. Sedangkan gejala psikologis merupakan sub variabel yang memberikan pengaruh dominan. Saran dalam penelitian ini adalah (1) Hendaknya mahasiswa mampu mengenali dan mendeteksi stress sedini mungkin melalui gejala-gejala yang ada sehingga stress sedini mungkin dapat diantisipasi kemungkinan dampak negatifnya dengan melakukan penanganan dan pendekatan yang sesuai dengan kadar stress yang dialami. (2) Hendekanya penanganan stress baik secara mandiri maupun melalui perantara diupayakan menggunakan metode-metode yang tepat dan hindarilah bentuk-bentuk pelarian untuk menghilangkan stress dengan perilaku-perilaku negatif atau bahkan menyimpang, seperti mabuk, menggunakan obat-obatan terlarang, berjudi, seks bebas, dan lain sebagainya yang dampaknya dapat dipastikan akan bertambah buruk terhadap pribadi yang mengalaminya. (3) Stress merupakan penyakit mental dan psikis, maka hendaknya setiap orang mampu menjaga ketenangan lahir dan batinnya, salah satunya dengan mendekatkan diri kepada Tuhan yang kita agungkan sesuai dengan agama dan kepercayaan masing-masing.

Laporan kerja praktek di perusahaan las dan konstruksi CV Nasional Malang
disusun oleh Senthot Amintoyo

 

Hubungan kohesivitas kelompok dan kecerdasan emosi dengan komitmen organisasi pada pengurus organisasi mahasiswa Universitas Negeri Malang / Debora Irawati

 

Kata kunci: Kohesivitas Kelompok, Kecerdasan Emosi, Komitmen Organisasi, Organisasi Mahasiswa UM Komitmen organisasi diperlukan di dalam setiap organisasi tak terkecuali pada pengurus Organisasi Mahasiswa Universitas Negeri Malang yang terdiri dari Organisasi Pemerintahan Mahasiswa (OPM) dan Organisasi Non Pemerintahan Mahasiswa (ONPM). Tujuan penelitian ini adalah mengetahui: 1) tingkat kohesivitas kelompok, 2) tingkat kecerdasan emosi, 3) tingkat komitmen organisasi, 4) hubungan antara kohesivitas kelompok dan kecerdasan emosi dengan komitmen organisasi pada pengurus Ormawa UM. Desain penelitian yang digunakan adalah deskriptif dan korelasional dengan sampel 101 orang, diambil dengan teknik cluster random sampling. Data dikumpulkan dengan skala kohesivitas kelompok, skala kecerdasan emosi, dan skala komitmen organisasi (reliabilitas alpha cronbach secara berturut-turut 0.922, 0.914, 0.912; koefisien validitas item 0.311 s.d 0.610, 0.310 s.d 0.594, 0.312 s.d 0.686). Data dianalisis dengan teknik regresi linier berganda. Hasil analisis menunjukkan ada hubungan positif antara kohesivitas kelompok dan kecerdasan emosi dengan komitmen organisasi pada pengurus Ormawa (R= 0.711, sig 0.000<0.025), pada pengurus OPM (R = 0.854, sig 0.000<0.025), dan pada pengurus ONPM (R = 0.741, sig 0.000<0.025). Artinya, semakin tinggi kohesivitas kelompok dan kecerdasan emosi maka semakin tinggi komitmen organisasi pada pengurus ormawa secara keseluruhan, OPM, dan ONPM. Tingkat kohesivitas kelompok pada pengurus ormawa kategori tinggi sebanyak 31 orang (30.7%), agak tinggi sebanyak 39 orang (38.6%), agak rendah sebanyak 25 orang (24.8%), dan rendah sebanyak 6 orang (5.9%). Tingkat kecerdasan emosi pengurus untuk kategori tinggi 11 orang (10.9%), agak tinggi sebanyak 34 orang (33.7%), agak rendah sebanyak 47 orang (46.5%), dan rendah sebanyak 9 orang (8.9%).Tingkat komitmen organisasi pengurus untuk kategori tinggi sebanyak 6 orang (5.9%), agak tinggi sebanyak 32 orang (31.7%), agak rendah sebanyak 39 orang (38.6%), dan rendah sebanyak 24 orang (23.8%). Berdasarkan hasil penelitian ini, disarankan bagi ormawa untuk meningkatkan koordinasi kelompok dalam mengerjakan tugas, menyelesaikan konflik berdasarkan kesepakatan bersama, saling memahami perasaan positif dan negatif antar pengurus dalam kerjasama. Pihak UM sebaiknya mengadakan diklat yang melatih teamwork dan kecerdasan emosi untuk calon-calon pengurus. Peneliti selanjutnya dapat meneliti faktor-faktor lain yang berkaitan dengan komitmen organisasi atau ketiga variabel tersebut diteliti menggunakan bentuk penelitian eksperimen.

Pengaruh kompetensi guru ekonomi terhadap hasil belajar siswa kelas XII IPS mata pelajaran ekonomi di SMA Negeri/Sederajat seKabupaten Sampang / Centia Agustina

 

ABSTRAK Centia, Agustina. 2015. Pengaruh Kompetensi Guru Ekonomi Terhadap Hasil Belajar Siswa Kelas XI IPS Mata Pelajaran Ekonomi Di SMA Negeri/Sederajat Se- Kabupaten Sampang.Skripsi, Jurusan Ekonomi Pembangunan Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (1) Drs. Mardono, M,Si. (2) Drs. Sapir S.Sos, M.Si. Kata Kunci : Kompetensi Pedagogik, Kompetensi Profesional, Kompetensi Kepribadian, Kompetensi sosial, Hasil Belajar. Pendidikan adalah sarana untuk mencerdaskan anak bangsa baik dari segi intelektual maupun spiritual. Sekolah juga merupakan salah satu lembaga yang bergerak di bidang pendidikan. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh kompetensi pedagogik, kompentensi profesional, kompetensi kepribadian, kompentensi sosial guru ekonomi terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/Sederajat Se-Kabupaten Sampang, serta mengetahui pengaruh kompetensi guru ekonomi terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/Sederajat Se-KabupatenSampang. Jenis penelitian ini merupakan jenis penelitian Eksplanasi dan rancangan penelitianya menggunakan deskriptif korelasional. Untuk memberikan gambaran tentang variabel kompetensi guru SMA Negeri/Sederajat Se-Kabupaten Sampang. Korelasional digunakan untuk mengetahui pengaruh variabel bebas terhadap variabel terikat. Untuk mengukur korelasional peneliti mengunakan tehnik analisis berganda. Obyek dalam penelitian ini guru mata pelajaran ekonomi di SMA Negeri/Sederajat Se-Kabupaten Sampang yang berjumlah 30 orang. Dari hasil analisis data tersebut, diperoleh hasil pertama, ada pengaruh antara kompetensi pedagogik terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/Sederajat Se-Kabupaten Sampang sebesar 0,00 ≤ α sebesar 0,05. Kedua, tidak ada pengaruh antara kompentesi profesional guru terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/sederajat Se-Kabupaten Sampang sebesar 0,316 > 0,05. Ketiga, ada pengaruh antara kompetensi kepribadian terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/Sederajat Se-Kabupaten Sampang sebesar 0,043 ≤ α sebesar 0,05. Keempat, ada pengaruh antara kompetensi sosial terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/Sederajat Se-Kabupaten sampang sebesar 0,00 ≤ α sebesar 0,05. Kelima, ada pengaruh secara simultan kompetensi pedagogik, kompetensi profesional, kompetensi kepribadian, kompetensi sosial terhadap hasil belajar siswa mata pelajaran ekonomi di SMA Negeri/Sederajat Se-Kabupaten Sampang sebesar 0,00 ≤ α sebesar 0,05. Saran dari hasil penelitian ini perlu adanya peningkatan kompetensi bagi guru untuk menunjang proses pembelajaran selanjutnya. Bukan hanya itu, guru seharusnya memanfaatkan sarana prasarana sekolah untuk menunjang kegiatan belajar mengajar dan bagi sekolah diharapkan dapat memantau dan mengevaluasi guru agar dapat meningkatkan kompetensi yang dimilikinya.

Laporan praktek otomotif III
oleh Supi'i

 

Analisis perhitungan dan pelaporan pajak penghasilan (PPh) pasal 21 atas gaji pegawai tetap pada PT. PLN (Persero) unit pelayanan dan jaringan Blitar / Ratna Setyawati

 

Pajak Penghasilan (PPh) Pasal 21 adalah pajak atas penghasilan dan pembayaran lain dengan nama dan dalam bentuk apapun sehubungan dengan pekerjaan, jabatan, dan kegiatan. Pada PT. PLN (Persero) UPJ Blitar, perhitungan PPh Pasal 21 dikenakan atas gaji pegawai tetap yang dilakukan oleh PT. PLN (Persero) APJ Kediri selaku kepala distribusi pelayanan jaringan listrik sekarisidenan Kediri. PPh Pasal 21 dipotong dan disetorkan atas penghasilan yang diterima sehubungan dengan pekerjaan dari PT. PLN (Persero) selaku pemberi kerja yang merupakan pelunasan pajak terutang untuk tahun pajak yang bersangkutan.Tujuan yang ingin dicapai dalam penulisan Tugas Akhir ini adalah untuk megetahui (1) Mekanisme Perhitungan PPh Pasal 21 atas gaji pegawai tetap pada PT. PLN (Persero) UPJ Blitar, (2) Prosedur pelunasan/pembayaran PPh Pasal 21 dan (3) Perlakuan Akuntansi atas PPh Pasal 21. Metode pemecahan masalah yang digunakan dalam penulisan Tugas akhir ini adalah (1) Analisis mekanisme perhitungan PPh Pasal 21 atas gaji pegawai tetap, (2) Analisis prosedur pelunasan/pembayaran PPh Pasal 21 dan, (3) Analisis perlakuan akuntansi atas PPh Pasal 21. Hasil penulisan Tugas Akhir ini yaitu (1) Mekanisme perhitungan PPh Pasal 21 pada PT. PLN (Persero) UPJ Blitar yang dilakukan oleh PT. PLN (Persero) APJ Kediri telah sesuai dengan Undang-Undang Perpajakan yang berlaku saat ini. Kesulitan-kesulitan yang dihadapi diantaranya yaitu tidak semua pegawai memiliki NPWP serta berubahnya status Wajib Pajak seperti tambahan anak, (2) Pelunasan dan pembayaran PPh Pasal 21 dilakukan oleh Bagian SDM dan Bagian Anggaran Keuangan yang lebih mengetahui masalah keuangan dan kepegawaian PT. PLN sehingga dapat memperkecil resiko kesalahan dalam pembukuan perusahaan, (3) Untuk akuntansinya, PT. PLN (Persero) telah melakukan pembukuan dengan baik untuk pembayaran gaji pegawai tetap serta pemotongan PPh Pasal 21. Untuk memaksimalkan perhitungan dan pelaporan PPh Pasal 21 pada PT. PLN (Persero) UPJ Blitar, sebaiknya bagi Wajib Pajak yang belum memiliki NPWP segera mendaftarkan diri untuk mempermudah administrasi dalam pembayaran pajak. Selain itu setiap pegawai yang berubah status Wajib Pajaknya wajib memberitahukan kepada perusahaan selaku pemotong pajak sebelum masa pembayaran pajak agar perhitungan PPh Pasal 21 sesuai kenyataan.

Laporan praktek kerja nyata di Murni Berlian Motor dealer kendaraan Mitsubishi
oleh Eko Saptono

 

Laporan praktek otomotif III
disusun oleh Suyadi

 

Pengaruh waktu kontak dan konsentrasi Pb2+ sebagai co-ion terhadap adsorpsi Cd2+ dari larutan Cd(No3)2 oleh serbuk nata de coco dengan metode batch / Chairunisa Ayu Saputri

 

Kata kunci: adsorpsi, waktu kontak, ion Pb2+, ion Cd2+, serbuk nata de coco Adsorpsi merupakan suatu proses penyerapan atom, ion, atau molekul-molekul dalam larutan pada suatu permukaan zat penyerap. Proses adsorpsi dipengaruhi banyak faktor, diantaranya adalah konsentrasi ion pengganggu dan waktu kontak. Penelitian yang dilakukan Eistiwijaya (2009) tentang pengaruh konsentrasi ion Cu2+ sebagai pengganggu terhadap persentase teradsorpsi ion Cd2+ oleh arang sekam padi dan arang komersial membuktikan bahwa adanya ion pengganggu menyebabkan penurunan adsorpsi ion Cd2+. Dalam penelitian ini digunakan ion Pb2+ sebagai co-ion dalam proses adsorpsi ion Cd2+ dan dilakukan uji adsorpsi awal klorofil yang merupakan suatu molekul organik sebagai pembanding. Penelitian ini bertujuan mengetahui pengaruh konsentrasi kation Pb2+ dengan menggunakan metode batch terhadap adsorpsi ion Cd2+. Penelitian lain yang dilakukan oleh Sari (2010) dan Nurastiningtyas (2005) tentang pengaruh waktu kontak terhadap adsorpsi ion Cd2+ membuktikan bahwa persentase teradsorpsi ion Cd2+ berbanding lurus dengan lamanya waktu kontak. Penelitian ini merupakan penelitian eksperimental dan dilakukan di laboratorium Kimia Jurusan Kimia dan Laboratorium Mikrobiologi Jurusan Biologi Fakultas MIPA Universitas Negeri Malang. Variabel bebas dalam penelitian ini adalah waktu kontak dan konsentrasi co-ion Pb2+. Variabel terikatnya adalah persentase Cd2+ dan Pb2+ teradsorpsi. Serbuk nata de coco yang digunakan berukuran 30-40 mesh sebanyak satu gram. Adsorbat yang digunakan merupakan campuran larutan Cd(NO3)2 dan Pb(NO3)2 dengan variasi konsentrasi Pb2+ (0, 10, 25, 50) ppm dan konsentrasi Cd2+ tetap yaitu 25 ppm. Penelitian ini menggunakan metode batch, yaitu larutan adsorbat yang telah dicampur dengan serbuk nata de coco dikocok dengan kecepatan 100 rpm. Pengocokan dilakukan dalam berbagai variasi waktu kontak yaitu 20, 40, dan 60 menit. Pengukuran konsentrasi Cd2+ dan Pb2+ sebelum dan sesudah adsorpsi diukur menggunakan AAS. Dengan metode yang sama, uji kemampuan serbuk nata de coco terhadap klorofil dengan variasi konsentrasi (pengenceran 50 dan 100 kali) dengan waktu kontak 20 menit. Panjang gelombang maksimum dari klorofil diukur dengan UV-Vis dan diperoleh nilai absorbansi tertinggi pada panjang gelombang 398 nm. Hasil penelitian menunjukkan bahwa (a) Peningkatan konsentrasi ion Pb2+ dalam larutan adsorbat dengan konsentrasi ion Cd2+ tetap 25 ppm berpengaruh secara signifikan terhadap adsorpsi ion Cd2+, (b) Persentase teradsorpsi ion Cd2+ meningkat seiring dengan peningkatan waktu kontak, (c) Peningkatan konsentrasi ion Pb2+ menyebabkan kenaikan persentase teradsorpsinya dan hal ini terjadi seiring dengan peningkatan waktu kontak. Persentase Cd2+ teradsorpsi lebih tinggi dibandingkan dengan ion Pb2+, (d) Profil serapan klorofil menunjukkan bahwa persentase teradsorpsi berbanding terbalik dengan kenaikan konsentrasi.

Laporan kerja praktek di PT Boma Stork Pasuruan
oleh Siswandi

 

Perancangan kontrol motor listrik 3 fasa dengan dua arah putar hubungan bintang-segitiga otomatis berbasis programmable logic controller (PLC) / oleh Yudhi Supomo, Agus Hadianto

 

Laporan praktek otomotif III
disusun oleh Masroni

 

Hubungan antara perkembangan sosioemosional dengan perilaku agresif siswa kelas VII dan VII SMP Laboratorium UM / Arina Fithriyana

 

Kata kunci: Perkembangan Sosioemosional, Perilaku Agresif. Setiap manusia pasti melalui proses perkembangan dalam hidupnya. Siswa Sekolah Menengah Pertama adalah siswa yang berada pada rentang usia remaja. Remaja cenderung belum memiliki kestabilan emosi padahal ia memiliki kebutuhan yang sangat besar untuk diterima oleh teman sebayanya. Hubungan dengan teman sebaya dan ketidakstabilan emosi yang ada pada dirinya dapat mendorong remaja untuk berperilaku agresif. Oleh kerena itu, siswa yang telah matang perkembangan sosioemosionalnya diharapkan mampu menunjukkan hubungan yang baik dengan orang lain dan dapat mereaksi secara wajar terhadap rangsangan yang diberikan orang lain sehingga dapat meminimalkan kecenderungan berperilaku agresif dalam dirinya. Penelitian ini bertujuan untuk mengetahui (1) gambaran perkembangan sosioemosional siswa, (2) gambaran perilaku agresif siswa, dan (3) hubungan antara perkembangan sosioemosional dengan perilaku agresif siswa. Rancangan yang digunakan dalam penelitian ini adalah deskriptif korelasional. Populasi dalam penelitian ini adalah siswa kelas VII dan VIII SMP Laboratorium UM pada tahun ajaran 2010/2011 dimana kelas VII terdiri dari 5 kelas dan kelas VIII terdiri dari 6 kelas. Pengambilan sampel pada penelitian ini dengan menggunakan teknik cluster random sampling dimana masing-masing tingkatan kelas diambil 1 kelas sebagai sampel penelitian. Data diambil dengan menggunakan angket, yaitu meliputi angket perkembangan sosioemosional dan angket perilaku agresif. Analisis data penelitian dengan menggunakan teknik analisis statistik deskriptif dan teknik korelasi Product Moment. Sedangkan untuk pengujian hipotesis, dengan menggunakan nilai probability error. Jika nilai probability error > 0,05, maka Ho diterima. Begitu juga sebaliknya. Hasil penelitian menunjukkan bahwa sebagian besar siswa kelas VII dan VIII SMP Laboratorium UM sudah matang perkembangan sosioemosionalnya. Sedangkan untuk perilaku agresif, sebagian besar siswa cenderung kurang agresif. Sementara itu, dari hasil uji korelasi didapat R = -0.364; p = 0,001. Hal ini menunjukkan bahwa p < 0.05 sehingga dapat diartikan terdapat hubungan yang negatif antara perkembangan sosioemosional dengan perilaku agresif siswa kelas VII dan VIII SMP Laboratorium UM. Arah hubungan yang negatif ini menunjukkan bahwa semakin matang perkembangan sosioemosional siswa, maka semakin berkurang tingkat perilaku agresifnya. Begitu juga sebaliknya. Berdasarkan hasil penelitian, saran yang dapat disampaikan antara lain: konselor sebaiknya berperan aktif dalam membimbing siswa memahami dirinya khususnya bagi siswa yang belum matang perkembangan sosioemosionalnya dan masih agresif perilakunya. Layanan yang diberikan dapat berupa layanan informasi, layanan individu, layanan bimbingan kelompok, dan lain sebagainya. Sedangkan guru matapelajaran, hendaknya mampu memahami siswa dan memberikan contoh yang baik kepada siswa supaya tidak memicu timbulnya perilaku yang tidak diharapkan di sekolah. Sementara itu, bagi peneliti selanjutnya yang tertarik dengan penelitian sejenis dapat melanjutkan penelitian terhadap berbagai aspek perkembangan siswa yang menarik untuk di kaji.

Laporan kerja praktek di bengkel Dinas Pekerjaan Umum Kotamadya Dati II Malang
oleh Tamsir

 

Laporan kerja praktek di perusahaan Jawatan Kereta Api Inspeksi X Depo Lokomotif Malang
oleh Sunanto

 

Improving the ability of English Department students of Kanjuruhan University Malang in writing descriptive essays through premora (pre-writing-monitored reading-activities) / Aliv Faizal Muhammad

 

Kata Kunci: kemampuan menulis, PREMORA Berdasarkan temuan temuan di preliminary study, kualitas isi dari karangan deskriptif mahasiswa pendidikan bahasa Inggris Universitas Kanjuruhan Malang belumlah mencukupi. Diidentifikasikan bahwa penyebabnya adalah kurangnya pengetahuan siswa akan topik yang dideskripsikan. Kurangnya pengetahuan tersebut kemungkinan bisa diatasi dengan menghadapkan siswa pada banyak kegiatan membaca. Peneliti berencana mengatasi masalah tersebut dengan menerapkan strategy berdasarkan logika hubungan membaca dan menulis yaitu PREMORA (Pre-writing Monitored Reading-Activities) guna meningkatkan kualitas isi karangan deskriptif siswa. Bentuk penelitian ini adalah penelitian tindakan kelas kolaborasi. Peneliti bekerja sama dengan guru kelas sebagai rekan dalam menyusun rencana pembelajaran, menerapkan pengajaran, mengamati pengajaran, dan melakukan refleksi. Pembelajaran ini diterapkan dalam satu siklus. Siklus tersebut terdiri atas tiga pertemuan. Pertemuan pertama ditekankan pada kegiatan pre-writing, pertemuan kedua dikhususkan untuk kegiatan drafting dan revising, dan pertemuan ketiga digunakan untuk kegiatan editing dan publishing. Subyek penelitian ini adalah 32 mahasiswa pendidikan bahasa inggris Universitas Kanjuruhan Malang semester empat. Datanya diambil menggunakan observation checklists, field notes, dan dari nilai akhir karangan deskriptif siswa. Penelitian ini menunjukkan bahwa penerapan PREMORA mampu meningkatkan kualitas isi karangan deskriptif siswa. Di preliminary study, 56.25% siswa mendapatkan nilai POOR pada kualitas isi karangan deskriptif mereka. Diharapkan setelah penerapan PREMORA, minimal 60% siswa mendapatkan nilai FAIR pada kualitas isi. Setelah penerapan PREMORA, didapati jumlah siswa yang mendapatkan nilai FAIR mencapai 78.12% siswa berdasakan penilai 1 dan 68.75% menurut penilai 2. Nilai dari kedua penilai telah mencapai nilai yang ditargetkan yaitu minimal 60% siswa mencapai nilai FAIR. Untuk membuktikan objektifitas penilaian kedua penilai, digunakanlah reabilitas inter rater menggunakan Pearson Product Moment. Didapatkan bahwa tingkat realibilitasnya adalah 0.803873 yang disederhanakan menjadi 804. Nilai reliabilitas ini tergolong tinggi (Djiwandono, 2008). Dengan kata lain, PREMORA berhasil meningkatkan kualitas isi karangan deskriptif siswa. Dari ke17 langkah pendekatan process writing dalam penelitian ini, PREMORA terdapat di langkah ke empat hingga ke sebelas. Langkah-tersebut adalah (4) memperkenalkan PREMORA kepada siswa berikut menjelaskan tujuan menggunakan PREMORA, (5) menunjukkan siswa bagaimana menggunakan PREMORA termasuk bagaimana bekerja dengan PREMORA form, (6) menentukan topik untuk dibuat karangan deskriptif bagi siswa, (7) membagikan PREMORA form kepada siswa, (8) meminta siswa mencari informasi terkait dengan topik untuk dibaca, (9) memerintakan siswa untuk membaca bacaan terkait dengan topik, (10) meminta siswa mengisi PREMORA formnya, (11) meminta siswa menulis karangan awal sesuai informasi yang mereka dapatkan dari bacaan yang sudah mereka catat di PREMORA form. Catatan dalam PREMORA form itu membantu mereka memperkaya informasi yang mereka tulis di karangan deskriptif mereka. Pengajar menulis bahasa inggris disarankan menggunakan PREMORA guna meningkatkan kualitas isi karangan deskriptif siswa. Peneliti berikutnya disilahkan menggunakan PREMORA guna meningkatkan kemampuan menulis siswa pada jenis karangan yang lain.

Laporan kerja praktek di perusahaan mesin dan cor CV Semeru Jaya Malang, dari tanggal 11 Januari 1982 sampai dengan tanggal 10 Maret 1982
disusun oleh Ibrahim

 

Laporan kerja praktek di bengkel Dinas Pekerjaan Umum Kota Madya Dati II Malang
oleh Bejo Sofianto

 

Keadaan sosial ekonomi pengemudi angkutan umum kota Malang / Jatu Agustina

 

Kata kunci: Sosial Ekonomi, Sopir Angkot, Kota Malang. Transportasi atau pengangkutan merupakan bidang kegiatan yang sangat penting dalam kehidupan masyarakat Indonesia. Pentingnya transportasi bagi masyarakat Indonesia disebabkan oleh beberapa faktor antara lain, keadaan geografis Indonesia yang terdiri dari ribuan pulau kecil dan besar, perairan yang terdiri dari sebagian besar laut, sungai dan danau yang memungkinkan pengangkutan dilakukan melalui darat, perairan, dan udara guna menjangkau seluruh wilayah Indonesia. Hal lain yang juga tidak kalah pentingnya akan kebutuhan alat transportasi adalah kebutuhan kenyamanan, keamanan, dan kelancaran pengangkutan yang menunjang pelaksanaan pembangunan yang berupa penyebaran kebutuhan pembangunan, pemerataan pembangunan, dan distribusi hasil pembangunan diberbagai sektor ke seluruh pelosok tanah air misalnya, sektor industri, perdagangan, pariwisata, dan pendidikan. Oleh karena itu, Pemerintah melaksanakan program perluasan sarana transportasi untuk mensejahterakan kehidupan sosial ekonomi masyarakat. Bila berbicara tentang kehidupan sosial ekonomi berarti juga membahas tentang kebutuhan dan bagaimana seseorang berusaha memenuhi kebutuhan tersebut, dan pemanfaatan hasil ekonomi yang diperoleh. Jadi, kehidupan sosial ekonomi yang dimaksud adalah cara-cara atau strategi yang diterapkan seseorang dalam memenuhi kebutuhan hidup sehari-hari, serta pemanfaatan penghasilan atau hasil ekonomi, yang diperoleh, dan juga berbicara menegnai keadaan hidup sehari-hari. Tujuan dari penelitian ini adalah untuk mendeskripsikan (1) keadaan sosial ekonomi pengemudi angkutan umum perkotaan di Kota Malang; (2) strategi adaptasi yang dilakukan para pengemudi angkutan perkotaan agar tetap survive dalam kehidupan sehari-hari; (3) pola transaksi dan hubungan kerja antara sopir angkot dan pemilik angkot. Metode penelitian yang digunakan adalah deskriptif kualitatif dan jenis penelitiannya adalah penelitian kualitatif. Subjek penelitian adalah sopir angkutan beserta keluarga dan pemilik angkutan. Kegiatan pengumpulan data dilakukan dengan menggunakan metode observasi, wawancara dan dokumentasi. Sedangkan analisa data menggunakan model reduksi data, penyajian data, dan kesimpulan atau verifikasi data. Untuk menjamin keabsahan data yang ditemukan, peneliti melakukan pengecekan data sebagai berikut: kecukupan referensi, diskusi dengan teman dan dosen serta triangulasi. Hasil penelitian menunjukkan bahwa: (1) Kondisi sosial ekonomi para sopir angkutan di Kota Malang berdasarkan tingkat pendapatan, memiliki penghasilan rata-rata antara Rp 20.000,- sampai Rp 70.000,- per hari. Jumlah tanggungan keluarga para sopir angkutan rata-rata dua sampai empat orang. Tingkat pendidikan anak sopir rata-rata masih duduk di bangku SD sampai SMA sederajat. Hal tersebut memaksa para sopir angkot untuk hidup dalam kondisi tempat tinggal yang sederhana dengan perabot yang sederhana. Untuk barang elektronik seperti televisi, lemari es, magic com, tape, setrika dan barang elektronik lainnya mereka harus membeli dengan cara mengkredit. Rata-rata sebagian besar sopir angkutan jarang terlibat dalam organisasi kemasyarakatan; (2) Strategi adaptasi yang dilakukan para sopir angkutan kota agar tetap survive dapat dilakukan dengan beberapa cara seperti ngetem, putar balik, dan menambah kapasitas penumpang. Selain itu, strategi adaptasi juga dilakukan keluarga sopir angkot untuk menambah pemasukan; (3) Bentuk pola transaksi antara sopir dengan pemilik berlangsung secara kekeluargaan. Di dalam transaksi tersebut berisi kesepakatan-kesepakatan dimana antara sopir dan pemilik saling memperoleh keuntungan. Para sopir bebas bernegosiasi dengan para pemilik, akan tetapi setiap pemilik angkot mempunyai ketentuan yang berbeda dalam setiap transaksi. Bagi sopir sekaligus pemilik angkot, mereka tidak terikat transaksi. Berdasarkan hasil penelitian tersebut disarankan: (1) Bagi Dinas Perhubungan Kota Malang diharapkan lebih meningkatkan pembinaan terhadap sopir angkutan agar lebih mentaati peraturan lalu-lintas dan lebih memperhatikan tingkat pelayanan serta kenyamanan bagi penumpang; (2) Para sopir hendaknya lebih mematuhi peraturan lalu-lintas agar tidak merugikan para pengguna jalan lainnya, sehingga terciptalah suasana tertib dan aman dalam berkendara; (3) Bagi keluarga sopir hendaknya lebih menyadari bahwa kondisi suami dalam bekerja sangatlah berat, sehingga bisa memaklumi apabila terjadi penurunan pendapatan. Untuk membantu suami, para istri dan keluarga hendaknya berusaha sekuat tenaga untuk menambah penghasilan agar dapat menutupi kekurangan pendapatan dan sebisa mungkin bisa mengontrol semua pengeluaran yang berlebihan dan mengurangi pengeluaran yang tidak terlalu penting; (4) Bagi peneliti saat ini maupun peneliti selanjutnya diharapkan lebih memahami tentang konsep sosial ekonomi. Sehingga peneliti mampu untuk menerapkan dalam kehidupan sehari-hari.

Laporan praktek kerja di Dinas Pekerjaan Umum Daerah Tingkat II Malang, Mei 1986 s.d Juni 1986
oleh Usman Achadi

 

Tindak tutur guru untuk memotivasi siswa / Eriska Fiki Yuswinda

 

ABSTRAK Yuswinda, Eriska Fiki. 2015. Tindak Tutur Guru untuk Memotivasi Siswa. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Sunaryo H.S., S.H, M.Hum, (II) Prof. Dr. Heri Suwignyo, M.Pd. Kata Kunci: tindak tutur, guru, motivasi Motivasi merupakan hal penting dalam pembelajaran. Selain digunakan untuk menggerakkan siswa agar aktif belajar, motivasi juga digunakan untuk mengarahkan dan mendorong siswa agar belajar lebih baik. Oleh sebab itu, tugas guru tidak hanya menyampaikan ilmu pengetahuan saja. Namun, guru harus mampu menciptakan proses belajar di kelas yang dapat merangsang siswa aktif belajar sehingga tujuan pembelajaran tercapai. Cara yang dapat digunakan guru agar siswa aktif belajar dan hasil belajar siswa meningkat yakni mendidik dengan memberikan pengarahan dan motivasi. Penelitian ini dilaksanakan dengan tujuan mendeskripsikan tiga hal yang mencakup bentuk tindak tutur guru untuk memotivasi siswa, fungsi tindak tutur guru untuk memotivasi siswa, serta strategi tindak tutur guru memotivasi siswa. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Data dalam penelitian ini berupa tindak tutur motivasi yang digunakan oleh guru dalam pembelajaran yang diperoleh dari rekaman 11 guru. Instrumen yang digunakan untuk mengumpulkan data berupa peneliti sendiri yang dibantu dengan instrumen penelitian tambahan, yakni berupa alat perekam serta pedoman analisis data. Pengumpulan data dilakukan dengan meggunakan perekaman, transkrip data, dan identifikasi data. Kegiatan analisis data dimulai dari merekam tindak tutur guru di dalam kelas, mentranskrip data, mengidentifikasi data, memberi kode data, dan menganalisis data berdasarkan rumusan masalah. Untuk menjaga keabsahan data, diadakan pemeriksaan ulang hasil temuan penelitian dan mendiskusikannya dengan pembimbing. Berdasarkan analisis data, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, bentuk tindak tutur guru untuk memotivasi siswa terdiri atas enam bentuk, yakni tindak tutur umpan balik, tindak tutur penghargaan, tindak tutur penciptaan suasana kelas yang demokratis, tindak tutur pujian, tindak tutur kritikan, dan tindak tutur pemberian bantuan tanpa diminta. Pemberian motivasi dalam bentuk umpan balik dapat dikombinasikan dengan pujian sehingga siswa benar-benar termotivasi oleh tuturan guru. Dengan demikian, banyak bentuk tindak tutur yang dapat digunakan guru untuk memotivasi siswa pada saat berinteraksi dengan siswa, menyampaikan isi pembelajaran, memberikan soal, dan ketika mengakhiri pembelajaran. Kedua, fungsi tindak tutur guru untuk memotivasi siswa terdiri atas empat fungsi, yakni fungsi insentif, fungsi penggerak, sungsi harapan, dan fungsi disiplin. Fungsi insentif dilakukan dengan cara memberikan umpan balik, penghargaan, dan dorongan secara lisan. Fungsi penggerak dilakukan dengan cara membuat suasana kelas menjadi demokratis. Fungsi harapan dilakukan dengan cara memberikan tuturan persuasif. Fungsi disiplin dilakukan dengan cara memberikan kritikan. Dilihat dari keempat fungsi tersebut, dapat disimpulkan bahwa guru menggunakan tindak tutur motivasi di kelas untuk menggerakkan, mendorong, dan mengarahkan siswa dalam pencapaian tujuan pembelajaran. Ketiga, strategi tindak tutur guru untuk memotivasi siswa terdiri atas dua strategi, yakni strategi langsung dan strategi tidak langsung. Bentuk strategi tidak langsung, yakni memberi informasi hasil kerja, membandingkan kemampuan siswa, menganggap mudah pelajaran, menginformasikan keyakinan, bertanya, menginformasikan penggunaan strategi, memberi penghargaan, memberi pujian, mengulang jawaban, serta memberi kritikan. Berbeda dengan strategi langsung, strategi tidak langsung berupa kritikan dan persaingan yang digunakan guru untuk memotivasi siswa dapat menimbulkan efek negatif. Saran disampaikan kepada tiga pihak, yakni guru, kepala sekolah, dan peneliti berikutnya. Guru terutama guru bahasa Indonesia disarankan melakukan pembuktian penggunaan tuturan motivasi dalam pembelajaran di kelas. Kepala sekolah disarankan dapat merencanakan dan menugaskan seluruh guru di sekolah agar menggunakan tindak tutur motivasi pada saat pembelajaran berlangsung. Bagi peneliti berikutnya disarankan untuk melakukan penelitian lain yang dapat menambah teori tindak tutur motivasi.

Laporan kerja praktek di bengkel Dinas Pekerjaan Umum Kotamadya Dati II Malang
oleh Jing Wahono

 

Pemanfaatan laboratorium komputer dalam pembelajaran TIK untuk siswa kelas XI di SMA Patra Dharma Balikpapan / Kiki Andrianti

 

Kata kunci : pemanfaatan, laboratorium komputer, pembelajaran TIK. Laboratorium merupakan sarana penunjang dalam proses pembelajaran siswa di sekolah. Walaupun laboratorium komputer dapat menjadi tempat yang member fungsi cukup baik, tetapi dalam pencapaian belajar siswa belum memenuhi target, hal ini disebabkan tenaga guru yang jumlahnya masih sedikit, dan cara mengajar TIK masih bersifat monoton, serta beberapa fasilitas yang tidak dapat dipergunakan. Pemanfaatan ini dilaksanakan dengan tujuan mendeskripsikan pengelolaan dan pemanfaatan laboratorium komputer, mendeskripsikan frekuensi pemanfaatan laboratorium komputer, mendeskripsikan tata cara atau penggunaan laboratorium computer serta mendeskripsikan factor yang mendukung dan menghambat dan menghambat Laboratorium Komputer dalam pembelajaran TIK yang telah melalui proses penelitian untuk siswa kelas XI di SMA Patra Dharma Balikpapan. Penelitian ini adalah penelitian deskriptif, data yang diperoleh dari guru TIK di SMA Patra Dharma Balikpapan, dan siswa yang diambil sebagai sampel adalah siswa kelas XI yang berjumlah 100 siswa yang terdiri dari 10 kelas. Instrument penelitian yang digunakan adalah angket yang diberikan kepada siswa, panduan wawancara yang dilakukan guru dan dokumentasi berupa pengamatan fasilitas yang tersedia di Laboratorium Komputer. Setelah melalui proses pengelolaan data, diketahui hasil penelitian adalah pengelolaam dan pemilihan fasilitas yang ada di Laboratorium Komputer cukup efektif. Ruangan yang tersedia mampu menampung 40 siswa. Pembelajaran TIK yang dilakukan di laboratorium computer efektif, dilihat dari kegiatan pembelajaran TIK yang menyenangkan siswa serta dapat memotivasi siswa selama proses belajar mengajar, serta tenaga laboran yang ada cukup membantu dalam kegiatan pembelajaran. Berdasarkan hasil kesimpulan tersebut disarankan siswa agar memanfaatkan laboratorium computer untuk pembelajaran TIK sebaik mungkin, kepada guru hendaknya tidak membiarkan peralatan laboratorium computer yang tidak bias dioperasionalkan, sehingga tidak akan menggangu proses belajar mengajar di laboratorium computer. Sebaiknya guru mencoba metode lain yang lebih menarik, materi disesuaikan dengan karakteristik peserta didik sehingga akan memotivasi sisawa dalam belajar.

Laporan elektronika
oleh Sugeng Setijono

 

Pengaruh good corporate governance, earning per share, return on equity, leverage terhadap nilai perusahaan manufaktur yang listing di BEI (periode 2006-2008) / Yantik Kusrini

 

Kata Kunci: Good Corporate Governance, EPS, ROE, Leverage terhadap Nilai Perusahaan Salah satu tujuan perusahaan mendaftarkan sahamnya di BEI adalah untuk mendapatkan dana dari masyarakat yang dapat digunakan untuk meningkatkan performance perusahaan. Tujuan investor dalam melakukan investasi di pasar modal adalah untuk meningkatkan kesejahteraan saat ini atau di masa yang akan datang. Investor akan memilih berinvestasi pada perusahaan yang dianggap mempunyai prospek untuk mendapatkan kemakmuran yang tinggi. Kemakmuran pemegang saham ini dapat dilihat dari nilai perusahaannya. Tujuan penelitian ini adalah untuk mengetahui pengaruh secara parsial GCG, EPS, ROE, Leverage terhadap nilai perusahaan, dan untuk mengetahui pengaruh secara simultan GCG, EPS, ROE, Leverage terhadap nilai perusahaan. Penelitian ini merupakan penelitian hypotheses testing. Alat analisis yang digunakan adalah regresi linier berganda dengan variabel independen, Komisaris Independen (X1), Ukuran Dewan Direksi (X2), Kepemilikan Manajerial (X3), Kepemilikan Institusional (X4), EPS (X5), ROE (X6), Leverage (X7), sedangkan variabel independenya adalah Nilai perusahaan (harga saham penutupan). Data dikumpulkan dengan metode dokumentasi. Jumlah sampel sebanyak 17 perusahaaan manufaktur dengan periode amatan 2006-2008 yang diperoleh dengan purposive sampling. Hasil penelitian menunjukkan bahwa Variabel Dewan direksi (X2), EPS (X5), dan ROE (X6) berpengaruh secara signifikan terhadap Nilai Perusahaan, sementara variabel Dewan komisaris independen (X1), Kepemilikan Manjerial (X3), Kepemilikan Institusional (X4), dan leverage (X7) secara parsial tidak berpengaruh terhadap nilai perusahaan. Uji F menunujukkan F-hitung sebesar 15,204 dengan F sig 0,000, yang berarti bahwa Komisaris Independen (X1), Ukuran Dewan Direksi (X2), Kepemilikan Manajerial (X3), Kepemilikan Institusional (X4), EPS (X5), ROE (X6), Leverage (X7), berpengaruh secara simultan terhadap Nilai Perusahaan. Nilai Adjusted R Square dalam penelitian ini sebesar 0,665, yang berarti bahwa 66,5% Nilai Perusahaan dipengaruhi oleh variabel Komisaris Independen, Ukuran Dewan Direksi, Kepemilikan Manajerial, Kepemilikan Institusional, EPS, ROE, Leverage. Disimpulkan bahwa Nilai Perusahaan dipengaruhi oleh Ukuran Dewan Direksi, EPS, ROE. disarankan bagi perusahaan yang ingin menaikkan nilai perusahaan hendaknya lebih memperhatikan EPS, dan ROE perusahaan, serta ukuran dewan direksi. Bagi investor hendaknya lebih mempertimbangkan faktor-faktor EPS, ROE dan ukuran dewan direksi. serta faktor eksternal yang mempengaruhi nilai perusahaan Bagi peneliti selanjutnya diharapkan dapat menambahkan variabel lain yang diduga mempengaruhi nilai perusahaan, dan menambahkan jumlah sampel penelitian.

Laporan kerja praktek di PT. Faroka S.A. Malang
disusun oleh Naziruddin

 

Perencanaan poros roda gigi
tugas
oleh Sujani

 

Pengembangan sistem penjadwalan mata pelajaran berbasis website di SMA Negeri 2 Tanggul Kabupaten Jember / Melinda Dwiarifani Yuwafiqi

 

ABSTRAK Yuwafiqi, Melinda Dwiarifani. 2015. Pengembangan Sistem Penjadwalan Matapelajaran Berbasis Website di SMA Negeri 2 Tanggul Kabupaten Jember. Skripsi, S1 Pendidikan Teknik Informatika, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Triyanna Widyaningtyas, S.T., M.T., (2) Heru Wahyu Herwanto, S.T., M.Kom. Kata Kunci: pengembangan, penjadwalan, algoritma genetika, sistem, website, mata pelajaran, waterfall model. Jadwal pelajaran merupakan aspek penting dalam pelaksanaan pembelajaran yang bertujuan untuk mendukung, memperlancar, dan mempertinggi kualitas pendidikan. Sekolah-sekolah pada umumnya, menyusun jadwal pelajaran secara manual. Menyusun jadwal juga memerlukan ketepatan dan ketelitian dari penyusunnya. Berdasarkan wawancara dengan waka kurikulum SMA Negeri 2 Tanggul, diperoleh informasi bahwa pihak kurikulum merasa kesulitan dalam membuat jadwal dan membutuhkan alat bantu dalam menyusun jadwal pelajaran. Berdasarkan permasalahan tersebut, maka pengembangan dan penelitian ini bertujuan untuk mengembangkan sistem penjadwalan berbasis website. Metode pengembangan yang digunakan adalah waterfall oleh Ian Sommerville. Tahapan model waterfall adalah (1) Requirement Analysis and Definition; (2) System and Software Design; (3) Implementation and Unit Testing; (4) Integration and System Testing; (5) Operation and Maintenance. Pengujian yang dilakukan adalah pengujian black box yang fokus pada aspek fungsionalitas untuk menguji apakah sistem valid atau tidak. Uji coba dilakukan dengan menyebarkan checklist uji coba fungsionalitas kepada ahli rekayasa web, waka kurikulum, guru, serta siswa. Berdasarkan pengujian yang dilakukan oleh ahli rekayasa web, waka kurikulum, guru, serta siswa diperoleh persentase aspek fungsionalitas sebesar 100%. Dari analisis data ini dapat disimpulkan bahwa (1) Sistem Penjadwalan Matapelajaran telah dirancang dan dikembangkan berdasarkan kebutuhan pengguna di SMA Negeri 2 Tanggul pada tahap awal pengembangan; (2) Sistem Penjadwalan Matapelajaran mempermudah proses pembuatan jadwal matapelajaran di SMA Negeri 2 Tanggul; (3) Sistem Penjadwalan Matapelajaran mempersingkat waktu pembuatan jadwal pelajaran; (4) Sistem Penjadwalan Matapelajaran memenuhi kebutuhan fungsionalitas dengan keterangan dapat diterima dibuktikan dari dapat diterimanya semua komponen fungsionalitas sistem.

Developing a prototype of English monopoly game for teaching speaking to the tenth graders of SMK / Erlina Mufiddah

 

Mufiddah, Erlina. 2013. Developing a Prototype of English Monopoly Game for Teaching Speaking to the Tenth Graders of SMK. Skripsi, Jurusan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: Dr. Sri Rachmajanti, Dip.TESL, M.Pd Kata kunci: English monopoly, pembelajaran berbicara, SMK     Penelitian ini bertujuan untuk mengembangkan media pengajaran dalam bentuk permainan monopoli untuk melatih kemampuan berbicara bahasa Inggris peserta didik kelas X SMK. Media ini bertujuan untuk membantu dan memotivasi peserta didik untuk berbicara bahasa Inggris. Materi yang dipilih berdasarkan kompetensi dasar dan silabus guru bahasa Inggris.     Penelitian ini menggunakan model penelitian dan pengembangan yang diadaptasi dari Borg & Gall (1983) dan Hyland (2003). Model tersebut terdiri dari enam tahapan yaitu: analisis kebutuhan, pengembangan materi dan produk, uji coba produk, revisi utama produk, tes penggunaan produk, dan revisi akhir produk . Instrumen yang digunakan untuk pengumpulan data penelitian dan informasi (analisis kebutuhan) adalah lembar observasi, kuesioner siswa, dan wawancara guru. Data dari kuesioner siswa dianalisis secara kuantitatif dalam bentuk prosentase. Sedangkan, data dari lembar observasi dan wawancara guru dianalisis secara kualitatif. Data yang didapat dari tahap analisis kebutuhan digunakan sebagai pertimbangan pengembanagan produk. Tahapan proses validasi menggunakan kuesioner sebagai pedoman untuk mengetahui kelemahan dan kekuatan dari media pembelajaran yang dikembangkan. Hasil kuesioner tersebut digunakan untuk merevisi produk sebelum beranjak untuk tahap tes penggunaan produk (uji coba). Hasil kuesioner validasi digambarkan dalam bentuk kuantitatif dan kualitatif, sedangkan hasil uji coba digambarkan secara kualitatif dan kuantitatif.     Uji coba dilakukan pada subjek yaitu kelas X Keperawatan 1 di SMKN 11 Malang. Terdapat 37 peserta didik, namun peneliti hanya mengambil 11 peserta didik sebagai perwakilan. Instrumen yang digunakan dalam proses uji coba adalah rekaman video, kuesioner siswa dilengkapi dengan penilaian diri sendiri, dan kuesioner guru dilengkapi dengan penilaian speaking peserta didik. Hasil rekaman video menunjukkan bahwa permainan English Monopoly dapat diaplikasikan. Hasil kuesioner siswa menunjukkan bahwa peserta didik tertarik bermain permainan tersebut dan menganggap bahwa permainan tersebut membantu belajar berbicara bahasa Inggris. Kuesioner guru menunjukkan bahwa permainan English Monopoly sesuai untuk pengajaran speaking.     Kesimpulannya, English Monopoly ini merupakan media berbicara yang menarik dan membantu. Produk ini merupakan media pengajaran speaking untuk kelas X SMK, oleh karena itu pengguna bisa mengubah materi atau peraturan tergantung pada kebutuhan peserta didik. Untuk peneliti selanjutnya, English monopoly dapat diubah menjadi aplikasi software atau bentuk 3 Dimensi dengan membuat pop-up.

Laporan praktek otomotif III
oleh Rini Endah Winarti

 

Laporan praktek kerja pembangunan gedung SMA Negeri I Malang
oleh Yudianto

 

Hubungan status sosial ekonomi dengan minat orang tua memasukkan anak di PAUD 'Aisiyah Bustanul Athfal 17 Kota Malang / Mukhibbatul Karimah

 

ABSTRAK Karimah, Mukhibbatul. 2015. Hubungan Status Sosial Ekonomi dengan Minat Orang tua Memasukkan Anak di PAUD ‘Aisyiyah Bustanul Athfal 17 Kota Malang. Skripsi, Jurusan Pendidikan Luar Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Dra Siti Asmah, M.Pd (II) SriWahyuni S.Pd, M.Pd Kata Kunci: Status Sosial Ekonomi, Minat Orang Tua, Anak Usia Dini Orang tua memegang peranan yang sangat penting dalam membentuk kepribadian anak. Salah satu yang mempengaruhi minat orang tua dalam memasukkan anak di lembaga PAUD adalah status sosial ekonomi orang tua. Berkaitan dengan hal tersebut, maka diperlukan penelitian untuk mengetahui hubungan antara status sosial ekonomi dengan minat orang tua memasukkan anak di PAUD. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan status sosial ekonomi pada aspek jenis pekerjaan, tingkat pendidikan, pendapatan orang tua dan minat orang tua memasukkan anak di PAUD, serta untuk menemukan ada tidaknya hubungan antara variabel-variabel tersebut. Metode penelitian ini menggunakan pendekatan kuantitatif dengan rancangan korelasional. Perolehan data penelitian ini didapat dari hasil penyebaran kuesioner/ angket dan dokumentasi. Analisis data berupa analisis deskriptif dan analisis korelasional dengan menggunakan Pearson Product Moment. Hasil penelitian dengan analisis deskriptif menunjukkan sebagian besar pekerjaan orang tua peserta didik yakni sebagai wiraswasta, kemudian sebagian besarpendidikan terakhir orang tua peserta didik yakni pada tingkat S-1, dan sebagian besar pendapatan orang tua peserta didik yakni sekitar Rp.2.000.000 – Rp.3.000.000. Minat orang tua memasukkan anak di PAUD tergolong pada tingkat sedang yakni dengan prosentase sebesar 36%. Analisis korelasional menunjukkan bahwa (1) terdapat korelasi antara status sosial ekonomi pada aspek jenis pekerjaan dengan minat orang tua memasukkan anak di PAUD, (2) terdapat korelasi antara status sosial ekonomi pada aspek tingkat pendidikan dengan minat orang tua memasukkan anak di PAUD, (3) terdapat korelasi antara status sosial ekonomi pada aspek pendapatan dengan minat orang tua memasukkan anak di PAUD. Adapun saran yang dapat diajukan dalam penelitian ini adalah (1) bagi orang tua, hasil penelitian ini sebagai sumber informasi tentang pentingnya tanggung jawab orang tua dalam memberikan pendidikan yang layak untuk anak usia dini. Oleh karena itu perlu upaya peningkatkan kesadaran akan pentingnya peranan orang tua pada pendidikan anak usia dini, selain itu orang tua juga harus mencari informasi dan memberikan fasilitas secara aktif mengenai kebutuhan anak di usia dini.(2) Bagi lembaga PAUD, menjadi referensi untuk menentukan peta atau sasaran bagi upaya promosi jasa pendidikan. (3) Bagi peneliti selanjutnya penelitian ini dapat digunakan sebagai acuan bagi pengembangan penelitian pada subjek dan obyek yang berbeda.

Laporan praktek kerja nyata di Perdana Motor Malang
oleh Pamuji Laksono

 

Laporan prkatek kerja bidang konversi energi di bengkel Melati Jaya Lawang
oleh Lilis Ichwanto

 

Laporan praktek kerja di PT Rothmans of Pall Mall Indonesia Malang (8 Juni s/d 4 Agustus 1987)
disusun oleh Riduwan

 

Peningkatan prestasi belajar matematika standar kompetensi FPB melalui permainan kartu di kelas V SDN Manukan Wetan I - 114 Surabaya / Suci Rahayu Ningsih

 

Kata Kunci: Prestasi Belajar, Pembelajaran Permainan Kartu Dalam proses pembelajaran di SDN Manukan Wetan I pada mata pelajaran matematika, guru menyampaikan materi dengan metode ceramah. Guru kurang memberikan variasi metode pembelajaran, sehingga pembelajaran menjadi membosankan. Penggunaan media pembelajaran sebagai alat bantu pemmbelajaran masih sangat kurang. Hasil yang diperoleh siswa kelas V SDN Manukan Wetan I mata pelajaran matematika pokok bahasan FPB kurang memuaskan. Hal ini terbukti dari 40 siswa, yang sudah tuntas belajar hanya 22 siswa sedangkan 18 siswa yang lain belum tuntas belajar. Jadi ketuntasan belajar siswa pada mata pelajaran matematika pokok bahasan FPB hanya 55%. Tujuan yang ingin dicapai melalui penelitian tindakan kelas ini adalah untuk mengetahui: 1. Penerapan model permainan kartu dalam meningkatkan prestasi belajar siswa kelas V SDN Manukan Wetan I – 114. 2. Peningkatan prestasi belajar siswa kelas V SDN Manukan Wetan I – 114 pada mata pelajaran matematika pokok bahasan FPB setelah diterapkannya model permainan kartu. Subjek penelitian dalam penelitian ini adalah siswa kelas V SDN Manukan Wetan I – 114 Surabaya. Teknik pengumpulan data dalam penelitian ini menggunakan metode observasi dan tes Sedangkan instrumen penelitian yang digunakan adalah lembar observasi aktivitas guru dan siswa dan lembar tes formatif. Pembelajaran permainan kartu memiliki dampak positif dalam meningkatkan hasil belajar siswa. Pemahaman siswa terhadap materi melalui keterampilan proses benar-benar mempunyai makna bagi siswa karena siswa mengalami sendiri pembelajaran secara nyata dan ikut secara langsung dalam pembelajaran. Penerapan pembelajaran permainan kartu dapat meningkatkan ketuntasan belajar siswa kelas V SDN Manukan Wetan I - 114 Kecamatan Tandes Surabaya, hal ini terbukti dari rata-rata persentase 72,5% pada siklus I menjadi 90% pada siklus II.

Laporan kerja praktek di Perusahaan Jawatan Kereta Api Malang
oleh Hari Purnomo

 

Laporan kerja praktek di PT PG Rejo Agung Baru Madiun
disusun Didik Sunarko

 

Peran Sanggar tari "Sekar Arum" dalam melestarikan nilai-nilai budaya dalam Tari RTopeng Getak di Desa Pasirian Kabupaten Lumajang / Siti Fitriani

 

ABSTRAK Fitriani, Siti Fitri. 2015. Peran Sanggar Tari “Sekar Arum” dalam Melestarikan Nilai-nilai Budaya dalam Tari Topeng Getak di Desa Pasirian Kabupaten Lumajang. Skripsi, Program Studi Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) Drs. Suparlan Al Hakim, M. Si, (2) Yuniastuti, S. H, M. Pd Kata Kunci: Peran, sanggar, melestarikan, nilai budaya. Kesenian merupakan salah satu unsur kebudayaan yang penting karena kesenian memiliki daya ekspresi yang dapat merefleksikan secara simbolik kehidupan batinila, sebagai media komunikasi dan penyampaian pesan. Maka kesenian yang perlu dilestarikan agar tidak hilang. Sehingga nilai-nilai Budaya yang ada didalamnya juga tidak akan hilang dan dapat dijadikan pedoman oleh masyarakat dalam bertingkah laku. Sanggar Tari “Sekar Arum” merupakan sanggar yang ada di Desa Pasirian Kabupaten Lumajang yang berupaya melestarikan nilai-nilai budaya dalam kesenian tari Topeng Getak. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan: (1) sejarah tari Topeng Getak; (2) latar belakang berdirinya sanggar tari “Sekar Arum”; (3) proses penampilan kesenian tari Topeng Getak; (4) nilai-nilai budaya tari Topeng Getak; (5) cara melestarikan nilai budaya tari Topeng Getak; (6) kendala dan upaya mengatasi kendala yang dihadapi sanggar tari “Sekar Arum” dalam melestarikan nilai-nilai budaya dalam tari Topeng Getak. Peneliti menggunakan pendekatan kualitatif deskriptif dan jenis penelitian studi kasus. Peneliti terjun langsung ke lapangan dan mengumpulkan data melalui informan. Informan dalam penelitian ini yaitu ketua dan anggota sanggar tari “Sekar Arum”, pelatih. Peneliti memilih lokasi penelitian di Desa Pasirian Kabupaten Lumajang. Sumber data berasal dari kata-kata, tindakan, dokumen dan foto. Teknik pengumpulan data yang digunakan yaitu observasi partisipan, wawancara, dan studi dokumentasi. Proses analisis data yang digunakan yaitu reduksi data, display data dan verifikasi data. Teknik pengecekan keabsahan data dengan cara perpanjangan keikutsertaan, ketenkunan pengamatan, dan triangulasi. Hasil penelitian ini sebagai berikut. Pertama, sejarah tari Topeng Getak Tari Topeng Getak awalnya bernama Tari Klonoan. Tarian ini menggambarkan tokoh Prabu Bolodewo dalam lakon Topeng Dhalang Madura yang ditiru oleh masyarakat awam. Topeng Dhalang Madura saat itu dimainkan dan ditonton hanya dilingkungan keraton atau kaum bangsawan. Jarang sekali atau hampir tidak mungkin ada kesempatan bagi masyarakat awam untuk menyaksikan penampilan Topeng Dhalang tersebut. Kedua, Latar belakang berdirinya sanggar tari “Sekar Arum” adanya suatu keinginan untuk terus melestarikan kesenian tradisional dan budaya asli jawa khususnya tari Topeng Getak dan juga adanya keinginan untuk menghidupkan kembali kesenian-kesenian yang saat ini sudah mulai memudar di masyarakat, dimana kesenian-kesenian itu akan dinaungi dalam wadah sanggar Tari “Sekar Arum” yang nantinya dapat memupuk rasa persatuan dan kesatuan dalam bidang seni. Ketiga, Properti dan kostum yaitu; (1) gendang, (2) tiga kenong, (3) srone, (4) gong, kostum yaitu; (1) topeng, (2) sapu tangan, (3) sabuk, (4) jamang, (5) gongseng, (6) rompi. Keempat, nilai budaya yang terkandung dalam tari Topeng Getak yaitu: (1) nilai hiburan, terlihat saat pementasan yang menarik dan menghibur; (2) nilai seni, terlihat pada seni dram, seni musik, dan seni tari; (3) nilai religius, terlihat pada saat ritual; (4) nilai perjuangan, menggambarkan tentang perjuangan warga pamekasan; (5) nilai persatuan dan kesatuan, terlihat pada saat adanya kegiatan antara anggota, masyarakat saling bersatu. Kelima, cara melestarikan nilai budaya dalam tari topeng Getak yaitu: (1) memberikan informasi kepada anggota dan masyarakat; (2) Membina para anggota sanggar dan juga masyarakat supaya dapat melestarikan tari Topeng Getak; (3) dukungan dari pemerintah; (4) aktif mengikuti festival-festival dan mengadakan pementasan. Kendala, kendala yang dihadapi sanggar tari “Sekar Arum” serta upaya mengatasi kendala tersebut sabagai berikut: faktor internal (1) Pendidikan;Mayoritas masyarakat yang kurangnya pendidikan sehingga tidak mengerti akan pentingnya pelestarian budaya.Upaya mengatasi kendala tersebut dengan memberikanlatihan rutin sehingga budaya yang sudah bertahun-tahun diwariskan tidak punah dari tahun ke tahun (2) masuknya budaya asing; (3) kurangnya kreativitas pelatih. Faktor eksternal, (1) dana yang terbatas; (2) faktor penonton; (3) adanya masyarakat yang kurang mendukung. Saran yang diberikan peneliti yaitu: (1) sanggar, sebaiknya antara sanggar tari “Sekar Arum”, masyarakat, dan pemerintah terus meningkatkan kerjasama yang baik; (2) Pemerintah: pemerintah sebaiknya lebih memperhatikan budaya tradisional agar tidak hilang; (3) masyrakat, pihak sanggar mengajak masyarakat untuk mempelajari kesenian tari Topeng Getak agar nantinya bisa diwariskan kepada anak cucu mereka; (4) pelatih tari, sanggar tari “Sekar Arum” terus menanamkan dengan cara pelatih seni mengemas tarian yang lebih menarik dan dapat diterima oleh seluruh lapisan masyarakat.

Laporan praktek kerja nyata di divisi munisi PT PINDAD (persero) Turen Malang
oleh Endiq Suliyanto

 

Implementasi e-learning oleh guru sejarah dalam rangka meningkatkan motivasi belajar pada siswa kelas XI MIPA SMAN 1 Pare / Diyah Ningrum Puspitasari

 

ABSTRAK Puspitasari, Diyah Ningrum. 2015. Implementasi E-learning Oleh Guru Sejarah Dalam Rangka Meningkatkan Motivasi Belajar Pada Siswa Kelas XI MIPA SMAN 1 Pare. Skripsi, Program Studi Pendidikan Sejarah, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing : (I) Drs. I Wayan Legawa, M.Si Kata Kunci : E-learning, motivasi belajar, sejarah, XI MIPA E-Learning adalah sistem pendidikan yang menggunakan aplikasi elektronik untuk mendukung pengembangan kegiatan belajar mengajar dengan media internet, intranet atau media jaringan komputer lain. Sejalan dengan fungsi e-learning tersebut juga mendukung program pemerintah yaitu Kurikulum 2013 yang memuat tentang pendidikan jarak jauh. Dan dengan moodle sebagai sofware e-learning yang digunakan memudahkan suatu instansi atau sekolah untuk menggunakannya. Rumusan masalah pada penelitian ini adalah (1) Pelaksanaan e-learning di dalam mata pelajaran sejarah di SMAN 1 Pare, (2) Pengaruh penerapan e-learning terhadap motivasi belajar siswa di SMAN 1 Pare, (3) Kendala penerapan e-learning terhadap motivasi belajar siswa di SMAN 1 Pare. Tujuan dilakukannya penelitian ini adalah untuk mengetahui e-learning di pembelajaran sejarah merupakan salah satu hal yang dapat memotivasi siswa dalam belajar tentang sejarah. Untuk memudahkan penelitian, peneliti menggunakan sampel acak. Peneliti menggunakan 10 siswa sebagai sampel dari keseluruhan siswa sebanyak 157 siswa mulai dari kelas XI MIPA 1-XI MIPA 4 dengan cara menyebarkan angket. Di dalam penelitian ini, menggunakan penelitian deskriptif Dengan pendekatan penelitian kombinasi model sequential explanatory, yang dimaksud penelitian kombinasi model sequential explanator adalah metode penelitian kombinasi yang menggabungkan metode penelitian kuantitatif dan kualitatif secara berurutan, dimana pada tahap pertama penelitian dilakukan dengan menggunakan metode kuantitatif dan pada tahap kedua dilakukan dengan metode kualitatif. Hasil dari penelitian adalah Jika di kelas XI MPA 1 skor rata-rata sebesar 86,7. XI MIPA 2 skor rata-rata sebesar 86,3. XI MIPA 3 skor rata-rata sebesar 89. XI MIPA 4 skor rata-rata 87,2 dari data tersebut dapat disimpulkan bahwa pengaruh e-learning jika dikaitkan dengan motivasi belajar siswa antara kelas satu dengan kelas lainnya berbeda. Walaupun berbeda namun, perbedaan yang sangat tipis antara 86,3 – 89 sudah termasuk dalam kategori positif. Hal ini berarti motivasi belajar siswa kelas XI MIPA 1- XI MIPA 4 dalam hal penerapan e-learning disambut positif oleh siswa. Kesimpulan dari penelitian ini adalah pengimplementasian e-learning oleh guru sejarah di SMAN 1 Pare disambut positif oleh siswa-siswi di kelas XI MIPA sebagai pelaku. Hal ini di sisi lain dapat digunakan sebagai salah satu inovasi pembelajaran dalam sejarah, di sisi lain juga mendukung adanya kolaborasi di bidang teknologi dan pendidikan. Kendala-kendala yang menjadi masalah di pengimplentasian ini merupakan kendala teknis yang diusahakan akan berkurang di waktu yang akan datang. Kendala-kendala tersebut menyangkut koneksi internet dan sosialisasi guru yang dilakukan secara bertahap. Sebaiknya kendala tersebut di masa yang akan datang bisa diperbaiki dan mendapat bantuan dari pemerintah untuk perkembangan e-learning.

Laporan praktek kerja di divisi munisi PT PINDAD (persero) Turen Malang
oleh Udi Riyantri

 

Perkembangan lokalisasi dan dampaknya terhadap masyarakat sekitar (studi tentang Lokalisasi Kebobang Kecamatan Wonosari Kabupaten Malang 1978-2014) / Maisyarah

 

ABSTRAK Maisyarah. 2015.Perkembangan Lokalisasi dan Dampaknya Terhadap Masyarakat Sekitar (Studi Tentang Lokalisasi Kebobang Kecamatan Wonosari Kabupaten Malang 1978-2014). Skripsi, Program Studi Pendidikan Sejarah, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. Ari Sapto, M.Hum, (II) Drs. Dewa Agung Gede Agung, M.Hum. Kata Kunci:perkembangan, prostitusi, Lokalisasi Kebobang. Prostitusi umumnya ada pada setiap negara. Prostitusi sejak jaman dahulu hingga saat ini sulit dihapuskan.Keberadaannya tidak hanya di kota besar, namun juga terdapat di desa. Lokalisasi Kebobang terletak di Desa Kebobang Kecamatan Wonosari yang ramai dikunjungi karena adanya Wisata Ritual Gunung Kawi. Lokalisasi Kebobang menjadi tempat singgah supir yang sedang menunggu tamunya berdoa di gunung Kawi. Rumusan masalah dalam penelitian ini adalah (1) bagaimana latar belakang munculnya Lokalisasi Kebobang; (2) bagaimana perkembangan Lokalisasi Kebobang tahun 1978-2014, dan (3) bagaimana dampak Lokalisasi Kebobang terhadap masyarakat Sekitar. Penelitian ini juga memiliki tujuan mendiskripsikan (1)latar belakang munculnya Lokalisasi Kebobang; (2)Perkembangan Lokalisasi Kebobang tahun 1978-2014, dan (3)dampak Lokalisasi Kebobang terhadap masyarakat Sekitar. Penelitian ini menggunakan metode penelitian historis melalui empat tahap yakni heuristik, kritik, interpretasi, dan historiografi. Berdasarkan hasil penelitian yang telah dilakukan di lapangan, maka diperoleh hasil penelitian sebagai berikut. Pertama, latar belakang munculnya Lokalisasi Kebobang karena adanya sebuah rumah yang dijadikan tempat prostitusi. Atas persetujuan Perangkat Desa dan masyarakat sekitar, maka dibuatlah lokalisasi di Kebobang. Kedua,Perkembangan Lokalisasi Kebobang terus meningkat dari tahun ke tahun,pada saat dibentuk tahun 1978 hingga tahun 2014. Setap Mucikari dan PSK memilki data yang teregister di Kepolisian, serta wanita yang ingin menjadi PSK harus melengkapi beberapa persyaratan yang telah ditentukan. Para pelanggan tidak hanya dari masyarakat biasa, namun juga pegawai Pemerintahan. Lokalisasi Kebobang resmi ditutup oleh Pemerintah Kabupaten Malang pada tanggal 24 November 2014. Setelah ditutup tidak membuatkegiatan di Lokalisasi berhenti, mereka masih melayani pelanggan secara “sembunyi-sembuyi”.Ketiga, Lokalisasi Kebobang memberikan dampak terhadap masyarakat sekitar, khusunya dalam bidang ekonomi.Keberadaan Lokalisasi tidak memberikan dampak terhadap perilaku sosial masyarakat Kebobang. Namun, dengan adanya lokalisasi memberi dampak terhadap penularan HIV dan AIDS. Adapun saran dari penelitian ini adalah adanya bagi peneliti selanjutnya masih ada celah dalam penelitian ini.Untuk penelitian selanjutnya, diharapkan agar memberikan penjelasan tentang dampak dalam bidang budaya dan pendidikan pada masyarakat sekitar.

Laporan praktek kerja di Pabrik Karung/Goni PT Koyo Mulyo Kencong Pare Kediri
disusun oleh Yoyok Sucahyo

 

Laporan praktek kerja mekanis di workshop PT Rothmas of Spall Mall Indonesia Malang 8 Juni s.d. 4 Agustus 1987
oleh Toton Rachmanto

 

Laporan kerja praktek di perusahaan daerah Aneka Jasa dan Permesinan unit Sumber Mas Malang
oleh Burhanudin

 

Pengaruh penambahan kromium (III) nitrat dan ph media tanam terhadap kadar kromium (III) pada jamur kuping hitam (Auriculeria polytricha) / Yessy Novita Anggraini

 

ABSTRAK Anggraini, Yessy Novita. 2015.Pengaruh Penambahan Kromium(III) Nitrat dan pHMedia Tanam Terhadap Kadar Kromium(III) Pada Jamur Kuping Hitam(Auricularia polytricha).Skripsi. Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Irma Kartika Kusumaningrum, S.Si., M.Si., (II) Dr. Sc. H. Anugrah Ricky Wijaya, S.Si., M.Sc. Kata kunci: penambahankromium(III), pH, jamur kuping hitam. Kromium(III) merupakan tingkatbilangan oksidasi kromium yang paling stabil saat berada di dalam tubuh makhluk hidup.Kromium(III) berperan dalammetabolisme lipid, protein, karbohidrat, dan asam nukleat. Penambahan kromium(III) pada penelitian ini dilakukan pada jamur kuping hitam. Jamur kuping hitam memiliki banyak kandungan gizi seperti karbohidrat, protein dan lemak. Penelitianinimerupakanrintisandari program fortifikasikromium(III) padajamur. Tujuan penelitian ini adalah mengetahui kemampuan jamur kuping hitam dalam menyerapkromium(III)yang ditambahkanpada media tanam, mengetahui pengaruh penambahan kromium(III)danpH media tanam terhadap keterserapan kromium(III) dalam badan buah jamur kuping hitam. Penelitian ini dilakukan melalui 6 tahap, yaitu (1) pembuatan media tanam jamur kuping hitam pada pH 6,7, dan 8 dengan konsentrasi Cr(NO3)3 sebesar 0 ppm, 25 ppm, 50 ppm, 75 ppm, dan 100 ppm, (2) budidaya dan pemanenan jamur kuping hitam, (3) preparasi sampel, (4) penentuan kadar kromium total dalam jamur kuping hitam (5) penentuan kadar kromium(VI) pada jamur kuping hitam dengan instrumen spektrofotometer UV-Vis (6) penentuan kadar kromiumpada jamur kuping hitamdengan instrumen AAS (AtomicAbsorption Spectrometry). Hasil penelitian menunjukkan kromium(III) pada media tanam dapat diabsorpsi oleh jamur kuping hitam. Kadar kromium(III) dalam jamur kuping hitam dipengaruhi kadar kromium(III)danpH media tanam. Semakin besar kadar kromium(III) dari range 0-100 ppm pada media tanam, maka kadar kromium(III) dalam jamur kuping hitam semakin besar. Pada kadar fortifikan yang sama, keterserapan kromium(III)padajamurkupinghitam paling tinggi pada media tanam denganpH 8apabila dibandingkan dengan media yang memiliki pH 6 dan 7.

Pelaksanaan strategi produk dan distribusi susu segar dan olahannya pada KUD Batu / Mochammad Rizky Pratama

 

Kata kunci: strategi, produk Dewasa ini setiap orang mempunyai kekuasaan untuk memilih suatu produk sesuai dengan keinginannya. Setiap orang berkuasa membandingkan, memilih, menolak, dan mengajukan kriteria atas produk yang diinginkan. Market oriented merupakan kegiatan perusahaan yang diarahkan untuk memenuhi keinginan dan memuaskan kebutuhan konsumen, mulai dari perencanaan produk, harga, distribusi, promosi dan sebagainya. Tujuan perusahaan menciptakan produk yang sesuai dengan kebutuhan konsumen merupakan tanggung jawab semua orang yang terlibat dalam penciptaan produk. KUD Batu adalah koperasi persusuan terbesar di wilayah kota Batu Malang, yang mengumpulkan susu segar dari peternak kemudian didistribusikan ke PT. Nestle, dijual dalam bentuk susu segar dan diolah menjadi susu pasteurisasi. Sehingga untuk melakukan usaha terutama yang berkaitan dengan produk yang bersifat perishable diperlukan sebuah koordinasi dan pengelolaan KUD Batu memiliki dua macam produk susu pasteurisasi, yaitu Nandhi Murni dengan kemasan botol 1 liter dan 200 ml dan susu KSB dengan kemasan cup 125 ml dan 140 ml. Unit susu pasteurisasi tidak melakukan pemasaran secara langsung namun bekerja sama dengan pihak lain. Untuk pasar sasaran susu Nandhi Murni bekerjasama dengan unit KPPS. Sedang pemasaan susu KSB bekerjasama dengan PT. Putih lestari Bandung sekaligus sebagai distribusi tunggal susu KSB. Lokasi pemasaran susu Nandhi Murni hanya terbatas wilayah sekitar Batu dan Malang, sedang pemasaran KSB selain di wilayah Batu dan Malang diperluas ke daerah Jawa Timur lainnya (Gresik, Surabaya, Madura, Madiun), Jawa Tengah,Jogja, dan Jawa Barat.

Laporan kerja praktek di Dipo PJKA Malang
disusun oleh Bambang Trisulo

 

Tugas perencanaan konstruksi baja (pertokoan)
oleh Umbu Nday L.A.

 

Laporan praktek kerja nyata di PT Faroka S.A. Malang dari tanggal 20 Agustus s/d 20 Oktober 1980
oleh Samsu Ismail

 

Pengaruh persepsi siswa mengenai koperasi sekolah terhadap partisipasi siswa di koperasi sekolah (studi kasus kelas X MAN Malang 1) / Ainun Rosidah

 

Kata Kunci: persepsi siswa, partisipasi siswa Keberadaan koperasi sekolah saat ini tidak hanya sebagai wahana untuk memenuhi kebutuhan para siswa, dalam hal ini kebutuhan untuk membeli barangbarang kebutuhan sekolah atau makanan ringan pada saat jam istirahat berlangsung, tetapi keberadaan koperasi sekolah agar mampu menjadi wahana untuk pembelajaran praktek berkoperasi bagi para siswa. Dengan adanya koperasi sekolah tersebut maka, diharapkan para siswa dapat berperan aktif dan ikut berpartisipasi dalam perjalanan koperasi sekolah, baik partisipasi dalam bidang usaha maupun partisipasi dalam bidang organisasi. Siswa merupakan generasi penerus yang memegang peranan penting dalam perjalanan koperasi khususnya koperasi sekolah, maka dari itu perlu ditanamkan sejak dini mengenai kesadaran siswa untuk ikut berpartisipasi di koperasi. Kesadaran siswa berkoperasi akan dapat tumbuh dan berkembang sebagai akibat dari adanya persepsi siswa itu sendiri mengenai koperasi sekolah, persepsi siswa tentang koperasi sekolah diduga merupakan salah satu faktor penting dalam perjalanan koperasi sekolah, selain itu siswa merupakan konsumen pertama dan utama bagi koperasi sekolah. Penelitian ini dilakukan untuk mengetahui persepsi siswa mengenai koperasi sekolah terhadap partisipasi siswa di koperasi sekolah. Persepsi siswa mengenai koperasi sekolah meliputi, persepsi siswa mengenai pengertian dan karakteristik koperasi sekolah, persepsi siswa mengenai maksud dan tujuan koperasi sekolah, persepsi siswa mengenai keanggotaan koperasi sekolah, persepsi siswa mengenai ketatalaksanaan koperasi sekolah, persepsi siswa mengenai kegiatan usaha koperasi sekolah, dan partisipasi siswa di koperasi sekolah meliputi partisipasi dalam bidang usaha dan partisipasi di bidang organisasi. Penelitan ini dilakukan di MAN Malang 1 pada bulan April sampai dengan Mei tahun 2010. Responden dalam penelitian ini adalah siswa kelas X yang ada di MAN Malang 1, sampel yang diambil dalam penelitian ini adalah 25% dari keseluruhan jumlah populasi yang ada yaitu sebanyak 247 siswa, teknik yang digunakan yaitu propotional random sampling. Metode yang digunakan dalam penelitian ini adalah metode angket dan dokumentasi. Hasil penelitian menunjukan bahwa tingkat partisipasi siswa MAN Malang 1 dapat dikatakan baik, hal ini terbukti dari penyebaran kuesioner atau angket yakni sebanyak 45 siswa (71,4%) memiliki persepsi yang baik mengenai pengertian dan karakteristik koperasi sekolah, sebanyak 44 siswa (69,8%) memiliki persepsi yang baik mengenai maksud dan tujuan koperasi sekolah, sebanyak 45 siswa (71,4%) memiliki persepsi yang baik mengenai keanggotaan koperasi sekolah, sebanyak 46 siswa (73%) memiliki persepsi yang baik mengenai ketatalaksanaan koperasi sekolah dan sebanyak 52 siswa (82,5%) memiliki persepsi yang baik mengenai kegiatan usaha koperasi sekolah. Sedangkan untuk partisipasi siswa di koperasi sekolah dikatakan kurang aktif yakni sebanyak 37 siswa (58,7%) kurang aktif berpartisipasi di koperasi sekolah. Secara parsial persepsi siswa mengenai pengertian dan karakterstik koperasi sekolah, persepsi siswa mengenai maksud dan tujuan koperasi sekolah, dan persepsi siswa mengenai kegiatan usaha koperasi sekolah tidak memiliki pengaruh yang positif dengan partisipasi siswa di koperasi sekolah meskipun rata-rata persepsi siswa mengenai ketiga aspek tersebut adalah baik.sedangkan aspek persepsi siswa mengenai keanggotaan koperasi sekolah dan persepsi siswa mengenai ketatalaksanaan koperasi sekolah memiliki pengaruh yang positif terhadap partisipasi siswa di koperasi sekolah. Secara simultan terdapat pengaruh yang positif antara persepsi siswa mengenai koperasi sekolah terhadap partisipasi siswa di koperasi sekolah terbukti dari hasil analisis menunjukan besaran probabilitas sebesar (Sig) 0,001 < 0,05. Berdasarkan hasil penelitian diharapkan pihak sekolah dapat melakukan beberapa hal diantaranya yaitu, dalam rangka meningkatkan persepsi siswa mengenai koperasi sekolah hendaknya dilakukan dilklat mengenai koperasi sekolah tidak hanya bagi para siswa yang ingin menjadi pengurus saja, tetapi kepada seluruh siswa yang ada di MAN Malang 1, melalui diklat diharapkan siswa tidak hanya memperoleh pengetahuan mengenai seluk beluk koperasi sekolah secara teori, tetapi juga memperoleh pengalaman untuk melakukan praktik dalam kepengurusan koperasi sekolah, selain itu perbaikan sarana dan prasarana yang berhubungan dengan kegiatan koperasi sekolah perlu diperbaiki dan ditambah.

Laporan praktek kerja di PT Rothmans of Pall Mall Indonesia Malang (8 Juni s/d 4 Agustus 1987)
disusun oleh Riduwan

 

Keterampilan manajerial kepala sekolah dalam pengelolaan dana Bantuan Operasional Sekolah (BOS) (studi multikasus di MTsN Malang 1, MTsN Malang 3, dan MTs Ma'arif Singosari Malang / Abdul Rahman

 

ABSTRAK Rahman, Abdul. 2016. Keterampilan Manajerial Kepala Sekolah Dalam Pengelo-laan Dana Bantuan Operasional Sekolah (BOS) (Studi Multikasus di MTsN Malang 1, MTsN Malang 3 dan MTs Ma’arif Singosari Malang), Disertasi, Program Studi Manajemen Pendidikan, Pascasarjana Universi-tas Negeri Malang. Pembimbing: (I) Prof. H.A. Sonhadji K.H, M.A.,Ph.D., (II) Prof. Dr. H. Muhammad Huda A.Y, M.Pd, (III) Dr. H. Kusmintardjo, M.Pd Kata kunci: keterampilan manajerial, kepala sekolah, bantuan operasional sekolah. Pengupayaan mutu di dalam organisasi sekolah dapat dilakukan sesuai dengan UU No 20 tahun 2003 yang memberikan tanggung jawab yang lebih besar dan otoritas langsung pada sekolah. Diharapkan sekolah dan masyarakat dapat ikut berkontribusi dalam peningkatan mutu sekolah dasar secara signifikan, termasuk dalam pengupayaan mutu guru. Penelitian ini dimaksudkan untuk mendeskripsikan tentang: (1) pengelola-an dana Bantuan Operasional Sekolah (BOS); (2) setrategi yang dilakukan kepala sekolah untuk meningkatkan keterampilan dalam mengelola keuangan Bantuan Operasional Sekolah (BOS), (3) keterampilan kepala sekolah dalam menyusun rencana anggaran belanja sekolah dalam konteks dana Bantuan Operasional Sekolah (BOS) (4) keterampilan kepala sekolah dalam penggunaan Bantuan Operasional Sekolah (BOS); dan (5) keterampilan kepala sekolah dalam menyu-sun laporan penggunaan keuangan Bantuan Operasional Sekolah (BOS). Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi multikasus pada MTsN Malang 1, MTsN Malang 3 dan MTs Ma’arif Singosari Malang. Teknik pengumpulan data menggunakan wawancara mendalam, observa-si, dan studi dokumentasi. Pengecekan kredibilitas data dilakukan dengan teknik triangulasi, member check, dan diskusi teman sejawat. Data yang terkumpul melalui ketiga teknik tersebut diorganisikan, ditafsir, dan dianalisis secara berulang-ulang, baik melalui analisis dalam kasus maupun melalui analisis lintas kasus guna menyusun konsep dan abstraksi temuan penelitian. Kesimpulan penelitian sebagai berikut: (1) pengelolaan Keuangan Bantuan Operasional Sekolah (BOS): mengacu pada visi misi dan renstra madrasah, memaksimalkan peran wali murid, komite madrasah dan pengurus yayasan, meningkatkan fasilitas fisik dan mutu akademik; (2) Strategi kepala sekolah untuk meningkatkan keterampilan pengelolaan dana Bantuan Operasional Sekolah (BOS) meliputi: mengembangkan visi dan misi pendidikan bertaraf internasional, membangun sarana fisik secara lengkap, fasilitas multimedia, asrama terpadu dengan pesantren, melibatkan pakar pendidikan, para kiai pondok pesantren, komite, dan pengurus yayasan dalam mengelola dana madrasah, mempublikasikan secara online dan offline, keunggulan prestasi akademik dan non akademik. Masing-masing madrasah saling menonjolkan keunggulan seperti buku raport online, fasilitas asrama, dan kerjasama dengan pakar pendidikan, perguruan tinggi, pondok pesantren, serta alumni¸ meng-gunakan bahasa agama yang umum digunakan; infaq, sodaqoh, tasyakuran maupun jariyah; (3) keterampilan kepala sekolah dalam menyusun Rencana Anggaran Belanja Sekolah meliputi: menyusun anggaran belanja mengacu hasil evaluasi dan rekomendasi program tahunan sebelumnya; perencanaan mengacu kepada RAPBM, renstra madrasah, dan program yayasan yang melibatkan guru, tata usaha, komite, dewan pakar pendidikan dan yayasan yang disusun secara terbuka dan dilaksanakan dan dilaporkan secara terbuka kepada kementerian agama, pengurus Komite Sekolah dan pengurus yayasan. Pembiayaan pendidikan hasil perencanaan dipublikasikan secara online dan offline; (4) keterampilan Kepala Sekolah dalam menyusun Rencana Anggaran Belanja Sekolah terdiri atas: menyusun anggaran belanja yang mengacu pada hasil evaluasi program kerja akhir tahun, penggunaan dana BOS disampaikan kepada wali murid dan semua pihak, ada dukungan dari komite dan dewan pendidikan pengembangan mutu; madrasah membentuk tim pengembanguntuk menggalang jariyah, infaq dan sadaqah; (5) keterampilan Kepala Sekolah dalam menyusun laporan penggunaan dana Bantuan Operasional Sekolah meliputi: laporan keuangan sekolah sebelum dipublikasikan dikaji dan dievaluasi oleh yayasan, kepala madrasah, bendahara, kepala TU dan kepanitian yang membidangi, dalam proses penggunaan dana selalu terkoordinasi dan termonitoring oleh kepala sekolah, komite, dan pengurus yayasan laporan keuangan madrasah disusun sesuai dengan perencanaan. Kepala madrasah dan komite menyampaikan laporan kepada wali murid secara terbuka, bentuk laporan secara langsung atau melalui pengurus yayasan. Kepala sekolah menunjuk dan memilih komite madrasah untuk mengembangan mutu madrasah. Kepala sekolah selalu berkomunikasi dengan wali murid, komite dan yayasan, semua laporan pengembangan mutu pendidikan dapat diakses oleh semua wali murid sehingga saling mempercayai. Berdasarkan simpulan hasil penelitian diberikan saran kepada: (1) Kepala MTsN 1 Malang, MTsN 2 Malang, dan MTs Ma’arif Singosari Malang, hendaknya dalam menyusun program kerja dan pengembangan madrasah bercermin pada visi dan misi madrasah; (2) bagi Kementrian Agama Kota dan Kabupaten Malang dukungan kepada lembaga pendidikan yang menerapkan pengelolaan dana Bantuan Opersaional Sekolah (BOS); (3) bagi peneliti berikut sebaiknya mengkaji lebih mendalam dengan topik dan fokus atau kasus yang lain; (4) untuk kemajuan ilmu pengetahuan, penelitian ini memberikan kontribusi adanya temuan bahwa dalam penerapan pengelolaan dana Bantuan Operasional Sekolah (BOS) dengan keterampilan manajerial kepala sekolah dapat meningkatkan mutu pendidikan.

Pengembangan model pembelajaran teknik dasar passing dalam bolabasket dengan menggunakan metode permainan tradisional di SMA Negeri 1 Singosari Kabupaten Malang / Ivan Tegar Riantiarno

 

ABSTRAK Riantiarno, Tegar. 2015. Pengembangan Model Pembelajaran Teknik Dasar (Passing) dalam Bolabasket dengan Menggunakan Metode Permainan Tradisional di SMA Negeri 1 Singosari Kabupaten Malang. Skripsi. Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Drs. Oni Bagus Januarto, M.Kes, (II). Usman Wahyudi, S.Pd, M.Pd Kata kunci:Pembelajaran,Mengumpan (Passing)Bolabasket, Permainan Tradisional. Teknik dasar passing sangat penting bagi olahraga bolabasket. Dalam pembelajaran teknik dasar mengumpan yang benar dinilai dapat meningkatkan nilai dan kemampuan siswa. Dari observasi yang dilakukan pada 1 orang guru dan 36 siswa didapati siswa yang kurang mampu untuk melakukan umpan dengan benar. Maka dari itu perlu adanya variasi model pembelajaranpassing dengan metode permainan tradisional untuk meningkatkan kemampuan siswa dalam melakukan umpan dan menambah kesenangan siswa melakukan kegiatan olahraga. Tujuan pengembangan ini adalah untuk menghasilkan sebuah produk berupa buku panduan yang berisi model pembelajaran teknik dasar passing dengan metode permainan tradisionaluntuk siswa kelas XII di SMA Negeri 1 Singosari Kabupaten Malang serta membantu menambah variasi pembelajaran yang diberikan kepada siswa SMA Negeri 1 Singosari Kabupaten Malang. Penelitian ini termasuk jenis penelitian dan pengembangan (research and development). Metode yang digunakan dalam penelitian ini mengacu pada model pengembangan research and development Borg and Gall. Dalam penelitian pengembangan ini teknik analisis data yang digunakan adalah teknik analisis deskriptif kuantitatif berupa persentase, yang digunakan untuk menganalisis hasil pengumpulan datadari penelitian awal (analisis kebutuhan), evaluasi ahli, uji coba kelompok kecil menggunakan 8 atlet dan kelompok besar menggunakan 32 atlet. Hasil penilaian atau evaluasi terhadap model latihan ini yaitu ahli pembelajaran didapatkan persentase 94,64%, dari ahli bolabasket didapatkan persentase 76,78%, dan dari ahli media didapatkan persentase 81,66%. Dari hasil uji coba kelompok kecil didapatkan rata-rata persentase 89,71% dan hasil dari uji coba lapangan (kelompok besar) didapatkan rata-rata persentase 90,95%. Sehingga,model pembelajaran passing dengan metode permainan tradisional ini memenuhi syarat kelayakan untuk digunakan pada pembelajaran olahraga di SMA Negeri 1 Singosari Kabupaten Malang. Diharapkan hasil pengembangan ini dapat diuji cobakan pada kelompok yang lebih luas dan disosialisasikan sehingga dapat digunakan sebagaimana mestinya. Selain itu, diharapkan ada penelitian selanjutnya, untuk menguji tingkat efektifitas produk yang dikembangkan.

Praktek kerja nyata di perusahaan mesin dan cor Antarlina Sempalwadak Kecamatan Bululawang Kabupaten Malang
disusun oleh Rini Endah Winarni

 

Pengaruh variasi suhu sintering terhadap struktur kristal dan sifat histerisis bahan feroelektrik calsium bismuth titanate (CaBi4Ti4O15) / Lija Oktya Artanti

 

Kata Kunci: Histerisis, Struktur kristal, ferroelektrik, CaBi4Ti4O15 Bahan feroelektrik adalah suatu bahan dielektrik nonlinier yang mempunyai sifat polarisasi spontan yang dapat dibalik dengan cara membalikkan arah medan listrik luar E yang diberikan pada bahan tersebut. Bahan keramik feroelektrik CaBi4Ti4O15 dapat digunakan sebagai kapasitor, memori feroelektrik, sensor pyroelektrik, peralatan elektrooptik dan PTC. Selain itu sifat film tipis feroelektrik yang mempunai sifat optik non linier, sehingga bahan CaBi4Ti4O15 dapat digunakan dalam piranti elektronik sebagai modulator dan saklar optik. Penelitian ini bertujuan untuk mengetahui struktur kristal dan sifat Histeresis bahan ferroelektrik Calsium Bismuth Titanate pada berbagai suhu sintering. Pada penelitian ini bahan dasar yang digunakan adalah CaCO3, TiO2 dan Bi2O3. Sampel disintesis dengan metode reaksi padatan (solid state reaction) pada suhu sintering 10000C, 10500C, 11000C selama 6 jam. Sampel ditentukan kurva Histeresisnya menggunakan rangkaian sawyer tower pada suhu ruang. Karakterisasi struktur kristal menggunakan Difraksi Sinar-X (XRD) dan dianalisis menggunakan program GSAS yang berbasis metode Analisis Rietveld. Hasil penelitian menunjukkan bahwa variasi suhu sintering 10000C, 10500C, 11000C selama 6 jam menyebabkan perubahan parameter kisi a, b, c dan volume kristal. Dari nilai FWHM diperoleh nilai tertinggi ada suhu 11000C yaitu sebesar 0.20 dan nilai terendah pada suhu 10500C sebesar 0.17. Hal itu menunjukkan bahwa kualitas kristal paling bagus ditunjukkan oleh sampel yang mempunyai nilai FWHM paling rendah, yaitu pada suhu 10500C sebesar 0.17.

Laporan perhitungan tugas beton bertulang
oleh Subagyo Utomo

 

Pengaruh pemberian warming up masage olahraga sebagai tambahan pemanasan pasif terhadap daya tahan cardiovascular pemain ekstrakurikuler bolabasket di SMP Negeri 8 Malang / Rizki Buwono

 

ABSTRAK Buwono, Rizki. 2015. Pengaruh Pemberian Warming Up Masase Olahraga Sebagai Tambahan Pemanasan Pasif Terhadap Daya Tahan Cardiovascular Pemain Ekstrakurikuler Bolabasket di SMP Negeri 8 Malang. Skripsi, Program Studi Pendidikan Jasmani dan Kesehatan, Program Sarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Asim, M.Pd dan (II) Drs. Supriatna, M.Pd. Kata Kunci: Bolabasket, daya tahan cardiovascular, pemanasan pasif, masase olahraga. Bolabasket merupakan salah satu permainan terpopuler di Dunia. Dalam permainan bolabasket diperlukan keterampilan-keterampilan dasar dan olahraga tim mulai dari pemanasan, olah bola, mengumpan, menembak, taktik dan kerja sama tim. Olahraga ini termasuk olahraga gabungan antara aerobic dan anaerobic. Karena dalam permainan ini mempunyai tempo permainan yang cepat maka memerlukan daya tahan cardiovascular dan kondisi fisik yang baik agar dapat bermain bagus. Untuk menyiapkan kondisi fisik salah satunya perlu dilakukan pemanasan pasif. Dalam melakukan pemanasan pasif dapat menggunakan masase olahraga. Peranan masase olahraga dalam pemanasan dapat membuka pembuluh darah sehingga darah mengalir lebih cepat sehingga jantung bisa berjalan dengan optimal, memperlancar distribusi energi ke dalam jaringan, sehingga kinerja jantung, paru-paru, dan peredaran darah serta menyiapkan kondisi fisik sebaik mungkin. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian masase olahraga sebagai pemanasan pasif. Penelitian ini adalah eksperimen sungguhan. Populasi penelitian adalah pemain ekstrakurikuler bolabasket SMP Negeri 8 Malang sebanyak 30 pemain. Pengelompokan untuk kelas yang diberi perlakuan dan kelompok kontrol menggunakan teknik matching sampling. Teknik pengumpulan data menggunakan pretest posttest. Analisis data untuk melengkapi hipotesis digunakan uji Anava satu arah dengan taraf 0,05 sebelum dilakukan uji anava dilakukan uji normalitas dan homogenitas. Hasil Analisis sebagai berikut : (1) Tambahan pemanasan pasif berupa masase olahraga berpengaruh terhadap daya tahan cardiovascular dengan rata-rata nilai untuk pretest 32,61 dan untuk posttest 35,47, (sig=0,000). Berdasarkan temuan tersebut diperoleh sig < 0,05 maka Ho ditolak. (2) Kelompok tanpa perlakuan mempunyai rata-rata daya tahan untuk nilai pretest 32,00 dan untuk posttest 32,95, (sig=0,028). Berdasarkan temuan tersebut diperoleh sig > 0,05 maka Ho diterima. (3) Kelompok pemberian tambahan pemanasan pasif berupa masase olahraga mempunyai pengaruh lebih baik dengan nilai rata-rata tes akhir 35,47 dibandingkan dengan kelompok tanpa perlakuan dengan nilai rata-rata 32,95 dengan sig < 0,05. Kesimpulan dari penelitian ini adalah pemberian pemanasan pasif berupa masase olahraga berpengaruh baik terhadap daya tahan cardiovascular dibandingkan kelompok tanpa pemberian pemanasan pasif.

Pengairan
tugas
oleh Achfandy

 

Persepsi mahasiswa dalam memilih pekerjaan berdasarkan kriteria pekerjaan dengan metode penskalaan dimensi ganda / Pramesti Widyaningtyas

 

Pengembangan latihan teknik dasar sikap pasang dan jatuhan pencak silat untuk ekstrakurikuler Perguruan satria Tunggal di SMA Negeri 1 dan 2 Lamongan melalui buku panduan latihan / Denox Rochmawati

 

Kata kunci: Pengembangan, teknik dasar Sikap Pasang dan Jatuhan pencak silat, ekstra kurikuler Perguruan Satria Tunggal, Buku Panduan Latihan. Pada latihan ekstrakurikuler pencak silat di SMA Negeri 1 dan 2 Lamongan ini masih sangat kurang media pembelajarannya, bahkan belum pernah menggunakan media pembelajaran untuk latihan, dan dipilihnya Buku Panduan Latihan karena fasilitas dari sekolahan tidak menyediakan alat-alat elektronik misalnya: laptop, LCD, proyektor, dan lain sebagainya Dengan adanya pengembangan Buku Panduan Latihan ini bertujuan agar peserta ekstrakurikuler lebih tertarik dan bersemangat baik dari segi isi Buku Panduan Latihan ataupun cara berlatih karena pelatih lebih bisa bervariasi dalam dalam menyampaikan teori, sehingga mempermudah dan mempercepat peserta untuk memahami teknik dasar sikap pasang dan jatuhan pencak silat. Metodelogi penelitian mengacu pada pengembangan research and development dari Borg dan Gall (1983:775), tetapi pada pengembangan ini peneliti hanya mengembangkan 8 langkah yaitu (1) observasi awal, (2) rancamgan produk, (3) evaluasi oleh ahli, (4) uji coba kelompok kecil 10 peserta, (5) revisi produk pertama, (6) uji coba kelompok besar 30 peserta, (7) revisi produk kedua, (8) hasil akhir produk. Berdasarkan hasil observasi awal, diperoleh hasil bahwa semua pelatih (3 orang) menyatakan bahwa yang penting dikembangkan adalah Sikap Pasang daripada teknik yang lain dan mereka memerlukan media pembelajaran dalam bentuk Buku Panduan Latihan. Sedangkan peserta ekstrakurikuler 37,5% memilih Jatuhan sebagai materi yang ingin dipelajari dan 40% peserta memilih Buku Panduan Latihan pada media pembelajarannya. Sehingga peneliti mengembangkan Teknik Dasar Sikap Pasang dan Jatuhan Pencak Silat dalam bentuk media pembelajaran Buku Panduan Latihan. Poduk awal yang telah dijustifikasi oleh Dosen Pembimbing 1 dan 2, pada aspek Teknik Dasar Sikap Pasang diperoleh persentase 80,14% sedangkan dari ahli pencak silat diperoleh persentase 83,61% dan pada aspek Teknik Dasar Jatuhan diperoleh persentase 79,33% sedangkan dari ahli pencak silat diperoleh persentase 91,95% dengan hasil akhir menunjukkan bahwa pengembangan tersebut dapat diuji cobakan di ekstrakurikuler pencak silat Perguruan Satria Tunggal SMA Negeri 1 dan 2 Lamongan. Dari hasil uji coba kelompok kecil dengan jumlah 10 peserta diperoleh persentase 94,74%, dan pada uji coba kelompok besar dengan jumlah siswa 30 peserta diperoleh persentase 99,16, sehingga Buku Panduan Latihan Teknik Dasar Sikap Pasang dan Jatuhan ini digunakan di ekstrakurikuler pencak silat Perguruan Satria Tunggal SMA Negeri 1 dan 2 Lamongan.

Studi kemampuan adsorpsi ion Cr(VI) oleh serbuk arang tempurung kelapa dan serbuk biji buah kelor / Retnaningtyas dewi Lestyana

 

ABSTRAK Lestyana, Retnaningtyas Dewi. 2010. Studi Kemampuan Adsorpsi Ion Cr(VI) oleh Serbuk Arang Tempurung Kelapa dan Serbuk Biji Buah Kelor. Skripsi, Jurusan Kimia FMIPA Universitas Negeri Malang. Pembimbing (1) Dra. Hayuni Retno Widarti, M.Si. (II) Neena Zakia, S.Si., M.Si. Kata kunci: adsorpsi, arang tempurung kelapa, biji buah kelor, ion Cr(VI) Adsorpsi merupakan proses penarikan komponen dari campuran gas atau cairan dimana komponen yang akan dipisahkan ditarik oleh permukaan adsorben. Proses adsorpsi dipengaruhi oleh banyak faktor antara lain massa adsorben, waktu kontak adsorben, dan konsentrasi adsorben. Adanya sumber pencemar yang berasal dari proses industri berupa logam berat seperti Cr(VI) dapat menimbulkan masalah terhadap lingkungan dan makhluk hidup lainnya sehingga diperlukan suatu cara untuk mengurangi kadar Cr(VI) di lingkungan. Penelitian ini bertujuan untuk mengetahui kondisi optimum analisis (berat adsorben, waktu kontak dan konsentrasi adsorben) dan berapa besar kemampuan daya adsorpsi pada serbuk arang tempurung kelapa dan serbuk biji kelor dalam menurunkan kadar ion logam Cr(VI) dengan metode batch (perendaman). Penelitian yang dilakukan merupakan penelitian eksperimental dan dilakukan di laboratorium Kimia Jurusan Kimia FMIPA Universitas Negeri Malang dengan analisis AAS di laboratorium Kimia Analitik FMIPA Universitas Gajah Mada. Variabel bebas dalam penelitian adalah arang tempurung kelapa dan biji buah kelor, sedangkan variabel terikatnya adalah massa optimum, waktu kontak optimum, dan konsentrasi optimum. Arang tempurung kelapa yang digunakan diperoleh dengan cara karbonasi pada 350°C selama 1,5 jam. Ukuran arang tempurung kelapa dan biji buah kelor adalah 20-40 mesh, dengan variasi massa 0,5; 1; dan 2 gram, waktu kontak 0,5; 1; dan 2 jam dan konsentrasi sebesar 5, 10, 25, dan 50 ppm. Teknik yang digunakan adalah batch, yaitu larutan adsorbat yang telah dicampur dengan adsorben (serbuk arang tempurung kelapa atau serbuk biji buah kelor) dikocok menggunakan shaker berkecepatan 100 rpm dengan masing-masing variasi massa adsorben, waktu kontak, dan konsentrasi yang telah ditentukan. Konsentrasi ion Cr(VI) sebelum dan sesudah proses adsorpsi diukur menggunakan AAS. Hasil penelitian menunjukkan pada kondisi optimum analisis serbuk arang tempurung kelapa diperoleh massa optimum sebesar 1,009 gram, waktu kontak pada 1,0 jam, konsentrasi optimum pada 10 ppm dan persen teradsorpsi sebesar 52,94 %, sedangkan pada kondisi optimum analisis serbuk biji buah kelor diperoleh data massa optimum pada 2,032 gram, waktu kontak pada 1,0 jam dan konsentrasi optimum pada 5 ppm dengan kemampuan adsorpsi sebesar 94,58 %.

Studi keanekaragaman lichen di daerah Batu-Malang / Wawan Hermanto

 

Pengaruh pengumuman penerbitan obligasi dan right issue terhadap abnormal return saham pada perusahaan yang tercatat di Bursa Efek Indonesia (periode 2006-2008) / Ririn Suryani

 

Kata Kunci: Pengumuman Penerbitan Obligasi, Pengumuman Right Issue, Abnormal Return Saham. Beberapa penelitian menunjukkan reaksi pasar yang berbeda-beda karena suatu pengumuman penerbitan obligasi dan right issue. Sehingga perlu dianalisa lebih dalam mengenai seberapa jauh pasar bereaksi terhadap pengumuman penerbitan obligasi dan right issue sehingga mampu mempengaruhi abnormal return saham. Penelitian ini bertujuan mengetahui pengaruh pengumuman penerbitan obligasi dan right issue terhadap abnormal return saham pada perusahaan yang tercatat di Bursa Efek Indonesia periode 2006-2008. Penelitian ini merupakan penelitian eksplanatif. Teknik pengambilan sampel dilakukan dengan metode purposive sampling. Sampel yang digunakan dalam penelitian ini adalah seluruh perusahaan yang melakukan pengumuman penerbitan obligasi dan right issue di Bursa Efek Indonesia serta merupakan saham yang aktif diperdagangkan pada periode 2006-2008. Alat analisis yang digunakan untuk menguji hipotesis dalam penelitian ini adalah statistik non parametrik Wilcoxon Sign Rank Test karena data yang digunakan dalam proses analisis tidak memenuhi asumsi kenormalan distribusi. Hasil penelitian ini menunjukkan bahwa variabel pengumuman penerbitan obligasi dan right issue tidak mempunyai pengaruh yang signifikan terhadap abnormal return saham. Hal ini mengindikasikan bahwa informasi tentang pengumuman penerbitan obligasi dan right issue tidak memiliki kandungan informasi yang cukup untuk mempengaruhi investor dalam keputusan investasinya. Berdasarkan hasil penelitian ini, disarankan agar untuk penelitian selanjutnya perlu mempertimbangkan pemilihan jenis dan jumlah sampel yang lebih representatif dengan periode yang lebih panjang, sehingga dapat diamati variasi antar waktunya dan hasilnya bisa lebih kuat untuk digeneralisasikan. Selain itu sebaiknya menggunakan variabel yang berbeda dari penelitian ini, seperti misalnya menguji pengaruh pengumuman penerbitan obligasi dan right issue terhadap perubahan struktur modal. Sehingga dapat memberikan kontribusi yang penting baik bagi ilmu pengetahuan maupun masalah-masalah praktis.

Laporan perhitungan tugas konstruksi beton
disusun oleh Yohanes Hadi Soesilo

 

Hubungan antara kemampuan manajemen waktu dan dukungan sosial dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar / Rochman Prasetyo

 

ABSTRAK Prasetyo, Rochman. 2015. Hubungan antara Kemampauan Manajemen Waktu dan Dukungan Sosial dengan Prestasi Menggambar teknik Program Studi Keahlian Teknik Bangunan di SMK Negeri 1 Blitar. Skripsi, Program Studi Pendidikan Teknik Bangunan, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dr. R.M Sugandi, S.T., M.T. (2) Drs. Priyono, M.Pd. Kata kunci: Manajemen Waktu, Dukungan Sosial, Prestasi Menggambar Teknik Prestasi belajar yang tinggi dalam menggambar teknik tidak sekedar menimbulkan rasa puas dan bangga, namun sekaligus menggambarkan sejauh mana tingkat keberhasilan belajar siswa dalam menempuh mata pelajaran tersebut. Mata pelajaran menggambar teknik sering menjadi masalah bagi siswa. Banyak faktor yang mempengaruhi terjadinya masalah dalam menggambar teknik oleh siswa, seperti belajar kurang teratur, kurang disiplin dalam mengatur waktu, dan kurangnya dukungan dari keluarga serta guru dan teman di sekolah. Tujuan penelitian ini adalah (1) untuk mengetahui adakah hubungan antara manajemen waktu dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar (2) untuk mengetahui adakah hubungan antara dukungan sosial dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar (3) untuk mengetahui adakah hubungan antara manajemen waktu dan dukungan sosial dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar. Penelitian ini termasuk penelitian korelasional dengan pendekatan kuantitatif. Populasi penelitian ini adalah siswa yang menempuh mata pelajaran gambar teknik Program Studi Keahlian Teknik Bangunan di SMK Negeri 1 Blitar Tahun Ajaran 2014/2015. Teknik pengumpulan data menggunakan kuesioner dan dokumentasi. Teknik analisis data menggunakan analisis statistik deskriptif dan analisis regresi linier ganda. Berdasarkan hasil analsis data, diperoleh tiga simpulan sebagai berikut. Pertama, terdapat hubungan positif yang signifikan antara manajemen waktu dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar. Kedua, terdapat hubungan positif yang signifikan antara dukungan sosial dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar. Dan ketiga, terdapat hubungan positif yang signifikan antara manajemen waktu dan dukungan sosial dengan prestasi menggambar teknik program studi keahlian teknik bangunan di SMK Negeri 1 Blitar.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |