Manajemen kurikulum dan pembelajaran bermuatan nilai-nilai karakter (studi multi kasus pada SMP Pembaharuan, SMP Pembangunan, dan SMP Pengembangan di Kota Surakarta) / Maryadi

 

ABSTRAK Tujuan penelitian ini adalah untuk(1) mengetahui dasar-dasar kurikulum, (2) mendeskripsikan penyiapan kurikulum,(3) mengkaji penyiapan guru pelajaran,(4) mengkaji pelaksanaan pembelajaran, dan (5)mendeskripsikan evaluasi kurikulum. Penelitian ini adalah kualitatif dengan rancangan studi multi kasus. Peneliti adalah instrumen utama. Teknik sampling adalah snowball sampling. Pengumpulan data menggunakan: wawancara mendalam, observasi-partisipan, dan studi dokumen. Subyek penelitian ini adalah Mantan Kasubdin SMP, Mantan Kepala Sekolah, Kepala Sekolah, Wakil Kepala Sekolah, dan Guru. Pengecekan keabsahan datamenggunakan uji kredibilitas. Teknik analisis lintas kasus adalah constant-comparative model Glaser dan Strauss (1967). Hasil penelitian menunjukkan bahwa: (1) dasar-dasar kurikulum mencakup: dasar sosiologis, filosofis, psikologis, danteknis,(2) Penyiapan kurikulum menghasilkan perangkat pembelajaran. (3) Penyiapan guru berupa pengenalan materi dan pelatihan metode pembelajaran, 4) Pelaksanaan pembelajaran meliputi: (a) tujuan pembelajaran: menanamkan nilai moral, membiasakan perilaku, dan mencegah perilaku tercela; (b) materi pembelajaran: ketuhanan, diri sendiri, lingkungan sosial, dan spiritualitas; (c) metode pembelajaran: student-centered learning dan pembiasan; (d) sarana-prasarana dan media pembelajaran: mushola, Lab. Budi Pekerti, kantin kejujuran, multi media, bahan cetak, dan obyek fisik. (e) evaluasi pembelajaran: observasi, skala sikap, dan laporan wali kelas; (f) dampak pembelajaran bersifat individual dan institusional. (5) Evaluasi kurikulumuntuk mengetahui kendala pembelajaran. Kata Kunci: manajemen, kurikulum, pembelajaran, dan karakter

Pergerakan wanita dalam organisasi Aisyiyah Daerah Malang 1968-1995 / Nur Laili Rohmah

 

Kata Kunci : Pergerakan Wanita, Organisasi Aisyiyah, Daerah Malang Pergerakan wanita memiliki kedudukan penting dalam kajian sejarah wanita. Berbagai jalan dilakukan oleh para wanita dalam melakukan pergerakan, salah satunya adalah dengan membentuk kelompok atau organisasi. Namun, kondisi ini sedikit ironis, karena kajian sejarah pergerakan wanita masih belum banyak diminati oleh sejarawan. Khususnya sejarah pergerakan wanita yang ada di daerah. Latar belakang inilah yang mendorong peneliti untuk melakukan penelitian tentang pergerakan wanita yang tergabung dalam organisasi Aisyiyah Daerah Malang. Rumusan masalah dalam penelitian ini adalah sebagai berikut : 1) Bagaimana kondisi umum organisasi Aisyiyah di Daerah Malang pada tahun 1968-1995?, 2). Bagaimana pergerakan organisasi Aisyiyah di Daerah Malang pada tahun 1968-1995?, 3). Apa nilai pendidikan yang terkandung dari Pergerakan Organisasi Aisyiyah Daerah Malang?. Tujuan penelitian ini adalah : 1). Mengetahui kondisi umum organisasi Aisyiyah di Daerah Malang pada tahun 1968-1995. 2). Mengetahui pergerakan organisasi Aisyiyah di Daerah Malang pada tahun 1968-1995. 3). Mengetahui nilai pendidikan yang terkandung dari Pergerakan Organisasi Aisyiyah Daerah Malang. Penelitian ini merupakan penelitian sejarah dengan menggunakan pendekatan sosial. Mulai dari pemilihan topik, heuristik, kritik, interpretasi hingga historiografi. Pemilihan topik menggunakan dua pendekatan yaitu kedekatan emosional dan intelektual. Heuristik adalah pengumpulan sumber-sumber sejarah yang terdiri dari sumber primer, skunder, dan lisan. Kritik (verifikasi) sumber dilakukan dengan dua cara yaitu kritik eksternal dan kritik internal. Interpretasi, dilakukan dengan dua cara yaitu analisis dan sintesis. Hasil interpretasi kemudian dituangkan dalam bentuk tulisan yang disusun secara kronologis. Hal ini biasa dikenal dengan istilah historiografi yang merupakan tahap akhir dari penelitian. Hasil penelitian ini dapat diketahui bahwa perjuangan pergerakan pengurus dan anggota organisasi Aisyiyah Daerah Malang, diterima dengan baik oleh masyarakat dengan adanya perkembangan organisasi Aisyiyah dari segi kuwalitas maupun kuantitas amal usahanya. Pergerakan organisasi Aisyiyah menggunkan strategi berkemajuan yaitu strategi yang mengikuti perkembangan zaman. Strategi tersebut antara lain, merintis berdirinya amal usaha, mengembangkan amal usaha, menata sistem salah satunya dengan melakukan pengkaderan, menata peta dakwah agar memudahkan pelaksanaannya, memahamkan gerakan, dan mensinkronkan program dari pusat dengan potensi daerah. Perjuangan pergerakan pengurus dan anggota organisasi Aisyiyah Daerah Malang, dilakukan dengan dua jalan yaitu melalui amal usaha organisasi dengan pengadakan pengajian untuk menambah pengetahuan agama Islam, mendirikan sekolah, rumah sakit, panti asuhan dan koperasi. Selain itu perjuangan pergerakan di luar amal usaha organisasi dilakukan dengan mendirikan mushola wanita, mendirikan Jamiatul Ummahat mendirikan, Rukun Kebahagian Wanita (RKW), merintis berdirinya Gabungan Organisasi Wanita Indonesia (GOWI), dan juga mengisi pengajian di Lapas Wanita Lowokwaru. Dalam menjalankan perjuangan pergerakannya organisasi Aisyiyah memiliki beberapa hambatan yaitu perbedaan pandangan dalam hal ibadah dengan sebagian masyarakat. Sedang dalam organisasi Aisyiyah sendiri adalah masalah kaderisasi dan rangkap jabatan dalam kepengurusan. Meskipun demikian para wanita dalam organisasi Aisyiyah Daerah Malang berusaha mengatasi hambatan tersebut. Pergerakan wanita dalam Organisasi Aisyiyah dapat dijadikan kajian materi penunjang dalam mata pelajaran IPS pada kelas IX dengan Standar Kompetensi 7. Memahami perubahan pemerintahan dan kerjasama internasional. Kompetensi Dasar 7.3 Menguraikan perilaku masyarakat dalam perubahan sosial-budaya di era global dengan materi, Perubahan Perilaku dalam Masyarakat. Materi Perubahan perilaku dalam Masyarakat menejelaskan tentang perubahan yang terjadi dalam kehidupan masyarakat. Saran bagi peneliti lain yang juga tertarik untuk meneliti tentang oragnisasi Aisyiyah Daerah Malang, baik organisasi Aisyiyah yang berada di Kota Malang maupun Kabupaten Malang sebagai tema skripsi, Masih banyak topik bahasan yang dapat dikaji dengan batasan waktu tertentu. Dengan demikian kita dapat mengetahui bentuk-bentuk perjuangan pergerakan kaum wanita yang tergabung dalam sebuah organisasi.

Identifikasi kapang kontaminan pada emping melinjo yang diprodiksi oleh beberapa industri kecil di Kabupaten Pacitan / oleh Rachma Hidayanti

 

Pengaruh media internet dan fitur copy paste terhadap motivasi siswa dalam menyelesaikan tugas sekolah / Agus Prasetyo Irtanto Wilaksono

 

ABSTRAK Prasetyo, Agus, 2015. Pengaruh Media Internet dan Fitur Copy Paste Terhadap Motivasi Siswa Dalam Menyelesaikan Tugas Sekolah. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (1) Dr. Cipto Wardoyo, S.E., M.Pd., M.Si., Ak. CA. (2) Dr. Sunaryanto, M.Ed. Kata Kunci : Media Internet, Fitur Copy Paste Dan Motivasi Siswa. Media internet sering digunakan siswa sebagai sumber belajar tambahan untuk membantu dalam menyelesaikan tugas sekolah. media internet memudahkan siswa untuk mencari informasi yang dibutuhkan. Selain media internet siswa juga sering memanfaatkan fitur copy paste untuk menyalin informasi yang didapatkan. fitur copy paste membantu siswa mempercepat dalam menyalin sebuah informasi tanpa harus menulis kembali. Penelitian ini bertujuan untuk mengetahui pengaruh media internet terhadap motivasi siswa dalam menyelesaikan tugas sekolah dan untuk mengetahui pengaruh fitur copy paste terhadap motivasi siswa dalam menyelesaikan tugas sekolah. Penelitian ini menggunakan pendekatan kuantitatif dengan metode eksplanasi. Populasi yang digunakan adalah kelas X jurusan akuntansi SMK Negeri 1 Panji Situbondo yang berjumlah 99 siswa dengan jumlah sampel 50 siswa. Pengumpulan data menggunakan kuesioner dan teknik analisis yang digunakan adalah uji validitas, uji reliabilitas, uji normalitas, analisis regresi berganda, uji heterokedastisitas, dan uji t. Hasil penelitian menunjukkan bahwa variabel media internet tidak berpengaruh terhadap motivasi siswa dalam menyelesaikan tugas sekolah. hal tersebut membuktikan bahwa motivasi siswa tidak terpengaruh oleh media internet. Sedangkan pada variabel fitur copy paste menunjukkan bahwa ada pengaruh fitur copy paste terhadap motivasi siswa dalam menyelesaikan tugas sekolah. hal tersebut membuktikan bahwa fitur copy paste mempengaruhi motivasi siswa dalam menyelesaikan tugas sekolah. Kesimpulan penelitian ini yaitu media internet tidak mempengaruhi motivasi siswa dalam menyelesaikan tugas sekolah. fitur copy paste memiliki pengaruh untuk meningkatkan motivasi siswa dalam menyelesaikan tugas sekolah.

Upacara adat perkawinan priyayi di Desa Ngembal Kecamatan Tutur Kabupaten Pasuruan / Linda Puji Astuti

 

Kata kunci: Upacara adat perkawinan priyayi, pelaksanaan Upacara perkawinan adat priyayi merupakan perkawinan yang menggunakan adat Jawa bersifat monogami. Namun demikian perkawinan seorang suami dengan lebih dari satu seorang istri dapat dilakukan apabila dipenuhi dengan persyaratan tertentu. Berdasarkan Undang-Undang Nomor 1 Tahun 1974 dan peraturan pemerintah Nomor 9 Tahun 1975 dalam Pasal 4 ayat 2 Undang-Undang Nomor 1 Tahun 1974 tentang Perkawinan dijelaskan bahwa seorang pria yang bermaksud kawin lebih dari satu orang harus ada alasan-alasan yaitu: (a) tidak dapat menjalankan kewajibannya sebagai istri; (b) istri mendapat cacat badan atau penyakit yang tidak dapat disembuhkan; (c) istri tidak dapat melahirkan keturunan. Undang-Undang Nomor 1 Tahun 1974 pasal 5 ayat 1 tentang Perkawinan dijelaskan bahwa untuk dapat mengajukan permohonan kepada Pengadilan, sebagaimana dimaksud dalam Pasal 4 ayat (1) Undang-undang ini, harus dipenuhi syarat-syarat sebagai berikut: (a) adanya persetujuan dari isteri/isteri-isteri; (b) adanya kepastian bahwa suami mampu menjamin keperluan-keperluan hidup isteri-isteri dan anak-anak mereka; (c) adanya jaminan bahwa suami akan berlaku adil terhadap isteri-isteri dan anak-anak mereka. Perkawinan merupakan hal yang sakral sehingga sebelum melaksanakan perkawinan perlu dipertimbangkan. Upacara perkawinan priyayi menggunakan adat Jawa. Upacara adat perkawinan priyayi tidak berubah meskipun dengan perubahan zaman dan perkembangan. Tujuan penelitian ini adalah untuk mendiskripsikan tentang pelaksanaan upacara adat perkawinan priyayi. Ada tiga hal yang dideskripsikan sehubungan dengan pelaksanaan upacara adat perkawinan priyayi, antara lain (1) sistem perkawinan priyayi di Desa Ngembal Kecamatan Tutur Kabupaten Pasuruan; (2) tradisi yang dilakukan sebelum perkawinan dilaksanakan; (3) pelaksanaan prosesi upacara adat perkawinan priyayi di Desa Ngembal Kecamatan Tutur Kabupaten Pasuruan. Dalam mencapai tujuan tersebut, peneliti menggunakan pendekatan kualitatif, peneliti mecari data dari informan yang terdiri dari Bapak Cahyono, Bapak Yusman Ibu Danis, Ibu Fitri selaku keluarga priyayi dan tokoh masyrakat. Kegiatan pengumpulan data dilakukan dengan menggunakan observasi partisipasi, wawancara, dokumentasi, kajian pustaka. Analisis yang dilakukan dengan cara: reduksi data, display data, pengambilan keputusan dan verifikasi. Kegiatan analisis data dilakukan selama maupun proses pengumpulan data. Analisis data dalam penelitian kualitatif, dimulai sejak peneliti datang ke lokasi penelitian. Untuk mengkaji keabsahan data yang ditemukan, peneliti daatng ke lokasi penelitian. Untuk menguji keabsahan data yang ditemukan, peneliti melakukan pengecekan keabsahan antara lain: perpanjangan keikutsertaan, triangulasi, ketekunan pengamat, pemeriksaan sejawat. Hasil penelitian menunjukkan bahwa: (1) sistem perkwainan priyayi di Desa Ngembal Kecamatan Tutur Kabupaten Pasuruan menunjukkan sistem perkawinan monogami; (2) terdapat tradisi yang dilakukan sebelum perkawinan dilaksanakan antara lain: (a) nontoni, merupakan pihak laki-laki sendiri ataupun pihak keluarga menanyakan terlebih dahulu apakah si perempuan tersebut sudah mempunyai pilihan untuk dijadikan pendamping atau belum dan anak perempuan bersedia untuk dipinang oleh laki-laki tersebut atau tidak; (b) lamaran, meneruskan pembicaraan pada waktu nontoni; (c) ningseti, mengencangkan tali ikatan apabila lamaran telah diterima oleh pihak keluarga perempuan; (c) sengkeran, pengamanan sementara bagi calon pengantin putra dan putri sampai upacara panggih selesai yang ditempatkan di lingkungan atau tempat khusus yang aman dan tidak diperkenankan meninggalkan lingkungan sengkeran; (d) siraman, upacara mandi kembang bagi calon pengantin wanita dan pria sehari sebelum upacara panggih; (e) langkahan, meminta izin dan moho doa restu untuk mendahului kawin; (f) ngerik, menghilangkan bulu halus sekitar dahi agar tampak bersih dan wajahnya menjadi bercahaya; (g) midodareni, mengharapkan berkah Tuhan Yang Mahaesa agar memberikan keselamatan kepada pemangku hajat pada perhelatan hari berikutnya; (h) nyantrik, calon mempelai pria tidak diajak pulang dan menyerahkan tanggung jawab kepada orang tua calon mempelai putri, (i) maskawin, pemberian dari calon pengantin laki-laki kepada calon pengantin perempuan berupa uang, barang-barang, ataupun perhiasan; (3) pelaksanaan prosesi upacara adat perkawinan priyayi di Desa Ngembal Kecamatan Tutur Kabupaten Pasuruan. Berdasarkan hasil penelitian sebagai berikut: perkawinan adat priyayi menggunakan adat perkwainan Jawa. Tradisi perkawinan dalam keluarga priyayi tidak berubah meskipun dengan perubahan zaman dan perkembangan. Oleh karena itu upacara adat perkawinan priyayi dengan menggunakan adat Jawa harus tetap dijaga dan dipertahankan. Perkawinan adat Jawa diharapkan tidak hanya kalangan priyayi yang menggunakan prosesi adat Jawa secara menyeluruh akan tetapi diharapkan masyarakat Indonesia khususnya masyarakat Jawa. Prosesi perkawinan Jawa perlu dijaga dan dilestarikan dengan cara belajar, memahami makna yang terkandung dalam tradisi serta melakukan tradisi tersebut.

Constructing a written test for the integrated course of the English Departement of Widya Mandala University / by Agnes Santi Widiati

 

Efektivitas penerapan modul tatanama senyawa biner dan anion poliatomik berbasis konsep sukar dan kesalahan konsep pada pemahaman dan persepsi peserta didik kelas X IPA SMAN 8 Malang / Putri Mustikasari

 

ABSTRAK Mustikasari, P. 2015. Efektivitas Penerapan Modul Tatanama Senyawa Biner dan Anion Poliatomik Berbasis Konsep Sukar dan Kesalahan Konsep pada Pemahaman dan Persepsi Peserta Didik Kelas X IPA SMAN8 Malang. Skripsi, Jurusan Kimia, FMIPA, Universitas Negeri Malang. Pembimbing: (I) Dr. Fariati, M. Sc., (II) Oktavia Sulistina, S.Pd., M. Pd. Kata kunci: modul tatanama senyawa, konsep sukar, kesalahan konsep, pemahaman,persepsi Tatanama senyawa biner dan anion poliatomik merupakan konsep dasar yang perlu dipahami dengan benar sebelum peserta didik mempelajari penulisan persamaan reaksi.Kesulitan yang dialami peserta didik dalam memahami konsep tatanama senyawa biner dan anion poliatomik dapat menimbulkan konsep sukar. Jikakonsepsukarterjadiberulang-ulangdanterusmenerusmakadapat me-nyebabkankesalahan konsep.Hasil observasi menunjukkansebanyak 54 peserta didik kelas X IPA SMAN 8 Malang mendapat nilai di bawah Kriteria Ketuntasan Minimal (KKM) pada ulangan hariantatanama senyawa kimia, sehingga belum mencapai ketuntasan belajar.Hal tersebutterjadikarena peserta didik mengalami konsep sukar dan kesalahan konsep. Peserta didik yang belum tuntas harus mengikuti pembelajaran remedial.Berdasarkan observasi, pembelajaran remedial yang dilakukan yaitu dengan pemberian latihan soal atau langsung diberikan ulangan remedial. Pembelajaran remedial dapat dilaksanakan dengan metode dan media yang berbeda dan pemberian latihan-latihan secara khusus.Salah satu penyebab peserta didik mengalami konsep sukar dan kesalahan konsep dimungkinkan karena bahan ajar yang kurang sesuai.Penelitian yang dilakukan,merupakan tahap lanjutan dari penelitian dan pengembangan modul berbasis konsep sukar dan kesalahan konsepdengan persentase kelayakan sebesar 86,67% (sangat valid)padapembelajaran remedial.Tujuan penelitian adalah men-deskripsikan keterlaksanaan pembelajaran, ketuntasan belajar, pemahaman, persepsi peserta didik, dan mengetahuiefektivitas modul dibanding latihan soal. Penelitian yang dilakukan adalah eksperimen murnidengan desaingrup kontrol pretes-postes.Sebanyak 54 peserta didik yang belum tuntas dibagi secara acak kemudian diambil 36 peserta didik sebagai sampel penelitian, sehingga didapat masing-masing 18 peserta didik di kelas eksperimen dibelajarkan denganbantuan modul dan kelas kontrol yang dibelajarkan denganbantuan latihan soal.Instrumen perlakuan yang digunakan adalah RPP, modul tatanama senyawa biner dan anion poliatomik berbasis konsep sukar dan kesalahan konsep, dan latihan soal. Instrumen pengukuran yang digunakan adalah tes diagnostik dengan validitas 92,3% (sangat valid) dan reliabilitas sebesar 0,687 (baik), angket persepsi peserta didik, dan lembar observasi keterlaksanaan pembelajaran. Teknik analisis statistik yang digunakan adalah uji-t dengan taraf signifikansi sebesar 0,050dandidukungperhitungangainternomalisasi. Hasil penelitian dilaporkan bahwa peserta didik yang dibelajarkan denganbantuan modul tatanama senyawa biner dan anion poliatomik dan bantuan latihan soal pada keterlaksanaan pembelajaran, ketuntasan belajar, penurunan persentase jawaban salah serta persentasekesalahanberturut-turut adalah 95,2% (baik) dan 88,6% (baik); 77,8% dan 38,9%;46,8% dan 34,3%; serta 13,2% dan 9,7%.Hasil uji-t (sig. (2-tailed) = 0,045) membuktikan bahwaada perbedaan pemahamanantara peserta didik kelas X IPA SMAN 8 Malang yang belum tuntas yang dibelajarkan denganbantuan modul dan latihan soal.Perhitungangainternomalisasimenunjukkanpemahamanpesertadidik yang dibelajarkandenganmoduldanlatihansoalberturut-turutadalahtinggi (0,74) dansedang(0,55). Darihasilanalisis data dapat disimpulkan bahwa modul tatanama senyawa biner dan anion poliatomik berbasis konsep sukar dan kesalahan konsep efektif digunakan sebagai bahan ajaruntuk meningkatkan pe-mahaman peserta didik.Persepsi peserta didik terhadap isi (83,8%) dan pem-belajaran menggunakan modul (77,1%) sangat positif. Hambatan pembelajaran adalah waktu yang terlalu singkat (58,3%) dan uraian materi dalam modul terlalu banyak (27,9%), sehingga peserta didik menyarankan modul boleh digandakan atau dibawa pulang (50,0%) dan uraian materi yang diberikan lebih ringkas (38,5%).Peserta didik perlu diajari cara membaca bahan ajar dengan tuntas, sehingga dapat memahami konsep kimia dengan utuh.

Status pekerjaan orang tua dan rencana pemilihan kelanjutan studi siswa kelas II SMP Negeri II Nganjuk studi kasus siswa dari kalangan keluarga kelas menengah ke bawah / oleh Eni Suswati

 

Kesulitan mahasiswa dan proses scaffolding dalam mengaplikasikan integral tentu pada volume benda putar / Imam Fahchruddin

 

ABSTRAK Fahcruddin, Imam. 2015. Kesulitan Mahasiswa dan Proses Scaffolding dalam Mengaplikasikan Integral Tentu pada Volume Benda Putar. Tesis. Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Edy Bambang Irawan, M.Pd., (2) Dr. rer. nat. I Made Sulandra, M.Si. Kata kunci: Kesulitan, Volume Benda Putar, Integral Tentu, Scaffolding. Integral tentu banyak diterapkan dalam kehidupan sehari-hari, seperti menentukan volume benda putar. Namun, banyak mahasiswa yang mengalami kesulitan dalam menerapkannya. Studi pendahuluan yang dilakukan pada mahasiswa semester ganjil angkatan 2014/2015, kelas A dan kelas B di Jurusan Matematika Universitas Islam Negeri Malang menyelidiki beberapa kesulitan mahasiswa ketika menyelesaikan masalah aplikasi integral pada volume benda putar, misalnya kesulitan dalam menggambar grafik fungsi bernilai mutlak, kesulitan menentukan volume irisan benda putar serta kesulitan memformulasikan volume benda putar. Penelitian ini bertujuan untuk mendeskripsikan kesulitan mahasiswa dalam menyelesaikan masalah aplikasi integral pada volume benda putar dan proses scaffolding. Jenis penelitian ini adalah penelitian studi kasus menggunakan pendekatan kualitatif. Subjek penelitian ini adalah enam mahasiswa yang terdiri dari dua mahasiswa baik kemampuan rendah, dua mahasiswa dengan kemampuan sedang, dan dua mahasiswa dengan kemampuan tinggi. Pengumpulan data dilakukan dengan tes tulis menyelesaikan lembar instrumen tugas dan wawancara. Hasil penelitian menunjukkan bahwa kesulitan yang dialami mahasiswa dalam menyelesaikan masalah aplikasi integral pada volume benda putar adalah 1) Kesulitan dalam menyederhanakan fungsi bernilai mutlak. Strategi scaffolding yang diterapkan adalah mengajak mahasiswa berpartisipasi menyelesaikan permasalahan menyederhanakan fungsi bernilai mutlak dan memverifikasi serta mengklarifikasi pemahaman mahasiswa tentang fungsi bernilai mutlak. Proses scaffolding meliputi pertanyaan yang mengarahkan mahasiswa untuk mengingat dan menjelaskan definisi fungsi bernilai mutlak, kemudian menyuruh mahasiswa menyederhanakan fungsi bernilai mutlak. 2) Kesulitan dalam menentukan daerah yang dibatasi beberapa fungsi. Hal ini dapat terjadi karena mahasiswa memahami bahwa daerah yang dibatasi fungsi merupakan daerah yang dibentuk oleh irisan daerah dibawah kurva. Strategi scaffolding yang diterapkan adalah mengajak mahasiswa untuk berkontribusi mencari petunjuk–petunjuk dalam menentukan daerah yang dibatasi beberapa fungsi. Proses scaffolding dapat berupa pertanyaan yang mengarahkan mahasiswa untuk mengingat daerah yang diarsir dibatasi oleh fungsi apa saja dan mencermati batas-batasnys. 3) Kesulitan dalam mengidentifikasi komponen-komponen yang digunakan untuk menentukan volume irisan benda putar, misalnya tinggi tabung atau jari-jari cakram. Strategi scaffolding yang diterapkanadalah mengajak mahasiswa untuk berkontribusi mencari petunjuk–petunjuk dalam menentukan komponen-komponen pada irisan benda putar. Proses scaffolding dapat berupa perintah untuk membuat garis yang mereprsentasikan tinggi atau jari-jari irisan benda putar, bisa juga titik yang memudahkan mahasiswa menentukan tinggi atau jari-jari irisan benda putar. 4) Kesulitan dalam formulasi volume benda putar. Hal ini terjadi karena kurangnya pemahaman mahasiswa terkait bagaimana memformulasikan volume benda putar. Strategi scaffolding yang diterapkanadalah memberikan pertanyaan yang mengingatkan mahasiswa terkait konsep-konsep apa saja yang digunakan untuk memformulasikan volume benda putar. Efektifitas scaffolding yang dilakukan peneliti dapat ditunjukkan dengan 1) kemampuan mahasiswa dalam mengingat, menjelaskan dan memahami materi yang diperlukan untuk memecahkan masalah, 2) kemampuan mahasiswa dalam menjelaskan kesulitan-kesulitan yang dialami sebelumnya serta dapat memperbaiki kesulitannya, kemudian menemukan jawaban yang benar.

Teknik pengajaran sistem persamaan dan pertidaksamaan di Sekolah Menengah Umum / oleh Eni Ruliyah

 

Preferensi kumbang kubah ((Coccinellidae), Laba-Laba Bermata Tajam (Oxyopidae), dan Belalang Sembah (Mantidae) terhadap tumbuhan liar Thunbergia alata Bojer., Centrosema pubescens (Bth.), dan Synedrella nodiflora L. Gaertn. dari kebun teh Wonosari, Singos

 

Pengendalian hama sangat dibutuhkan untuk meningkatkan produksi dan mengurangi kerugian pada bidang pertanian. Teknik penyemprotan pestisida yang biasa dilakukan di kebun teh Wonosari, Singosari dalam rangka penanggulangan hama dan gulma dapat mengorbankan keanekaragaman dan efesiensi dari arthropoda predator yang ada di agroekosistem. Penggunaan pestisida dirasa kurang efektif, hal ini berhubungan dengan luas kebun teh Wonosari, Singosari yang ? 628,86 hektar dan efek pemakaian pestisida. Penelitian ini bertujuan untuk mengetahui: 1) preferensi kumbang kubah (Coccinellidae), laba-laba bermata tajam (Oxyopidae), dan belalang sembah (Mantidae) terhadap tumbuhan liar Thunbergia alata Bojer., Centrosema pubescens (Bth.), dan Synedrella nodiflora L. Gaertn. dari kebun teh Wonosari, Singosari. 2) perbedaan persentase individu hewan uji kumbang kubah (Coccinellidae), laba-laba bermata tajam (Oxyopidae ), dan belalang sembah (Mantidae) terhadap tumbuhan liar Thunbergia alata Bojer., Centrosema pubescens (Bth.), dan Synedrella nodiflora L. Gaertn. dari kebun teh Wonosari, Singosari. 3) waktu orientasi arthropoda predator kumbang kubah (Coccinellidae), laba-laba bermata tajam (Oxyopidae), dan belalang sembah (Mantidae) terhadap tumbuhan liar Thunbergia alata Bojer., Centrosema pubescens (Bth.), dan Synedrella nodiflora L. Gaertn. dari kebun teh Wonosari, Singosari Kab Malang. Jenis Penelitian ini adalah deskriptif dengan pendekatan kuantitatif, karena mendeskripsikan tentang preferensi beberapa arthropoda predator terhadap beberapa tumbuhan liar dari kebun teh Wonosari. Deskripsi perbedaan preferensi hewan arthropoda predator dalam memilih tumbuhan liar dianalisis dengan anava tunggal. Jika basil analisis varian menunjukkan signifikan, maka dilakukan uji lanjut dengan uji BNT 5%. Hasil penelitian ini adalah 1) hewan-hewan artropoda predator menunjukkan preferensi terhadap tumbuhan liar dengan cara memilih ke salah satu jenis tumbuhan liar yang diujikan berdasarkan bau yang dikeluarkan oleh tumbuhan liar tersebut. 2) persentase preferensi individu hewan uji yaitu kumbang kubah (Coccinellidae), dan laba-laba (Oxyopidae) terhadap tumbuhan liar (Thunbergia alata Bojer, Centrosema pubescens (Bth), dan Synedrella nodiflora L. Gaertn) ternyata berbeda secara nyata, tetapi belalang sembah (Mantidae) terhadap tumbuhan liar (Thunbergia alata Bojer, Centrosema pubescens (Bth), dan Synedrella nodiflora L. Gaertn) berbeda tetapi tidak nyata. 3) waktu orientasi yang diperlukan hewan uji kumbang kubah (Coccinelidae) pada tumbuhan uji Synedrella nodiflora L. Gaertn adalah 53 detik sedang hewan uji laba-laba (Oxyopidae,) terhadap tumbuhan uji Thunbergia alata selama 58 detik dan hewan uji belalang sembah (Mantidae) memilih Synedrella nodiflora L. Gaertn memerlukan waktu selama 3 menit 35 detik untuk menentukan pilihannya

Analisis pengaruh Earning Per Share (EPS), Price Earning Ratio (PER) dan Return On Equity (ROE) terhadap harga saham dengan inflasi sebagai variabel kontrol (studi kasus pada perusahaan real estate dan property yang terdaftar di Bursa Efek Indonesia periode 2011-2013) /

 

ABSTRAK Pangestika, Yuninda Dyan. Analisis Pengaruh Earning Per Share (EPS), Price Earning Ratio (PER), Return On Equity (ROE), dan Inflasi Terhadap Harga Saham (Studi pada Perusahaan Real Estate dan Property yang Terdaftar di Bursa Efek Indonesia Periode 2011-2013). Skripsi, Jurusan Akuntansi, Program Studi S1 Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang, Pembimbing: (1) Dr. Sunaryanto, M.Ed. (2) Ika Putri Larasati, S.E., Mcom. Kata Kunci: Earning Per Share (EPS), Price Earning Ratio (PER), Return On Equity (ROE), Inflasi, Harga Saham. Analisis saham berguna untuk mengetahui kemampuan perusahaan untuk tumbuh dan berkembang di masa depan. Harga saham mencerminkan nilai dari suatu perusahaan. Jika perusahan mencapai prestasi yang baik, maka saham perusahaan akan banyak diminati oleh para investor. Prestasi baik yang dicapai perusahan dapat dilihat di dalam laporan keuangan yang dipublikasikan oleh perusahaan. Penelitian ini bertujuan untuk meneliti apakah faktor-faktor fundamental seperti EPS, PER, ROE dan Inflasi dapat mempengaruhi harga saham perusahaan. Populasi dalam penelitian ini adalah perusahaan Real Estate dan Property yang Terdaftar di Bursa Efek Indonesia Periode 2011-2013 yaitu sebanyak 45 perusahaan. Sampel penelitian diambil berdasarkan teknik purposive sampling dan pemilihan sampel berdasarkan kriteria-kriteria tertentu. Hasilnya diperoleh sebanyak 36 perusahaan. Variabel bebas yang digunakan dalam penelitian ini meliputi EPS, PER, ROE dan variabel kontrol dalam penelitian ini adalah Inflasi. Sedangkan harga saham menjadi variabel terikat. Pengujian terhadap penelitian ini dilakukan dengan menggunakan uji asumsi klasik, yang terdiri dari 4 asumsi dasar, yaitu normalitas, autokorelasi, multikoliniearitas, dan heteroskedastisitas. Setelah itu dilakukan uji regresi linier berganda yang dilakukan untuk menentukan persamaan regresi yang menunjukkan hubungan variabel terikat yang ditentukan dengan dua atau lebih variabel bebas.Dan Uji-t digunakan untuk melihat signifikansi dari pengaruh variabel bebas secara individu terhadap variabel terikat dengan menganggap variabel lain bersifat konstan. Hasil penelitian ini menunjukkan bahwa secara parsial EPS, PER dan ROE berpengaruh positif dan signifikan terhadap harga saham. Dan setelah dikendalikan oleh inflasi pengaruhnya menjadi semakin besar. Hal ini membuktikan inflasi berperan untuk meningkatkan pengaruh EPS, PER dan ROE terhadap harga saham. Berdasarkan hasil penelitian, disarankan bagi peneliti selanjutnya untuk menambah variabel lain dalam penelitian, baik dari faktor internal seperti debt to equity ratio (DER) atau return on asset ( ROA) dan faktor eksternal seperti tingkat suku bunga atau perubahan kurs mata uang. Bagi menajemen perusahaan diharapkan untuk meningkatkan kinerja fundamentalnya agar dapat meningkatkan nilai perusahaannya.

Hubungan latar belakang orang tua dan motivasi belajar dengan hasil belajar sistem transmisi siswa kelas XI teknik kendaraan ringan di SMK Negeri 6 Malang / Etha Yuda Wigananda

 

ABSTRAK Wigananda, Etha Y., 2015. Hubungan Latar Belakang Orang Tua dan Motivasi Belajar dengan Hasil Belajar Siswa Mata Pelajaran Sistem Transmisi Kelas XI Teknik Kendaraan Ringan di SMK Negeri 6 Malang. Skripsi. Jurusan Teknik Mesin, Program Studi Pendidikan Teknik Otomotif, Fakultas Teknik, Universitas Negeri Malang. Pembimbing I : Dr. Syarif Suhartadi, M.Pd. Pembimbing II : Drs. H. Agus Sholah, M.Pd Kata kunci: Latar Belakang Orang Tua, Motivasi Belajar, dan Hasil Belajar. Hasil belajar merupakan bagian akhir dari proses belajar dengan kata lain tujuan dari belajar adalah mendapat hasil yang baik. Maka menurut Wingkel (1987:51) menyatakan “Hasil belajar adalah perubahan yang mengakibatkan manusia berubah dalam sikap dan tingkah lakunya”. Latar belakang orang tua disini meliputi latar belakang sosial dan latar belakang ekonomi orang tua. Menurut Mifflen (1985:227) status sosial merupakan prestise yang diberikan berdasarkan hal-hal kemasyarakatan kepada orang yang menduduki posisi tertentu. Motivasi belajar adalah suatu perubahan tenaga di dalam diri seseorang (pribadi) yang ditandai dengan timbulnya perasaan dan reaksi untuk mencapai tujuan (Frederick J. Mc Donald dalam H. Nashar,2004:39).Berdasarkan latar belakang di atas, rumusan masalah dari penelitian iniadalah:1.Apakah ada hubungan latar belakang orang tua dengan hasil belajar siswa?, 2. Apakah ada hubungan motivasi belajar dengan hasil belajar siswa?, 3. Apakah ada hubungan latar belakang orang tua dan motivasi belajar dengan hasil belajar mata pelajaran system transmisi? Metode yang digunakan peneliti dalam pengumpulan data dalam penelitian yaitu angket, dan post tes merupakan suatu teknik atau cara mengumpulkan data. Angket merupakan teknik pengumpulan data yang dilakukan dengan cara memberi seperangkat pertanyaan atau pernyataan tertulis kepada kepada responden untuk dijawabnya (sugiono, 2009:119). Hasil belajar berupa skor peningkatan, diukur dengan tes soal sistem transmisi. Hasil penelitian menunjukkan bahwa Latar belakang orang tua dengan hasil belajar sebesar 0,930, motivasi belajar dengan prestasi belajar sebesar 1,006, latar belakang orang tua dan motivasi belajar dengan hasil belajar siswa adalah 0,738 yang diinterpretasikan memliki hubungan yang kuat. Dengan memperhatikan kesimpulan di atas, ada beberapa saran yang dapat disampaikan yaitu: (1)Bagi Guru, disarankan untuk dapat memilih strategi pembelajaran yang tepat untuk karakteristik siswa yang berbeda, yang disebabkan oleh perbedaan latar belakang orang tua dan perbedaan motivasi belajar serta mampu meningkatkan motivasi belajar siswa. (2) Bagi siswa, disarankan untuk menumbuhkan dan meningkatkan motivasi belajar yang berasal dari dalam diri. (3)Bagi peneliti selanjutannya, diharapkan untuk meneliti tentang latar belakang orang tua dan motivasi belajar dengan hasil belajar pada objek yang lain.

Pengaruh motivasi dan kepuasan kerja terhadap disiplin kerja karyawan Kusuma Agrowisata Hotel Batu / Windy Rizki Adi

 

Kata Kunci: motivasi kerja, kepuasan kerja, disiplin kerja Keberadaan sumber daya manusia di dalam suatu perusahaan memegang peranan sangat penting. Seiring dengan perkembangannya, perusahaan sering kali mengabaikan tentang pengelolaan sumber daya manusia yang dimilikinya. Sementara itu dunia pada saat ini sedang menghadapi dua tantangan utama. Untuk menghadapi tantangan utama ini perusahaan perlu untuk menuntut kedisiplinan yang tinggi dari karyawannya, karena tindakan-tindakan disiplin tidak hanya mempunyai dampak langsung atas mental para karyawan akan tetapi juga dapat berpengaruh terhadap efektifitas kerjanya maupun efisiensi kerja secara keseluruhan. Motivasi adalah suatu faktor yang mendorong seseorang untuk melakukan suatu perbuatan atau kegiatan tertentu, oleh karena itu motivasi sering kali diartikan pula sebagai faktor pendorong perilaku seseorang. Selain motivasi kerja karyawan ada hal penting lainnya yang dapat mempengaruhi disiplin kerja karyawan yaitu kepuasan kerja. Kepuasan kerja merupakan ukuran proses pembangunan manusia yang berkelanjutan dalam suatu organisasi. Peneliti menarik rumusan masalah sebagai berikut : (1) Bagaimanakah deskripsi motivasi kerja karyawan Kusuma Agrowisata Hotel Batu? (2) Bagaimanakah deskripsi kepuasan kerja karyawan Kusuma Agrowisata Hotel Batu? (3) Bagaimanakah deskripsi disiplin kerja karyawan Kusuma Agrowisata Hotel Batu? (4) Apakah terdapat pengaruh positif yang signifikan motivasi kerja karyawan terhadap disiplin kerja karyawan Kusuma Agrowisata Hotel Batu? (5) Apakah terdapat pengaruh positif yang signifikan kepuasan kerja karyawan terhadap disiplin kerja karyawan Kusuma Agrowisata Hotel Batu? (6) Apakah terdapat pengaruh positif yang signifikan kepuasan kerja karyawan dan motivasi kerja karyawan secara bersama-sama terhadap disiplin kerja karyawan Kusuma Agrowisata Hotel Batu? (7) Variabel manakah yang lebih dominan berpengaruh terhadap disiplin kerja Kusuma Agrowisata Hotel Batu? Penelitian ini terdiri atas variabel bebas yaitu Motivasi Kerja (X1), Kepuasan Kerja (X2), dan variabel terikat yaitu Disiplin Kerja (Y). Dimana sampel yang diambil adalah 58 responden yaitu karyawan Kusuma Agrowisata Hotel Batu. Keseluruhan data kualitatif akan diuji dengan regresi linier berganda dengan menggunakan SPSS Windows. Berdasarkan hasil analisis didapatkan variabel Motivasi (X1) memiliki nilai t hitung = 3.303; nilai signifikansi 0,002 < 0,05, maka hipotesis yang berbunyi ada pengaruh positif yang signifikan motivasi kerja (X1) terhadap disiplin kerja (Y) diterima. Untuk variabel Kepuasan Kerja (X2) memiliki nilai t hitung = 6.016; nilai signifikansi 0,000<0,05, maka hipotesis yang berbunyi ada pengaruh positif yang signifikan Kepuasan Kerja (X2) terhadap Disiplin Kerja (Y) diterima. Berdasarkan penelitian ini dapat disimpulkan: Terdapat pengaruh positif yang signifikan motivasi kerja dan kepuasan kerja secara bersama-sama terhadap disiplin kerja karyawan. Kepuasan kerja merupakan variabel yang dominan berpengaruh terhadap disiplin kerja. Berdasarkan kesimpulan di atas disarankan, hendaknya untuk pihak manajemen Kusuma Agrowisata Hotel Batu selalu memperhatikan faktor-faktor yang mempengaruhi disiplin kerja karyawan, sehingga dapat membawa dampak pada aktivitas kerja karyawan berjalan secara efektif dan efisien

Pengaruh pengumuman dividen terhadap harga saham (studi kasus pada perusahaan manufaktur yang terdaftar pada bursa efek tahun 2013) / Sigit Titis Wicaksono

 

ABSTRAK Wicaksono, Sigit Titis. 2013. Pengaruh Pengumuman Dividen Terhadap Harga Saham (Studi Kasus pada Perusahaan Manufaktur yang Terdaftar pada Bursa Efek Tahun 2013). Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I)Dr. Nurika Restuningdiah, S.E., M.Si., Ak . (II)Sulastri S.pd.M.SA Kata Kunci : pengumuman dividen, harga saham Pengumuman dividen merupakan bagian dari kebijakan perusahaan. Dividen yang dibayarkan oleh perusahaan kepada pemegang saham dapat dijadikan signal atau tanda baik buruknya suatu perusahaan. Pengumuman dividen dapat dikatakan mengandung informasi jika dapat mempengaruhi keputusan investor. Tujuan penelitian ini adalah mengetahui pengumuman dividen berpengaruh secara signifikan terhadap harga saham pada perusahaan manufaktur yang listing di bursa efek Indonesia (BEI) dan mengeluarkan dividen tahun 2013. Sampel dalam penelitian ini sebanyak 36 perusahaan. Teknik pengambilan sampel menggunakan teknik purposive sampling. Sumber data merupakan data sekunder dengan analisis uji beda berpasangan digunakan dalam penelitian ini digunakan dalam penelitian ini untuk menganalisis reaksi pasar dari setiap variable independen yang berdistribusi normal. Sedangkan analisis Mann Whitney dilakukan pada data variabel independen dengan distribusi tidak normal. Berdasarkan hasil analisis dapat diketahui bahwa, (1) tidak terdapat perbedaan harga saham sebelum dan waktu pengumuman dividen, (2) Terdapat perbedaan harga saham yang signifikan diwaktu dan sesudah pengumuman dividen, (3) terdapat perbedaan harga saham yang signifikan sebelum dan sesudah pengumuman dividen. Hasil tersebut mengindikasikan perbedaan persepsi investor dalam menanggapi signal dari pengumuman dividen membuat naik turunnya harga saham. dan saran untuk penelitian selanjutnya adalah dengan mengembangkan variable-variabel penelitian dan menambah durasi waktu penelitian agar didapat hasil yang akurat dan representif.

Pengembangan bahan ajar membaca dan menulis untuk siswa kelas VII SMP / Restu Hapsari Rahayu

 

Kata kunci : pengembangan, bahan ajar, membaca, menulis Membaca dan menulis itu penting. Kompetensi tersebut diajarkan pada setiap jenjang pendidikan, yang bertujuan agar siswa memahami serta mampu menerapkannya dengan baik. Akan tetapi, seiring dengan berjalannya waktu, kompetensi ini sering diabaikan. Hal ini ditunjukkan dengan adanya bahan ajar bahasa Indonesia yang berupa buku paket dan Lembar Kerja Siswa yang lebih mengutamakan pemahaman teori. Untuk itulah, dikembangkan bahan ajar membaca dan menulis dengan kegiatan pembelajaran yang lebih bervariasi. Dengan adanya kegiatan pembelajaran tersebut, diharapkan dapat memunculkan kembali minat siswa terhadap pembelajaran membaca menulis. Penelitian ini dilakukan dengan penelitian pengembangan. Langkah-langkah dalam penelitian pengembangan ini adalah (1) menyusun RPP, (2) menyusun draf bahan ajar, (3) uji produk, dan (4) merevisi bahan ajar. Uji produk dilaksanakan sebanyak tiga kali, yaitu uji ahli, uji praktisi, dan uji siswa. Uji ahli dilakukan oleh Bapak Dr. Nurhadi, yang merupakan dosen jurusan sastra Indonesia. Uji praktisi dilakukan oleh Ibu Siti Fatimah, S.Pd, yang merupakan guru Bahasa Indonesia SMPN 1 Malang. Uji siswa dilakukan oleh 24 orang siswa kelas VII F SMPN 1 Malang. Berdasarkan uji produk diperoleh hasil berikut. Rata-rata hasil uji bahan ajar kepada ahli sebesar 80%. Ahli juga memberikan saran dan komentar untuk penyempurnaan bahan ajar. Rata-rata hasil uji bahan ajar kepada praktisi sebesar 90%. Praktisi memberikan catatan untuk kesempurnaan bahan ajar. Rata-rata hasil uji bahan ajar kepada siswa sebesar 77%. Siswa memberikan saran untuk memperbaiki tampilan bahan ajar. Hasil penelitian yang diperoleh berupa produk bahan ajar, yang penyusunannya berdasarkan RPP yang telah dibuat. RPP yang dibuat berisi: identitas RPP, standar kompetensi dan kompetensi dasar, indikator, tujuan pembelajaran, alokasi waktu, materi ajar, metode pembelajaran, langkah-langkah pembelajaran, sumber belajar, dan penilaian. Bahan ajar yang dihasilkan terdiri dari tiga unit. Masing-masing unit menjabarkan satu kompetensi dasar yang harus dikuasai siswa. Pada akhir unit tiga, terdapat uji materi yang bertujuan untuk mengukur tingkat pemahaman dan penguasaan siswa terhadap materi dan kompetensi yang diajarkan. Dari penelitian ini disarankan, bahan ajar membaca dan menulis, dapat digunakan sebagai salah satu alternatif untuk mengembangkan keterampilan membaca dan menulis bagi siswa. Bahan ajar ini memiliki kegiatan pembelajaran yang bervariasi dan memungkinkan siswa untuk berinteraksi dengan lingkungan sekitar. Siswa dapat memanfaatkannya untuk meningkatkan penguasaan terhadap kompetensi membaca dan menulis.

Pengaruh dividend payout ratio, current ratio, variance of earnings growth terhadap price earnings ratio pada perusahaan manufaktur yang terdaftar di bursa efek Indonesia periode tahun 2006-2008 / Yuli Setiowati

 

Kata Kunci: Dividend Payout Ratio, Current Ratio, Variance of Earnings Growth dan Price Earnings Ratio Perkembangan harga saham di pasar modal adalah salah satu faktor yang sangat dipertimbangkan oleh para analis dan pemodal dalam mengambil kebijakan melakukan analisis di pasar modal. Investor dalam menanamkan dananya pada saham sangat berkepentingan dengan return yang diharapkan di masa yang akan datang, sehingga sebelum menanamkan dananya investor perlu melakukan analisis terhadap kemampuan perusahaan untuk menghasilkan laba. Dalam mengambil kebijakan untuk melakukan investasi para investor menggunakan analisis fundamental. Salah satu analisis fundamental yang dapat dipergunakan untuk melakukan penilaian saham adalah dengan menggunakan Price Eaenings Ratio yaitu rasio antara harga per lembar saham dengan laba per lembar saham. Penelitian ini bertujuan meneliti Pengaruh Dividend Payout Ratio, Current Ratio dan Variance of Earnings Growth Terhadap Price Earnings Ratio . Populasi dalam penelitian ini adalah seluruh perusahaan manufaktur yang terdaftar di BEI dan membagikan dividen selama periode tahun 2006-2008, sehingga diperoleh sampel sebanyak 12 perusahaan secara purposive sampling. Dengan pooled data didapatkan sebanyak 36 data observasi (12x3). Analisis data menggunakan analisis regresi linear berganda dengan uji asumsi klasik, uji hipotesis t dan F. Hasil penelitian menunjukkan bahwa (1) dividend payout ratio, current ratio dan variance of earnings growth secara parsial berpengaruh terhadap price earnings ratio (2) dividend payout ratio, current ratio dan variance of earnings growth secara simultan berpengaruh terhadap price earnings ratio. Hal ini terjadi karena para investor mempertimbangkan faktor-faktor yang mempengaruhi PER dalam melakukan investasi di pasar modal. Saran dalam penelitian ini untuk peneliti selanjutnya diharapkan (1) memperluas sampel yang digunakan sebagai obyek penelitian dengan meneliti semua perusahaan yang go public di Bursa Efek Indonesia sehingga dapat diperoleh hasil penelitian yang lebih baik, (2) menambah jenis faktor fundamental yang lain misalnya penjualan, total asset, dan leverage perusahaan yang mungkin berpengaruh terhadap nilai PER, (3) menambah periode pengamatan sehingga dapat diketahui sampai berapa lama variabel independen mampu mempengaruhi variabel dependen. Penelitian ini juga memiliki keterbatasan diantaranya yaitu keterbatasan dalam sampel penelitian, hanya menggunakan beberapa variabel fundamental perusahaan, rentang waktu yang digunakan dalam penelitian relatif singkat.

Kelengkapan dan relevansi struktur isi teks eksposisi karya siswa kelas X SMK Negeri 2 Malang / Zozana Rahmasanti

 

ABSTRAK Rahmasanti, Zozana. Kelengkapan dan Relevansi Struktur Isi Teks Eksposisi Karya Siswa Kelas X SMK Negeri 2 Malang. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Sumadi, M.Pd, (II) Musthofa Kamal, S.Pd, M.Sn. Kata Kunci: kelengkapan struktur isi, relevansi struktur isi, dan teks eksposisi Kelengkapan struktur isi berkaitan dengan hadir tidaknya isi di dalam sebuah teks. Secara umum, sebuah teks terdiri dari tiga paragraf yang dibedakan menjadi paragraf awal yang merupakan pembuka, paragraf tengah yang merupakan tubuh teks (mungkin terdiri dari beberapa paragraf apabila memiliki banyak pokok-pokok bahasan), dan paragraf akhir yang merupakan bagian penutup teks. Berkaitan dengan kelengkapan isi teks eksposisi, untuk mencapai teks eksposisi yang jelas, tertib, dan memadai, secara tegas atau sekurang-kurangnya mencerminkan sebuah susunan yang terdiri dari tiga bagian, yaitu (1) tesis, (2) argumen, dan (3) simpulan. Khusus untuk bagian penutup atau simpulan, bagian isi ini tidak diwajibkan hadir karena terdapat contoh teks eksposisi yang tidak menyertakan bagian penutup atau simpulan. Terkait dengan relevansi struktur isi antarbagian teks, judul pada suatu teks melukiskan dengan singkat masalah yang ditulis. Judul harus dirumuskan dengan jelas, singkat, dan relevan dengan isi tulisan tetapi tidak terlalu provoaktif. Lebih lanjut, judul ditelaah terlebih dahulu agar tidak terjadi salah pemahaman yang dapat berakibat salah dalam mengembangkan isi. Kemudian, tesis (pendahuluan), tesis merupakan bagian yang paling penting di dalam teks, tesis menyatakan topik khusus dan menyatakan adanya subtopik yang akan dibahas pada bagian selanjutnya. Untuk memudahkan penulisan bagian tesis ini, penulis harus mengingat kembali tujuan penulisan teks. Selanjutnya, bagian tubuh (argumen) tidak menyimpang dari pernyataan tesis. Terakhir, bagian simpulan (simpulan), bagian ini dapat disusun dengan menuliskan ringkasan atau mengungkapkan kembali hal-hal yang sangat penting yang dibahas pada bagian tubuh (argumen) dengan kalimat yang berbeda. Teks eksposisi merupakan salah satu bentuk penuturan untuk memenuhi kebutuhan akan penjelasan mengenai sesuatu hal apa pun. Teks eksposisi mampu menyampaikan penjelasan secara khusus ataupun secara umum. Teks eksposisi berisi uraian atau penjelasan tentang suatu topik. Teks eksposisi memilik sasaran, yaitu memperluas pengetahuan pembaca. Penelitian ini bertujuan untuk menilai kelengkapan isi dan relevansi isi yang terdapat di dalam teks eksposisi karya siswa kelas X SMKN 2 Malang secara apa adanya dengan menggunakan angka atau presentase. Penelitian ini menggunakan pendekatan kualitatif dengan kajian evaluatif yang berpedoman pada keriteria untuk memberikan penilaian terhadap kelengkapan dan relevansi isi teks eksposisi. Data dalam penelitian ini berupa kelengkapan dan relevansi isi teks eksposisi karya siswa kelas X SMKN 2 Malang. Prosedur pengumpulan data yang digunakan dalam penelitian ini adalah dengan menggunakan teknik dokumentasi teks eksposisi karya siswa kelas X SMKN 2 Malang yang diperoleh dari guru bahasa Indoneisa di SMK tersebut. Lebih lanjut, prosedur pengumpulan data yang dilakukan meliputi (1) berkoordinasi dengan guru mata pelajaran bahasa Indonesia di SMKN 2 Malang dan (2) meminjam teks eksposisi karya siswa untuk digandakan sebagai data penelitian. Pada analisis data digunakan analisis data kualitatif yang terdiri atas tiga alur kegiatan yang terjadi secara bersamaan, yaitu reduksi data, penyajian data, dan penarikan kesimpulan. Reduksi data yang dilakukan dalam penelitian ini meliputi identifikasi, klasifikasi, dan kodifikasi. Penyajian data menunjukkan terdapat (1) kelengkapan isi dan (2) relevansi isi di dalam teks eksposisi karya siswa kelas X SMKN 2 Malang. Penyajian data dapat dilihat pada bab III, yaitu pada paparan data dan temuan penelitian. Berdasarkan paparan data, ditemukan dua jenis temuan berdasarkan kelengkapan isi yang terdapat di dalam teks eksposisi. Kedua jenis temuan tersebut, yaitu (1) teks eksposisi yang memiliki isi lengkap dan (2) teks eksposisi yang memiliki isi tidak lengkap. Kelengkapan ini dilihat dari kehadiran isi yang membangun sebuah teks eksposisi, yaitu judul, tesis, argumen, dan simpulan (tidak diwajibkan hadir namun disarankan bagi teks yang memiliki paragraf yang panjang). Berikut ini adalah jumlah temuan berdasarkan kelengkapan isi yang terdapat di dalam teks eksposisi karya siswa kelas X SMKN 2 Malang. Berdasarkan 19 teks eksposisi yang diteliti terdapat 1 (5%) teks eksposisi yang memiliki isi tidak lengkap karena tidak menghadirkan judul, sedangkan ke-18 (95%) lainnya memiliki isi yang lengkap, yaitu teks eksposisi yang terdiri atas (1) judul, (2) tesis, (3) argumen, dan (4) simpulan. Berdasarkan paparan data, ditemukan temuan-temuan sebagai berikut, yaitu (1) judul yang relevan dengan keseluruhan isi (tesis, argumen, dan simpulan), (2) judul yang tidak relevan dengan keseluruhan isi (tesis, argumen, simpulan), (3) tesis yang relevan dengan judul, (4) tesis yang tidak relevan dengan judul, (5) argumen yang relevan dengan tesis, (6) argumen yang tidak semua bagian relevan dengan tesis, (7) argumen yang tidak relevan dengan tesis, (8) simpulan yang relevan dengan keseluruhan isi (tesis, dan argumen), dan (9) simpulan yang tidak relevan dnegan keseluruhan isi (tesis, dan argumen). Berdasarkan paparan data, temuan penelitian, dan pembahasan penelitian ini, terdapat beberapa saran yang dapat diberikan. Paparan masing-masing saran disajikan sebagai berikut. Pertama, mengingat pentingnya unsur pembangun sebuah teks untuk mencapai kesempurnaan ketika menuliskan sebuah teks, disarankan kepada guru untuk melatih keterampilan menulis siswa terkait dengan kelengkapan isi dan relevansi isi yang terdapat di dalam teks eksposisi, serta disarankan bagi guru untuk mengoreksi kembali karya siswa untuk perbaikan pada proses belajar mengajar selanjutnya. Kedua, siswa disarankan agar banyak berlatih menulis teks eksposisi dengan memperhatikan kelengkapan isi dan relevansi isi yang terdapat di dalam teks eksposisi sehingga teks eksposisi yang ditulis memiliki kelengkapan isi dan relevansi antar isinya.

Kesalahan struktur isi, ejaan, dan tanda baca pada teks eksposisi karya siswa kelas VII SMP Negeri 13 Malang / Zozane Rahma Sinta

 

Tampilan opac program Senayan versi Meranti di Perpustakaan Politeknik Negeri Malang / Eva Devita Emilia Siswanti

 

ABSTRAK Siswanti, Eva Devita Emilia. 2015. Tampilan OPAC Program Senayan Versi Meranti di Perpustakaan Politeknik Negeri Malang. tugas akhir, Jurusan Sastra Indonesia, Program Studi D3 Perpustakaan, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Roekhan, M.Pd. (II) Sokhibul Ansor, S.Sos., M.Hum. Kata Kunci: OPAC, otomasi perpustakaan, perpustakaan perguruan tinggi, teknologi informasi Perkembangan teknologi dan informasi (TI), membawa banyak dampak terhadap perkembangan dunia perpustakaan. Salah satunya adalah beralihnya penanganan kegiatan perpustakaan yang semula tradisional atau manual berubah menjadi perpustakaan yang modern atau perpustakaan terautomasi. Dengan adanya perpustakaan terautomasi diharapkan dapat membantu segala kegiatan dalam perpustakaan sehingga lebih efisien dan akurat. Penelitian ini dilaksanakan dengan tujuan mendeskripsikan tampilan fitur OPAC yang ada di UPT Perpustakaan Universitas Politeknik Negeri Malang, dan mendeskripsikan kesesuaian tampilan fitur OPAC Perpustakaan Universitas Polteknik Negeri Malang berdasarkan standar IFLA. Penelitian ini menggunakan metode penelitian deskriptif. Teknik pengumpulan data dengan cara dokumentasi. Sumber data yang digunakan berupa printscreen OPAC, dan penjelasan tampilan fitur OPAC di UPT Perpustakaan Politeknik Negeri Malang. Hasil penelitian diperoleh dari pengamataan terhadap OPAC UPT Perpustakaan Politeknik Negeri Malang, sebagai bukti, Pertama, tampilan OPAC di UPT Perpustakaan Politeknik Negeri Malang hanya ada satu bagian yaitu konten. Terdapat 6 menu navigasi yang ditampilkan OPAC. Urutan dari atas ke bawah yaitu beranda, informasi perpustakaan, bantuan, informasi untuk cek peminjaman, pilih bahasa, dan login masuk untuk pustakawan. Kedua, tampilan fitur OPAC UPT Perpustakaan Politeknik Negeri Malang belum bisa memenuhi kesesuaian prinsip dan rekomendasi IFLA. OPAC UPT Perpustakaan Politeknik Negeri Malang hanya memenuhi 12 indikator dari keseluruhan 37 indikator rekomendasi IFLA. Saran yang diberikan terkait pengembangan OPAC UPT Perpustakaan Politeknik Negeri Malang yaitu: (1) pustakawan sebaiknya mempelajari perkembangan ilmu perpustakaan baik nasional maupun internasional atau standar lain yang berhubungan dengan perpustakaan dan menerapkan pengetahuan tersebut di UPT Perpustakaan Politeknik Negeri Malang. Selain itu pustakawan harus bekerja sama dengan tenaga TI untuk lebih mengoptimalkan fungsi tampilan OPAC, agar mempermudah pemustaka dalam menggunakan layanan OPAC, dan (2) tenaga TI sebaiknya mengikuti pelatihan atau seminar mengenai pengembangan teknologi informasi selain itu tenaga TI semestinya ikut bergabung dengan komunitas SLiMS sehingga dapat mengetahui perkembangan dari SLiMS, karena rencana pengembangan konten digital perlu dilakukan dengan baik dan matang. Agar pemustaka dapat memahami cara dan alat yang digunakan untuk menelusur informasi yang ada di perpustakaan.

Studi kasus tindak pembelajaran yang membimbing oleh Guru Sekolah Dasar di Kabupaten Bangkalan / Miranti Widi Andriani

 

ABSTRAK Andriani, Miranti Widi. 2015. Studi Kasus Tindak Pembelajaran yang Membimbing oleh Guru Sekolah Dasar di Kabupaten Bangkalan. Tesis, Program Studi Bimbingan dan Konseling, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Fattah Hanurawan, M.Si., M.Ed. (II) Dr. Triyono, M.Pd. Kata-kata kunci: studi kasus, pembelajaran yang membimbing, sekolah dasar Pembelajaran yang membimbing adalah pemberian pengalaman dalam proses pembelajaran sejak merancang, melaksanakan dan mengevaluasi yang bertujuan agar siswa mampu mengembangkan potensi dirinya atau mencapai tugas-tugas perkembangannya. Penelitian ini dilaksanakan untuk meneliti tindak pembelajaran yang membimbing oleh guru SD. Tujuan penelitian ini adalah mendeskripsikan tindak pembelajaran yang termasuk ke dalam peran membimbing sebagai pelaku bimbingan dan konseling. Penelitian ini menggunakan pendekatan kualitatif, jenis penelitian studi kasus untuk menjawab pertanyaan di atas. Peneliti sebagai instrumen utama. Data penelitian ini adalah tindak pembelajaran yang membimbing oleh guru SD sebagai pelaku bimbingan dan konseling. Peneliti mengumpulkan data melalui wawancara mendalam (in-depth interview), observasi tidak terstruktur, dan dokumen. Triangulasi sumber data dilakukan dengan pengecekan data hasil wawancara kepada subjek penelitian, pengecekan data hasil wawancara kepada ahli, dan memeriksa pengaruh peneliti dalam paparan data dan temuan penelitian diterapkan untuk mengecek keabsahan data. Hasil penelitian menunjukkan tindak pembelajaran yang membimbing oleh guru SD: merancang program pembelajaran dengan memperhatikan kebutuhan, kemampuan, dan kesulitan yang dihadapi siswa; memahami dan mengakomodasi perbedaan individu; membangun interaksi positif dengan membentuk kelompok agar siswa dapat bersosialisasi; mendorong dan meningkatkan perkembangan siswa (pribadi, belajar, sosial, dan karir); membantu siswa mengurangi tingkah laku yang merugikan dalam belajar; memberi layanan konsultasi pada siswa dan walimurid; memperhatikan perubahan kemajuan siswa dilihat dari pencapaian tugas perkembangan; memeriksa diri atas tindakan yang telah dilakukan; dan memberikan bimbingan agar siswa dapat belajar dari kesalahannya. Saran dari hasil penelitian, temuan teoritis dapat dijadikan sebagai informasi dalam bimbingan dan konseling deskripsi tindak pembelajaran yang membimbing oleh guru SD. Hasil penelitian dapat pula digunakan sebagai tambahan wawasan mengenai kerangka pedagogis yang harus dipersiapkan guru dalam kegiatan pembelajaran; digunakan untuk meningkatkan pemahaman guru dalam mengembangkan rencana pembelajaran; dan digunakan untuk mendorong guru secara aktif terlibat dalam pembelajaran yang membimbing. Pada penelitian selanjutnya diharapkan dapat digunakan sebagai bahan rujukan dalam penelitian pengembangan pelatihan tindak pembelajaran yang membimbing oleh guru SD.

Pengaruh scaffolding konseptual dalam Group Investigation terhadap keterampilan berpikir tingkat tinggi ditinjau dari pengetahuan awal pada materi kalor / Tyas Ajeng Puspitasari

 

ABSTRAK Puspitasari, Tyas Ajeng. 2015. Pengaruh Scaffolding Konseptualdalam Group Investigation terhadapKeterampilanBerpikir Tingkat TinggiDitinjaudariPengetahuanAwalSiswapadaMateriKalor. Tesis. JurusanPendidikanFisika, PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. SupriyonoKoes H, M.A., M.Pd., (II) Prof. Dr. ArifHidayat, M.Si Kata kunci: Scaffolding konseptual, Group Investigation, KeterampilanBerpikir Tingkat Tinggi, Pengetahuanawal. Meningkatkanketerampilanberpikirtingkattinggimenjadiupayapentingbidangpendidikan Indonesia dalammenghadapiarusglobalisasi.Pelajaranfisikadapatmenjadiwahanabagisiswauntukmengembangkanketerampilanberpikirtingkattinggi. Bantuanatauscaffolding diberikankepadasiswauntukmencapaihasilpembelajaran yang sebelumnyatidakdapatdicapaisecaramandiri. Scaffoldingkonseptualadalahjenisbantuanuntukmembangunkonsep yang telahdipelajari, mengenalikonsep, menambahstrukturuntukmelakukansesuatudanmemisahkandalamkategori-kategorikonsep.Dalampembelajaran di kelastidakmemungkinkanpemberianscaffolding secaraindividu. PenelitianinidilakukanuntukmencaripengaruhdariintegrasiscaffoldingkonseptualdalamGroup Investigations (GI) terhadapketerampilanberpikirtingkattinggi. Tujuan penelitian adalah (1) mengetahuiapakahketerampilanberpikirtingkattinggisiswapadapembelajaranscaffoldingkonseptualdalamGIlebihtinggidibandingsiswapadapembelajaran GI; (2) mengetahuiapakahketerampilanberpikirtingkattinggipadasiswaberpengetahuanawaltinggilebihtinggidibandingsiswaberpengetahuanawalrendah; dan (3) mengetahuiinteraksistrategipembelajarandenganpengetahuanawalterhadapketerampilanberpikirtingkattinggi. Penelitianinimerupakanpenelitiankuasieksperimen, dengandesainfaktorial 2 X 2. Populasipenelitianadalahsiswakelas X MIA SMAN 4 Malang TahunPelajaran 2014/2015 yang berjumlah 6 kelas. Sampelpenelitianmengambilduakelas yang berjumlahmasing-masing 34 siswa. Data dianalisismenggunakanstatistikdeksriptifdanstatistikinferensialdenganteknik ANAVA duajalur. Hasilpenelitianmenunjukkan: (1) keterampilanberpikirtingkattinggiantarasiswapadapembelajaranscaffolding konseptualdalamGIlebihtinggidibandingkandengansiswapadapembelajaranGI; (2) Tidakadaperbedaanketerampilanberpikirtingkattinggiantarasiswaberpengetahuanawaltinggidenganberpengetahuanawalrendah; (3) adainteraksistrategipembelajarandanpengetahuanawalterhadapketerampilanberpikirtingkattinggi. SiswapadapembelajaranscaffoldingkonseptualdalamGImenunjukkanketerampilanberpikirtingkattinggi yang lebihdibandingsiswadalampembelajaran GI. Interaksiditunjukkanolehtingginyaketerampilanberpikirtingkattinggisiswadenganpengetahuanawaltinggidanbelajarddenganscaffoldingkonseptualdalam GI dibandingkelompoklainnya. Hasilinimenunjukkanpembelajaranscaffoldingkonseptualdalam GI denganmemperhatikanpengetahuanawalsiswamemilikipengaruhterhadapketerampilanberpikirtingkattinggi.

Analisis faktor-faktor yang berpengaruh terhadap pengungkapan internet financial reporting (studi kasus pada perusahaan jasa sektor keuangan yang terdaftar di BEI tahun 2013 / Angga Saka Nur Kusuma

 

ABSTRAK Kusuma, Angga Saka Nur. 2015. Analisis Faktor-Faktor yang Berpengaruh Terhadap Pengungkapan Internet Financial Reporting. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Sulastri, S.Pd, MSA (II) Sriyani Mentari, S.Pd, M.M. Kata Kunci: Internet financial reporting, ukuran perusahaan, jenis perusahaan, leverage, profitabilitas, umur listing, likuiditas, dan reputasi auditor. Perkembangan teknologi saat ini sangatlah pesat. Hal ini juga dimanfaatkan oleh perusahaan, salah satunya dengan penggunaan internet. Dengan adanya internet, perusahaan lebih mudah dan cepat dalam menyebarkan informasinya, khususnya informasi keuangan. Hal ini lebih dikenal dengan Internet Financial Reporting (IFR) yaitu pelaporan keuangan yang dilakukan oleh perusahaan melalui internet yang disajikan dalam website perusahaan (Prasetya dan Irwandi, 2012). Penelitian ini bertujuan untuk menguji faktor-faktor yang berpengaruh terhadap pengungkapan Internet Financial Reporting (IFR). Variabel yang digunakan adalah ukuran perusahaan, jenis perusahaan, leverage, profitabilitas, umur listing, likuiditas, dan reputasi auditor. Jenis penelitian ini adalah penelitian kuantitatif dengan menggunakan data sekunder, yaitu annual report. Metode pengambilan sampel dengan menggunakan teknik purposive sampling. Sampel dalam penelitian ini sebanyak 66 perusahaan sektor keuangan yang terdaftar di Bursa Efek Indonesia tahun 2013. Hipotesis diuji menggunakan analisis regresi logistik. Hasil dari penelitian ini membuktikan bahwa ukuran perusahaan, jenis perusahaan, leverage, profitabilitas, umur listing, likuiditas, dan reputasi auditor tidak berpengaruh terhadap pengungkapan IFR. Untuk penelitian selanjutnya, peneliti menyarankan pada periode pengamatan menggunakan kurun waktu melebihi satu tahun agar dapat diketahui perbandingan IFR dari tahun yang berbeda dan pengukuran variabel pengungkapan IFR sebaiknya menggunakan skala indeks agar dapat diketahui secara jelas, serta kelengkapan pelaporan keuangan perusahaan melalui media internet secara detail.

Penerapan metode group investigation dipadu dengan game puzzle untuk meningkatkan aktivitas dan hasil belajar biologi siswa kelas VII-B SMP Negeri 1 Bondowoso / Gendot Budiyono

 

Kata Kunci: Group Investigation (GI), game puzzle, aktivitas, hasil belajar. Observasi awal yang dilakukan menunjukkan bahwa pembelajaran Biologi di kelas VII-B SMP Negeri 1 Bondowoso terdapat beberapa masalah antara lain: (1) ketika pembelajaran berlangsung, siswa cenderung ramai, tidak memperhatikan penjelasan guru, berbicara dengan temannya dan bermain HP, (2) dalam me-nyelesaikan suatu tugas, siswa dengan karakteristik yang sama cenderung untuk mengelompok menjadi satu, sehingga terbentuk kelompok-kelompok homogen di kelas, (3) saat diberi tugas untuk berdiskusi siswa mengerjakan sendiri-sendiri, siswa yang berkemampuan lebih tinggi tidak pernah membagi pengetahuannya kepada siswa yang lemah, (4) menurut beberapa siswa metode ceramah dan tanya jawab yang diterapkan oleh guru kurang menarik minat dan perhatian siswa, karena hanya siswa tertentu saja yang aktif berpendapat. Dari permasalahan tersebut juga meng¬akibatkan rendahnya hasil belajar siswa, setiap tes selalu ada siswa tidak tuntas belajar yang jumlahnya lebih kurang 40% jumlah siswa di kelas. Berdasarkan kondisi tersebut maka dilakukan penelitian tindakan kelas yang bertujuan untuk: (1) meningkatkan aktivitas belajar siswa kelas VII-B SMP Negeri 1 Bondowoso, (2) meningkatkan hasil belajar siswa kelas VII-B SMP Negeri 1 Bondowoso, tujuan tersebut dicapai dengan pembelajaran menggunakan metode group investigation yang dipadu dengan game puzzle. Jenis penelitian ini adalah penelitian tindakan kelas yang dilakukan dalam dua siklus, siklus pertama terdiri dari empat kali pertemuan, dan siklus kedua terdiri dari enam kali pertemuan. Peneliti sebagai pengelola instrumen, perancang tindakan dan guru. Prosedur pengumpulan data diperoleh melalui lembar observasi keterlaksanaan tindakan oleh guru dan siswa dalam metode GI yang dipadu dengan game puzzle, lembar observasi aktivitas belajar siswa dalam metode GI yang dipadu dengan game puzzle, pemberian test hasil belajar kognitif dan afektif setiap akhir siklus dan pengisian lembar penilaian hasil belajar psikomotorik. Tahap-tahap penelitian meliputi planning, implementing, observing dan reflecting yang pelaksanaannya disesuaikan dengan GI yang dipadu dengan game puzzle. Hasil penelitian menunjukkan bahwa penerapan metode GI yang dipadu dengan game puzzle dapat meningkatkan aktivitas dan hasil belajar siswa kelas VII-B SMP Negeri 1 Bondowoso. Aktivitas belajar siswa dari siklus I 73,63% dengan kriteria baik dan pada siklus II sebesar 89,57% dengan kriteria sangat baik, sehingga terjadi peningkatan 15,94%. Terdapat peningkatan hasil belajar kognitif dari siklus I sebesar 74,07% dan siklus II sebesar 96,29% sehingga ada peningkatan sebesar 22,22%, hasil belajar afektif tidak terjadi peningkatan dari siklus I ke siklus II, tetapi nilai hasil belajar afektif sangat bagus yaitu sebesar 96,29%. Peningkatan terjadi juga pada hasil belajar psikomotor dari siklus I sebesar 77,78% menjadi 100% pada siklus II sehingga ada peningkatan sebesar 22,22%. Dari hasil penelitian dapat disarankan, agar guru menggunakan metode GI yang dipadu dengan game puzzle untuk pembelajaran Biologi pada materi yang dapat diinvestigasi. Guru bisa mencari bentuk permainan lain yang disukai siswa yang berguna sebagai penguatan konsep dan dipadukan dengan metode pembelajaran yang relevan. Teknik tersebut sesuai dengan sifat anak SMP yang masih suka bermain.

Analisis faktor-faktor yang mempengaruhi audit fee dari segi client attributes (studi pada perusahaan yang listing di Singapore Exchange Ltd. Company tahun 2011-21013) / Muhammad Audy Prasetya

 

ABSTRAK Prasetya, Muhammad Audy. 2015. AnalisisFaktor-Faktor yang Mempengaruhi Audit Fee dariSegi Client Attributes (Studipada Perusahaan yang Listing di Singapore Exchange Ltd. Company Tahun 2011-2013).Skripsi. JurusanAkuntansi, FakultasEkonomiUniversitasNegeri Malang. Pembimbing: (1) Hj. YuliWidiAstuti, S.E., M.Si., Ak. (2) NujmatulLaily, S.Pd., M.SA. Kata kunci: Firm Size, Inherent Risk, Complexity, Profitability, Leverage, Corporate Governance, Industry, danAudit Fee. Penelitianinibertujuanuntukmemberikaninformasimengenaifaktor-faktor yang mempengaruhiaudit feedarisegiclient attributes. Variabel-variabel yang terdapatdalamclient attributesadalahfirm size, inherent risk, complexity, profitability, leverage, corporate governance dan industry.Penelitianinimenggunakanpendekatankuantitatifdenganjenispenelitianeksplanasi. Populasipenelitianinimeliputiseluruhperusahaanyang listing di Singapore Exchange Ltd. Company periode 2011-2013 yang dipilihberdasarkankarakteristiktertentusehinggadiperoleh 184 perusahaansebagaipopulasipenelitian. Metodepengambilansampel yang digunakanadalahSimple Random Sampling. Berdasarkanpemilihansampel, sampel yang digunakandalampenelitianiniadalah 65perusahaan. Penelitianinimenggunakanannual report perusahaan yang listing di Singapore Exchange Ltd.Company 2011-2013sebagai data penelitian.PenelitianinimenggunakanmetodeStructural Equation Model – Partial Least Square (SEM-PLS) sebagaiteknikanalisis data danpengujianhipotesis. Hasilpenelitianmenunjukkanbahwavariabelfirm size,inherent risk, profitability,leverage, danindustrytidakberpengaruhterhadapaudit fee.Variabelcomplexitydancorporate governanceberpengaruhterhadapaudit fee.HasilpengujiansimultanmenunjukkannilaiR-squareyang dihasilkansebesar 0,281, artinya 28,1% besarkecilnyaaudit feedipengaruhiolehvariabeldarisegiclient attributes.

Pengembangan modul PKN berbasis kemampuan berpikir kritis SMP kelas VIII / Nofi Rosita Hayati

 

Kata Kunci: Pengembangan Modul, PKn SMP, Berpikir Kritis Pengajaran dengan modul adalah salah satu pembelajaran yang berorientasi kepada siswa (student centered).Modul merupakan bahan ajar cetak yang dirancang untuk dapat dipelajari secara mandiri oleh peserta pembelajaran Modul disebut juga media untuk belajar mandiri karena didalamnya telah dilengkapi petunjuk untuk belajar mandiri. ( htttp://www. Rosyid info.2010/06pengertian-funsi-dan-tujuan-penulisan.html). Penggunaan modul dalam kegiatan pembelajaran diharapkan dapat mempermudah siswa dalam memahami suatu konsep melalui gaya penulisan yang komunikatif yang diharapkan akan menambah motivasi dan minat baca siswa. Kegiatan pembelajaran PKn akan lebih bermakna bila ditunjang dengan adanya modul, bagi guru menyiapkan dan menyusun modul yang baik memakan waktu, memerlukan keahlian, dan keterampilan yang cukup memadai. Hendaknya guru yang memulai pengajaran dengan modul, diberikan waktu khusus untuk mempersiapkannya. Saat ini dilakukan berbagai usaha mengembangkan modul pembelajaran yang sesuai dengan materi PKn yang diajarkan dengan pembelajaran yang sesuai salah satunya dengan berpikir kritis. Oleh karena itu pada penelitian ini dikembangkan Modul Pkn Berbasis Kemampuan Berpikir Kritis SMP Kelas VIII. Tujuan penelitian ini adalah untuk menghasilkan Modul PKn Berbasis Kemampuan Berpikir Kritis SMP Kelas VIII serta menguji tingkat kelayakkannya. Langkah pengembangan modul ini meliputi penelitian dan pengumpulan data, perencanaan, pengembangan produk awal, uji coba kelompok kecil dan uji coba lapangan (kelompok besar). Uji coba pada pengembangan ini meliputi tinjauan Ahli, uji coba kelompok kecil dan uji coba kelompok besar (uji lapangan). Tinjauan ahli terdiri dari 1 ahli media yaitu Dosen TEP, 1 Ahli pembelajaran yaitu guru PKn, dan 1 ahli Pkn yaitu Dosen PPKN. Uji coba kelompok kecil sebanyak 6 siswa MTs Mubtadiin Malang, dan Uji coba Kelompok besar (Uji lapangan) sebanyak 30 siswa MTs Mubtadiin Malang. Hasil pengembangan dari penelitian ini terdiri dari 4 bagian yaitu bagian pendahuluan, bagian isi, bagian akhir dan bagian kunci jawaban. Bagian pendahuluan terdiri dari halaman muka (cover), halaman dalam, kata pengantar, petujuk penggunaan, daftar isi, daftar gambar, daftar tabel. Bagian isi terdiri dari 5 Bab, wacana, ajang berpikir kritis dan soal latihan. Bagian akhir terdiri dari daftar pustaka. Bagian kunci jawaban berisi jawaban-jawaban dari soal ajang berpikir kritis dan soal latihan. Hasil dari ahli media, ahli pembelajaran, ahli PKn , uji coba kelompok kecil dan uji coba kelompok besar diperoleh persentase sebesar (70,1%¬100%) dengan makna digunakan. Hal ini menunjukkan bahwa modul PKn yang dikembangkan sudah layak digunakan sebagai bahan ajar. Saran yang dapat diberikan adalah (1). Modul PKn SMP Kelas VIII yang dikembangkan akan lebih i baik bila di uji cobakan lebih dari satu sekolahan. (2). Guru yang menggunakan Modul PKn SMP Kelas VIII yang dikembangkan, sebaiknya terlebih dahulu mempelajari langkah-langkah berpikir kritis (3). Modul PKn SMP Kelas VIII yang dikembangkan diharapkan dapat bermanfaat sebagai media pembelajaran PKn SMP Kelas VIII.

Pengaruh brand image (Citra Merek) terhadap keputusan pembelian laptop merek Axioo (Studi pada pemilik laptop merek Axioo di kedai kopi hotspot AB3 Dinoyo Malang) / Sindy Mita Kusumawardani

 

Kata kunci: Brand image, Keputusan pembelian. Perkembangan pengguna laptop setiap hari semakin meningkat. Komputer jinjing alias laptop kini bukan lagi dianggap sebagai barang mewah. Dari banyaknya laptop yang beredar di pasar, diperlukan brand image yang baik dari pihak konsumen terhadap sebuah produk sebelum melakukan keputusan pembelian laptop. Brand image yang mempengaruhi keputusan pembelian ini terdiri dari empat macam, yaitu Jenis-jenis Asosiasi Merek, Dukungan Asosiasi Merek, Kekuatan Asosiasi Merek, dan Keunikan Asosiasi Merek. Keempat macam brand image ini diaplikasikan oleh konsumen ketika membeli laptop Axioo. Tujuan dari penelitian ini adalah untuk mengetahui deskripsi keadaan Brand image dan Keputusan Pengguna Laptop Axioo di Kedai Kopi Hotspot AB3 Dinoyo Malang dalam Membeli Laptop Axioo, mengetahui pengaruh variabel. Brand Image (Jenis-jenis Asosiasi merek, Dukungan asosiasi merek, Kekuatan asosiasi merek, dan Keunikan asosiasi merek) secara parsial maupun simultan terhadap keputusan pembelian laptop Axioo, dan mengetahui sub variabel brand image yang dominan mempengaruhi keputusan pembelian. Penelitian ini dilakukan di Kedai Kopi Hotspot AB3 Dinoyo Malang. Variabel dalam penelitian ini, meliputi variabel bebas yaitu brand image (X) dengan subvariabel Jenis-jenis Asosiasi merek (X1), Dukungan asosiasi merek (X2), Kekuatan asosiasi merek (X3), serta Keunikan asosiasi merek (X4) sedangkan variabel terikat (Y) adalah keputusan pembelian. Populasi dalam penelitian ini yaitu pengguna laptop Axioo di Kedai Kopi Hotspot AB3 Dinoyo Malang dengan jumlah sampel sejumlah 100 responden yang dipilih dengan menggunakan teknik purposive sampling dan menggunakan instrumen berupa kuesioner. Sedangkan teknik analisis data dalam penelitian ini adalah teknik analisis regresi linier berganda. Berdasarkan hasil penelitian ini diketahui bahwa Jenis-jenis Asosiasi merek (X1), Dukungan asosiasi merek (X2), Kekuatan asosiasi merek (X3), serta Keunikan asosiasi merek (X4) mempunyai nilai thitung masing-masing (4,318; 2,254; 2,576; 2,249) sedangkan nilai Fhitung sebesar 15,529 dengan tingkat signifikansi sebesar 0,000 lebih kecil dari nilai 0,05. Berdasarkan hasil tersebut dapat disimpulkan Brand image yang terdiri dari Jenis-jenis Asosiasi merek (X1), Dukungan asosiasi merek (X2), Kekuatan asosiasi merek (X3), serta Keunikan asosiasi merek (X4) berpengaruh positif dan signifikan terhadap keputusan pembelian (Y) laptop Axioo baik secara parsial maupun simultan. Sedangkan faktor berpengaruh dominan terhadap keputusan pembelian laptop Axioo adalah Jenis-jenis Asosiasi merek (X1)

Hubungan penguasaan teori dan minat belajar dengan kompetensi praktikum intalasi penerangan listrik pada siswa Kelas XI TIPTL di SMK Negari 6 Malang tahun ajaran 2015/2016 / Galih Aditya Ragil Putra

 

ABSTRAK Ragil Putra, Galih Aditya. HubunganPenguasaanTeoridanMinatBelajardenganKompetensiPraktikumInstalasiPeneranganListrikpadaSiswaKelas XI TIPTL SMK Negeri 6 Malang TahunAjaran 2015/2016. Skripsi, JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: (1) Drs. DwiPrihanto, S.S.T., M.Pd, (2) Drs. Sujono, M.T. Kata Kunci: hubungan, penguasaanteori, minatbelajar, kompetensipraktikum Pendidikanmerupakanfaktor yang sangatpentingdalammewujudkansuatunegara yang berkualitas. Upayatersebutsalahsatunyadenganmeningkatkankualitaslulusan SMK dalammenyiapkantenagakerja yang terampil agar dapatbersaingmemasukilapangankerja. Salah satunyadenganlebihmemperhatikanfaktor yang mempengaruhibelajar, sepertipenguasaanteoridanminatbelajar. Tujuandaripenelitianiniadalahuntukmengungkaphubunganantarapenguasaanteori (X1) danminatbelajarsiswa (X2) dengankompetensipraktikuminstalasipeneranganlistrik(Y) di SMKN 6 Malang baiksecaraparsialmaupunsecarasimultan, sertamendeskripsikanmasing-masingvariabelpenguasaanteori, minatbelajar, dankompetensiPraktikumInstalasiPeneranganListrik. Penelitianiniadalahpenelitiankorelasional. Sampeldaripenelitianiniadalahseluruhsiswakelas XI TIPTL SMKN 6 Malang. Pengumpulan data (penguasaanteori) menggunakantes, (minatbelajar) menggunakanangketdan data (kompetensiPraktikumInstalasiPeneranganListrik) menggunakan data dokumentasinilaihasilpraktikuminstalasipeneranganlistrik. Ujipersyaratananalisispenelitianinitelahmemenuhipersyaratan. UntukmengungkappenguasaanteoridengankompetensiPraktikumInstalasiPeneranganListrikdanminatbeajardengankompetensiPraktikumInstalasiPeneranganListrikmenggunakananalisiskorelasiparsial. SedangkanuntukpenguasaanteoridanminatbelajarsecarasimultandengankompetensiPraktikumInstalasiPeneranganListrikmenggunakananalisisregresi linier gandadenganbantuan software IBM SPSS Statistics 22. HasilPenelitian: (1) penguasaanteorikategorisedang (44%), (2) minatbelajardalamkategorisangattinggi (44%), (3) kompetensipraktikumdalamkategoritinggi (35%), (4) terdapathubunganpositifdansignifikanantarapenguasaanteoridengankompetensiPraktikumInstalasiPeneranganListrik yang memilikikorelasiparsialsebesar0.679, (5) terdapathubunganpositifdansignifikanantaraminatbelajardengankompetensiPraktikumInstalasiPeneranganListrikyang memilikikorelasiparsialsebesar 0,421, (6) terdapathubunganpositifdansimultanantarapenguasaanteoridanminatbelajardenganPraktikumInstalasiPeneranganListrik, dan (7) terdapatsumbanganprediktorsebesar51,6% terhadapvariabelbebas.

Penggunaan pembelajaran model silih tanya dengan bantuan kartu model untuk meningkatkan hasil belajar matematika siswa kelas X-3 SMA Negeri 5 Malang / Nanda Nike Rosidha

 

Kata kunci: silih tanya, kartu model, hasil belajar matematika Metode pembelajaran matematika di SMA Negeri 5 Malang yang sering digunakan guru. Peserta didik cenderung hanya mendengar materi yang disampaikan oleh guru dan tidak mempunyai keinginan untuk menyampaikan ide kreatifitasnya sendiri. Hudoyo (1998) berpendapat bahwa belajar matematika merupakan proses membangun dan mengkonstruksikan konsep-konsep dan prinsip-prinsip matematika. Hal inilah yang mendorong peneliti untuk mengadakan penelitian tentang penerapan model silih tanya agar peserta didik lebih bersemangat untuk berpartisipasi aktif dalam pokok bahasan persamaan kuadrat. Penelitian ini bertujuan untuk mendeskripsikan penerapan pembelajaran silih tanya dengan bantuan kartu model sehingga diharapkan dapat meningkatkan hasil belajar siswa kelas X-3 SMA Negeri 5 Malang. Dan pad akhirnya dapat dimanfaatkan oleh guru untuk menentukan pertimbangan dalam memilih srtategi pembelajaran yag tepat sehingga dapat meningkatkan prestasi belajar siswa. selai itu dengan metode silih tanya ii dapat melatih kepemimpinan dan kerjasama siswa dalam bekerja secara kelompok. Penelitian ini menggunakan pendekatan kualitatif dengan penelitian tindakan kelas sebagai jenis penelitiannya. Penelitian dilakukan pada bulan Oktober sampai dengan November 2010 di SMA Negeri 5 Malang, tepatnya di kelas X-3. Penelitian dilakukan dalam 2 siklus dan masing-masing siklus terdiri dari 3 pertemuan, di mana pada setiap siklus peneliti melaksanakan pembelajaran yang di awali dengan pembelajaran ekspositori kemudian dilanjutkan pembelajaran dengan silih tanya yang meliputi pembuatan soal dan kunci jawabannya, pembentukan kelompok bermain, penentuan urutan pengajuan soal dan lamanya pengerjaan soal, pengumpulan kunci jawaban, proses saling tanya jawab, pengembalian kunci jawaban, pengoreksian jawaban, pemberian nilai, pengumpulan hasil pekerjaan siswa, perekapan nilai, pengumuman pemenang, dan diakhiri dengan tes akhir tindakan. Hasil penelitian ini menunjukkan bahwa pembelajaran dengan menggunakan pembelajaran Silih Tanya dengan bantuan kartu model dapat meningkatkan hasil belajar siswa. Hal ini ditunjukkan dengan peningkatan rata-rata skor tes, peningkatan ketuntasan belajar siswa (tes awal adalah 20%, pada siklus I adalah 63%, pada siklus II adalah 89%), dan berdasarkan hasil evaluasi pelaksanaan silih tanya pada siklus I tuntas sebanyak 82% dan pada siklus II tuntas 91%.. Hal tersebut diperkuat dengan hasil observasi aktivitas siswa dan guru masuk dalam kategori “Baik” pada siklus I dan hasil observasi aktivitas siswa dan guru masuk dalam kategori “Sangat Baik” pada siklus II.

Penulisan deskripsi bibliografi koleksi pada Opac di Perpustakaan Politeknik Kesehatan Kemenkes Malang / Iva Yuana Putri

 

ABSTRAK Putri, Iva Yuana. 2015. Penulisan Deskripsi Bibliografi Koleksi pada OPAC di Perpustakaan Politeknik Kesehatan Kemenkes Malang. Tugas Akhir, Program Studi D3 Perpustakaan, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Wahyudi Siswanto, M.Pd, (II) Drs. Dwi Sugianto, M.Pd. Kata Kunci: deskripsi bibliografi, OPAC Deskripsi bibliografi merupakan suatu susunan data bibliografi yang mencakup informasi-informasi penting dari bahan pustaka yang dicatat pada katalog yang bertujuan untuk memberikan kemudahan dan kecepatan kepada pemustaka dalam menemukan koleksi. Tujuan penulisan tugas akhir ini adalah untuk mendeskripsikan: (a) proses entri data pada OPAC (Online Public Access Catalogue) di Pepustakaan Politeknik Kesehatan Kemenkes Malang, (b) penulisan deskripsi bibliografi koleksi pada OPAC (Online Public Access Catalogue) di Perpustakaan Politeknik Kesehatan Kemenkes Malang, dan (c) kendala-kendala dalam penulisan deskripsi bibliografi koleksi pada OPAC (Online Public Access Catalogue) di Perpustakaan Politeknik Kesehatan Kemenkes Malang. Penelitian ini menggunakan desain penelitian deskriptif kualitatif. Penelitian ini dilakukan di Perpustakaan Politeknik Kesehatan Kemenkes Malang. Data dalam penelitian ini adalah penulisan deskripsi bibliografi yang diperoleh dari OPAC (Online Public Access Catalogue) dan pustakawan. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara dan dokumentasi. Langkah-langkah dalam melakukan analisis data, yaitu: (1) peneliti mengumpulkan data-data dari hasil observasi, wawancara dan dokumentasi untuk selanjutnya diseleksi dan dikualifikasikan yang berkenaan dengan proses entri data, penulisan deskripsi bibliografi pada OPAC dan kendala-kendala dalam penulisan deskripsi bibliografi, (2) peneliti menyajikan data dalam bentuk naratif, dan (3) menarik kesimpulan dari data yang telah dianalisis. Berdasarkan hasil pendeskripsian penulisan deskripsi bibliografi koleksi pada OPAC di Perpustakaan Politeknik Kesehatan Kemenkes Malang diperoleh tiga simpulan, yaitu: pertama, proses entri data pada OPAC adalah sebagai berikut: (1) login petugas, (2) klik menu buku, pilih tambah baru, (3) mengisi field-field yang tersedia yang meliputi ID buku, ISBN, klasifikasi, judul buku dan anak judul (jika ada), pengarang, subjek, luasan pustaka, bahasa, tahun terbit, edisi, nama penerbit, kota terbit, status penyimpanan (tersedia atau tidak), lokasi penyimpanan, jumlah eksemplar, item koleksi, dan gambar/cover buku, kemudian (4) klik simpan. Kedua, penulisan deskripsi bibliografi koleksi pada OPAC (Online Public Access Catalogue) terdapat beberapa kekeliruan, tidak konsisten, dan kurang lengkapnya informasi yang di entri. Ketiga, dalam penulisan deskripsi bibliografi koleksi pada OPAC (Online Public Access Catalogue) mengalami beberapa kendala, antara lain: (1) pustakawan (SDM), yaitu kurang teliti dan kurang lengkapnya informasi yang di entri pada aplikasi, (2) sistem, yaitu sering terjadi error atau gangguan dari jaringan internet dan dari aplikasinya sendiri, sehingga jika terjadi error pihak perpustakaan mendatangkan programmer, dan (3) sarana dan prasarana, yaitu tidak adanya pedoman atau sumber referensi yang dijadikan pedoman kerja dalam penulisan deskripsi bibliografi, sehingga penulisan menjadi tidak konsisten. Serta tidak tersedianya komputer untuk penelusuran melalui OPAC atau alat penelusuran lainnya seperti katalog konvensional.

Pengaruh investment opportunity set (IOS) terhadap return saham blue chip (LQ45) pada bursa Efek Indonesia periode 2006-2008 / Dhea Primayudha Purnamasari

 

Kata kunci: IOS, Market to book value of asset, market to book value of equity, price to earnings, capital xpenditure to book value asset, return saham LQ45. Tujuan perusahaan melakukan investasi adalah adanya harapan untuk mendapatkan keuntungan dimasa mendatang sehingga perusahaan dapat dikatakan going concern. Keberlanjutan suatu usaha berkaitan dengan pertumbuhan perusahaan yang menghasilkan prospek yang menguntungkan, karena investasi yang ditanamkan diharapkan akan memberikan return yang tinggi. Pilihan-pilihan investasi yang dilakukan perusahaan di masa depan tersebut kemudian dikenal dengan investment opportunity set (IOS) yang proksi dengan market to book value of asset (MBVA), market to book value of equity (MBVE), price earnings ratios (PER) dan capital expenditure to book value asset (CAPBVA). Penelitian ini menggunakan saham yang masuk dalam indeks LQ45 dikarenakan memiliki fundamental yang baik dan memiliki posisi keuangan yang mencerminkan pertumbuhan perusahaan. Populasi dalam penelitian ini adalah perusahaan yang terdaftar dalam Indeks LQ45 di Bursa Efek Indonesia periode 2006-2008 dengan jumlah 135 perusahaan. Dengan teknik purposive sampling diperoleh sampel sebesar 51 perusahaan. Sedangkan metode analisis datanya menggunakan analisis regresi linear berganda. Berdasarkan hasil penelitian diketahui bahwa variabel MBVA (X1) mempunyai nilai thitung 2,472 dan ttabel 2,0076, sehingga thitung > ttabel. Dengan sig.t 0,017 lebih kecil dari nilai 0,05. Sedangkan variabel MBVE (X2), PER (X3), dan CAPBVA (X4) mempunyai nilai thitung masing-masing (0,149; 0,832; -0,461) dan ttabel 2,0076 sehingga thitung < ttabel. Dengan sig.t masing-masing (0,882; 0,410; 0,647) lebih besar dari nilai 0,05. Dengan demikian dapat disimpulkan bahwa MBVE berpengaruh positif dan signifikan, sedangkan MBVE, PER dan CAPBVA tidak berpengaruh terhadap return saham LQ45 periode 2006-2008. Saran yang diberikan untuk mengatasi keterbatasan penelitian ini adalah (1) Untuk lebih mengetahui seberapa akurat IOS mempengaruhi return saham perusahaan, perlu dilakukan penelitian dengan periodisasi yang lebih panjang yang melibatkan tahun-tahun penelitian yang tidak terkena dampak krisis keuangan dan tahun yang terkena dampak krisis keuangan.; (2) Penentuan sampel penelitian terhadap proksi IOS, hendaknya penelitian selanjutnya menggunkan sektor perusahaan yang sejenis, agar lebih dapat menginterpretasikan proksi IOS terhadap return saham perusahaan.; (3) Penggunaan return saham perusahaan yang melibatkan jumlah dividen yang dibagikan oleh perusahaan kepada para pemegang saham biasa atau disebut relative return.

Hubungan antara persepsi guru terhadap proses pembuatan keputusan kepala sekolah dan kepuasan Kerja di Sekolah Menengah Atas (SMA) Negeri se-Kota Kediri / Wyenda Lazuardi

 

ABSTRAK Lazuardi, Wyenda. 2014.Hubungan Antara Persepsi Guru terhadap Proses Pembuatan Keputusan Kepala Sekolah dan Kepuasan Kerja di Sekolah Menengah (SMA) Negeri se-Kota Kediri. Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Ali Imron, M.Pd, M.Si, (II) Sunarni, S. Pd, M. Pd Kata Kunci: persepsi, proses pembuatan keputusan, kepuasan kerja. Pembuatan keputusan selalu dilakukan oleh manusia di setiap kehidupannya, karena di setiap keputusan yang diambil akan memberikan pembelajaran untuk masalah-masalah yang dihadapi selanjutnya. Pembuatan keputusan diperlukan di semua tingkat administrator dalam organisasi, tidak terkecuali di sekolah. Kepala sekolah juga berperan sebagai manajer yang mempunyai tugas sebagai penentu hasil akhir sebuah keputusan yang bertujuan untuk meningkatkan kualitas lembaga yang dipimpinnya, selain itu pembuatan keputusan oleh kepala sekolah juga memberikan tantangan bagaimana ia dapat mengembangkan kemampuannya untuk mengelola sekolah. Di dalam setiap pembuatan keputusan untuk menuju pada suatu hasil di dalamnya pasti terdapat proses. Untuk mendapatkan keputusan yang terbaik, proses yang dilakukan juga semakin panjang karena harus memilih alternatif-alternatif terpilih yang telah dimiliki seorang pemimpin sebagai penentu utama dalam setiap keputusan. Kadang di dalam proses pembuatan keputusan terdapat persepsi yang berbeda dari setiap anggota pengambil keputusan (guru). Jika persepsi mereka kurang baik terhadap proses yang dijalani kepala sekolah disaat pembuatan keputusan akan berpengaruh juga terhadap kepuasan kerja guru, dikarenakan guru juga sebagai pelaksana dari keputusan kepala sekolah pasti akan selalu berfikir negatif proses pembuatan keputusan jangan-jangan hasilnya akan merugikan mereka atau kurang memperhatikan kebutuhan-kebutuhan yang guru perlukan. Oleh karena itu persepsi atau anggapan terhadap proses pembuatan keputusan setiap guru berbeda-beda. Setiap individu guru mempunyai latar pemikiran yang berbeda serta kebutuhan yang berbeda, maka dari itu tidak salah jika setiap guru mempunyai persepsi yang berbeda terhadap proses pembuatan keputusan yang dilakukan oleh kepala sekolah. Baik buruknya persepsi guru terhadap pengambilan keputusan mempengaruhi kepuasan kerja guru di dalam melaksanakan pekerjaannya. Tujuan penelitian ini secara rinci adalah: (1) mengungkapkan persepsi guru terhadap proses pembuatan keputusan yang dilakukan oleh kepala sekolah; (2) mengetahui tingkat kepuasan kerja guru terhadap pembuatan keputusan kepala sekolah; (3) mengetahui apakah ada hubungan antara persepsi guru terhadap proses pembuatan keputusan kepala sekolah dan kepuasan kerja di SMAN se-Kota Kediri. Penelitian ini menggunakan rancangan penelitian dengan pendekatan kuantitatif deskriptif korelasional. Teknik pengumpulan data yang digunakan adalah metode angket/kuesioner. Pada penelitian ini menggunakan uji validitas dan reliabilitas untuk mengetahui keabsahan data penelitian. Teknik analisis data yang digunakan adalah dengan menggunakan teknik korelasi product moment. Berdasarkan analisis data tersebut, diperoleh kesimpulan mengenai hasil penelitian sebagai berikut: (1) persepsi guru terhadap proses pembuatan keputusan oleh kepala sekolah Menengah Atas Negeri se-Kota Kediri dalam kategori baik; (2) tingkat kepuasan kerja guru SMA Negeri se-Kota Kediri berada dalam kategori tinggi; (3) tidak ada hubungan yang signifikan antara persepsi guru terhadap proses pembuatan keputusan kepala sekolah dan kepuasan kerja di Sekolah Menengah Atas (SMA) Negeri se-Kota Kediri. Berdasarkan kesimpulan dari penelitian ini, maka saran dapat dirumuskan sebagai berikut: (1) kepala SMA Negeri se-Kota Kediri,mengingat variabel persepsi guru terhadap proses pembuatan keputusan Kepala Sekolah berada pada kategori yang tinggi, maka kepala Sekolah Menengah Atas Negeri se-Kota Kediri harus senantiasa lebih meningkatkan kemampuannya dalam membuat keputusan sesuai dengan langkah yang benar; (2) guru SMA Negeri se-Kota Kediri, guru diharapkan dapat meningkatkan kinerjanya agar dapat menciptakan anak didik yang nantinya dapat berguna bagi negaranya, tidak mudah puas dengan apa yang telah dicapai selama ini, dan juga ikut serta bertanggungjawab dalam pelaksanaan kegiatan di dalam sekolah; (3) ketua jurusan Administrasi Pendidikan, hasil penelitian ini diharapkan akan menjadi sumber referensi bagi perkembangan perkuliahan khususnya yang membidangi ilmu manajemen sumber daya manusia (SDM). Serta referensi mengenai kepuasan kerja di bidang pendidikan, karena yang sering sekali ditemukan adalah kepuasan kerja di bidang ekonomi (perusahaan); (4) peneliti lain, mengingat masih terdapat beberapa kekurangan pada penelitian ini, diantaranya keterbatasan variabel penelitian yang diteliti, maka diharapkan pada peneliti selanjutnya untuk lebih disempurnakan baik dari segi poulasi penelitian, variabel penelitian, dan juga instrumen penelitian yang digunakan.

Analisis strategi pengembangan produk dan penyerapan tenaga kerja di Pabrik Rokok Djagung Padi Mas (studi kasus di Pabrik Rokok Djagung Padi Mas Kecamatan Kedungkandang Kota Malang) / Emil Yulia Darma

 

ABSTRAK Yulia, Emil. 2015. Analisis Strategi Pengembangan Produk Dan Penyerapan Tenaga Kerja Industri Pabrik Rokok Djagung Padi Mas. Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. Mardono, M, Si, (II) Thomas Soseco, S.E, M.Sc. Kata Kunci: strategi pengembangan produk, jumlah produksi, penyerapan tenaga kerja. Dewasa ini tingkat persaingan di antara berbagai perusahaan semakin meningkat dan tentunya pada masa-masa yang akan datang persaingan akan semkin ketat. Kondisi ini memposisikan perusahaan agar dapat selalu memberikan pelayanan yang baik dan memuaskan kepada konsumen, terutama terkait dengan produk-produk yang dihasilkan oleh perusahaan. Fenomena yang ada menunjukkan bahwa tingkat persaingan juga diikuti oleh siklus hidup produk (product life cycle) yang semakin lama semakin pendek. Produk memiliki arti penting bagi perusahaan karena tanpa adanya produk, perusahaan tidak akan dapat melakukan apapun dari usahanya. Persaingan industri yang semakin ketat menuntut perusahaan untuk mengoptimalkan seluruh sumber daya yang dimiliki dalam menghasilkan produk berkualitas tinggi agar mampu bertahan dalam persaingan dengan perusahaan lain. Tujuan Penelitian : Untuk mengetahui strategi pengembangan produk dan penyerapan tenaga kerja Industri Pabrik Rokok Djagung Di Kedungkandang Kota Malang. Untuk mengetahui kendala yang dihadapi dalam strategi pengembangan produk dan penyerapan tenaga kerja Industri Pabrik Rokok Djagung Padi Mas Di Kedungkandang Kota Malang. Metode penelitian menggunakan penelitian deskriptif kuantitatif, adalah metode penelitian yang digunakan untuk meneliti dengan menggunakan data yang ada, kemudian diuraikan oleh penulis. Analisis data yang digunakan untuk memecahkan masalah adalah sebagai berikut : Mempertimbangkan deregulasi industri sebagai salah satu faktor strategis berbagai kemungkinan alternatif strategi (SO, ST, WO, WT). Pengembangan produk dan pengembangan tenaga yang dilakukan PT. Djagung Padi Mas Malang dari tahun 2013-2015. Tahun 2013 pengembangan produk Djagung Pada Hijau 10, Djagung Pada Hijau 16, Djagung Pada Coklat 12, Djagung Pada Coklat 16 memerlukan tenaga kerja berjumlah 300 orang. Tahun 2014 pengembangan produk Djagung Pada Hijau 10, Djagung Pada Hijau 16, Djagung Pada Coklat 12, Djagung Pada Coklat 16 memerlukan tenaga kerja berjumlah 305 orang. Tahun 2015 pengembangan produk Djagung Pada Hijau 10, Djagung Pada Hijau 16, Djagung Pada Coklat 12, Djagung Pada Coklat 16 memerlukan tenaga kerja berjumlah 302 orang. PT. Djagung Padi Mas Malang, menjelaskan mengenai Faktor-faktor yang menghambat pengembangan produk, yaitu: 1. Kekurangan gagasan mengenai produk, mahalnya proses pengembangan produk baru, siklus hidup produk yang lebih singkat, banyaknya produk yang sejenis.Lingkungan internal PT. Djagung Padi Mas Malang. meliputi sumber daya perusahaan, sumber daya tersebut yaitu sumber daya berwujud dan tidak berwujud, selain itu lingkungan internal juga meliputi kompetensi inti. Disamping lingkungan internal ada juga lingkungan eksternal pada PT. Djagung Padi Mas Malang. yang meliputi lingkungan khusus dan lingkungan umum yang menjadi lingkungan khusus perusahaan antara lain pelanggan, pemasok, dan pesaing. Sedangkan yang termasuk dalam lingkungan umum yaitu kondisi ekonomi,kondisi politik atau hukum, kondisi sosial dan budaya, kondisi demografi, teknologi dan global. ekuatan yang dimiliki PT. Djagung Padi Mas Malang. antara lain memiliki produk yang bervariatif, sumber daya yang memiliki loyalitas, dan salah satu perusahaan yang memiliki ekuitas merk yang baik. Tidak adanya kekuatan tetapi perusahaan juga memiliki kelemahan yang harus dibenahi, antara lain tingkat pendidikan karyawan kurang, pangsa pasar yang masih rendah, dan sumberdaya manusia yang belum memanfaatkan teknologi belum maksimal. Selain itu ancaman yang dihadapi semakin komplek seperti tingkat inflasi yang belum stabil, ancaman pendatang baru, persaingan diantara perusahaan rokok, citra perusahaan yang masih buruk dimasyarakat. Akan tetapi perusahaan diharapkan mampu mengahadapinya dengan mampu memanfaatkan peluang yang ada yaitu kemajuan teknologi, jumlah penduduk yang meningkat, tingkat pendidikan yang semakin tinggi, pendapatan masyarakat meningkat, serta potensi yang dimanfaatkan cukup besar

Pengaruh PDB dan impor migas terhadap inflasi di Indonesia pada tahun 2012-2014 / Satyani Prameswara Tandhawijaya

 

ABSTRAK Tandhawijaya, Satyani P. 2015. Pengaruh PDB dan Impor Migas Terhadap Inflasi di Indonesia pada Tahun 2012-2014. Skripsi, Jurusan Ekonomi Pembangunan Fakultas Ekonomi Universitas Negeri Malang. Pembimbing : (I) Dr. Agung Haryono, S.E.,M.P.,Ak., (II) Drs. Mardono, M.Si. Kata Kunci : produk domestik bruto, impor migas, inflasi. Inflasi merupakan salah satu indikator yang digunakan untuk mengukur pertumbuhan ekonomi suatu negara. Pertumbuhan ekonomi suatu negara dikatakan baik apabila disertai stabilitas harga umum, yang diukur dengan tingkat inflasi dimana tingkat inflasi yang tinggi diikuti oleh kenaikan harga secara umum. Ketika perekonomian suatu negara berkembang pesat, kesempatan kerja yang tinggi akan menciptakan tingkat pendapatan yang tinggi pula. Apabila pendapatan masyarakat tinggi, maka daya beli masyarakat dan permintaan terhadap barang dan jasa akan meningkat pula. Saat jumlah permintaan melebihi kemampuan produksi maka akan terjadi kelangkaan yang diikuti kenaikan harga. Kenaikan harga secara terus menerus akan menyababkan tingginya tingkat inflasi. Keniakan harga barang yang merupakan kebutuhan pokok bagi masyarakat seperti BBM juga dapat mengakibatkan tingkat inflasi yang tinggi. Penelitian ini bertujuan untuk mengetahui pengaruh antara Produk Domestik Bruto dan impor migas terhadap inflasi. Periode penelitian dipilih dalam kurun waktu 2012-2014 karena pada masa itu terjadi gejolak ekonomi pada negara-negara di Amerika dan Eropa yang mempengaruhi perekonomian dunia termasuk harga migas di pasar internasional. Pada periode gejolak tersebut Indonesia mampu bertahan karena kuatnya konsumsi domestik dan investasi swasta sehingga mampu merefleksikan perekonomian Indonesia. Pengambilan data diperoleh dari data sekunder dengan model yang digunakan dalam menganalisis pengaruh variabel-variabel diatas tersebut adalah model korelasi dengan alat uji regresi linier berganda. Popolasi dalam penelitian ini adalah keseluruhan data Produk Domestik Bruto, impor migas, dan inflasi. Sampel dalam penelitian ini adalah data Produk Domestik Bruto, impor migas, dan inflasi Indonesia pada tahun 2012-2014. Pengambilan sampel dilakukan melalui metode purposive sampling. Hasil penelitian menunjukkan bahwa dua variabel yakni produk domestik bruto dan impor migas memiliki pengaruh positif terhadap inflasi. Dalam hubungan secara bersama-sama, dua variabel tersebut memiliki pengaruh kuat terhadap inflasi. Sehingga berdasarkan penelitian ini, dapat disarankan untuk peneliti selanjutnya agar menambahkan variabel yang bisa mempengaruhi inflasi seperti Jumlah Uang Beredar, Tingkat Suku Bunga, nilai tukar Rupiah terhadap Dollar dan menggunakan periode penelitian yang terbaru sehingga hasil penelitian akan lebih akurat dan relevan.

Pengembangan paket pembelajaran kimia untuk kelas XI IPA di SMAK Frateran malang / Francisca Wahyu Kurniawati

 

Kata kunci : pengembangan, paket pembelajaran, kimia Mata pelajaran Kimia merupakan salah satu pelajaran tersulit bagi kebanyakan siswa SMA. Kesulitan belajar kimia disebabkan oleh beberapa faktor. Salah satu faktor penyebabnya terkait dengan karakteristik ciri-ciri ilmu kimia itu sendiri yaitu (1) sebagian besar bersifat abstrak dan kompleks, (2) berjenjang dan berurutan, (3) memerlukan ketrampilan algoritma matematik. Faktor lain yang turut berperan sebagai penyebab kesulitan belajar kimia adalah karakteristik siswa. Karakteristik siswa Kelas XI IPA SMAK Frateran Malang yang dimaksud adalah (1) memiliki kemampuan yang bervariasi, (2) ketertarikannya terhadap mata pelajaran kimia rendah, (3) kemandirian belajar rendah, (4) kemampuan perhitungan matematis sedang sampai rendah, (5) kemampuan menafsirkan data berupa tabel, grafik dan bagan kurang.Selain itu guru yang menyampaikan mata pelajaran kimia umumnya menggunakan bahan ajar serta media konvensional yang tidak mempertimbangkan karakteristik materi pelajaran dan karakteristik siswa. Tesis ini bertujuan mengembangkan suatu paket pembelajaran kimia yang mempertimbangkan karakteristik mata pelajaran dan karakteristik siswa. Paket pembelajaran yang dirancang sesuai kebutuhan siswa dapat meningkatkan ketertarikan siswa dan pada gilirannya akan meningkatkan prestasi belajarnya. Model pengembangan yang dipilih adalah model Dick and Carey instructional system design. Alasan pemilihan model ini karena model Dick and Carey menggunakan pendekatan sistem-prosedural sesuai dengan karakteristik mata pelajaran kimia yang berjenjang dan berurutan, alasan lain adalah model ini dapat digunakan untuk pengembangan bahan pembelajaran pada ranah informasi verbal, ketrampilan intektual, psikomotor dan sikap yang relevan dengan Standar Isi Kurikulum Tingkat Satuan Pendidikan (KTSP). Tahapan yang dilakukan dalam pengembangan paket pembelajaran ini adalah (1) mengidentifikasi tujuan pembelajaran umum, (2) melakukan analisis pembelajaran, (3) mengidentifikasi kemampuan awal dan karakteristik siswa, (4) merumuskan tujuan pembelajaran khusus, (5) menyusun instrumen penilaian, (6) mengembangkan strategi pembelajaran, (7) mengembangkan dan memilih materi pembelajaran, (8) merancang dan melakukan evaluasi formatif, (9) merevisi pembelajaran. Penelitian pengembangan ini menghasilkan 5 (lima) produk yaitu (1) buku ajar, (2) panduan siswa, (3) panduan guru, (4) buku kerja dan (5) cd pendukung pembelajaran. Proses pengembangan melibatkan ahli isi mata pelajaran, ahli desain pembelajaran dan ahli media pembelajaran untuk memberikan tanggapan dan masukan perbaikan. Selain itu guru mata pelajaran kimia dan siswa SMAK Frateran Malang sebagai pengguna paket pembelajaran ini juga diminta memberikan tanggapan dan masukannya. Perbaikan produk pengembangan setelah reviewer ahli isi, ahli desain dan ahli media dengan tahap-tahap : (1) uji coba perorangan oleh 3 orang siswa sebagai responden, (2) uji coba kelompok kecil dengan 9 siswa sebagai responden, (3) uji coba lapangan dengan responden 21 siswa dan 1 guru kimia. Hasil uji coba lapangan menunjukkan (1) buku ajar memperoleh prosentase pencapaian 84,90% dari siswa dan 75% dari guru sehingga buku ajar berada dalam kualifikasi baik, (2) panduan siswa memperoleh penilaian 81,16% dari siswa menunjukkan berada pada kualifikasi sangat baik, (3) panduan guru memperoleh penilaian 80% dari guru menunjukkan berada pada kualifikasi baik, (4) media pendukung memperoleh 86,03% dari siswa dan 80% dari guru menunjukkan kualifikasi baik. Paket pembelajaran kimia kelas XI IPA semester gasal yang dikembangkan oleh Francisca Wahyu Kurniawati dapat digunakan oleh siswa dan guru kimia kelas XI IPA SMAK Frateran Malang dan dapat digunakan oleh guru dan siswa SMA dengan memperhatikan saran pemanfaatan produk, saran desiminasi dan saran pengembangan lebih lanjut.

Studi kasus banjir rancangan pada Waduk Gongseng dengan menggunakan metode Hidrograf Satuan Sintetik Nakayusu di Kabupaten Bojonegoro / Bayu Kurniawan

 

ABSTRAK Kurniawan, Bayu. 2014Studi Banjir Rancangan Waduk Gongseng dengan menggunakan Metode HidrografSatuanSintetikNakayasudiKabupatenBojonegoro. Proyek Akhir, Program Studi Diploma III Teknik Sipil dan Bangunan, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: Ir. Nugroho Suryoputro, M. T. dan Ir.Titi Rahayuningsih,M. SI. Kata kunci: banjir rancangan, higrografsatuansintetikNakayasu WadukGongseng di bangunpadasalahsatualiransungai yang manapadasungaitersebutmenjadialternatifpelimpahan air yang tertampungpadaWadukPacalsaatmusimhujanberlangsung.WadukGongsengtersebutdiharapkanmenjadisalahsatuWaduk yang dapatmemenuhituntutanmasyarakatdalampengembanganpertaniandanpeningkatansuplai air irigasi, sertapenyediaan air bakuuntukwilayahBojonegoro. Rumusan masalah dalam Proyek Akhir ini adalah berapakahcurahhujanrencanadenganmenggunakanmetodeGumbeldan berapakahdebit banjirrancangandenganmenggunakanmetode HSSNakayasu.Berdasarkan rumusan masalah tersebut, maka tujuan Proyek Akhir adalah untuk mengetahui banjirrancangandenganmenggunakanDistribusiGumbeldan HSSNakayasu untukwadukGongsengKabupatenBojonegoro. Metodeperhitungan HSS Nakayasu yaitu untukmenganalisa debit banjirrancangan. Parameter yang diperlukananalisisSatuanHidrografSintetikNakayasuadalah 1) Tenggangwaktudaripermulaanhujansampaipuncakhidrograf; 2) Tenggangwaktudarititikberathujansampaititikberathidrograf; 3) Tenggangwaktuhidrograf; 4) Luasdaerahpengaliran; 5) Panjangalursungaiutama; 6) koefisienpengaliran. Hasil perhitungan banjir rancangan denganmetodeGumbeladalahR2thn=82,670;R5thn=100,243;R10thn=111,878;R20thn=123,038;R25thn=126,579;R50thn=137,485;R100thn=148,310;R500thn=173,326;R1000thn=184,080. Sedangkanhasilperhitungan debit maksimumbanjirrancangandenganmetodeNakayasuadalahQ2thn= 91.582;Q5thn=130,850; Q10thn=157,654; Q20thn=183,399; Q25thn=191,614; Q50thn=217,035;Q100thn=242,430;Q500thn=301,634;Q1000thn=327,272.

Pelaksanaan strategi disain produk pada UD. Adi Anugerah Batu / Romdan M. Rijal

 

Kata kunci : Disain Produk, Strategi Disain Produk Persaingan kini sudah semakin global, dengan semakin pudarnya batas negara. Indonesia juga terekspos pada tantangan ini, terutama dengan kini diberlakukannya AFTA-China, yang tentunya mengakibatkan persaingan industri semakin meruncing. Menghadapi hal ini, bisnis harus punya strategi yang inovatif, salah satunya dengan mengandalkan disain produk. Penulisan Tugas Akhir ini bertujuan mendeskripsikan disain produk yang dilaksanakan oleh UD. Adi Anugerah Batu. Untuk mengetahui pelaksanaan strategi disain produk yang dilakukan oleh UD. Adi Anugerah Batu, ada empat masalah yang diamati, yaitu: (1) strategi strategi disain produk yang dilaksanakan oleh UD. Adi Anugerah Batu; (2) proses pembuatan disain produk yang dilaksanakan oleh UD. Adi Anugerah Batu; (3) kendala yang terjadi dalam pelaksanaan strategi disain produk yang dilaksanakan oleh UD. Adi Anugerah Batu; (4) cara mengatasi kendala yang terjadi dalam pelaksanaan strategi disain produk yang dilaksanakan oleh UD. Adi Anugerah Batu. Hasil dari Praktek Kerja Lapangan (PKL) menunjukkan bahwa: (1) strategi disain produk yang dilakukan oleh UD. Adi Anugerah Batu yaitu produk standar dengan modifikasi, yakni disain yang dibuat tergantung dengan permintaan konsumen dan diproduksi dalam jumlah banyak (2) proses pembuatan disain produk yaitu (a) pembuatan konsep, (b) visualisasi, (c) pembuatan prototype, (d) pengiriman kembali ke konsumen dan konfirmasi dan (e) produksi (3) kendala-kendala yang sering terjadi dalam pelaksanaan strategi disain produk adalah (a) perangkat lunak yang digunakan seperti Microsoft Windows, CorelDraw dan Photoshop tidak legal, (b) tidak adanya karyawan pada bagian disain produk (c) perangkat atau teknologi komputer yang digunakan kurang memenuhi standar spesifikasi disain (d) tidak adanya karyawan yang melayani konsumen (4) adapun cara untuk mengatasi kendala dalam pelaksanaan strategi disain produk antara lain: (a) membeli perangkat lunak yang digunakan seperti Microsoft Windows, CorelDraw dan Photoshop yang legal (asli), (b) melakukan perekrutan karyawan pada bagian disain produk (c) melakukan peremajaan teknologi komputer yang digunakan sesuai standar spesifikasi disain (d) melakukan perekrutan karyawan yang melayani konsumen. Dalam penulisan kali ini penulis berusaha untuk mengamati semua kegiatan yang berhubungan dengan strategi disain produk, dan setelah itu penulis berusahan untuk mendeskripsikannya.

Sintesis dan karakterisasi senyawa kompleks dari perak(I) nitrat dengan Ligan N,N'-dietiltiourea / Ratna Widayati

 

ABSTRAK Hidayati, Ratna. 2015.Sintesis dan Karakterisasi Senyawa Kompleks dari Perak(I) Nitrat dengan Ligan N,N’-dietiltiourea. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Fariati, M.Sc., (II) Prof. Effendy, Ph.D. Kata-kata kunci:sintesis, senyawa kompleks, karakterisasi, AgNO3, dan N,N’-dietiltiourea Reaksi antara AgNO3 dan ligan tiourea (tu) dengan perbandingan mol 1:3 menghasilkan senyawa kompleks ionik [Ag(tu)3](NO3). Struktur kation [Ag(tu)3]+adalah trigonal planar. Ligan N,N’-dietiltiourea (detu) merupakan turunan dari tu. Detu lebih sterik daripada tu karena adanya penggantian dua atom hidrogen dengan dua gugus etil.Senyawa kompleks dari AgNO3 dan detubelum disintesis. Pergantian tudengandetu dapat menghasilkan struktur senyawa kompleks yang berbeda. Tujuan dari penelitian ini adalah sintesis dan karakterisasi senyawa kompleks dari AgNO3 dan ligan detu. Struktur senyawa kompleks yang dihasilkanberguna untuk mengetahui pengaruh subtituen yang ada pada ligan detu. Sintesis senyawa kompleks dilakukan dengan mereaksikan langsung antara AgNO3 dan ligan detu padastoikiometri 1: 4 dalam pelarut metanol.Uji titik lebur dilakukan untuk mengindikasikan senyawa kompleks hasil sintesis berupa baru,murni, dan memiliki kestabilan termal. Analisis denganEDXdigunakan untuk mengetahui rumus empiris senyawa kompleks. Uji daya hantar listrik(DHL) dan kualitatif ion nitrat untuk menentukan jenis senyawa kompleks hasil sintesis merupakan senyawa ionik atau molekuler.Berdasarkan rumus empiris dan jenis senyawa kompleks, rumus kimia dari senyawatersebut dapat ditentukan sehingga diperoleh juga prediksi strukturnya.Energi bebas dari struktur prediksi dihitung dengan program Spartan’14. Struktur senyawa kompleks yang palingsesuai adalah struktur dengan energi bebas terendah. Senyawa kompleks hasil sintesis dari AgNO3 dan detu berupa kristal tidak berwarna dengan titik lebur 116-118˚C. Hasil uji titik lebur mengindikasikan bahwa senyawa kompleks hasil sintesis merupakan senyawa baru, murni, dan stabil. Analisis EDX memberikan rumus empiris C15H36AgN7O3S3.Hasil uji DHL dan kualitatif ion nitrat diketahui bahwa senyawa kompleks hasil sintesis berupa kompleks ionik dengan rumus kimia [Ag(detu)3]NO3. Berdasarkan rumus kimia tersebut, terdapat dua prediksi struktur senyawa kompleks hasil sintesis yaitu monomer [Ag(detu)3NO3] dan dimer [(detu)2Ag(µ-S-(detu)2Ag(detu)2](NO3)2.Hasil perhitungan energi bebas dapat diketahui monomer [Ag(detu)3NO3] dan dimer [(detu)2Ag(µ-S-(detu)2Ag(detu)2](NO3)2memiliki energi bebas berturut-turut sebesar -588,3507kJ/mol dan -1492,1812 kJ/mol.Energi bebas dari dimer lebih rendah dari dua kali energi bebas monomer. Berdasarkan perhitungan energi bebas, struktur dimer lebih mudah terbentuk. Oleh sebab itu, senyawa kompleks hasil sintesis adalah {[(detu)2Ag(µ-S-(detu)2Ag(detu)2](NO3)2. kation dari senyawa kompleks berupa dimer dengan geometri tetrahedral terdistorsi di sekitar atom pusatnya.

Pengaruh strategi bimbingan karir dan locus of control terhadap kompetensi karir siswa SMKN 6 Malang / Yuliana Aziza

 

ABSTRAK Aziza, Yuliana. 2015. Pengaruh Strategi Bimbingan Karir dan Locus of Control terhadap Kompetensi Karir Siswa SMKN 6 Malang, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Eddy Sutadji, M.Pd, (II) Dr. Waras Kamdi, M.Pd. Kata Kunci: strategi bimbingan karir, locus of control, kompetensi karir. Penelitianinibertujuanuntukmembentukkompetensikarirsiswa SMKN 6 Malang agar dapatmeningkatkankematangankarir.Kompetensikarir yang baikdapatdimanfaatkansiswadalammenentukanjeniskarir yang sesuaidenganminat, bakat, dankompetensikeahlian.Bimbingankarirdilaksanakan agar dapatmeningkatkankompetensikarirsiswasehinggasiswamampumenentukanjeniskarirkedepan.Strategibimbingankarirdipilih yang terbaikuntukmenunjangpelaksanaanbimbingankarirpadasiswa SMKN 6 Malang, sehinggasiswadapatmeningkatkankompetensikarir.Hal inidilakukankarenasiswa SMKN 6 belummendapatkanbimbingankarir yang dilaksanakansecarastrukturaldanperiodiksehinggasiswaawamdalambidangkarir. Rumusanmasalahpenelitianiniadalahapakahadapengaruhstrategibimbingankarir yang menggunakanpersonal development plan, portofolio, dankonvensionalsertalocus of control internal daneksternalterhadapkompetensikarirsiswajurusanteknikmesin, teknikgambarbangunan, danteknikkendaraanringankelas X SMKN 6 Malang. Rancanganpenelitian yang digunakanadalahmetodepenelitianeksperimentaldenganpendekatankuantitatif.Populasipenelitianiniadalahsiswa SMKN 6 Malang kelas X semuajurusan. Jenissampel yang digunakanadalahassignment random sampling yakni random kelompokdenganjumlahsubjekpenelitiansejumlah 94 siswa.Teknikpengumpulan data yang digunakanadalahtes.Analisis data yang digunakanadalahstatistikdeskriptifdaninferensialdengan program SPSS for windows versi 21. Hasilpenelitianmenunjukkanbahwaterdapatperbedaan yang signifikankompetensikarirsiswa yang dibimbingdenganstrategibimbingankarirpersonal development plan, portofolio, dankonvensionaldenganP-value : 0.000. Selainitu, terdapatperbedaan yang signifikankompetensikarirsiswa yang memilikilocus of control internal daneksternalyakniP-value : 0.000. Hasilpenelitian yang terakhiradalahterdapatinteraksiantarastrategibimbingankarir yang menggunakanpersonal development plan, portofolio, dankonvensionalsertalocus of control internal daneksternalterhadapkompetensikarirsiswajurusanteknikmesin, teknikgambarbangunan, danteknikkendaraanringankelas X SMKN 6 Malang yaknisebesarP-value: 0.000. Kompetensikarirsiswa yang paling baikdicapaiolehsiswa yang dibimbingdenganmenggunakanstrategibimbinganpersonal development plan danmemilikilocus of control internal.

Proses berpikir mahasiswa dalam mengonstruksi bukti kekongruenan segitiga berdasarkan teori pemrosesan informasi / Puguh Darmawan

 

ABSTRAK Darmawan, Puguh. 2015. Proses Berpikir Mahasiswa dalam Mengkonsruksi Bukti Kekongruenan Segitiga Berdasarkan Teori Pemrosesan Informasi. Tesis. Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Toto Nusantara, M.Si., (2) Dr. Hery Susanto, M.Si. Kata kunci: proses berpikir, konstruksi bukti, kekongruenan segitiga, teori pemrosesan informasi Penelitian ini bertujuan untuk mendeskripsikan proses berpikir mahasiswa dalam mengonstruksi bukti berdasarkan teori pemrosesan informasi. Materi yang dipilih adalah kekongruenan segitiga. Selanjutnya pendeskripsian proses berpikir dipaparkan berdasarkan komponen teori pemrosesan informasi yaitu (1) sensory register (2) attention (3) perception (4) short-term memory (5) long-term memory (6) retrieval (7) rehearsal dan (8) encoding. Peneliti memberikan tes kepada 29 mahasiswa yang sudah menempuh matakuliah Geometri Euclid di Universitas Kanjuruhan Malang. Kemudian peneliti menggolongkan kemampuan mahasiswa menjadi tinggi, sedang dan rendah. Penggolongan kemampuan tersebut berdasarkan skor tes dengan berpedoman pada rubrik penilaian serta pertimbangan nilai Geometri Euclid. Mahasiswa berkemampuan tinggi adalah mahasiswa dengan skor tes 11 sampai 12 dan nilai Geometri Euclid A, A-, atau B+. Mahasiswa berkemampuan sedang adalah mahasiswa dengan skor tes 9 sampai 10 dan nilai Geometri Euclid B. Mahasiswa berkemampuan rendah adalah mahasiswa dengan skor tes dibawah 9 dan nilai Geometri Euclid B-, C+ atau C. Selanjutnya untuk mendeskripsikan proses berpikir secara kualitatif dipilih dua mahasiswa berkemampuan tinggi, dua sedang dan dua rendah dengan mempertimbangkan kemampuan komunikasinya. Dari hasil penelitian diperoleh 3 jenis proses berpikir yaitu proses berpikir lengkap, hampir lengkap dan tidak lengkap. Ciri proses berpikir lengkap yang diwakili oleh mahasiswa berkemampuan tinggi yaitu: (1) mampu mengidentifikasi asumsi dalam pernyataan yang akan dibuktikan. (2) cakap dalam menggunakan strategi pembuktian. (3) memahami dengan baik semua konsep yang diperlukan dalam konstruksi bukti. (4) cakap dalam menyusun argumen. (5) mampu memunculkan semua ekspresi kunci. (6) menggunakan bahasa pembuktian yang komunikatif dan bermakna. Ciri proses berpikir hampir lengkap yang diwakili mahasiswa berkemampuan sedang yaitu: (1) memiliki kelemahan mengidentifikasi sebagian dari asumsi dalam pernyataan yang akan dibuktikan. (2) mampu memperlihatkan penggunaan strategi pembuktian yang tepat tetapi konsistensi terhadap penggunaan strategi tidak terjaga dengan baik. (3) memahami dengan baik sebagian konsep terkait yang diperlukan dalam konstruksi bukti. (4) menggunakan argumen dengan tingkat akurasi rendah. (5) konstruksi bukti diwarnai dengan upaya memunculkan ekspresi kunci, tetapi tidak dinyatakan dengan tepat. (6) bahasa pembuktian yang komunikatif dan bermakna. Ciri proses berpikir tidak lengkap yang diwakili oleh mahasiswa berkemampuan rendah yaitu: (1) tidak mampu mengidentifikasi asumsi dalam pernyataan yang akan dibuktikan. (2) tidak mampu memilih strategi pembuktian yang tepat. (3) tidak menguasai dan memahami hubungan antar konsep yang terkait dengan konstruksi bukti. (4) pengambilan kesimpulan terhadap langkah pembuktian tidak berdasarkan argumen yang tepat. (5) tidak mampu memunculkan ekspresi kunci. (6) bahasa pembuktian yang digunakan tidak mempunyai makna atau menimbulkan ambiguitas. Ciri-ciri proses berpikir lengkap menunjukan bahwa LTM mahasiswa menyimpan dengan baik konsep dan pengalaman yang diperlukan dalam proses konstruksi bukti, hal tersebut terlihat dari penjabaran konsep secara operasional dilakukan dengan benar dan juga penggunaan strategi pembuktian yang jelas. Akan tetapi hal tersebut tidak terjadi pada mahasiswa dengan proses berpikir hampir lengkap dan tidak lengkap.

Analisis visualisasi motif Batik Gayatri Tulungagung / Devi Ayu Lia Fitria

 

ABSTRAK Fitria, Devi Ayu Lia. 2015. AnalisisVisualisasi Motif Batik Gayatri Tulungagung. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra,Universitas Negeri Malang. Pembimbing: (I) Drs. A. A. G. Rai Arimbawa, M. Sn, (II) Ike Ratnawati S. Pd, M. Pd. Kata Kunci: Batik Gayatri, Analisis Visualisasi, Motif Batik merupakan salah satu ciri khasanah budaya bangsa yang tak surut termakan zaman. Sampai saat ini batik menjadi salah satu identitas budaya dan karakter bangsa Indonesia di mata internasional. Batik memiliki makna atau filosofi yang disampaikan lewat motif yang dimilikinya yang tergambar indah. Motif-motif tersebut dicipta dengan berbagai macam latar belakang yang mempengaruhinya. Begitu pula pada warna yang memiliki latar belakang dari tempat pembuatan batik tersebut, salah satunya adalah Batik GayatriTulungagung. Batik Gayatri dianggap sebagai batik khas Tulungagung, oleh karena itu perlu diungkap lebih lanjut mengenai pembahasan dengan menganalisis visualisasi motif batik Gayatri Tulungagung. Penelitian ini menggunakan penelitian deskriptif kualitatif yang diperoleh dengan mengungkapkan informasi secara menyeluruh dan sesuai dengan konteks melalui pengumpulan data. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, dan dokumentasi secara langsung. Analisis data dimulai dari tahap deskripsi, analisis formal, interpretasi, dan evaluasi. Berdasarkan hasil penelitian, ide penciptaan dari motif ini merupakan ide kreatifitas perajin yang mengambil dari beberapa tempat yang ada di Tulungagung. Ide tersebut kemudian diolah dengan menstilasi dan mendeformasikan bagian-bagian yang akan dikembangkan. Motif-motif yang terdapat pada Griya Batik Gayatri memiliki beberapa ornamen motif batik, diantaranya adalah ornamen utama, ornamen pendukung, danisen-isen motif batik sertawarna yang terdapatpada motif batik Gayatri. Hasil penelitian ini diharapkan dapat memberikan manfaat untuk bekal calon pendidik Seni Budaya dan Prakarya, sehingga pendidik dapat melibatkan kekayaan ornamen motif batik daerah setempat sebagai materi mengajar Seni Budaya di sekolah serta untuk menambah wawasan dan pengetahuan guna memperoleh data mengenai seni kerajinan batik dan diharapkan untuk lebih kreatif mengembangkan ide penciptaan desain motif batik untuk memperkaya budaya daerah dan nusantara yang akan diwariskan secara turun temurun.

Pengembangan bahan ajar materi larutan elektrolit berbasis POGIL untuk siswa SMA/MA kelas X Program IPA / Nur Hidayati Dehani Dwi Linggayani

 

ABSTRAK Linggayani, Nur Hidayati Dehani Dwi. 2015. Pengembangan Bahan Ajar Materi Larutan Elektrolit Berbasis POGIL untuk Siswa SMA/MA Kelas X Program IPA. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (1) Prof. Effendy, Ph.D. dan (2) Oktavia Sulistina, S.Pd., M.Pd. Kata-kata Kunci: pengembangan bahan ajar, Larutan Elektrolit, POGIL Salah satu topik dalam mata pelajaran kimia di SMA dan MA adalah Larutan Elektrolit. Topik ini mencakup representasi makroskopik, mikroskopik, dan simbolik serta konsep-konsep abstrak yang cenderung hanya dapat dipahami dengan baik oleh individu yang sudah mengembangkan kemampuan berpikir formal. Beberapa penelitian melaporkan bahwa siswa Sekolah Menengah Atas belum semuanya mencapai kemampuan berpikir formal sehingga mereka mengalami kesulitan dalam memahami topik tersebut. Selama ini pembelajaran topik Larutan Elektrolit cenderung disampaikan dengan pendekatan verifikasi yang tidak merangsang stimulasi intelektual siswa karena siswa tidak terlibat secara aktif dalam mengkonstruk konsep yang mereka pelajari. Pendekatan pembelajaran yang melibatkan siswa dalam mengkonstruk konsep adalah potensial untuk merangsang perkembangan kemampuan berpikir formal siswa dan diharapkan memberikan hasil belajar yang lebih tinggi. POGIL merupakan salah satu pendekatan pembelajaran yang memenuhi kriteria tersebut. Implementasi POGIL membutuhkan bahan ajar yang spesifik. Berdasarkan hasil analisis, sampai saat ini dapat dianggap belum ada bahan ajar yang memenuhi. Tujuan penelitian ini adalah mengembangkan bahan ajar materi Larutan Elektrolit berdasarkan POGIL untuk siswa SMA/MA kelas X Program IPA serta menguji kelayakan dan keefektifannya ditinjau dari hasil belajar siswa setelah menggunakan bahan ajar tersebut. Penelitian ini mengadopsi model pengembangan Plomp yang terdiri dari lima fase, yaitu investigasi awal, perancangan, realisasi/konstruksi, tes, evaluasi, dan revisi, dan implementasi. Fase implementasi tidak dilakukan karena produk pengembangan masih digunakan secara terbatas. Bahan ajar yang dikembangkan terdiri dari “Buku Kerja Siswa” dan “Buku Pedoman Guru”. Bahan ajar yang dihasilkan dinilai kelayakan isi, bahasa, dan penyajiannya menggunakan instrumen yang dikembangkan berdasarkan standar pengembangan bahan ajar yang telah ditetapkan oleh BSNP. Penilaian kelayakan bahan ajar dilakukan oleh validator ahli yang terdiri dari satu dosen kimia dan dua guru kimia SMA. Keefektifan bahan ajar didasarkan pada hasil belajar siswa kelas X IPA SMA Negeri 1 Kedungpring setelah dilibatkan dalam proses pembelajaran menggunakan bahan ajar yang dikembangkan pada uji coba lapangan terbatas. Data dalam penelitian terdiri dari data kualitatif dan data kuantitatif. Data kualitatif meliputi tanggapan dan saran dari validator ahli terhadap bahan ajar yang dikembangkan. Data kuantitatif berupa hasil penilaian bahan ajar oleh validator ahli serta hasil belajar siswa pada uji coba lapangan terbatas. Data hasil belajar siswa dikumpulkan dengan menggunakan tes pilihan ganda yang terdiri dari 20 butir soal dengan validitas isi 89,1% dan koefisien reliabilitas, dihitung dengan persamaan Kuder-Richardson 20, sebesar 0,87. Hasil pengembangan berupa “Buku Kerja Siswa” dan “Buku Panduan Guru” untuk materi Larutan Elektrolit. Buku Kerja Siswa berisi urutan aktivitas yang harus ditempuh oleh siswa berdasarkan sintaks POGIL dalam membangun konsep dengan bantuan dari guru. Buku Pedoman Guru berisi jawaban dari setiap aktivitas yang terdapat dalam Buku Kerja Siswa. Hasil penilaian validator ahli menunjukkan bahwa kelayakan isi bahan ajar Larutan Elektrolit adalah 81,0%, kelayakan bahasa adalah sebesar 84,5 dan kelayakan penyajian adalah sebesar 86,1%. Rata-rata hasil belajar siswa setelah dibelajarkan dengan buku kerja siswa adalah 83,2. Sebanyak 83,9% siswa telah mencapai nilai di atas Kriteria Ketuntasan Minimal (KKM). Berdasarkan hasil uji coba tersebut, dapat disimpulkan bahwa bahan ajar hasil pengembangan adalah layak dan efektif digunakan dalam pembelajaran topik Larutan Elektrolit.

Pengembangan media pembelajaran e-learning berbasis Edmodo Blog Education pada mata pelajaran akuntansi kelas XI / Noer Indah Puspitasari

 

ABSTRAK Puspitasari, Noer Indah. 2015. Pengembangan Media Pembelajaran E-learning Berbasis Edmodo Blog Education pada Mata Pelajaran Akuntansi Kelas XI. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Sulastri, S.Pd., M.SA, (II) Dr. Puji Handayati, S.E., M.M., Ak., CA, CMA. Kata Kunci: pengembangan media, akuntansi, e-learning, edmodo Penelitian ini bertujuan untuk mengembangkan media pembelajaran e-learning berbasis edmodo blog education pada mata pelajaran akuntansi kelas XI. Jenis penelitian ini adalah penelitian pengembangan dengan model Borg dan Gall yang telah dimodifikasi menjadi tujuh langkah pengembangan. Langkah-langkah pengembangan tersebut meliputi (1) studi lapangan, (2) pengembangan produk awal, (3) penyusunan produk, (4) validasi ahli, (5) revisi produk I, (6) uji coba terbatas, dan (7) revisi akhir dan produk akhir. Jenis data pada penelitian ini menggunakan data kuantitatif dan data kualitatif. Data kuantitatif berupa hasil validasi dianalisis menggunakan analisis deskriptif persentase. Data kualitatif berupa kritik, saran, dan komentar dari validator digunakan sebagai pertimbangan dalam melakukan revisi terhadap media yang dikembangkan. Validasi isi produk dilakukan dengan menggunakan angket yang dilengkapi skala penilaian berdasarkan skala likert. Berdasarkan data hasil validasi diperoleh penilaian dari validasi materi sebesar 88%, validasi media sebesar 97%, dan validasi uji coba terbatas sebesar 84%. Apabila hasil validasi tersebut dihitung secara keseluruhan, diperoleh rata-rata sebesar 90%. Hal ini menunjukkan bahwa media pembelajaran e-learning berbasis edmodo pada mata pelajaran akuntansi kelas XI dinyatakan valid dan layak digunakan dalam proses pembelajaran materi siklus akuntansi perusahaan jasa pada pokok bahasan laporan keuangan di SMA Laboratorium UM. Saran kepada pengembangan selanjutnya dapat membuat produk dengan materi bahasan yang lain, menambahkan gambar, video, link, lagu, maupun komik dengan kandungan materi di dalamnya.

Pengaruh Return On Equity (ROE), Debt to Equity Ratio (DER) dan Price Earnings Ratio (PER) terhadap harga saham indeks LQ-45 di Bursa Efek Indonesia Periode 2012-2014 / Nasrita Ulfa

 

ABSTRAK Ulfa, Nasrita. 2015. Pengaruh Return On Equity (ROE), Debt to Equity Ratio (DER), dan Price Earnings Ratio (PER) terhadap Harga Saham Indeks LQ-45 di Bursa Efek Indonesia Periode 2012-2014. Skripsi, Jurusan Akuntansi Program Studi S1 Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Dr. Satia N. Maharani, S.E., M.SA., Ak., (II) Diana Tien Irafahmi, S.Pd., M.Ed. Kata Kunci: Return On Equity (ROE), Debt to Equity Ratio (DER), Price Earnings Ratio (PER), Harga Saham. Perubahan harga saham di pasar modal dipengaruhi oleh kinerja keuangan perusahaan. Dan pengukuran kinerja keuangan dapat dilakukan melalui analisis rasio pada laporan keuangan. Pada rasio keuangan terkandung informasi yang dapat memberikan sinyal bagi investor untuk mendukung proses pengambilan keputusan investasi. Penelitian ini bertujuan untuk mengetahui pengaruh parsial dan simultan variabel ROE, DER, dan PER terhadap harga saham. Data yang digunakan adalah data sekunder berupa data laporan keuangan perusahaan dan data harga saham. Populasi dalam penelitian ini adalah perusahaan indeks LQ-45 tahun 2012-2014 yang terdiri dari 71 perusahaan. Teknik pengambilan sampel menggunakan teknik purposive sampling dan diperoleh 26 perusahaan. Metode analisis data yang digunakan adalah analisis regresi linier berganda. Hasil penelitian ini menunjukkan bahwa secara parsial, ROE memiliki pengaruh signifikan terhadap harga saham, sedangkan DER dan PER tidak memiliki pengaruh signifikan terhadap harga saham. Secara simultan, ROE, DER, dan PER tidak memiliki pengaruh signifikan terhadap harga saham. Saran untuk penelitian selanjutnya diharapkan untuk menambahkan variabel lain yang lebih potensial baik dari faktor internal dan eksternal, dan menggunakan sampel perusahaan sejenis.

Pengaruh solvabilitas, provitabilitas, kualitas auditor dan ukuran perusahaan terhadap ketepatan waktu penyampaian laporan keuangan pada perusahaan Real Estate and Property yang terdaftar di Bursa Efek Indonesia periode tahun 2011-2013 / Mutiara Priza Dinanti

 

ABSTRAK Dinanti, Mutiara Priza. 2015. Pengaruh Solvabilitas, Profitabilitas, Kualitas Auditor dan Ukuran Perusahaan Terhadap Ketepatan Waktu Penyampaian Laporan Keuangan Pada Perusahaan Real Estate and Property yang terdaftar di Bursa Efek Indonesia Periode Tahun 2011-2013. Skripsi. Jurusan Akuntansi Program Studi Akuntansi Fakultas ekonomi Universitas Negeri Malang. Pembimbing (I) Dr. H. Cipto Wardoyo, S.E., Mpd, M.si. Ak, CA (II) Dr. Suparti, M.P Kata Kunci: Solvabilitas, Profitabilitas, Kualitas Auditor, Ukuran Perusahaan, Ketepatan Waktu Penyampaian Laporan Keuangan. Dalam suatu perusahaan ketepatan waktu dalam penyampaian laporan keuangan kepada publik merupakan hal yang penting karena dengan begitu publik dapat melihat kondisi atau kinerja manajemen perusahaan secara tepat. Ketepatan waktu dalam meyampaikan informasi laporan keuangan untuk pihak investor dan juga dapat mengurangi konflik keagenan yang terjadi pada perusahaan. Tepat atau tidaknya waktu dipengaruhi oleh kinerja manajemen dalam menghasilkan informasi keuangan perusahaan yang tertulis dalam informasi laporan keuangan tahunan. Penelitian ini bertujuan untuk mengetahui seberapa besar pengaruh informasi laporan keuangan tahunan seperti debt to equity ratio, profitabilitas, kualitas auditor dan ukuran perusahaan terhadap ketepatan waktu penyampaian laporan keuangan. Jenis penelitian ini adalah eksplanasi (explanatory research) dengan jumlah populasi 51 perusahaan. Sampel penelitian sebanyak 36 perusahaan., dengan teknik purposive sampling. Teknik pengumpulan data adalah dokumentasi. Penelitian ini menggunakan analisis regresi logistik. Hasil penelitian ini menunjukkan bahwa : (1) Solvabilitas dan ukuran perusahaan berpengaruh positif tidak signifikan terhadap ketepatan waktu penyampaian laporan keuangan (2) Profitabilitas berpengaruh positif signifikan terhadap ketepatan waktu pnyampaian laporan keuangan (3) Kualitas auditor berpengaruh negatif tidak signifikan terhadap ketepatan waktu penyampaian laporan keuangan. Saran yang dapat diberikan berdasarkan hasil penelitian ini adalah: (1) bagi perusahaan real estate and property hendaknya lebih cepat dalam melaporkan laporan keuangan perusahaan, sehingga para pemakai laporan keuangan dapat lebih cepat dalam memperoleh informasi yang dibutuhkan untuk menentukan keputusan investasi yang dibuatnya (2) Bagi investor hendaknya mampu menilai dan memahami laporan keuangan yang dilaporkan perusahaan, sehingga investor tidak akan salah dalam pengambilan keputusan investasi.

Kepemimpinan pemerintahan desa dalam upaya meningkatkan keberdayaan masyarakat desa (studi kasus di Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk) / Alfia Noer Shafa'at

 

Kata Kunci: kepemimpinan, pemerintahan desa, keberdayaaan. Kepemimpinan merupakan unsur yang sangat menentukan dalam keberlangsungan dan perkembangan suatu organisasi atau pemerintahan. Dalam era yang penuh dinamika serta perubahan yang cepat seperti sekarang ini, kepemimpinan yang peka terhadap perubahan sangat diperlukan dalam memberdayakan semua potensi yang dimiliki masyarakat. Dalam mewujudkan pembangunan desa tidak hanya dibutuhkan peranan kepemimpinan pemerintahan desa saja, namun harus ada hubungan yang sinergis antara kepemimpinan pemerintahan desa dengan partisipasi masyarakat desa. Pemerintahan desa harus mampu meningkatkan keberdayaan masyarakat desa agar tercipta masyarakat yang sejahtera. Tujuan dari penelitian ini adalah: (1) mendeskripsikan kepemimpinan pemerintahan Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk, (2) mendeskripsikan bidang kegiatan pemberdayaan masyarakat di Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk, (3) mendeskripsikan upaya pemerintahan desa dalam meningkatkan keberdayaan masyarakat di Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk, (4) mendeskripsikan kendala (permasalahan) yang dihadapi pemerintahan desa dalam meningkatkan keberdayaan masyarakat di Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk dan cara mengatasi kendala (permasalahan) tersebut. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Lokasi penelitian di Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk. Sumber data dalam penelitian ini adalah manusia, peristiwa, dan dokumen profil desa. Metode pengumpulan data menggunakan observasi, wawancara dan dokumentasi. Prosedur analisis data terdiri dari reduksi data (data reduction), penyajian data (data display), dan penarikan kesimpulan/verifikasi. Temuan penelitian ini menunjukkan bahwa (1) kepemimpinan pemerintahan Desa Kaloran Kecamatan Ngronggot Kabupaten Nganjuk selalu berupaya mengarahkan, membimbing, menumbuhkan dan mengembangkan potensi yang dimiliki oleh masyarakat desa, (2) bidang kegiatan pemberdayaan masyarakat di Desa Kaloran Kecamatan Ngroggot Kabupaten Nganjuk mencakup pemberdayaan diberbagai bidang, antara lain bidang ekonomi, pendidikan, sosial dan budaya. Di bidang ekonomi yaitu pemberdayaan pada sektor home industry batu bata merah dan gentheng serta masyarakat pembuat tempe/tahu. Di bidang pendidikan yaitu pendirian PAUD oleh pemerintahan desa sendiri. Di bidang sosial yaitu adanya PKK, Karang Taruna, dan arisan-arisan. Di bidang budaya i yaitu adanya Nyadranan (bersih desa), (3) upaya pemerintahan Desa Kaloran dalam meningkatkan keberdayaan masyarakat di bidang pendidikan yaitu pendirian PAUD, pemerintah desa membantu memberikan sarana penunjang seperti mainan anak-anak dan buku-buku. Di bidang sosial yaitu pengadaan PKK, Karang Taruna dan arisan-arisan yang diadakan secara rutin. PKK dan Karang Taruna diadakan perkumpulan setiap sebulan sekali untuk membahas program, sedangkan arisan setiap RT mengadakan jadwal sendiri. Di bidang budaya yaitu mengikutsertakan seluruh masyarakat dalam acara Nyadranan (bersih desa) mulai dari bersih-bersih desa, penataan kerapian desa, acara hiburan dan do’a bersama. Di bidang ekonomi upaya dari pemerintahan desa yaitu meningkatkan sektor home industry batu bata merah dan gentheng, yaitu melalui pengadaan promosi penjualan hasil produksi ke luar kota, berupaya mendatangkan orang dari Pemda untuk melakukan penyuluhan/pembinaan di desa, pembinaan dari pemerintahan desa sendiri, pengadaan koperasi simpan pinjam “Argo Mulyo”, dan pemberian bantuan alat (cetakan gentheng dan masin penggiling tempe/tahu), (4) kendala (permasalahan) yang dihadapi pemerintahan Desa Kaloran yaitu dalam meningkatkan keberdayaan masyarakat di bidang ekonomi yaitu sektor home industry batu bata merah dan gentheng, yaitu kurangnya penyuluhan/pembinaan dari Pemda Kabupaten Nganjuk ke desa, cuaca buruk, persediaan tanah untuk bahan membuat batu bata merah dan gentheng di Desa Kaloran sendiri semakin menipis. Cara untuk mengatasi kendala (permasalahan) tersebut yaitu pemerintahan Desa Kaloran sendiri mengadakan pembinaan kepada masyarakat terkait dengan pemasaran batu bata merah dan gentheng, pemerintahan Desa Kaloran turut berusaha mencarikan informasi keberadaan tanah untuk bahan membuat batu bata merah dan gentheng dari luar desa seperti Trayang, Keludan, Dadapan, Banjarsari dan sekitar sungai Brantas. Berdasarkan temuan penelitian di atas, saran yang diajukan yaitu: (1) untuk mewujudkan masyarakat yang sejahtera, seyogyanya kepemimpinan pemerintahan desa berusaha melayani masyarakat dengan baik, memberikan arahan dan bimbingan serta mampu menumbuhkan potensi masyarakat desa, (2) untuk menumbuhkan potensi masyarakat desa, seyogyanya pemerintah desa berada di tengah-tengah masyarakat desa, sehingga mengetahui kondisi masyarakat desa, (3) untuk menciptakan pemberdayaan masyarakat yang baik, seyogyanya dijalin hubungan yang sinergis antara masyarakat desa dengan pemerintah desa.

Pengaruh brand trust terhadap brand loyalty telepon seluler Nokia (Studi pada pengguna telepon seluler nokia di Kelurahan Sumbersari Malang) / Juwita Nawang Sari

 

Kata kunci: Brand Trust, Brand Loyalty Mempertahankan pelanggan bukan hal yang mudah bagi perusahaan, karena pesaing memberikan rangsangan-rangsangan kepada konsumen agar beralih ke produk pesaing. Selain itu selera konsumen mudah berubah, jika perusahaan tidak mampu untuk memenuhinya dengan mudah konsumen akan berpindah ke produk lain. Kunci utamanya adalah dengan membangun kepercayaan pada merek. Kepercayaan yang tinggi dari konsumen terhadap telepon seluler Nokia akan menciptakan loyalitas pelanggan pada telepon seluler Nokia. Tujuan dari penelitian ini adalah untuk mengetahui deskripsi keadaan brand trust dan brand loyalty pengguna telepon seluler Nokia di Kelurahan Sumbersari Malang dan mengetahui pengaruh variabel brand trust (brand reliability dan brand intentions) secara parsial maupun simultan terhadap brand loyalty. Penelitian ini mempunyai dua variabel, yaitu variabel bebas (X) dan variabel terikat (Y). Variabel bebas (X) terdiri dari sub variabel, yaitu brand reliability (X1) dan brand intentions (X2), sedangkan variabel terikatnya (Y) yaitu brand loyalty. Populasi dalam penelitian ini adalah warga kelurahan Sumbersari Malang yang menggunakan telepon seluler Nokia dengan jumlah sampel adalah 100 responden. Sampel diambil dengan menggunakan teknik Accidental Random Sampling dan menggunakan instrument berupa kuesioner. Sedangkan teknik analisis data dalam penelitian ini adalah teknik analisis regresi linear berganda. Hasil penelitian ini menyimpulkan bahwa: (1) ada pengaruh positif dan signifikan brand reliability secara parsial terhadap brand loyalty telepon seluler Nokia dengan nilai B= 0,445 ; thitung = 3,747 dengan signifikansinya 0,000; (2) ada pengaruh positif dan signifikan brand intentions secara parsial terhadap brand loyalty telepon seluler Nokia dengan nilai B= 0,272 ; thitung 2,325 dengan signifikansinya 0,022; (3) Ada pengaruh positif dan signifikan antara brand trust (brand reliability dan brand intentions) secara simultan terhadap brand loyalty telepon seluler Nokia, dengan nilai Fhitung 24,565; signifikansi F= 0,000; R=0,580; R Square =0,336; Adjusted R Square=0,323. Dengan demikian dapat disimpulkan bahwa Brand Trust (kepercayaan merek) dapat mempengaruhi Brand Loyalty baik secara parsial maupun simultan. Brand reliability dan brand intentions mempengaruhi rand loyalty telepon seluler Nokia pada pengguna telepon seluler Nokia di Kelurahan Sumbersari Malang sebesar 32,3%, sedangkan sisanya 67,7% dipengaruhi faktor-faktor lain diluar penelitian.

Pengembangan media papan berbunyi untuk melatih kemampuan menulis permulaan siswa down syndrome di SDLB Sengon Agung Kabupaten Pasuruan / Qiftya Syofiana Putri

 

ABSTRAK Syofiana.P,Qiftya. 2015. Pengembangan Media Papan Berbunyi Untuk Melatih Kemampuan Menulis Permulaan Siswa Down Syndrome Di SDLBN Sengonagung Kabupaten Pasuruan. Skripsi, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (I) Drs. Abdul Huda, M.pd, (II) Dra. Sudarsini, M.pd. Kata kunci: Media Papan Berbunyi, Menulis Permulaan, Down Syndrome. Gangguan perkembangan yang dialami anak down syndrome menyebabkan anak sulit dalam melakukan suatu kegiatan meskipun itu kegiatan yang sederhana, salah satu gangguan yang dialami yaitu gangguan pada gerak motorik halus. Di SDLB Sengonagung anak down syndrome mengalami kesulitan dalam pembelajaran menulis permulaannya, sehingga tidak jarang mereka sulit menerima pelajaran dengan baik. Tujuan pengembangan ini adalah mengasilkan sebuah media pembelajaran yang dapat membantu anak down syndrome dalam pembelajaran menulis permulaan, media ini adalah media papan berbunyi yang dimodifikasi dari media papan tulis magnet. Metode pengembangan yang digunakan adalah Model Sadiman, dkk (2010). Jenis data pada pengembangan ini berupa data kuantitaf dan data kualitatif. Teknik pengumpulan data pengembangan ini menggunakan beberapa instrumen yang ditujukan kepada ahli materi, ahli media dan guru pengamat saat proses pelaksanaan berupa angket Hasil penelitian pengembangan ini diperoleh dari nilai validasi yang dilakukan dengan beberapa validator, antara lain ahli materi diperoleh hasil 87.5%, sedangkan ahli media diperoleh hasil 100%, dan hasil yang diperoleh dari guru pengamat yaitu 80%, dari hasil tersebut dapat diinterprestasikan pengembangan media papan berbunyi dengan kriteria valid dan layak digunakan sebagai salah satu media pembelajaran. Kesimpulan pada penelitian pengembangan ini yaitu produk yang dihasilkan memperoleh hasil yang valid yaitu dengan kata lain produk yang dikembangkan dapat digunakan untuk membantu siswa down syndrome di SDLBN Sengonagung Kabupaten Pasuruan. Saran penelitian lebih lanjut dalam pengembangan media pembelajaran diharapkan lebih menginovasi suatu subyek dengan bervariasi dan lebih berkembang

Pengaruh gaya kepemimpinan ketua dan interaksi kelompok terhadap tingkat partisipasi anggota kelompok dasawisma dalam upaya memelihara kebersihan lingkungan di Kotamadya Malang
oleh S. Mundzir

 

Upaya Dinas Pendapatan Kota Kediri dalam meningkatkan pendapatan pajak hotel berdasarkan Perda No. 17 Tahun 2002 di Kota Kediri / Ahdiat Prihantono

 

Kata Kunci : Potensi Pajak Hotel, Pendapatan Asli Daerah. Dinas Pendapatan Daerah Kota Kediri merupakan salah satu instansi yang bertanggujawab dalam mengelola Pendapatan Asli Daerah Kota Kediri. Pendapatan asli daerah di kota Kediri diperoleh dari berbagai sumber salah satunya pajak hotel. Pajak hotel merupakan sumber pendapatan asli daerah yang memiliki prospek baik di kota Kediri, hal ini dikarenakan cukup banyaknya jumlah hotel yang terdapat di kota tersebut. Namun masih terdapat faktor yang menghambat terwujudnya hal tersebut dan mengakibatkan pendapatan dari sektor pajak hotel tidak sesuai dengan target yang diharapkan. Penelitian ini bertujuan untuk mengetahui potensi pajak hotel, kendala apa yang dihadapi serta upaya yang harus dilakukan dinas pendapatan kota Kediri dalam meningkatkan pendapatan daerah di sektor pajak hotel. Metode pemecahan masalah dalam penulisan Tugas Akhir ini adalah metode kualitatif, yaitu analisa dalam bentuk kalimat untuk memperoleh kesimpulan dan kuantitatif untuk menghitung presentase. Data penelitian yang dihasilkan adalah uraian kata-kata yang berbentuk uraian kalimat baik menggunakan teori-teori maupun pemikiran yang logis. Hasil penilitian menunjukkan perbandingan antara realisasi dengan potensi pajak hotel. Pada tahun 2007 realisasi pajak yang dapat dicapai sebesar 86,8% sehingga masih terdapat potensi yang belum tergali sebesar 13,2% dan pada tahun 2008 terjadi peningkatan pendapatan dari tahun lalu, realisasi yang dicapai sebesar 89,6% namun masih belum bisa memenuhi potensi yang ditetapkan. Prosentase potensi yang belum tergali sebesar 10,4%. Penyebab pajak hotel di Kota Kediri belum bisa direalisasi secara optimal antara lain karena penetapan target yang terlalu tinggi, kurangnya kesadaran wajib pajak terhadap peraturan, pemungutan pajak yang belum efektif. Saran yang diajukan dalam penelitian ini adalah peningkatan kedisiplinan kepada para pegawai, sosialisasi terhadap wajib pajak tentang pentingnya membayar pajak serta pemberian penghargaan khusus /reward bagi wajib pajak yang teratur membayar pajak sehingga timbul semangat dari wajib pajak dan tidak ada keinginan untuk menghindar dari kewajiban perpajakan, perhitungan potensi secara berkala mengenai perkembangan situasi dan kondisi yang dianggap berpengaruh terhadap peningkatan pendapatan pajak, mengembangkan sektor pariwisata, perlu adanya tim audit agar hasil penerimaan pajak mulai proses pendataan sampai dengan pelaporan dapat terkontrol dengan baik sehingga tingkat kebocoran dapat ditekan.

Pengaruh faktor fundamental terhadap harga saham (studi pada perusahaan hotel, restoran dan pariwisata yang terdaftar di Bursa Efek Indonesia Periode 2009-2013 / Echa Nury Rahayu

 

ABSTRAK Rahayu, Echa, Nury. Pengaruh Faktor Fundamental Terhadap Harga Saham (Studi Pada Perusahaan Hotel, Restoran dan Pariwisata yang Terdaftar di Bursa Efek Indonesia Periode 2009-2013). Skripsi, Jurusan Akuntansi, Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Sawitri Dwi Prastiti, S.E., M.Si., Ak. (II) Ika Putri Larasati, S.E., M.Com Kata Kunci: Rasio Keuangan, Analisis Fundamental, Harga Saham Faktor yang mempengaruhi harga saham terdiri dari faktor internal dan eksternal. Fakrtor fundamental termasuk dalam faktor internal yang mempengaruhi harga saham sebab analisis fundamental merupakan analisis berdasarkan data laporan keuangan sebuah perusahaan. Sehingga tujuan penelitian ini adalah mengetahui pengaruh faktor fundamental berupa rasio keuangan yang terdiri dari Debt Equity Ratio, Return On Asset, Return On Equity dan Net Profit Margin terhadap harga saham sektor Hotel Restoran dan Pariwisata periode 2009-2013. Penelitian ini merupakan jenis penelitian eksplanasi yang bertujuan menjelaskan dan menguji teori yang ada khususnya signaling theory. Populasi dalam penelitian ini adalah seluruh Perusahaan Hotel, Restouran dan Pariwisata yang listing di Bursa Efek Indonesia dalam periode 2009 sampai 2013. Pemilihan sampel menggunakan teknik purposive sampling dan diperoleh 11 perusahaan sampel. Alat analisis menggunakan bantuan software SPSS 16, metode penelitian meliputi uji asumsi klasik yaitu uji normalitas data, uji autokorelasi data, dan uji multikolonearitas, uji hipotesis menggunakan uji nilai t untuk pengaruh secara parsial dan untuk menguji hipotesis. Berdasarkan hasil penelitian ini menunjukan Debt Equity Ratio, Return On Asset, Return On Equity dan Net Profit Margin berpengaruh terhadap harga saham baik secara simultan maupun parsial. Pengaruh faktor fundamental tersebut menunjukan bahwa investor pada sektor perusahaan Hotel, Restoran dan Pariwisata memperhatikan perubahan rasio keuangan berupa DER, ROA, ROE dan NPM sebagai sinyal yang diberikan perusahaan terkain prospek perusahaan di masa mendatang. Keterbatasan dalam penelitian ini meliputi, (1) Variabel Debt Equity Ratio (DER) yang digunakan dalam penelitian ini hanya mencerminkan prospek perusahaan, dan (2) Belum dilakukan pemilahan asset dalam pengukuran Variabel Return On Asset (ROA). Berdasarkan keterbatasan tersebut saran untuk peneliti selanjutnya yaitu: (1) dapat menggunakan nilai Tobin’s Q sebagai pendekatan nilai perusahaan. (2) Peneliti selanjutnya dapat mengukur nilai faktor fundamental ROA melalui pemilahan kelompok aset.

Pengembangan media video tutorial interaktif berbasis WEB pada mata pelajaran teknologi informasi dan komunikasi di SMA Laboratorium UM Malang / Aditya Rendy Thaharah

 

Kata kunci: Pengembangan, Video Tutorial, Interaktif, Web, TIK Teknologi Informasi dan Komunikasi merupakan payung besar terminologi yang mencakup seluruh peralatan teknis untuk memproses dan menyampaikan informasi. Teknologi Informasi dan Komunikasi memiliki dua aspek yakni Teknologi Informasi dan Teknologi Komunikasi. Dalam Teknologi Informasi mencakup segala hal yang berkaitan dengan proses, hasil, manipulasi, penggunaan alat bantu dan penyampaian informasi. Pada Teknologi Komunikasi merupakan segala hal yang berhubungan dengan penggunaan alat bantu untuk memproses dan mentransfer data dari perangkat satu ke perangkat lainnya. Pendidikan merupakan salah satu aspek yang tidak akan pernah terlepas dari teknologi. Karena teknologi berkembang terus-menerus di dalam pendidikan. Teknologi memiliki peranan yang sangat penting dalam pendidikan. Berdasarkan observasi di SMA Laboratorium UM Malang, metode dan materi telah berkembang pesat dengan acuan Departemen Pendidikan Nasional. Salah satu mata pelajaran yang sedang berkembang adalah Mata Pelajaran Teknologi Informasi dan Komunikasi. Mata pelajaran tersebut mempunyai materi-materi yang lengkap dengan metode mengajarnya. Namun, pada SMA Laboratorium UM tersebut, mata pelajaran TIK masih diajarkan dengan metode tradisional yaitu dengan menggunakan buku ajar. Dengan ini, pengembang mengembangkan sebuah media yang berfungsi untuk media pembelajaran Teknologi Informasi dan Komunikasi di SMA Laboratorium UM Malang tersebut. Pengembangan ini dilaksanakan dengan tujuan menghasilkan media pembelajaran berupa video tutorial interaktif berbasis web yang telah melalui validasi pada mata pelajaran Teknologi Informasi dan Komunikasi di SMA Laboratorium UM Malang kelas XI/I. Video Tutorial Interaktif berbasis Web ini mempunyai kelebihan dan kelemahan, yaitu (1) dapat di gunakan secara individu sehingga siswa lebih leluasa dalam memanfaatkan pengerjaannya, (2) tidak membutuhkan waktu yang lama dalam mengerjakan media ini, (3) web yang menjadi jembatan video tutorial interaktif bersifat dinamis dapat diubah dan dikelola sesuai kebutuhan dan dapat digunakan secara berulang, (4) dilengkapi materi-materi dan informasi tentang pelajaran materi desain grafis, (5) mampu menampilkan video tutorial secara step by step (langkah per langkah) dengan cara siswa dapat menekan tombol next dan back di dalam video untuk menjalankan ke sesi berikutnya atau sebelumnya. Sedangkan kelemahan dari media ini adalah (1) dibutuhkan pembuatan ulang saat materi pada buku ajar TIK acuan SMA Laboraturium UM Malang kelas XI/I berubah, (2) hanya dapat digunakan secara individual, tidak dalam bentuk kelompok, (3) kualitas grafis video sedikit lemah. Pengumpulan data dilakukan dengan menggunakan angket validasi, pre test dan post test, pengembangan video tutorial interaktif berbasis web kepada ahli media dan ahli materi, kemudian data tersebut diolah untuk mengetahui tingkat kevalidan video tutorial interaktif berbasis web. Hasil pengembangan video tutorial interaktif untuk mata pelajaran TIK di SMA Laboratorium UM Malang ini memenuhi kriteria valid dengan hasil uji ahli media mencapai tingkat kevalidan 90,3%, ahli materi mencapai tingkat kevalidan 73%, uji responden sebagai calon user (siswa) perseorangan mencapai tingkat kevalidan 85,8%, uji responden sebagai calon user (siswa) kelompok kecil mencapai tingkat kevalidan 70,1% dan uji responden sebagai calon user (siswa) uji lapangan mencapai tingkat kevalidan 72%. Disamping itu, nilai peningkatan hasil belajar siswa pada uji coba perseorangan mencapai 60%, uji coba kelompok kecil mencapai 55% dan uji coba lapangan mencapai 51%. Berdasarkan hasil pengembangan telah dilakukan, dapat disimpulkan bahwa video tutorial interaktif berbasis web untuk mata pelajaran TIK di SMA Laboratorium UM Malang, valid/layak digunakan sebagai media pembelajaran.

Pengembangan Blog Pena - Ilmiah sebagai media pelatihan menullis artikel ilmiah bagi guru / Zulmy Faqihuddin Putera

 

ABSTRAK Putera, Zulmy Faqihuddin. Pengembangan Blog Pena-Ilmiah Sebagai Media Pelatihan Menulis Artikel Ilmiah Bagi Guru. Tesis, Program Studi Pendidikan Bahasa Indonesia, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Roekhan, M.Pd.,(II) Dr. Sunoto, M.Pd. Kata Kunci : Pengembangan Blog, Media Pelatihan, Artikel Ilmiah Menulis artikel ilmiah merupakan salah satu bentuk kegiatan menulis dengan didasarkan pada kemampuan yang berpikir logis serta dapat dipertanggungjawabkan. Menulis artikel ilmiah merupakan salah satu jenis dari sebuah karya ilmiah selain makalah serta laporan penelitian. Penulisan artikel ilmiah sangat penting dalam meningkatkan kompetensi serta profesionalitas guru. Publikasi artikel ilmiah masih kurang dilakukan atau diminati oleh guru disebabkan belum tersedianya media pelatihan yang mendukung proses kegiatan penulisan artikel ilmiah. Maka dari itu, media dibutuhkan untuk mengatasi dan mendukung publikasi ilmiah dalam hal ini artikel ilmiah oleh guru Tujuan pengembangan media ini adalah menghasilkan wujud blog sebagai media pelatihan penulisan artikel ilmiah pada dan menghasilkan kelayakan blog sebagai media pelatihan penulisan artikel ilmiah pada guru. Model pengembangan yang digunakan dalam penelitian ini adalah model Borg and Gall (1983) yang telah dimodifikasi. Adapun langkah-langkah penelitian media yang digunakan adalah sebagai berikut (1) penelitian / mengidentifikasi kebutuhan, (2) perencanaan, (3) pengembangan produk awal, (4) validasi ahli, (5) revisi produk awal, (6) ujicoba pemakaian I, (7) revisi produk I, (8) ujicoba pemakaian II, dan (9) revisi produk II/akhir. Media ini terintegrasi dengan jaringan internet dan penggunaanya terlebih dulu harus login ke alamat blog. Tampilan blog berisi sembilan menu utama , yaitu: (1) Beranda, (2) Tentang Artikel Ilmiah, (3) Jenis Artikel Ilmiah, (4) Bahasa Ilmiah, (5) Penulisan, (6) Penyuntingan, (7) Publikasi, (8) Papan Karya, dan (9) Bacaan Pengayaan. Posting yang ditampilkan oleh ke tujuh menu utama yang disertai submenu-submenu berkaitan dengan materi disertai juga bagan dan gambar yang mendukung. Hasil uji media blog pada aspek materi yakni kesesuaian materi, kelengkapan materi, dan kejelasan contoh dan evaluasi dengan ahli materi dan uji lapangan menunjukkan kelayakan rata-rata sebesar 81,9% dan uji lapangan sebesar 84,7%. Hasil tersebut tersebut menunjukkan bahwa bahan ajar tersebut dinyatakan valid dan siap diimplementasikan. Hasil uji media blog pada aspek tampilan yakni kemenarikan tampilan media, keinteraktifan, dan ketepatan penggunaan bahan pendukung, dan kejelasan alur mesia dengan ahli materi dan uji lapangan menunjukkan kelayakan rata-rata sebesar 83,3% dan uji lapangan sebesar 81,2%. Hasil tersebut tersebut menunjukkan bahwa bahan ajar tersebut dinyatakan valid dan siap diimplementasikan. namun perlu direvisi pada aspek materi yakni kedalaman materi dan kejelasan contoh serta pada aspek tampilan yakni pemilihan font dan penyajian navigasi berdasarkan saran oleh ahli dan uji lapangan pemakai. Dari penjabaran hasil uji coba tersebut, dapat disimpulkan bahwa produk media tergolong sangat valid dan dapat diimplementasikan. Produk yang telah dikembangkan diharapkan bukan sebagai pengganti buku maupun pengganti, namun bertujuan sebagai media alternatif dalam mencari informasi secara fleksibel tanpa terikat wakt, jadi guru diharapkan tetap buku referensi yang lain untuk menunjang literatur yang berkaitan dengan penulisan artikel ilmiah. Pengembangan lebih lanjut disarankan untuk mengembangkan produk media blog penulisan artikel ilmiah bagi guru yang lebih kompleks sesuai dengan tuntutan misalnya, website utuh dan untuk pembelajaran yang lebih luas, tidak hanya pembelajaran menulis artikel ilmiah.

Peningkatan hasil menggambar ragam hias pada bahan kayu melalui model learning cycle di kelas VII A SMP Negeri I Karangploso Kabupaten Malang / Sutisnowati

 

ABSTRAK Sutisnowati. 2015. Peningkatan Hasil Menggambar Ragam Hias pada Bahan Kayu Melalui Model Learning Cycle di Kelas VIIA SMP Negeri I Karangploso. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang, Pembimbing: Dra. Tjitjik Sriwardhani, M.Pd. Kata Kunci: menggambar ragam hias, bahan kayu, model Learning Cycle, SMP Berdasarkan data awal yang diperoleh hasil belajar siswa masih di bawah KKM, dengan rata-rata KKM 75. Hal ini disebabkan karena siswa dalam berkarya kurang memahami bentuk motif ragam hias dan belum mengusai tehnik pemberian warna pada bahan kayu secara baik. Oleh sebab itu, pembelajaran menggambar ragam hias pada bahan kayu melalui model Learning Cycle dapat dijadikan solusi untuk meningkatkan hasil belajar siswa. Penelitian ini bertujuan untuk mendeskripsikan penerapan menggambar ragam hias pada kayu melalui model Learning Cycle yang dapat meningkatkan hasil menggambar ragam hias pada bahan kayu siswa di kelas VIIA SMP Negeri I Karangploso. Pelaksanaan penelitian tindakan kelas (PTK) dengan rancangan pada model siklus yang meliputi empat tahap yaitu: (1) perencanaan, (2) pelaksanaan tindakan, (3) pengamatan, dan (4) refleksi. Tehnik pengumpulan data menggunakan lembar observasi, wawancara, tes, dan dokumentasi. Data hasil belajar diperoleh dari nilai aktivitas siswa dan tes praktek adalah untuk mengukur hasil belajar digunakan teknik tes unjuk kerja dan hasil karya yang akan dianalisis secara diskriptif, kualitatif yang bersifat kuantitatif, melalui tahapan analisis masalah pada pembelajaran menggambar ragam hias pada bahan kayu siswa kelas VIIA SMP Negeri I Karangploso dari 32 siswa dan refleksi siklus-siklusnya. Berdasarkan analisis data diperoleh kesimpulan bahwa aktivitas dan hasil karya siswa mengalami peningkatan melalui penerapan model Learning Cycle. Peningkatan prosentase rata-rata aktivitas siswa dalam KBM dengan kategori sangat baik dari 1,3% (siklus I) menjadi 42,8% (siklus II), dan kategori baik dari 52,2% (siklus I) menjadi 57,2% (siklus II). Sedangkan kategori cukup 44,2% pada siklus I turun menjadi 3,1% pada siklus II dan kategori kurang 2,2% pada siklus I turun menjadi 0% pada siklus II. Nilai rata-rata hasil karya siswa pada siklus I adalah 69,0 meningkat menjadi 82,0 pada siklus II dengan prosentase kenaikan sebesar 15,65%. Nilai hasil karya dengan kategori cukup 3,1% dan kurang pada siklus I tidak ditemukan lagi pada siklus II. Tingkat ketuntasan siswa berdasarkan KKM sebesar 96,9%. Berdasarkan hasil penelitian ini, disarankan guru dapat menggunakan model Learning Cycle pada materi lain untuk sebagai alternatif pertimbangan dalam penggunaan variasi model pembelajaran. Dan siswa diharapkan dapat memperkaya pengetahuan dan pengalamannya dalam berkarya seni serta meningkatkan minat dan motivasinya dalam mengikuti pembelajaran Seni Budaya khususnya Seni Rupa.

Pengaruh hasil pelatihan dan motivasi kerja terhadap kinerja karyawan di Bagian Produksi Sigaret Kretek Mesin (studi pada PT Karya Dibya Mahardika, Pasuruan) / Raiza Nora Dahana

 

ABSTRAK Dahana, Raiza, Nora. 2014. Pengaruh Hasil Pelatihan Dan Motivasi Kerja Terhadap Kinerja Karyawan Di Bagian Produksi Sigaret Kretek Mesin (Studi Pada PT Karya Dibya Mahardika, Pasuruan) Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Sutrisno, M.M. (II) Elfia Nora, S.E., M.Si Kata Kunci : Kinerja Karyawan, Hasil Pelatihan, Motivasi Kerja Kinerja karyawan merupakan suatu hal yang sangat penting dalam upaya untuk mencapai tujuan. Kinerja merupakan suatu kondisi yang harus diketahui dan dikonfirmasikan kepada pihak tertentu untuk mengetahui tingkat pencapaian hasil suatu instansi dihubungkan dengan visi yang diemban suatu organisasi atau perusahaan serta mengetahui dampak positif dan negatif dari suatu kebijakan operasional. Tujuan dari penelitian ini adalah untuk mendeskripsikan pengaruh Hasil Pelatihan dan Motivasi Kerja Karyawan terhadap Kinerja Karyawan Di Bagian Produksi Sigaret Kretek Mesin Pada PT. Karya Dibya Mahardika, Pasuruan. Jenis penelitian ini adalah Explanatory Research dan Deskriptif dengan dua variabel bebas hasil pelatihan dan motivasi kerja serta dengan variabel terikat kinerja karyawan. Teknik pengambilan sampel mengunakan random sampling. Sampel dalam penelitian ini berjumlah 44 karyawan pada bagian Produksi Sigaret Kretek Mesin. Penelitian ini menggunakan pendekatan kuantitatif , data dalam penelitian ini diperoleh melalui penyebaran angket penelitian yang diisi oleh responden yang sudah ditentukan. Metode analisis data yang digunakan adalah metode regresi linear berganda. Hasil penelitian dapat diketahui bahwa terdapat pengaruh positif dan signifikan antara hasil pelatihan terhadap kinerja karyawan. Dan terdapat pengaruh positif dan signifikan antara motivasi kerja terhadap kinerja karyawan. Saran yang diberikan sebagai berikut: 1) Bagi penelitian selanjutnya sebaiknya menambah variabel bebas pada penelitian selanjutnya, sehingga penelitian menjadi berbeda dan lebih menarik untuk diteliti. 2) Perusahaan sebaiknya lebih memperhatikan program pelatihan dengan melaksanakan program pelatihan diluar tempat karyawan bekerja, supaya tidak terpecah fokus pada pekerjaannya.

Manajemen Sekolah Dasar Negeri (SDN) pasca penggabungan sekolah (studi multi situs pada dua SDN di Kabupaten Sidodadi) / Suyitno

 

Kata kunci: manajemen, penggabungan sekolah, sekolah dasar Penggabungan sekolah adalah merupakan salah satu upaya agar hakekat manajemen sekolah dapat diwujudkan yaitu efektifitas dan efisiensinya. Dua lembaga sekolah di satu lokasi/halaman sekolah dapat menimbulkan kerawanan konflik baik secara budaya, organisasi, maupun secara fisik. Secara budaya dapat berakibat benturan-benturan kebiasaan, sikap-perilaku yang dimiliki oleh warga di masing-masing lembaga sekolah; secara organisasi dapat memunculkan gesekan-gesekan antar sub sistem organisasi diantara masing-masing lembaga sekolah; secara fisik terjadi kalau konflik budaya dan konflik organisasi tersebut tidak terelakkan. Selain permasalahan yang melanda sekolah-sekolah yang berada dalam satu halaman, bupati Sidodadi mengeluarkan keputusan tentang penggabungan sekolah dasar negeri sejak tahun 2005. Di dalam pelaksanaannya banyak kesulitan yang dihadapi oleh para kepala sekolah pemangkunya, hal tersebut bisa terjadi karena penggabungan sekolah dilaksanakan tidak disertai dengan pedoman pelaksanaan pasca penggabungan sekolah secara rinci. Pada tahun 2006 di Kabupaten Sidodadi terdapat tujuh puluh dua lembaga sekolah dasar negeri digabungkan menjadi tiga puluh enam lembaga sekolah. Sebagian besar juga menjumpai kesulitan yang relatif sama, sehingga peneliti tertarik terhadap dua sekolah dasar negeri yaitu SDN Pagerwesi (penggabungan dari SDN Pagerwesi I dengan SDN Pagerwesi II) Kecamatan Bundaran dan SDN Sumosari (penggabungan dari SDN Sumosari I dengan SDN Sumosari II) Kecamatan Panji untuk ditelitinya. Penelitian ini bertujuan untuk menggambarkan manajemen sekolah pasca penggabungan yang terfokus kepada: (1) penyatuan wujud budaya para guru yang berasal dari dua kelompok lembaga sekolah asal masing-masing; melalui (a) pemusatan ruang guru, (b) menyesuaikan kebiasaan/perilaku antar kelompok guru, (c) memusatkan tempat kegiatan sekolah, (d) meningkatkan kegiatan sekolah, dan (e) pembentukan panitia Penerimaan Siswa Baru secara transparan; (2) penyatuan visi sekolah; melalui (a) pembahasan dua visi sekolah yang ada, dan (b) pembentukan visi sekolah yang baru; (3) pengorganisasian siswa; (4) pendayagunaan sarana-prasarana sekolah; (5) penyatuan kepengurusan komite sekolah; dan (6) efisiensi yang diperoleh pasca penggabungan sekolah. Pendekatan yang digunakan adalah pendekatan kualitatif, rancangan studi multi situs dengan metode komparatif konstan serta induktif konseptualistik. Orientasi teoritis penelitian kualitatif yang digunakan adalah pendekatan fenomenologis. Adapun langkah-langkah pengumpulan data sesuai kategori fokus, hasilnya dianalisis sehingga menjadi teori sementara tentang manajemen sekolah dasar negeri pasca penggabungan sekolah. Kemudian dilanjutkan pada situs kedua dan hasilnya dianalisis, dikomparasikan dengan teori sementara pada situs pertama. Pengumpulan data dilakukan secara berulang, sambil terus mengkomparasikan sampai diambil keputusan tentang teori yang mantap mengenai manajemen sekolah dasar negeri pasca penggabungan sekolah. Penelitian ini dilakukan di SDN Pagerwesi dan SDN Sumosari dengan sumber data person dan non person. Sumber data person sebagai informan penelitian dipilih secara purposif dan dipadukan dengan teknik snowball sampling. Data yang dikumpulkan melalui teknik wawancara mendalam, observasi partisipan dan studi dokumentasi. Dalam pelaksanaannya digunakan alat bantu: kertas catatan, format catatan lapangan, tustel, dan alat perekam. Untuk menjaga keabsahan data dilakukan kredibilitas, transferabilitas, dependabilitas, dan konfirmabilitas. Berkaitan dengan kredibilitas dilakukan dengan kegiatan(1) diskusi dengan teman sejawat, (2) trianggulasi, dan (3) pengecekan anggota. Berkaitan dengan dependabilitas dilakukan dengan kegiatan pembimbingan oleh para pembimbing disertasi dan untuk memeriksa konfirmabilitas dari senior peneliti. Analisis data dilakukan dengan menggunakan model analisis interaktif yang mencakup kegiatan sajian data, reduksi data, verifikasi dan penarikan kesimpulan. Analisis dilakukan di dalam situs dan lintas situs. Analisis lintas situs adalah pemaduan temuan-temuan sementara yang dirumuskan menjadi beberapa proposisi dari kedua situs tersebut, selanjutnya ditarik kesimpulan teoritik lintas situs. Hasil penelitian ini menunjukkan bahwa; (1) dalam penyatuan wujud budaya memerlukan suatu proses dan harus disertai saran atau strategi kepala sekolah yang memerlukan keuletan; (2) Mengenai penyatuan visi sekolah, sekolah mengkondisikan dua visi yang sudah ada dengan konsekuensinya menyempurnakan visi tersebut; (3) Tentang pengorganisasian siswa, diawali dengan penataan nomor induk siswa, penggabungan siswa ke dalam kelas, dan interaksi antar siswa yang berasal dari lembaga sekolah yang berlainan; (4) pendayagunaan sarana dan prasarana sekolah yang berwujud pemanfaatannya ke dalam semua kegiatan sekolah; (5) Penyatuan kepengurusan komite sekolah terdapat perbedaan, di SDN Pagerwesi kebetulan masa bakti kepengurusannya telah berakhir kedua-duanya, sehingga pembentukan bersamaan dengan reformasi pengurus, di SDN Sumosari kepengurusannya hanya dengan kesepakatan bendahara komite SDN Sumosari I (sebelum penggabungan) yang diamanati sebagai bendahara komite sekolah pasca penggabungan karena sebelum penggabungan pengurus komite sekolahnya adalah satu kepengurusan; dan (6) efisiensi pasca penggabungan sekolah berupa penurunan biaya operasional sekolah, bisa memberikan bantuan kesulitan pembayaran kekurangan kebutuhan biaya para siswa di sekolah, pengurangan beban pikiran dan tenaga para guru. Berdasarkan keseluruhan temuan teoritik di atas dapat ditarik sebuah teori substantif yaitu: Manajemen SDN Pagerwesi dan SDN Sumosari sudah “baik”, namun perlu adanya tenaga atau petugas khusus yang menangani sarana prasarana dan tata usaha sekolah, juga peran serta komite sekolah di SDN Sumosari perlu ditingkatkan

Kompetensi pemodelan matematika masalah persamaan linier siswa MAN Tlogo dan scaffoldingnya / Rahma Ramadhani

 

ABSTRAK Ramadhani, Rahma. 2015. Kompetensi Pemodelan Matematika Masalah Persamaan Linier Siswa MAN Tlogo dan Scaffoldingnya. Tesis, Program Studi Pendidikan Matematika, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Abdur Rahman As’ari, M. Pd, M. A., (II) Dr. Swasono Rahardjo, S. Pd, M. Si. Kata kunci: kompetensi pemodelan matematika, masalah persamaan linier, scaffolding Ketika siswa diberikan masalah yang berkaitan dengan literasi matematika, siswa jarang yang mengaitkan masalah tersebut dengan masalah matematika. Siswa tidak memahami bahwa masalah tersebut dapat diselesaikan dengan pemodelan matematika. Adapun langkah pemodelan matematika adalah understanding, simplifying/structuring, mathematizing, working mathematically, dan interpreting/validating. Kompetensi pemodelan matematika siswa masih sangat rendah. Oleh karena itu, perlu untuk memberikan bantuan salah satunya yaitu dengan scaffolding. Tujuan penelitian ini adalah mendeskripsikan bagaimana kompetensi pemodelan matematika siswa sebelum scaffolding, bagaimana scaffolding yang sesuai, dan bagaimana kompetensi pemodelan matematika siswa setelah diberikan scaffolding dalam menyelesaikan masalah persamaan linier. Peneliti memberikan tes kompetensi pemodelan matematika terlebih dahulu kepada seluruh siswa kelas XA dan XG. Jawaban siswa dianalisis dengan mendeskripsikan jawaban siswa kemudian peneliti menduga kompetensi pemodelan matematika siswa. Selanjutnya, peneliti melakukan wawancara kepada beberapa subjek untuk mendapatkan informasi lebih detail. Peneliti menetapkan satu subjek dari masing-masing level yang muncul yaitu level 0, level 1, dan level 2 kemudian diberikan scaffolding. Selanjutnya, ketiga subjek tersebut diberikan tes II untuk melihat kompetensi pemodelan matematika setelah scaffolding. Hasil penelitian menunjukkan bahwa siswa pada level 0 yaitu siswa yang belum dapat melakukan langkah understanding, dengan menggunakan scaffolding yaitu pertanyaan penyelidikan, pemeriksaan dan pengungkapan, pengenalan konteks bermakna, serta pertanyaan arahan, dapat meningkat pada level 3 yaitu siswa dapat melakukan langkah understanding, simplifying/structuring, dan mathematizing. Siswa pada level 1 yaitu siswa yang hanya dapat melakukan langkah understanding, dengan scaffolding yang diberikan adalah pertanyaan penyelidikan, pertanyaan arahan, pengungkapan ulang bicara siswa serta pemeriksaan dan pengungkapan, dapat meningkat pada level 5 yaitu siswa dapat melakukan seluruh langkah pemodelan matematika. Siswa pada level 2 yaitu siswa yang hanya dapat melakukan langkah understanding dan simplifying/structuring, dengan scaffolding yang diberikan yaitu pertanyaan penyelidikan, pemeriksaan dan pengungkapan, serta pertanyaan arahan dapat meningkat pada level 5 yaitu siswa dapat melakukan seluruh langkah pemodelan matematika. Hal-hal yang mempengaruhi kompetensi pemodelan matematika siswa antara lain kurang cermat dalam membaca, kurang teliti dalam langkah penyelesaian serta kurangnya pengetahuan matematis siswa.

Pengembangan model latihan kaki gaya dada cabang olahraga renang pada kegiatan ekstrakurikuler SMP Muhammadiyah 8 Batu - Kabupaten Malang / Arfian Novie Syaputra

 

Kata kunci : Pengembangan, renang, latihan kaki gaya dada, Sekolah Menengah Pertama Renang adalah suatu olahraga yang dilakukan di air, dengan cara menggerakkan anggota badan, mengapung di air, dan seluruh anggota badan bergerak dengan bebas. Cabang olahraga renang diberikan sebagai salah satu materi yang diajarkan pada kegiatan ekstrakurikuler di SMP Muhammadiyah 8 Batu. Kegiatan ekstrakurikuler renang diberikan sebagai atas dasar pertimbangan tingginya minat siswa pada cabang olahraga ini, selain itu sarana dan prasarana yang cukup terjangkau dari sekolah menjadi faktor pendukung dalam pelaksanaan kegiatan ekstrakurikuler renang. Salah satu faktor penghambat dalam pemberian materi tekhnik renang gaya dada pada siswa SMP Muhammadiyah adalah gerakan koordinasi antara lengan dan kaki. Banyak siswa yang melakukan gerakan kaki pada renang gaya dada sama dengan gerakan kaki pada gaya bebas. Tujuan penelitian ini adalah untuk mengembangkan model latihan kaki gaya dada khususnya latihan kaki pada kegiatan ekstrakurikuler renang di SMP Muhammadiyah 8 Batu. (1)Pengembangan model latihan kaki gaya dada pada kegiatan ekstrakurikuler renang di SMP 8 Muhammadiyah Batu menggunakan model pengembangan Research & Development ( R & D ) dari Borg and Gall. Melakukan penelitian dan pengumpulan informasi (kajian pustaka, pengamatan kelas, persiapan laporan tentang pokok persoalan) (2) Melakukan perencanaan (pendefinisian keterampilan, perumusan tujuan, penentuan urutan pengajaran, dan uji coba skala kecil) (3) Mengembangkan bentuk produk awal (penyiapan materi pengajaran, penyusunan buku pegangan, dan perlengkapan evaluasi) (4) Melakukan uji lapangan permulaan (dilakukan pada 2-3 sekolah, menggunakan 6-12 subjek) (5) Melakukan revisi terhadap produk utama (sesuai dengan saran-saran dari hasil uji lapangan permulaan) (6) Melakukan uji lapangan utama (dengan 5-15 sekolah dengan 30-100 subjek. (7) Melakukan revisi produk (berdasarkan saran-saran dan hasil uji coba lapangan utama). (8) Uji lapangan meliputi 10-30 sekolah dengan 40-200 subjek (9) Revisi produk akhir (10) Membuat laporan mengenai produk pada jurnal, bekerja dengan penerbit yang dapat melakukan distribusi secara komersial. Lokasi penelitian ini dilakukan di SMP Muhammdiyah 8 Batu. Subjek uji coba dari pengembangan ini terdiri dari 1) tinjauan dari satu ahli pembelajaran Pendidikan Jasmani Olahraga dan Kesehatan, dan dua ahli renang, 2) uji coba kelompok kecil adalah siswa SMP Muhammadiyah 8 Batu yang diambil secara random sampling dengan jumlah 10 orang, dan 3) uji coba lapangan adalah siswa SMP Muhammadiyah 8 Batu dengan jumlah 20 orang. Tekhnik pengumpulan data menggunakan instrumen berbentuk angket untuk evaluasi untuk ahli pembelajaran, ahli renang dan siswa. Analisis data yang digunakan dalam pengembangan ini adalah persentase. Dari pengembangan dan prosedur yang dilakukan diatas, diperoleh kesimpulan bahwa pengembangan model latihan kaki gaya dada pada kegiatan ekstrakurikuler renang di SMP Muhammadiyah 8 Batu dapat digunakan sebagai acuan pelatihan kegiatan ekstrakurikuler di SMP Muhammadiyah 8 Batu. Untuk perbaikan pengembangan model latihan kaki gaya dada ini disarankan agar perlu adanya tindak lanjut oleh peneliti lain yang sesuai dengan pengembangan ini, dengan maksud untuk mengetahui kelebihan dan kekurangan yang ada pada pengembangan ini. Sehingga hasil pengembangan ini dapat dimanfaatkan dengan baik.

Hubungan konsep diri dan kemandirian belajar terhadap prestasi belajar mata pelajaran pengetahuan dasar teknik mesin (PDTM) siswa kelas XI Program Teknik Pemesinan SMK Muhammadiyah 1 Kepanjen / Wawan Sukhron Fauzi

 

Kata kunci: Konsep Diri, Kemandirian Belajar, Prestasi Belajar, Mata Pelajaran PDTM Proses belajar akan menghasilkan perubahan-perubahan dalam diri seseorang. Untuk mengetahui seberapa jauh perubahan yang terjadi, perlu adanya penilaian dari hasil belajarnya. Penilaian terhadap hasil belajar seorang siswa difungsikan untuk mengetahui sejauh mana pencapaian sasaran belajar siswa, hal inilah yang disebut sebagai prestasi belajar. Terdapat beberapa faktor yang ikut menyumbang dalam pencapaian prestasi belajar. Konsep Diri dan Kemandirian Belajar merupakan salah satu contoh faktor internal yang mempunyai pengaruh terhadap hasil belajar siswa. Penelitian ini bertujuan untuk mengetahui hubungan Konsep Diri dan Kemandirian Belajar dengan prestasi belajar pada mata Pelajaran PDTM, baik secara parsial maupun secara simultan. Konsep Diri dan Kemandirian Belajar diukur dengan penyebaran angket. Untuk hasil prestasi belajar pada mata Pelajaran PDTM didapat dari nilai raport siswa pada semester gasal. Populasi pada penelitian ini adalah semua siswa kelas XI Program keahlian teknik mesin semester ganjil 2010/2011 SMK Muhammadiyah 1 Kepanjen. Dari populasi tersebut kemudian digunakan metode proportional random sampling untuk menentukan jumlah sampel yang akan diambil. Dalam penelitian ini ada 50 siswa yang dijadikan sampel penelitian. Rancangan penelitian ini adalah korelasional. Penelitian ini menggunakan pengujian hipotesis yang diuji dengan analisis regresi berganda. Pengujian hipotesis hubungan konsep diri dengan hasil belajar pada mata pelajaran PDTM menunjukkan bahwa nilai signifikansi adalah (0,002) < 0,05, dan thitung (3,263) > ttabel (2,008). Hubungan Kemandirian Belajar dengan hasil belajar pada mata pelajaran produktif menghasilkan nilai Signifikansi (0,000) < 0,05. dan thitung (11,528) > ttabel (2,008), Sehingga H0 ditolak dan menerima hipotesis yang diajukan. Sedangkan pengujian hipotesis hubungan secara simultan menunjukkan bahwa tingkat signifikansinya (0,000) < 0,05. dan Fhitung (208,) > Ftabel (3,18), sehingga H0 ditolak dan menerima hipotesis yang diajukan. Berdasarkan hasil penelitian siswa kelas XI SMK Muhammadiyah 1 Kepanjen tahun ajaran 2010/2011 diketahui bahwa tidak ada (0%) siswa mempunyai nilai Konsep Diri yang rendah, 18 siswa (36%) mempunyai nilai Konsep Diri sedang, dan 32 siswa (64%) mempunyai nilai Konsep Diri tinggi. Berdasarkan hasil penelitian Kemandirian Belajar diketahui sebanyak 22 siswa (44%) memiliki Kemandirian Belajar tinggi, 26 siswa (52%) memiliki Kemandirian Belajar sedang, dan 2 siswa (4%) memiliki Kemandirian Belajar rendah.

Pengaruh informasi rasio likuiditas, aktivitas, profit margin, dan nilai pasar terhadap return saham pada perusahaan real estate and property yang listing di BEI periode 2007-2009 / Indri Novitasari

 

Kata Kunci: rasio keuangan, return saham Setiap investor yang ingin menginvestasikan dananya dalam bentuk saham bertujuan untuk mendapatkan tingkat pengembalian (return) atas investasinya. Dalam melakukan penilaian suatu saham menurut pendekatan fundamental dapat digunakan teknik analisis rasio. Dalam penelitian ini rasio-rasio keuangan yang digunakan Likuiditas, Rasio Aktivitas, Profit Margin, dan Rasio Nilai Pasar. Penelitian ini dilaksanakan dengan tujuan menguji hubungan kausal antara variabel-variabel independen (likuiditas, rasio aktivitas, profit margin, dan rasio nilai pasar) dengan variabel dependennya (return saham). Sampel yang digunakan dalam penelitian ini sebanyak 11 perusahaan real estate and property periode 2007—2009 yang memenuhi kriteria yang telah ditentukan. Teknik sampling yang digunakan dalam penelitian ini adalah purposive sampling. Jenis data yang digunakan adalah kuantitatif dan merupakan data sekunder yang diperoleh dari Indonesian Capital Market Directory (ICMD) tahun 2007—2009. Uji asumsi klasik yang digunakan adalah uji normalitas, uji autokorelasi, uji multikolinearitas, dan uji heteroskedastisitas. Analisis data menggunakan teknik analisis regresi linear berganda dengan bantuan software statistik SPSS ver 16.0. Hasil penelitian menunjukkan bahwa secara parsial variabel likuiditas (current ratio), rasio aktivitas (total asset turn over), dan profit margin tidak berpengaruh terhadap return saham. Sedangkan variabel rasio nilai pasar (price earning ratio) berpengaruh secara signifikan terhadap return saham. Secara simultan variabel likuiditas (current ratio), rasio aktivitas (total asset turn over), profit margin dan rasio nilai pasar (price earning ratio) berpengaruh signifikan terhadap return saham. Saran yang dapat diberikan berdasarkan hasil penelitian ini adalah: (1) Bagi investor sebaiknya harus tetap menggunakan analisis fundamental sebagai acuan utama dalam mengambil keputusan investasi, (2) Bagi perusahaan hendaknya tetap mempertahankan kinerja keuangan perusahaannya, atau bahkan dapat meningkatkannya lagi, sehingga perusahaan tersebut dapat bersaing dengan perusahaan lokal maupun perusahaan dari luar negeri, (3) Untuk penelitian selanjutnya penulis menyarankan agar dalam mengetahui aktivitas perusahaan tidak menggunakan TATO tetapi menggunakan aktiva lancar misalnya Inventory Turn Over. TATO bisa digunakan untuk perusahaan yang perputaran persediaannya tinggi, misalnya perusahaan retail. Sehingga dalam pemilihan variabel disesuaikan dengan jenis perusahaannya.

Pengaruh rasio Pendapatan Asli Daerah (PAD), Dana Alokasi Umum (DAU), dan Dana Alokasi Khusus (DAK) terhadap Tingkat kemandirian keuangan daerah Kabupaten/ Kota di Provinsi Jawa Timur tahun 2010-2013 / Anisa Nur Izzati

 

ABSTRAK Izzati, AnisaNur. 2015. PengaruhRasioEfektivitasPendapatanAsli Daerah (PAD), Dana AlokasiUmum (DAU), dan Dana AlokasiKhusus (DAK) terhadap Tingkat KemandirianKeuangan Daerah Kabupaten/Kotadi ProvinsiJawaTimurTahun 2010-2013.Skripsi, JurusanAkuntansi, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (I) Sri Pujiningsih, S.E., M.Si., Ak, (II) Dr. Suparti, M.P. Kata Kunci: Tingkat KemandirianKeuangan Daerah, RasioEfektivitasPendapatanAsli Daerah (PAD), Dana AlokasiUmum (DAU), Dana AlokasiKhusus (DAK). Penelitianinibertujuanuntukmenguji: 1) PengaruhPendapatanAsli Daerah terhadaptingkatkemandiriankeuangandaerah, 2) Pengaruh Dana AlokasiUmumterhadaptingkatkemandiriankeuangandaerah, 3) PengaruhDana AlokasiKhususterhadaptingkatkemandiriankeuangandaerah, 4)PengaruhrasioefektivitasPendapatanAsli Daerah, Dana AlokasiUmum, dan Dana AlokasiKhususterhadaptingkatkemandiriankeuangandaerahkabupaten/kota di ProvinsiJawaTimurtahun 2010-2013 Penelitianinimerupakanpenelitianeskplanatori.Sampelpenelitian yang digunakansebanyak21Kabupaten/Kota dari 38Kabupaten/Kota yang ada di ProvinsiJawaTimur,ditentukandenganmetode purposive sampling. Penelitianinidilakukanuntukperiode 2010-2013.Jenis data yang digunakanadalah datasekunder.Data diperolehmelaluisitusDepartemenKeuanganRepublik Indonesia DirektoratJenderalPerimbanganKeuangan (www.djpk.depkeu.go.id).Data yang dianalisisdalampenelitianiniadalah data LaporanAnggaranPendapatandanBelanja Daerah (APBD) dan data LaporanRealisasiAnggaranPendapatandanBelanja Daerah (LRAPBD).Data yang telahdikumpulkandianalisisdenganmetodeanalisis data yaitupengujianasumsiklasiksebelummelakukanpengujianhipotesis.Pengujianhipotesisdalampenelitianinimenggunakanregresi linier bergandadenganuji t danuji F. Hasilanalisismenunjukkanbahwasecaraparsial1) rasioefektivitasPendapatanAsli Daerahberpengaruhterhadaptingkatkemandiriankeuangandaerah,2) Dana AlokasiUmumberpengaruhterhadaptingkatkemandiriankeuangandaerah, 3) Dana AlokasiKhususberpengaruhterhadaptingkatkemandiriankeuangandaerah, 4) SecarasimultanrasioefektivitasPendapatanAsli Daerah, Dana AlokasiUmum, dan Dana AlokasiKhususberpengaruhterhadaptingkatkemandiriankeuangandaerah..

Pengembangan buku panduan latihan renang gaya dolphin bagi pemula di Perkumpulan Renang Class Malang / Citra Destiasari

 

Kata kunci : pengembangan, buku panduan, renang, gaya dolphin. Buku panduan merupakan salah satu bentuk dari sumber latihan. Buku panduan latihan renang gaya dolphin tidak dimiliki di Perkumpulan Renang Class Malang. Buku merupakan salah satu media yang memiliki kelebihan merupakan buku tertulis, ringan dan dapat dibaca dimana saja. Buku panduan dianggap penting sekali pada pelatihan, oleh karena itu perlu sekali dikembangkan buku panduan latihan renang gaya dolphin bagi pemula di perkumpulan renang class Malang. Tujuan pengembangan buku panduan latihan renang gaya dolphin ini yang nantinya dapat membantu siswa untuk mempercepat proses pemahaman dalam mempelajari teknik renang gaya dolphin. Metode pembelajaran ini dikemas dalam bentuk buku panduan dan berisi tentang latihan renang gaya dolphin bagi pemula, tujuan dari setiap bentuk latihan renang gaya dolphin juga contoh gerakan variasi renang gaya dolphin tentunya dilengkapi dengan foto-foto dan gambar-gambar yang menarik yang dapat membantu memperjelas apa yang tersaji dalam buku panduan. Dalam penelitian ini peneliti menggunakan model pengembangan dari Borg dan Gall (1983:775) dan Ardana (2002:09). Adapun langkah-langkah yang dipilih oleh peneliti untuk pengembangan buku panduan latihan renang gaya dolphin adalah sebagai berikut: 1) Analisis kebutuhan, yaitu dengan pengumpulan informasi melalui analisis kebutuhan sebagai landasan pemikiran guna membuat konsep, 2) Pembuatan naskah awal buku panduan tentang pengembangan buku panduan latihan renang gaya dolphin mulai dari model latihan yang mudah ke model latihan yang sulit, 3) Evaluasi naskah awal produk buku panduan, 4) Revisi tahap1 naskah awal produk buku panduan, 5) Uji coba permulaan lapangan, 6) Uji coba produk, produk di uji coba ke 3 ahli, 7) Revisi tahap 2 produk buku panduan, revisi dilakukan setelah menerima masukan dan saran dari ahli untuk memperbaiki produk yang dihasilkan, 8) Reproduksi, penyempurnaan produk untuk menuju kesempurnaan dari produk yang dihasilkan kemudian menjadi produk akhir berupa buku panduan latihan renang gaya dolphin bagi pemula di perkumpulan renang class Malang. Hasil pengembangan ini berupa buku panduan latihan renang gaya dolphin bagi pemula di perkumpulan class Malang. Diharapkan hasil ini dapat diuji cobakan kepada lingkup yang lebih luas dan dapat disosialisasikan kepada perkumpulan atau juga club yang terkait sehingga dapat digunakan sebagaimana mestinya. Karena penelitian ini hanya terbatas pengembangan produk, maka diharapkan ada penelitian selanjutnya yang menguji tentang tingkat efektivitas produk yang telah dikembangkan.

Pengembangan modul dalam mata pelajaran Komunikasi Bisnis berdasarkan kurikulum 2013 (studi pada siswa kelas XI Pemasaran SMK Pawyatan Daha 1 Kediri / Mita Khurohmah

 

ABSTRAK Khurohmah, Mita. 2015. Pengembangan Modul Dalam Mata Pelajaran Komunikasi Bisnis Berdasarkan Kurikulum 2013.(Studi Pada Siswa Kelas XI Pemasaran Di Smk Pawyatan Daha 1 Kediri).Skripsi, Program Studi Pendidikan Tata Niaga, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (I) Dr. Sopiah, M.Pd, M.M (II) Afwan Hariri Agus Prohimi, S.E, M.Si. Kata Kunci: Modul Pembelajaran, Komunikasi Bisnis, Kurikulum 2013. Perkembangan pendidikan di Indonesia mengalami kemajuan salah satunya dengan penerapan kurikulum 2013. Penerapan kurikulum 2013 bukan sekedar pergantian kurikulum, tetapi menuntut perubahan dalam pembelajaran di sekolah, salah satunya adalah perangkat pembelajaran yang digunakan oleh siswa yaitu modul. bahan ajar sangat diperlukan dalam proses pembelajaran karena dapat membantu guru maupun siswa. Oleh karena itu, guru harus mampu mengembangkan bahan ajar yang sesuai dengan tuntutan kurikulum. Salah satu bentuk bahan ajar adalah modul. modul adalah buku yang digunakan baik oleh siswa maupun guru dalam kegiatan belajar mengajar. Materi dalam modul merupakan realisasi dari materi yang tercantum dalam kurikulum. Tujuan penelitihan adalah menghasilkan produk berupa modul pembelajaran komunikasi bisnis berdasarkan kurikulum 2013 pada mata pelajaran komunikasi bisnis dengan materi teknik negosiasi yang telah melalui proses validasi. Model pengembangan produk modul pembelajaran ini menggunakan modifikasi dari langkah-langkah penelitian dan pengembangan yang dikemukakan oleh Borg & Gall yang terdiri dari analisis kebutuhan, pengembangan produk, validasi ahli, revisi, uji penggunaan terbatas dan produk akhir. Jenis data pada penelitian ini menggunakan data kuantitatif dan data kualitatif. Data kuantitatif berupa saran, tanggapan, dan kritik dari validator yang digunakan sebagai pertimbangan dalam melakukan revisi terhadap modul pembelajaran yang dikembangkan. Hasil proses uji coba produk tersebut didukung dengan hasil validasi yang diperoleh dari ahli kepenulisan modul sebesar 97,73%, ahli materi sebesar 86,10%, ahli bahasa sebesar 86,50%, dan uji coba pengguna siswa sebesar 85,30%, sehingga apabila hasil tersebut dihitung secara keseluruhan diperoleh rata-rata sebesar 88,91%. Berdasarkan hasil analisis tersebut, dapat disimpulkan bahwa Modul Pembelajaran Komunikasi Bisnis Berdasarkan Kurikulum 2013 dinyatakan layak dan dapat digunakan dalam proses pembelajaran materi teknik negosiasi di SMK Pawyatan Daha 1 Kediri.

Pengaruh good corporate governance terhadap kinerja keuangan dan nilai perusahaan pada perusahaan food and beverages yang terdaftar di BEI tahun 2011-2013 / Alfiani Dinanti

 

ABSTRAK Dinanti, Alifiani. 2015. Pengaruh Good Corporate Governance terhadap Kinerja Keuangan dan Nilai Perusahaanpada Perusahaan Food and Beverages yang terdaftar di BEI Tahun 2011-2013. Skripsi, Jurusan Akuntansi, Program Studi S1 Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Dr. Hj. Endang Sri Andayani, S.E, M.Si., Ak.(2) Dr. Hj. PujiHandayati, S.E, M.M., Ak., CA., C.MA Kata Kunci : good corporate governance, nilai perusahaan dan kinerja keuangan Nilaiperusahaanmerupakankonseppentingbagi investor, di mananilaiperusahaanadalahindikatorbagaimanapasarmenilaiperusahaansecarakeseluruhan.Hambatan perusahaan dalam proses meningkatkan nilai perusahaan adalah adanya agency problem. Agency theory menyatakan bahwa hubunganagencymunculketikaprincipalsmempekerjakanagentuntukmemberikansuatujasadanpengambilankeputusankepadaagentersebut. KonflikkeagenantersebutdapatdiminimalisasidenganadanyaGood Corporate Governance. Penelitian Good Corporate Governanceterhadap nilai perusahaan masih menghasilkan berbagai kesimpulan beragam, maka perlu dilakukan penelitian kembali dengan menambah variabel kinerjakeuangan sebagai variabel intervening. Tujuan penelitian ini adalah untuk menguji pengaruh Good Corporate Governanceterhadap nilai perusahaan dengan kinerja keuangan variabel intervening. Penelitian ini termasuk jenis penelitian explanatory research. Pengumpulan data dilakukan dengan cara dokumentasi berupa laporan keuangan tahunan perusahaan food and beverages yang telah dipublikasikan di BEI tahun 2011-2013 dengan menelitisejumlah 45 perusahaan food and beverages yang terdaftar di BEI tahun 2011-2013 dengan kriteria memiliki Good Corporate Governance.Penelitian ini menggunakan analisis jalur (path analysis). Pengujian hipotesis menggunakan uji t dengan signifikansi 5%, serta pengujian analisis menggunakan alat bantu program SPSS 16.0. Hasil pengujian hipotesis menunjukkan bahwa (1) kepemilikan institusional berpengaruh terhadap kinerja keuangan (2) dewan direksi berpengaruh terhadap kinerja keuangan(3) dewan komisaris independen berpengaruh terhadap kinerja keuangan(4) Kepemilikan Institusional berpengaruh terhadap nilai perusahaan (5) dewan direksi berpengaruh terhadap nilai perusahaan (6) dewan komisaris independen berpengaruh terhadap nilai perusahaan (7) kinerja keuangan berpengaruh terhadap nilai perusahaan (8) Kepemilikan Institusional berpengaruh terhadap nilai perusahaan dengan kinerja keuangan sebagai variabel intervening (9) dewan direksi berpengaruh terhadap nilai perusahaan dengan kinerja keuangan sebagai variabel intervening (10) dewan komisaris independen berpengaruh terhadap nilai perusahaan dengan kinerja keuangan sebagai variabel intervening.

Pemanfaatan Teknologi Informasi dan Komunikasi sebagai upaya peningkatan kualitas pembelajaran Ekonomi di kelas XI IIS SMA Negeri 1 Grati Kabupaten Pasuruan / Muhammad Arriza Arrizqi

 

ABSTRAK Arriza Arrizqi, Muhammad 2015. Pemanfaatan Teknologi Informasi dan Komunikasi sebagai upaya Peningkatan Kualitas Pembelajaran Ekonomi kelas XI IIS SMA Negeri 1 Grati Kabupaten Pasuruan. Skripsi. Jurusan Ekonomi Pembangunan. Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (I) : Dr. Nasikh, MP., M.Pd, Pembimbing (II) : Drs. Sapir, S.Sos., M.Si. Kata Kunci : Teknologi Informasi dan Komunikasi, Kualitas Pembelajaran. Kualitas pembelajaran merupakan iklim pembelajaran yang diciptakan oleh guru dan siswa pada saat kegiatan pembelajaran, serta hasil yang dicapai setelah adanya kegiatan pembelajaran. Pemanfaatan Teknologi informasi dan komunikasi sebagai upaya peningkatan kualitas pembelajaran adalah penggunaan Teknologi informasi dan komunikasi sebagai penunjang pada proses pembelajaran berlangsung yang dilakukan oleh guru dan siswa dikelas, maupun proses pembelajaran secara mandiri baik yang dilakukan oleh guru maupun siswa pada saat berada diluar pembelajaran. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui bagaimana pemanfaatan Teknologi informasi dan komunikasi sebagai upaya peningkatan kualitas pembelajaran pada mata pembelajaran ekonomi di kelas XI IIS SMA Negeri 1 Grati, dan untuk mengetahui bagaimana respon siswa dalam pemanfaatan teknologi informasi dan komunikasi sebagai upaya peningkatan kualitas pembelajaran mata pelajaran ekonomi . Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Data penelitian yang berupahasil angket. Pengumpulan data dilakukan dengan menggunakan, wawancara, dan laporan pengamatan langsung. Instrumen yang digunakan berupa data berupa instrumen angket dan wawancara. Untuk menjaga keabsahan data, dilakukan kegiatan trianggulasi data, dan tahap evaluasi data. Berdasarkan hasilpenelitian, menunjukkan pemanfaatan teknologi informasi dan komunikasi di kelas XI IIS SMA Negeri 1 Grati sudah sangat baik, namun fasilitas yang disediakan oleh sekolah kurang memadai. Efektivitas waktu proses kegiatan pembelajaran, adalah penghambat dalam terciptanya kualitas pembelajaran yang baik. Dikarenakan, pada saat proses kegiatan pembelajaran siswa merasa kelelahan dan membuat suasana belajar menjadi tidak nyaman. Berdasarkan pengamatan, sebagian siswa yang lebih memilih tidur dan mengobrol, sisanya siswa hanya diam dan menanggapi materi tanpa keseriusan. .

Upaya guru kelas rendah melestarikan bentuk Lagu Anak yang bermakna pendidikan di Sekolah Dasar Kecamatan Klojen Kota Malang / Herni Etikasari

 

ABSTRAK Etikasari, Herni. 2014. Upaya Guru Kelas Rendah Melestarikan Bentuk Lagu Anak yang Bermakna Pendidikan di Sekolah Dasar Kecamatan Klojen Kota Malang. Skripsi, Program Studi S1 Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Pra Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Usep Kustiawan, M.Sn, (II) Drs. I Made Seken, M.Pd. Kata Kunci: guru kelas rendah, lagu anak yang bermakna pendidikan Dalam kurun waktu terakhir ini, lagu anak-anak sudah mulai dilupakan. Peran guru kelasrendahsangat diperlukan untuk pelestarian bentuk lagu anak-anak yang bermakna pendidikan. Berkaitan dengan itu, maka diperlukan penelitian lebih lanjut tentang upaya-upaya guru kelas rendah melestarikan bentuk lagu anak di sekolah dasar kecamatan Klojen kota Malang. Penelitian ini dilaksanakan dengan bertujuan: (1) untuk mendiskripsikan upaya guru kelas rendah untuk melestarikan bentuk lagu anak yang bermakna pendidikan di sekolah dasar kecamatan Klojen kota Malang, dan (2) untuk mengetahui kendala yang dihadapi guru kelas rendah untuk melestarikan bentuk lagu anak yang bermakna pendidikan di sekolah dasar kecamatan Klojen kota Malang. Penelitianinimenggunakanrancanganpenelitiandeskriptifkualitatif. Penelitibertindaksebagaiinstrumensekaliguspengumpul data. Populasidarisumber data padapenelitianiniadalah 19 SDN di kecamatanKlojen. Sampel yang diambilpenelitiadalah 9 SDN di kecamatanKlojen. Pengumpulan data dilakukandenganmetodeobservasi, wawancaradengan 9 orang guru, dokumentasidanangketuntuk 39 orang guru kelasrendah. Proses analisis data dimulaidenganmenelaahseluruh data yang tersediadairberbagaisumberseperti data angketdan data wawancara yang terkumpul. Langkahselanjutnya yang akanditempuholehpenelitisetelah data terkumpuladalahdenganmenganalisis data tersebut.Pengecekankeabsahantemuandilakukandenganmenggunakanteknikdiskusidengantemansejawat, diskusidengan guru keseniansekolahdasar, dandiskusidengandosenpembimbing. Sebagianbesar guru hanyakadang-kadangsajamenggunakanlaguanakdalampembelajaran. Selainitu, lagu yang dinyanyikanadalahlagu-lagujamandahulu, karenalaguanak-anak yang barusudahjarang. Seringnyasiswahanyadiajakmenyanyisaja, tanpadijelaskanbentukdarilagu yang dinyanyikan. Guru kelasrendahmasihbanyak yang belumturutsertamemaksimalkanpelestarianlaguanakmelaluipembelajaran. Guru hanyamengacupadakurikulum yang adatanpamelakukanpengembangan yang lain. Kendala yang dihadapi guru kelasrendahpadasaatmelestarikanlaguanakadalahkurangnyapengetahuan guru tentanglaguanakdankurangnyaminatsiswauntukmempelajarilaguanak-anak. Kesimpulan dari penelitian ini adalah upaya guru kelas rendah di SD kecamatan Klojen kota Malang masihbelum maksimal, karena masih sedikit guru kelas rendah yang melakukan upaya melestarikan lagu anak yaitu dengan menyisipkan lagu anak pada materi pembelajaran di kelas rendah yang disesuaikan dengan kurikulum yang ada, menggunakan lagu anak sebagai penghilang rasa bosan ketika pembelajaran berlangsung, memperdengarkan lagu anak di luar pembelajaran dalam kelas. Kendala-kendala yang dihadapi guru kelas rendah dalam melestarikan bentuk lagu anak yang bermakna pendidikan adalah pengetahuan guru yang terbatas yaitu hanya memahami tentang lagu tanpa memahami tentang bentuk lagu anak terutama tentang unsur-unsur musik yang terkandung di dalamnya dan ketika mengajarkan kepada siswa, guru hanya sekedar mengajarkan tanpa ada tindak lanjut, serta kurangnya minat siswa untuk belajar lagu anak-anak karena perkembangan industri musik yang lebih mengarah ke lagu orang dewasa, serta kurangnya filter dari orang tua terhadap siswa.

Penerapan pembelajaran metode group investigation untuk meningkatkan motivasi dan hasil belajar biologi siswa kelas XI.IPA.2 SMA Negeri 1 Blitar / Dwi Novitasari

 

Karakteristik emosi anak sulung dan anak bungsu siswa MAN Malang 3 / Irstanty Indah Mentari

 

ABSTRAK Mentari, Irstanty Indah. 2015. KarakteristikEmosiAnakSulung dan AnakBungsuSiswaMAN Malang 3. Skripsi. JurusanBimbingan dan KonselingFakultasIlmuPendidikanUniversitasNegeri Malang. Pembimbing: (I) Dra. Ella Faridati Zen, M.Pd. (II) Irene Maya Simon, S.Pd, M.Pd. Kata Kunci: karakteristikemosi, anaksulung, anakbungsu Emosiadalahsuatuperasaan yang khas, suatukeadaanbiologis dan psikologis dan serangkaiankecenderunganuntukbertindakterhadaprangsangandariluar dan dalamdiriindividumencakupperubahan-perubahan yang disadari, yang mendalamsifatnya, dan perubahanperilakupadaumumnyadisertaiadanyaekspresikejasmanian. Karakteristikemosiadalahciri-ciri yang spesifiktentangperasaan, keadaanbiologis dan psikologisdarimanusia. Salah satufaktor yang dapatmempengaruhikarakteristikemosipadamanusiaadalahposisiurutankelahiran. Hal inidapatdilihatpadaperbedaankarakteristikemosiantaraanaksulung dan anakbungsu. Penelitianlebihlanjuttentangperbedaankarakteristikemosiantaraanaksulung dan anakbungsu, dilakukan di MAN Malang 3denganbeberapapertimbangan, yaitu: (1) MAN Malang 3 lebihmengedepankanperilaku yang baik yang dapatmempengaruhikarakteristikemosisiswa, (2) MAN Malang 3 memilikilatar belakang siswa yang beragam dan (3) MAN Malang 3 memenuhikriteria yang terdapatdalampenelitianyaituterdapatsiswa yang memilikiurutankelahiransebagaianaksulung dan anakbungsu.. Berdasarkan uraiankontekspenelitian yang telahdikemukakan di atas, makafokuspenelitianiniadalah: (1) karakteristikemosianaksulung di MAN Malang 3 dan (2) karakteristikemosianakbungsu di MAN Malang 3. Penelitian ini dilakukan di MAN Malang 3dengansumberdata yaitusiswaMAN Malang 3 yang merupakananaksulung dan anakbungsudalamkeluarganya.Penelitianini menggunakan pendekatan kualitatif,teknik pengumpulan datanya meliputi: wawancara, observasi, dan studi dokumentasi. Data yang terkumpulditafsirkan dan dianalisaguna penyusunan temuan lapangan. Kredibilitasi sumber dengan menggunakan triangulasi teknik pengumpulan data. Berdasarkanhasilpenelitianinidapatdisimpulkanbahwakarakteristikemosi yang dimilikianaksulungadalahsebagaiberikut: (a) anaksulungmampumengenaliemosidirisendiri, (b) anaksulungmampumengendalikanemosi, (c) anaksulungmampumengelola dan mengungkapkanemosi, (d) anaksulungmendahulukanpikiranrasionalnya, dan (e) anaksulungmemilikiempatiatauperasaanmemahami orang lain, sedangkankarakteristikemosi yang dimilikiolehanakbungsuadalah: (a) anakbungsumemilikijiwa ceria atauperiang, (b) anakbungsumemilikiemositidakstabil, (c) anakbungsumerupakanpemberontakemosional, dan (d) anakbungsukurangmemilikikepekaan.Hasiltemuaninidiharapkandapatmembantukonselor agar dapatmemberikanpelayananbimbinganpribadikepadasiswasecaramaksimalsesuaidengankarakteristikemosipadamasing-masingsiswa.

Hubungan minat belajar geografi dan fasilitas belajar di rumah dengan prestasi belajar geografi siswa MAN Kunir Blitar / Boby Dwi Pradana

 

ABSTRAK Pradana, Boby.Dwi. 2014. Hubungan Minat Belajar Geografi dan Fasilitas Belajar di Rumah dengan Prestasi Belajar Geografi Siswa MAN Kunir Blitar. Skripsi, Jurusan Geografi FIS Universitas Negeri Malang. Pembimbing: (I) Dr. Ach. Amirudin, M.Pd, (II) Drs. Mustofa, M.Pd Kata Kunci: minat, fasilitas, prestasi. Prestasi belajar siswa yang rendah merupakan suatu masalah yang tidak dapat dibiarkan begitu saja, karena masalah tersebut akan berdampak buruk terhadap perkembangan sumber daya manusia sehingga berakibat semakin buruknya citra pendidikan di negara kita. Ada dua macam faktor yang menjadi penghambat dalam belajar, yaitu faktor internal dimana faktor penghambatnya berasal dari dalam diri siswa, dan faktor eksternal dimana faktor penghambatnya berasal dari lingkungan sekitar siswa. Penelitian ini merupakan jenis penelitian survei. Tujuan penelitian ini untuk mengetahui hubungan minat belajar geografi dan fasilitas belajar di rumah dengan prestasi belajar geografi. Populasi penelitian adalah siswa kelas XI IPS MAN Kunir Blitar sebanyak 147 siswa. Sampel diambil menggunakan teknik random sederhana (simple random sampling) dan diperoleh sampel sebanyak 107 siswa. Metode pengumpulan data instrumen angket dengan skala likert. Uji validitas dengan rumus korelasi pearson product moment, uji reliabilitas dengan rumus alpha cronbach. Uji prasyarat analisis dengan uji normalitas, uji linieritas, uji homogenitas, uji heteroskedastisitas dan uji multikoliniearitas. Teknik analisis data untuk hubungan menggunakan analisis korelasi sederhana sedangkan hubungan simultan menggunakan analisis korelasi ganda. Setelah dilakukan analisis data, didapatkan koefisien korelasi untuk minat belajar geografi sebesar 0,513, koefisien determinasi sebesar 26,3%, t hitung sebesar 5,634 sedangkan t tabel sebesar 1,659. Hal ini menunjukkan bahwa minat belajar geografi memiliki hubungan positif dan signifikan dengan prestasi belajar geografi. Minat belajar geografi memiliki kontibusi sebesar 26,3% dengan prestasi belajar geografi, sisanya ditentukan oleh faktor lainnya. Sementara itu, didapatkan koefisien korelasi untuk fasilitas belajar di rumah sebesar 0,286, koefisien determinasi sebesar 8,2%, t hitung sebesar 2,223 sedangkan t tabel sebesar 1,659. Hal ini menunjukkan bahwa fasilitas belajar di rumah memiliki hubungan positif dan signifikan dengan prestasi belajar geografi. Fasilitas belajar di rumah memiliki kontribusi sebesar 8,2% dengan prestasi belajar geografi, sisanya ditentukan oleh faktor lainnya. Semakin tinggi minat belajar geografi maka semakin tinggi prestasi belajar geografi yang dicapai. Semakin baik fasilitas belajar di rumah maka semakin tinggi prestasi belajar geografi yang dicapai. Saran peneliti yaitu pembelajaran sesekali dilakukan diluar kelas agar siswa lebih mengenal lingkungan geografi secara langsung untuk menumbuhkan minat belajar geografi pada siswa. Orang tua hendaknya menciptakan suasana kondusif di rumah agar anak bisa belajar dengan maksimal serta menyediakan segala fasilitas yang diperlukan anak untuk belajar di rumah. Untuk peneliti berikutnya sebaiknya melakukan penelitian dengan mengangkat faktor-faktor lain yang dapat mempengaruhi prestasi belajar yang belum diungkapkan dalam skripsi ini

Implementasi regresi akar ciri terhadap faktor-faktor yang mempengaruhi diabetes mellitus (studi kasus di RSU Dr. Saiful Anwar Malang) / Ratnawati

 

Kata kunci :regresi linear berganda, multikolinearitas, kuadrat terkecil termodifikasi, regresi akar ciri Analisis regresi linear berganda digunakan untuk menganalisis hubungan linear antara dua atau lebih variabel bebas secara bersama-bersama dengan satu variabel terikat. Adanya korelasi antar variabel yang cukup tinggi menimbulkan multikolinearitas yang menyebabkan model persamaan regresi yang diperoleh kurang representatif. Pada penelitian ini analisis regresi linear berganda digunakan untuk mencari bagaimana pengaruh variabel-variabel bebas (usia, tekanan darah, kandungan kolesterol, kandungan asam urat, dan kandungan hemoglobin) terhadap variabel terikat (kadar gula darah). Dari variabel-variabel bebas tersebut diidentifikasi terdapat multikolinearitas. Salah satu cara untuk mengatasi multikolinearitas adalah dengan menggunakan regresi akar ciri. Regresi akar ciri merupakan perluasan dari regresi komponen utama. Perbedaannya terletak pada nilai akar ciri yang diperoleh yaitu dari matrik korelasi antara peubah bebas dengan peubah tak bebas. Penghitungan koefisien regresi dapat menggunakan persamaan kudrat terkecil termodifikasi. Regresi Akar ciri menghasilkan variabel-variabel bebas baru yang tidak saling berkorelasi sehingga masalah multikolinearitas dapat diatasi. Dengan regresi akar ciri menghasilkan persamaan regresi sebagai berikut : Y = 225.7 + 10.39X1 + 0.16X2 + 0.0023X3 + 54.03X4 + 191.18X5 Metode regresi akar laten menghasilkan model regresi linier berganda yang telah bebas dari multikolinearitas.

Kepemimpinan kepala sekolah dalam meningkatkan mutu pendidikan pada Sekolah Dasar Islam Unggul di Banjarmasin (studi multisitus pada SD Islam Sabilal Muhtadin, SD Muhammadiyah 10, dan SD Islam Terpadu Ukhuwah) / Noorhapizah

 

ABSTRAK Noorhafizah. 2015. Kepemimpinan Kepala Sekolah dalam Meningkatkan Mutu Pendidikan Sekolah Dasar Islam Unggul di Banjarmasin (Studi Multisitus pada SD Islam Sabilal Muhtadin, SD Muhammadiyah 10, dan SD Islam Terpadu Ukhuwah). Disertasi, Program Studi Manajemen Pendidikan, Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. H. Ahmad Sonhadji K.H. M.A. Ph.D., (II) Dr. H. Imron Arifin, M.Pd, dan (III) Drs. H. Ahmad Suriansyah, M.Pd, Ph.D. Kata kunci: kepemimpinan, kepala sekolah, mutu pendidikan, sekolah dasar Islam unggul Kepemimpinan kepala sekolah pada kondisi proses interaksi lokal, nasional, regional dan internasional sangat diperlukan guna mempercepat penyesuaian antara kondisi rutinitas ke arah dinamisasi institusi. Pendidikan di masa depan sangat ditentukan oleh kebutuhan pasar bebas. Pemimpin adalah sosok yang mampu membangun stimulus intelektual, idealisme dan komitmen mutu, motivasi berprestasi, bersaing dan menguasai pasar dalam pemasukan dan keluaran serta kepercayaan. Pimpinan mempunyai potensi terutama dari ketokohan, kemampuan analisis dan membangun kepercayaan bawahan. Berdasarkan studi pendahuluan, di beberapa SD di Kota Banjarmasin, secara khusus telah terjadi perkembangan menarik dalam mutu pendidikan dan telah mendapat kepercayaan masyarakat. Sekolah yang menjadi pilihan masyarakat tersebut adalah sekolah dasar Islam unggul. Penelitian ini bertujuan untuk mendeskripsikan: (1) kapasitas kepemimpinan kepala sekolah dalam dimensi: visi, misi profesional, dan rutinitas pelaksanaan tugas manajerial, (2) aspek-aspek mutu pendidikan meningkat secara konsisten meliputi: masukan (input), proses (proccess), dan keluaran (output) sebagai produk aktualisasi kepemimpinan kepala sekolah, (3) strategi dan prakarsa kepala sekolah dalam meningkatkan mutu pendidikan pada SD Islam Sabilal Muhtadin, SD Muhammadiyah 10, dan SD Islam Terpadu Ukhuwah Banjarmasin. Penelitian ini menggunakan pendekatan kualitatif dan dilakukan pada tiga situs yaitu SD Islam Sabilal Muhtadin, SD Muhammadiyah 10, dan SDIT Ukhuwah. Berdasarkan latar persamaan berbasis Islam dan kekhasan penyelenggaraan program SD unggul digunakan rancangan penelitian multisitus dengan metode induksi analisis konstan termodifikasi dalam analisis data. Orientasi teoretik yang digunakan adalah pendekatan fenomenalogis, sedangkan sampel ditetapkan secara purposif sampling. Teknik pengumpulan data yang digunakan meliputi: (1) wawancara, (2) observasi dan (3) studi dokumentasi. Data yang terkumpul melalui ketiga teknik tersebut diorganisir, ditafsirkan dan dianalisis secara berulang-ulang, baik melalui analisis dalam situs (within situs analysis) maupun analisis lintas situs (cross situs analysis), guna penyusunan konsep dan abstraksi temuan lapangan. Kredibilitas data dicek dengan prosedur triangulasi, pengecekan anggota, diskusi teman sejawat dan pengecekan mengenai kecukupan referensi. Sedangkan dependabilitas dan konfirmabilitas dicapai dari pengeditan oleh para pembimbing. Temuan penelitian ini meliputi: (1) kepala sekolah menjadikan visi sekolah sebagai alat untuk mengarahkan haluan dan tujuan, menjadikan misi sekolah sebagai penjabaran dari visi sekolah yang mendorong perilaku dan budaya yang unggul, menjadikan misi sebagai pendorong untuk menggali potensi, kreasi, dan inovasi yang dimiliki warga sekolah demi terwujudnya tujuan sekolah. Nilai kepemimpinan, menanamkan nilai-nilai unggul dan Islami di sekolah untuk diyakini warga sekolah dan dimanifestasikan dalam perilaku sehari-hari sehingga dapat menumbuhkan budaya berprestasi di sekolah. Rutinitas kepemimpinan yang muncul: mengajak guru dan siswa menyelenggaraan pendidikan dan pengajaran, membina hubungan dan komunikasi, tanggung jawab, mengawasi, dan menciptakan pelayanan. (2) aspek-aspek mutu pendidikan meningkat secara konsisten: masukan (input), kepala sekolah sama-sama mengawali pembentukan kepanitiaan, perkiraan tentang jumlah kelas, seleksi, jumlah siswa, guru-guru, personil tambahan, dana, dan pembekalan. Aspek mutu proses (proccess), ketiga kepala sekolah memfokuskan pada: kurikulum dan pembelajaran berbasis Islam, manajemen ketenagaan, sarana dan prasarana penunjang, program pembinaan, pendidikan dan pengajaran, supervisi pengajaran. Aspek mutu keluaran (output): fokus pencapaian hasil ujian nasional, mendorong siswa unggul dalam akademik dan non-akademik dan melanjutkan ke sekolah favorit. (3) strategi dan prakarsa kepala sekolah dalam meningkatkan mutu pendidikan sekolah unggul, kepala sekolah fokus pada: kurikulum dan pembelajaran sesuai kebutuhan masyarakat, menegakkan nilai agama, aplikasi pembelajaran inovatif dan kreatif, pengembangan diri, melibatkan orangtua siswa menyusun kurikulum muatan lokal, mengelola tenaga yang profesional bermutu dan berkarakter, mengutamakan kualitas lulusan, kemitraan dengan lingkungan, memperhatikan kesejahteraan guru, dan melakukan kontrol. Saran-saran: (1) kepada kepala SD Islam Sabilal Muhtadin, SD Muhammadiyah 10 dan SD Islam Terpadu Ukhuwah Banjarmasin disarankan untuk membangun dan mengembangkan kemampuan kepemimpinan dan komunikasi dengan semua lini, yayasan, komite sekolah dan pemerintah, (2) kepada yayasan pendidikan dan Institusi Keagamaan SD Islam Sabilal Muhtadin, SD Muhammadiyah 10 dan SD Islam Terpadu Ukhuwah Banjarmasin membuat kebijakan fleksibelitas dana, tetap berorientasi pada mutu pendidikan, (3) Dinas Pendidikan Kota Banjarmasin disarankan memberikan pembinaan kepada kepala sekolah dasar Islam dalam aspek kepemimpinan untuk meningkatkan mutu pendidikan, pengembangan kurikulum, perhatian dana pendidikan dan bantuan sarana prasarana, (4) Dinas Pendidikan Provinsi Kalimantan Selatan disarankan memberikan pembinaan kepala sekolah dasar Islam dalam aspek kepemimpinan untuk meningkatkan mutu pendidikan aspek kurikulum, menjalin komunikasi dengan kepala sekolah untuk memantau mutu pendidikan, (5) Direktorat Pembinaan Sekolah Dasar Kementerian Pendidikan dan Kebudayaan disarankan melakukan kajian untuk tentang kepemimpinan kepala sekolah dalam meningkatkan mutu pendidikan Sekolah Dasar Islam unggul di tingkat nasional. (6) peneliti lain, agar hasil penelitian ini dapat dijadikan acuan yang ingin mengkaji lebih mendalam dengan topik dan fokus serta setting yang lain tentang kepemimpinan kepala sekolah dalam meningkatkan mutu pendidikan, (7) pengembangan ilmu pendidikan agar hasil penelitian ini menjadi khasanah pengetahuan mengenai kepemimpinan kepala sekolah unggul dalam meningkatkan mutu pendidikan Sekolah Dasar Islam unggul di Indonesia umumnya.

Manajemen Sekolah Dasar dalam pengembangan Pendidikan karakter berbasis kurikulum 2013 (studi multi-situs pada SDN Sungai Miai 7, SDN Antasan Besar 7, dan SDN Karang Mekar 1 Banjarmasin / Asniwati

 

ABSTRAK Asniwati. 2015. Manajemen Sekolah Dasar dalam Pengembangan Pendidikan Karakter Berbasis Kurikulum 2013 (Studi Multi-Situs Pada SDN Sungai Miai 7, SDN Antasan Besar 7, dan SDN Karang Mekar 1 Banjarmasin). Disertasi, Program Magister Manajemen Pendidikan, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. H. Ahmad Sonhadji K.H. M.A. Ph.D., (II) Prof. Hj. Utami Widiati, M.A. Ph.D., dan (III) Dr. H. Imron Arifin, M.Pd. Kata kunci: manajemen, pendidikan karakter, Kurikulum 2013, Sekolah Dasar Pendidikan karakter adalah suatu sistem penanaman nilai-nilai perilaku (karakter) meliputi komponen pengetahuan, kesadaran atau kemauan, dan tindakan melaksanakan yang baik. Kurikulum adalah seperangkat rencana dan pengaturan mengenai tujuan, isi, dan bahan pelajaran serta cara yang digunakan sebagai pedoman penyelenggaraan kegiatan pembelajaran untuk mencapai tujuan pendidikan tertentu. Sejak diberlakukan Kurikulum 2013, pendidikan karakter dikembangkan sebagai pilot projek di sejumlah sekolah dasar di Banjarmasin. Penelitian ini menggunakan pendekatan deskriptif kualitatif studi multi-situs meliputi: (1) formulasi pengembangan pendidikan karakter, (2) implementasi pengembangan pendidikan karakter, (3) pengendalian pengembangan pendidikan karakter, (4) resistensi dan strategi mengatasi resistensi dalam pengembangan pendidikan karakter berbasis Kurikulum 2013 pada SDN Sungai Miai 7, SDN Antasan Besar 7 dan SDN Karang Mekar 1. Melalui sumber data penelitian: kepala sekolah, ketua komite sekolah, wakasek, wali kelas, guru, dan siswa. Teknik pengumpulan data: wawancara, observasi dan dokumentasi. Analisis data interaktif, yaitu reduksi data, penyajian data dan penarikan kesimpulan. Uji keabsahan data dilakukan dengan triangulasi sumber maupun metode. Hasil penelitian: Pertama, formulasi pengembangan pendidikan karakter berbasis kurikulum 2013 pada tiga sekolah dasar meliputi: rencana kerja sekolah, visi dan misi sekolah, master plan kurikulum. Kedua, implementasi pengembangan pendidikan karakter berbasis Kurikulum 2013 pada tiga sekolah dasar meliputi: struktur dan muatan kelompok mata pelajaran, rasionalisasi muatan pelajaran dan silabus, organisasi RPP dan silabus, KBM, pengukuran hasil, rapat dewan guru dan pertemuan KKG, guru membuat program semester dan tahunan. Pada tiga sekolah dasar melaksanakan pendekatan contextual teaching and learning (CTL), menekan prosentase absensi, disiplin, budaya senyum, salam, sapa, sopan dan santun (5 S), serta pelaksanaan 7 K, guru-guru mengembangkan budaya karakter, pengembangan diri dan budaya sekolah, mengintegrasikan silabus dan RPP, menyusun program implementasi, pelaksanaan, penilaian dan evaluasi, belajar aktif, berpusat pada siswa dan budaya positif. Pengaturan beban belajar, struktur dan muatan kurikulum, penugasan sesuai kompetensi dasar (KD), potensi, minat, dan bakat siswa, penerapkan kriteria ketuntasan minimal (KKM), kompetensi pengetahuan (kognitif) dan praktik (psikomotor). Pada SDN Karang Mekar 1: kompetensi karakter hidup teratur, prestasi, semboyan belajar, kemandirian, pembiasaan baik dan bertanggung jawab, menghargai, menghindari interogatif, mendorong alternatif dan semangat siswa, menyusun RPP, pengembangan alat dan media mengajar, penilaian, remedial dan pengayaan, pembiasaan hidup sehat, hidup bersih, penanaman nilai-nilai keagamaan, jujur, sopan dan beradab, pelaksanaan kegiatan pengembangan diri seperti Pramuka, PMR, drum band, maulid Habsyi, pengajian, khataman Al-qur’an, sholat zuhur berjamaah. Ketiga, pengendalian sekolah dasar pengembangan kurikulum pendidikan karakter berbasis Kurikulum 2013 pada tiga sekolah dasar dilaksanakan oleh kepala sekolah penanggung jawab, wakil kepala sekolah, para guru dan wali kelas, tata tertib siswa, kredit poin dan dokumen, membentuk tim penilai. Pada tiga sekolah dasar penanggungjawab kepala sekolah, wakil kepala sekolah, para guru, wali kelas dan komite sekolah/orang tua siswa, peraturan akademik, dan supervisi dari pengawas. Pada tiga sekolah dasar kepala sekolah sebagai penanggung jawab, wakil kepala sekolah, para guru dan wali kelas dan pengawas/pembina. Guru-guru menjabarkan RPP, pelaksanaan kegiatan belajar mengajar serta keteladanan setiap hari, menerapkan peraturan kerja. Keempat, resistensi dan mengatasi resistensi pengembangan pendidikan karakter pada tiga sekolah dasar dari sarana, strategi secara bergantian, memanfaatkan halaman dan lapangan, siswa sebagai model keteladanan, mendatangkan nara sumber, memanfaatkan semua guru dan wali kelas sebagai model, merancang program, waktu, kegiatan, peningkatan pengayaan, meningkatkan sumber daya manusia, melaksanakan pembinaan minat bakat siswa, pengadaan dan memanfaatkan sarana dan prasarana, menggalang dana dari pemerintah, masyarakat, donatur dan dunia usaha, review Kurikulum 2013 melalui KKG, meningkatkan pendidikan guru-guru, serta mengoptimalkan peran guru-guru, menata sarana dan prasarana pembelajaran ke arah penerapan karakter. Bekerjasama dengan instansi baik pemerintah maupun swasta sebagai pemberi materi ceramah agama maupun materi kesehatan, lingkungan dan peraturan-peraturan (hukum). Saran kepada Bagi sekolah-sekolah yang diteliti pada tiga sekolah dasar agar mengadakan workshop atau pelatihan tentang kurikulum pendidikan karakter dalam pengembangan kurikulum 2013 kepada semua guru. Bagi Dinas Pendidikan Kota Banjarmasin dan Dinas Pendidikan Provinsi Kalimantan Selatan membuat kebijakan tentang manajemen pendidikan karakter, melakukan pemetaan kesiapan pelaksanaan pendidikan karakter dengan membentuk Tim Pengembang Kurikulum, Bagi Kementerian Pendidikan Dasar dan Menengah Republik Indonesia membuat kebijakan tentang manajemen pengembangan pendidikan karakter melalui tim pengembang kurikulum 2013 dari pemerintah pusat untuk memberikan bimbingan dan pelatihan kepada satuan pendidikan di daerah-daerah di Indonesia mengenai bagaimana pelaksanaan kebijakan tentang manajemen sekolah dasar manajemen sekolah dasar dalam pengembangan pendidikan karakter berbasis kurikulum 2013.Demikian pula untuk peneliti lain dan pengembang ilmu manajemen pendidikan yang terus mengembangkan teori manajemen manajemen sekolah dasar dalam pengembangan pendidikan karakter berbasis kurikulum 2013.

Hubungan kepemimpinan transformasional kepala sekolah, kepuasan kerja guru, komitmen organisasi, dan Organizational Citizenship Behavior (OCB) dengan kinerja guru-guru Sekolah Dasar di Kota Banjarmasin / Aslamiah

 

ABSTRAK Aslamiah. 2015. Hubungan Kepemimpinan Transformasional Kepala Sekolah, Kepuasan Kerja, Komitmen Organisai, dan Organizational Citizenship Behavior (OCB) dengan Kinerja Guru Sekolah Dasar Negeri di Kota Banjarmasin. Disertasi, Program Studi Manajemen Pendidikan Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof.H.Ahmad Sonhaji K.H, M.A., Ph.D (II) Dr.H.Imron Arifin, M.Pd, dan (III) Drs.Ahmad Suriansyah, M.Pd., Ph.D Kata kunci: kepimpinan transformasional, kepuasan kerja, komitmen organisasi, organizational citizenship behavior (OCB), kinerja guru, sekolah dasar negeri Kinerja guru merupakan salah satu aspek yang menjadi perhatian semua orang, sehingga banyak pandangan baik positif maupun negatif terhadap kinerja guru karena terkait dengan profesionalisme seseorang. Oleh sebab itu kinerja guru harus menjadi prioritas untuk selalu dilakukan peningkatan oleh semua pemangku kepentingan termasuk kepala sekolah. Kepala sekolah memiliki peranan penting dan strategis di sekolah sebagai ujung tombak untuk meningkatkan kinerja guru. Hal ini dapat dilakukan melalui kepemimpinannya yang dapat menciptakan kepuasan kerja, komitmen organisasi dan membentuk Organizational Citizenship Behavior (OCB). Untuk itu penelitian ini akan menkaji tentang kinerja guru dan variabel-variabel yang di duga mempengaruhinya kepemimpinan trasnformasional kepala sekolah, kepuasan kerja, komitmen organisasi dan organizational citizenship behavior (OCB). Tujuan utama kajian ini adalah untuk menggambarkan persepsi guru-guru terhadap kepemimpinan transformasional kepala sekolah, kepuasan kerja, komitmen organisasi guru, OCB dan kinerja guru di sekolah-sekolah dasar di Banjarmasin, serta untuk mengetahui hubungan langsung maupun tidak langsung kepemimpinan transformasional kepala sekolah, kepuasan kerja, komitmen organisasi dan organizational citizenship Behavior (OCB) dengan kinerja guru sekolah dasar negeri di Banjarmasin. Penelitian ini menggunakan rancangan penelitian deskriptif korelasional. Jumlah sampel penelitian ini sebanyak 261 orang guru sekolah dasar di Kota Banjarmasin yang dipilih secara proportional random sampling. Instrumen MultifactorLeadership Questionnaire (MLQ) yang dikembangkan oleh Bass dan Avolio (2004) telah digunakan untuk mengukur kepimpinan transformasional kepala sekolah. Instrumen Organizational Commitment Questionnaire (OCQ) yang dikembangkan oleh Allen dan Meyer (1990) digunakan untuk mengukur komitmen guru-guru, dan alat ukur Teaching Satisfaction Scale (TSS) yang dikembangkan oleh Ho dan Au (2006) digunakan untuk mengukur kepuasan kerja guru. Sedangkan Organizational Citizenship Behavior (OCB) dan kinerja dikembangkan sendiri. Teknik analisis data menggunakan statistik deskriftif dan insferensial. Deskriptif data dianalsis menggunakan mean dan standar deviasi. Sedangkan inferensial menggunakan model persamaan struktural (Structural Equation Model/SEM) Berdasarkan hasil analisis statistik deskriptif diperoleh gambaran tingkat kepimpinan transformasional kepala sekolah adalah berada pada tahap sedang dengan mean 61.16, kepuasan kerja berada pada tingkat sedang dengan mean 16.87, komitmen organisasi guru-guru pada tingkat sedang dengan mean 73.01, demikian pula untuk OCB juga sedang dengan mean 89.74. hanya kinerja guru yang tergolong tinggi dengan mean 81.94. Hasil analisis SEM Amos menunjukkan sebagai berikut: 1) terdapat hubungan langsung kepemimpinan transformasional dengan kepuasan kerja, dan kepemimpinan transformasional dengan komitmen organisasi serta kepemimpinan transformasional dengan organizational citizenship behavior (OCB). 2) terdapat hubungan langsung kepuasan kerja dengan kinerja guru, dan komitmen organisasi dengan kinerja serta organizational citizenship behavior (OCB) dengan kinerja. 3) terdapat hubungan tidak langsung kepemimpinan transformasional dengan kinerja melalui komitmen organisasi, dan hubungan tidak langsung kepemimpinan transformasional dengan kinerja melalui komitmen organisasi serta hubungan tidak langsung kepemimpinan transformasional dengan kinerja melalui organizational citizenship behavior (OCB). Implikasi teoritis dari hasil penelitian ini menjustifikasi teori-teori dasar yang dikembangkan oleh para ahli yang digunakan sebagai dasar dalam pengujian model penelitian ini, sehingga semua hasil analisis hubungan antar variabel yang ditemukan penelitian ini mendukung teori dan hasil penelitian yang dikembangkan terdahulu. Secara praktis hasil penelitian ini memberikan masukan untuk merumuskan kebijakan kepada berbagai pemangku kepentingan dalam meningkatkan kinerja guru, melalui peningkatan kompetensi kepemimpinan transformasional, kepuasan kerja, komitmen organisasi dan organizational citizenship behavior (OCB). Berdasarkan hasil penelitian ini maka disarankan kepada beberapa pihak yaitu dinas pendidikan baik Kabupaten maupun Provinsi serta Direktorat Pembinaan Sekolah Dasar agar membina kepala sekolah dan meningkatkan kompetensi dan profesionalisme kepemimpinannya khususnya dalam implementasi kepemimpinan transformasional. Bagi guru hasil penelitian ini memberikan masukan tentang tingkat kepuasan kerja, komitmen organisasi dan kinerjanya sehinga dapat dijadikan dasar untuk lebih meningkatkan dan mengembangkan lagi ke depan. Sedangkan bagi pengembang ilmu manajemen pendidikan dan peneliti lainnya disarankan untuk melakukan kajian yang lebih mendalam dan lebih luas dengan menggunakan pendekatan dan strategi yang berbeda.

Peranan pembangunan sektor pariwisata dalam peningkatan pendapatan asli daerah (PAD) Kota Batu / Feny Novianti Nur Hidayah

 

Kata Kunci: Pembangunan Sektor Pariwisata, Pendapatan Asli Daerah Indonesia telah lama mencanangkan adanya suatu gerakan pembangunan nasional yang merupakan suatu gerakan nasional yang bertujuan untuk meningkatkan kesejahteraan rakyat Indonesia. Hal ini dapat dicapai apabila pemerintah meningkatkan pendapatannya baik dari dalam negeri ataupun luar negeri. Salah satu komponen pembangunan daerah adalah pembangunan pariwisata. Pembangunan pariwisata secara umum diarahkan pada peningkatan sektor pariwisata menjadi sektor andalan yang mampu menggerakkan kegiatan ekonomi. Dimana sektor pariwisata juga merupakan sektor yang sangat terbuka untuk terciptanya lapangan kerja, naiknya pendapatan masyarakat, pendapatan daerah dan pendapatan negara. Dengan adanya pembangunan pariwisata ini diharapkan akan meningkatkan Pendapatan Asli Daerah. Hal ini dikarenakan PAD merupakan pendapatan yang di kelola oleh Pemerintah Daerah. Selain adanya kesiapan dari dari pihak pemerintah, diharapkan juga adanya kesiapan dari warga masyarakat disekitar obyek pariwisata pada khususnya, dan juga adanya kesiapan dari warga masyarakat Kota Batu pada umumnya. Diharapkan dengan adanya dukungan dari warga masyarakat Kota Batu dalam kegiatan sektor pariwisata akan semakin menunjang keberhasilan program pemerintah menjadikan Kota Batu sebagai sentra wisata. Penelitian ini bertujuan untuk menganalisis strategi, kebijakan strategis dan upaya yang dilakukan Dinas Pariwisata dan Kebudayaan dalam pembangunan sektor pariwisata di Kota Batu, peranan sektor pariwisata terhadap peningkatan Pendapatan Asli Daerah (PAD) Kota Batu, dan kesiapan warga masyarakat dalam menghadapi dan mengembangkan pembangunan sektor pariwisata Kota Batu. Penelitian ini menggunakan metode deskriptif dengan pendekatan Kualitatif, dimana penelitian ini dilakukan di Kota Batu dengan data yang digunakan adalah data primer dan data sekunder. Jenis penelitian ini adalah studi kasus. Teknik pengumpulan data menggunakan observasi, wawancara dan dokumentasi. Pengecekan keabsahan temuan diuji menggunakan perpanjangan keikut sertaan, ketekunan pengamatan, dan triangulasi. Analisis data menggunakan reduksi data atau merangkum data, display data atau penyajian data, dan verifikasi data atau menyimpulkan data. Dari paparan data dan temuan penelitian, bahwa yang menjadi sasaran sasaran dari kebijakan di sektor pariwisata antara lain seperti kelompok seni budaya, kelompok industri kerajinan, pengusaha hotel dan restoran, kelompok masyarakat, pengusaha jasa angkutan dan hiburan, generasi muda dan pasar wisata. Sedangkan kebijakan yang dilakukan oleh Dinas Pariwisata dan kebudayaan Kota Batu dalam pembangunan sektor pariwisata yaitu (i) dengan membina kemitraan antara pemerintah dengan pihak swasta, (ii) membentuk jaringan kerjasama dengan industri pariwisata, pemerintah, perusahaan perniagaan dan lembaga ikatan profesional, (iii) meningkatkan kemampuan sumber daya manusia, (iv) meningkatkan kesadaran masyarakat tentang sadar wisata/sapta pesona, memasarkan potensi Obyek Daya Tarik Wisata (ODTW) dan seni budaya, (v) mengikut sertakan industri pariwisata dalam kegiatan promosi, (vi) melaksanakan pengamanan bagi keselamatan wisatawan dan pelaku pariwisata, (vii) menyusun rencana induk pengembangan pariwisata dan mengesahkannya dengan Perda, (viii) Memudahkan pelayanan di Bidang Pariwisata, serta (ix) Meningkatkan pembinaan terhadap seniman dan seniwati dalam kaitan pelestarian budaya lokal serta nilai – nilai tradisional / adat. Selain itu, ada banyak usaha yang dilakukan oleh Dinas Pariwisata dan Kebudayaan Kota Batu dalam meningkatkan kunjungan wisatawan baik dari dalam maupun luar negeri diantaranya dengan membuat Branding, melalui website resmi Pemerintah Kota Batu, promosi ke daerah-daerah, melalui Booklit, menjadi narasumber di berbagai acara, dan lain-lain. Selain promosi juga ada usaha lain yaitu melakukan kerjasama dengan daerah lain untuk mempromosikan sektor pariwisata Kota Batu, membangun faktor internal sumber daya manusia pelaku pariwisata, menjadikan desa wisata sebagai daerah tujuan wisata dan lain sebagainya. Sedangkan untuk peranan pembangunan pariwisata pada PAD menyumbang rata-rata sebesar 38,38 persen. Dengan kata lain, rata-rata sektor pariwisata menyumbang sebesar Rp 4.233.654.958,7 pada Pendapatan Asli Daerah Kota Batu yang sebesar Rp 11.030.888.376 per tahun. Untuk peran serta masyarakat dalam mendukung Kota Batu sebagai Kota Wisata sangatlah diperlukan. Jadi kesiapan menyongsong Kota Batu sebagai Kota Wisata tidak hanya dikalangan pemerintah saja. Akan tetapi juga warga masyarakat Kota Batu itu sendiri juga mendukung. Dari penelitian yang telah dilakukan di tiga tempat, yakni Desa Sisir, Desa Oro-Oro Ombo dan juga Desa Sidomulyo bisa dikatakan siap untuk mendukung pemerintah dalam mewujudkan Kota Batu sebagai Kota Wisata. Jadi dapat disimpulkan bahwa peranan sektor pariwisata pada Pendapatan Asli Daerah Kota Batu memiliki peranan yang cukup besar jika dibandingkan dengan sektor lainnya. Dengan adanya hal tersebut menunjukkan bahwa pembangunan sektor pariwisata mempunyai pengaruh yang penting dalam menyumbang naiknya PAD. Beberapa saran masih diperlukan untuk meningkatkan pendapatan dari sektor pariwisata diantaranya dengan menggali sumber pendapatan sektor pariwisata yang lain diantaranya seperti spa, salon, rental Play Station, warnet, gedung olahraga, dan lain-lain. Sedangkan untuk meningkatkan kesadaran masyarakat akan pentingnya pariwisata dengan mensosialisasikan Program Sadar Wisata pada semua warga Kota Batu sehingga diharapkan POKDARWIS (Kelompok Sadar Wisata) tiap desa akan bisa memaksimalkan potensi-potensi di desanya masing-masing dengan keunikan yang mereka miliki.

Penerapan pendekatan proses dengan pemanfaatan lingkungan sekitar untuk meningkatkan keterampilan menulis deskripsi siswa kelas IV SDN Permisan Jabon / Syarifatul Umariyah

 

Kata kunci: menulis deskripsi, lingkungan sekitar, pendekatan proses, sekolah dasar Permasalahan keterampilan menulis deskripsi siswa yang rendah tidak terjadi di satu jenjang sekolah saja tetapi terjadi di Sekolah Dasar (SD), Sekolah Menengah Pertama (SMP), dan Sekolah Menengah Atas (SMA). Salah satu sekolah tersebut yaitu Sekolah Dasar Negeri (SDN) Permisan Jabon. Hasil yang dicapai oleh siswa dalam menulis deskripsi masih di bawah Kriteria Ketuntasan Minimal (KKM). Setelah guru melaksanakan pembelajaran menulis deskripsi yang menerapkan pendekatan proses dengan pemanfaatan lingkungan sekitar, keterampilan siswa dalam menulis deskripsi semakin meningkat baik pada siklus I maupun siklus II. Dari hasil pengamatan/observasi dapat diketahui penyebabnya yaitu kurangnya pemanfaatan lingkungan sekitar sebagai upaya untuk meningkat- kan keterampilan deskripsi siswa. Di samping itu penyebab yang lain adalah kurangnya pemahaman siswa tentang tahap-tahap menulis deskripsi. Tujuan dari penelitian ini adalah untuk mengetahui kegiatan pembelajaran menulis yang menerapkan pendekatan proses dengan pemanfaatan lingkungan sekitar dan peningkatan keterampilan menulis deskripsi siswa kelas IV SDN Permisan Jabon. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) dengan prosedur penelitian: perencanaan, pelaksanaan, pengamatan, dan refleksi. Kegiatan yang dilaksanakan dalam penelitian ini berdasarkan pada pendekatan proses menulis yaitu pra menulis, pemburaman, perbaikan/revisi, penyuntingan/pengeditan, dan publikasi. Pada pra tindakan siswa dari kelompok tinggi memperoleh skor rata-rata sebesar 66,3, kelompok sedang sebesar 50, dan kelompok rendah sebesar 38,7. Pada siklus I skor rata-rata siswa dari kelompok tinggi adalah 78, kelompok sedang sebesar 66,3, dan kelompok rendah sebesar 41,7. Pada siklus II perolehan skor rata-rata siswa dari kelompok tinggi adalah 86,3, kelompok sedang sebesar 79, dan kelompok rendah sebesar 71,7. Simpulan dari penelitian ini adalah bahwa penerapan pendekatan proses dengan pemanfaatan lingkungan sekitar dapat meningkatkan keterampilan menulis deskripsi dan prestasi belajar siswa kelas IV SDN Permisan Jabon. Oleh karena itu untuk meningkatkan keterampilan menulis deskripsi dan prestasi belajar siswa SD disarankan agar dapat memanfaatkan lingkungan sekitar sebagai media pembelajarannya melalui pendekatan proses menulis.

Pengembangan simulasi komputer berbasis pendekatan saintifik sub materi peredaran darah manusia kelas VIII / Rinda Annisaa

 

ABSTRAK Annisaa, Rinda. 2015. PengembanganSimulasiKomputerBerbasisPendekatanSaintifik Sub MateriPeredaranDarahManusiaKelas VIII.Skripsi, JurusanBiologi, FakultasMatematikandanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: (I) Dr. EndangSuarsini, M.Ked., (II) Dra. Hj. Susilowati, M.S. Kata kunci: SimulasiKomputer, PendekatanSaintifik, danPeredaranDarahManusia Dalam proses pembelajaran, konsepmerupakanhal yang perludipahami, dipelajari, dandikuasaiolehpesertadidik. Konsep-konsep yang dimilikiolehpesertadidikbergunasebagaidasarpengetahuanaturan-aturan yang relevandalammemecahkanmasalah yang dihadapiolehpesertadidiktersebut.Akan tetapi, seorangpesertadidiktidakselaludapatmemahami, mempelajaridanmenguasaikonsepdenganbaik.Berdasarkanhasilobservasiterhadap 29 pesertadidikkelas IX SMPN 9 Kota Malang, diketahuiterdapatbeberapamiskonsepsipesertadidikterhadap sub materiperedarandarahmanusia. Miskonsepsitersebutdapatdiatasidenganpenggunaanmedia danpendekatanpembelajaran yang tepat.Tujuanpenelitianiniadalahuntukmenghasilkansimulasikomputerberbasispendekatansaintifik yang valid, praktis, danefektifdalammeningkatkantingkatpemahamanpesertadidik. Pengembanganinimenggunakan model pengembanganSadiman (2002).Tahappertamayaitumengidentifikasikebutuhan.Tahapkeduayaitumerumuskantujuanpengembangan.Tahapketigayaitumerumuskanbutirmateri.Tahapkeempatyaitumerumuskanalatpengukurkeberhasilan.Tahapkelimayaitumenuliskannaskah media.Tahapkeenammelakukanvalidasikepadaahlimateri, ahli media, danpraktisipendidikansertaujicobaperorangan, kelompokkecil, danlapangan di SMPN 9 Malang.Data yangdiperolehmerupakandata kualitatifberupakomentardan saran paraahlidanpesertadidikpadatigatahapujicoba. Data kuantitatifberupanilaikelayakan media dari validator, nilaipretestdanpostestyang dilengkapidengan CRI sertalembarpenilaianpesertadidikterhadap media. Hasilpenelitianinimenunjukkanbahwasimulasikomputer yang dikembangkanmerupakan media yang valid berdasarkanvalidasiahlimateri, media, danpraktisipendidikandenganskor98%, 98%, dan 100%. Simulasikomputerjugapraktisdigunakandalampembelajaran, terlihatdariresponpesertadidikpadatigatahapujicoba, yakniujicobaperorangandenganskor98%, ujicobakelompokkecil 88%, danujicobalapangan 93%.Simulasikomputerefektifuntukmeningkatkantingkatpemahamanpesertadidikberdasarkanpenghitungannilai CRI pretest danposttestpesertadidikpadaujicobaperorangansebesar 62%, ujicobakelompokkecilsebesar 77%, danujicobalapangansebesar 92%.

Pembuatan busana pesta wanita dengan teknik patchwork / Aziiza Fitria Fadhilla

 

ABSTRAK Fadhilla, Aziiza, Fitria. 2015. Pembuatan Busana Pesta Wanita dengan Teknik Patchwork. Tugas Akhir, Teknologi Industri, Program Studi Diploma III Tata Busana, Fakultas Teknik, Universitas Negeri Malang. Pembimbing (I) Dra. Idah Hadijah, M.Pd, (II) Dra. Endang Prahastuti, M.Pd, Kata Kunci:TeknikPatchwork, Busana Pesta TeknikPatchwork merupakanteknik menyatukan potongan-potongan kain perca menjadi kain yang lebih besar melalui jahitan. meski pengerjaannya lebih sederhana dibanding teknik bordir, menyatukan potongan kain perca membutuhkan kreativitas yang tinggi agar dapat menghasilkan motif baru yang menarik.Menentukan bentuk potongan yang akan dipakai sebagai penghubung antar bentuk patchwork sangat dibutuhkan sebelum pembuatan pola dilakukan. “Busana pesta wanita dengan teknikpatchwork”merupakan jenis busana pesta yang diadakan di malam hari. Pemilihan warna menggunakan warna dingin yang bersumber dari warna biru dan abu-abu, untuk memberikan tampilan busana terlihat segar dan ceria. Bahan utama busana menggunakan jenis bahan kain satin duchess, kain organza, kain shantung, kainpoliester, dan kain chenille. Tujuan penulisan Tugas Akhir yang akan dihasilkan adalah: (1) memperkenalkan produk “busana pesta wanita dengan teknikpatchwork”, (2) menjabarkan proses “pembuatan busana pesta wanita dengan teknikpatchwork”, dan (3) memberikan informasi terhadap “pembuatan busana pesta wanita dengan teknikpatchwork”. Rangkaian proses pembuatan “busana pesta wanita dengan teknikpatchwork”memiliki beberapa tahap sebagai berikut: pembuatan desain, pengambilan ukuran, pembuatan draft busana, pembuatan pola dan pecah pola busana, rancangan bahan dan harga, langkah kerja menjahit busana, finishing busana, dan perawatan busana. Kesimpulan dalam “pembuatan busana pesta wanita dengan teknik patchwork diantaranya adalah: tahap penyambungan setiap potongan pada teknikpatchwork membutuhkan ketelatenan agar setiap potongan patchwork sesuai dengan pola bagian rok pias 6 modifikasi, bahan utama pada bagian potongan rok pias modifikasi diberikan tambahan lapisan M32 agar sifat bahan utama menjadi kaku, dan pemilihan kerangka dari bahan rotan pada bagian dalam rok pias 6 modifikasi bertujuan agar membentuk bagian rok pias modifikasi saat digunakan.

Pelabuhan dan masyarakat Penarukan (1890-1957) / Ardi Syahrial

 

ABSTRAK Syahrial, Ardi. 2015. Pelabuhan dan Masyarakat Panarukan. Skripsi. Jurusan Pendidikan Sejarah FIS Univesitas Negeri Malang. Pembimbing: Dr. R. Reza Hudiyanto, M. Hum. Kata kunci: Pelabuhan, Panarukan, Masyarakat Pelabuhan Panarukan dikembangkan oleh seorang Ondenemer atau pemilik perkebunan terkemuka di kawasan Besuki yakni George Birnie pada tahun 1890-an dengan nama Maactschappij Panaroekan. Peranan Pelabuhan Panarukan menimbulkan dampak terhadap kehidupan masyarakat Panarukan baik dari aspek sosial maupun aspek ekonomi. Masyarakat di daerah Panarukan mayoritas bersifat heterogen. Pemukiman suku-suku bangsa pribumi maupun bangsa asing tumbuh dan telah berkembang di daerah Panarukan. Pelabuhan Panarukan mengalami kemerosotan setelah diambil alih oleh Pemerintah Indonesia. Adapun rumusan masalah dalam penelitian ini adalah: (1) Bagaimana latar belakang daerah Panarukan?; (2) Bagaimana pembangunan Pelabuhan Panarukan?; (3) Bagaimana dampak Pelabuhan Panarukan terhadap masyarakat? Metode penelitian ini menggunakan metode kepustakaan yang merupakan pengumpulan data atau bahan yang diperoleh dari buku-buku kepustakaan yang berhubungan dengan penelitian baik tempat ataupun tahun kejadian. Hasil penelitian menunjukkan bahwa (1) Panarukan merupakan daerah kekuasaan Kerajaan Blambangan yang kemudian direbut oleh Adipati Pasuruan dan VOC. Nama Panarukan berasal dari kata Penarukan yang artinya sebagai tempat menaruh barang dagangan milik bangsa Eropa. (2) Pelabuhan Panarukan dimodernisasikan oleh seorang pengusaha yaitu George Birnie dengan nama Maatschappij Panaroekan pada tahun 1886 dengan tujuan sebagai komite perdagangan dan pengoperasian gudang dan perahu. Tujuannya adalah untuk melancarkan pengiriman tembakau ke Belanda. Pemerintah Belanda juga membangun jalur rel kereta api untuk melancarakan usaha pengangkutan hasil bumi dari pedalaman menuju Pelabuhan Panarukan dengan cepat dan murah. Fungsi Pelabuhan Panarukan semakin merosot pada saat Pemerintah Indonesia mengambil alih perusahaan-perusahaan swasta milik Belanda dengan dasar nasionalisasi. (3) Profesi penduduk Panarukan sangat mendukung terhadap perkembangan Pelabuhan Panarukan. Profesi penduduk Panarukan memudahkan kegiatan ekonomi, karena penduduk Panarukan berperan sebagai penyedia dan penggerak hasil bumi yang dibutuhkan oleh Pemerintah Belanda ataupun pedagang pribumi. Pada masa kemerdekaan Pelabuhan Panarukan mengalami kemerosotan karena kurangnya perawatan dari pemerintah. Saran diberikan kepada Pemerintah Kabupaten Situbondo agar melakukan tindakan terhadap Pelabuhan Panarukan. Sedangkan untuk masyarakat Panarukan diharapkan dapat menjaga dan melstarikan peninggalan-peninggalan yang ada di Pelabuhan Panarukan.

Pendidikan politik di pondok pesantren Wali Songo Kecamatan Panji Kabupaten Situbondo / Deddy Hermawan Caputra

 

Kata kunci: pendidikan, politik, pondok pesantren Pendidikan politik yang biasa dilakukan sebagai proses pembinaan kesadaran warga negara dalam melaksanakan hak dan kewajiban perlu disosialisasikan kepada warga negara Indonesia, termasuk di kalangan pondok pesantren. Usaha sosialisasi nilai politik bangsa Indonesia secara sadar dilakukan oleh berbagai organisasi pergerakan jauh sebelum masa kemerdekaan dengan tujuan untuk memperoleh hak politik yang dirampas oleh penjajah. Upaya tersebut terus berlangsung secara alamiah menjadi sikap politik menentang penjajah melalui peningkatan kemampuan berorganisasi dibidang politik. Penelitian ini bertujuan untuk mengetahui pendidikan politik di Pondok Pesantren Wali Songo. Secara khusus penelitian ini bertujuan untuk mengetahui (1) Upaya yang dipersiapkan oleh pengurus Pondok Pesantren Wali Songo dalam penyelenggaraan pendidikan politik para santri, (2) Bentuk kegiatan Pondok Pesantren Wali Songo yang mencerminkan pelaksanaan pendidikan politik, (3) Faktor-faktor yang mempengaruhi proses pendidikan politik di Pondok Pesantren Wali Songo, (4) Dampak implementasi pendidikan politik, terutama dalam partisipasi politik para santri Pondok Pesantren Wali Songo. Pendekatan yang digunakan dalam penelitian adalah pendekatan kualitatif dan untuk jenis penelitiannya adalah mengacu pada strategi observasi, dokumentasi, wawancara dan partisipasi ke dalam aktivitas mereka yang akan diselidiki. Sedangkan untuk analisis data yang digunakan dalam penelitian ini adalah analisis data model interaktif. Hasil penelitian ini menunjukkan bahwa upaya-upaya yang perlu dilakukan untuk menunjang pendidikan politik di Pondok Pesantren Wali Songo mengacu pada tiga hal yaitu (1) pendidikan formal, (2) pendidikan informal, (3) aplikatif. Kegiatan di Pondok Pesantren Wali Songo yang mencerminkan proses pendidikan politik antara lain (a) Kegiatan pembelajaran Pendidikan dan Kewarganegaraan di sekolah tingkat MTS maupun MA, (b) Kegiatan dakwah yang diberikan oleh kyai, (c) Pengajian rutin mengenai Pancasila dan Keorganisasian. Faktor-faktor yang mempengaruhi proses pendidikan politik di Pondok Pesantren Wali Songo, yaitu (1) Faktor pendukung, meliputi: (a) Kebijakan Kyai, (b) Organisasi dan manajemen yang baik, (c) Sarana dan prasarana, (d) Sosial budaya, serta (e), Partisipasi masyarakat. Sedangkan (2) Faktor penghambatnya, yaitu: (a) SDM, (b) anggaran pendidikan, serta (c) tenaga pendidikan. Dampak implementasi pendidikan politik di Pondok Pesantren Wali Songo yaitu (a) Intern. Implementasi dari pendidikan politik dalam ruang lingkup pesantren terwujud dalam hal pemilihan pengurus OSIM (Organisasi Siswa Intra i Madrasah) yang dilaksanakan oleh santri setiap tahunnya, (b) Ekstern. Dampak implementasi ini ruang lingkupnya langsung ke masyarakat. Berdasarkan hasil penelitian ini, disarankan untuk (1) untuk memperoleh hasil yang maksimal dalam proses pendidikan politik, terutama dalam kegiatan pengajian rutin mengenai Pancasila dan Keorganisasian, sebaiknya dibuat suatu kurikulum dan silabus kegiatan supaya siswa mengerti tentang materi yang akan disampaikan, (2) untuk mencapai hasil yang maksimal dalam proses pendidikan politik, seyogyanya Pondok Pesantren Wali Songo menambahkan insentitas pertemuan pada pengajian rutin Pancasila misalnya yang mulanya satu minggu satu kali menjadi satu minggu dua kali, (3) guna menumbuhkan partisipasi politik santri sebaikya ditekankan pada santri bahwa partisipasi politik bukan hanya untuk memperoleh kekuasaan saja melainkan lebih kepada bagaimana santri menjalankan hak dan kewajibannya sebagai warga negara Indonesia yang baik, (4) guna meningkatkan nasionalisme santri sebaikya pandangan Pondok Pesantren Wali Songo mengenai Pancasila dan hasil Mukhtamar NU ke-27 tentang Asas Tunggal Pancasila dipampang di setiap ruangan Pondok Pesantren Wali Songo.

Penerapan permainan kartu kata bergambar untuk meningkatkan keterampilan membaca dan menulis di kelas I tema 1 SDN Dinoyo 4 Kota Malang / Suranto Hariadi

 

ABSTRAK Hariadi, Suranto. 2015. Penggunaan Permainan Kartu Kata Bergambar untuk Meningkatkan Keterampilan Membaca dan Menulis Siswa Kelas I Tema I SDN Dinoyo 4. Skripsi. Program S1 PGSD, Jurusan Kependidikan Sekolah Dasar dan Prasekolah Universitas Negeri Malang. Pembimbing (1) Drs. Rumidjan, M.Pd (2) Drs. Achmad Taufik, M.Pd. Kata kunci: permainan, kartu kata bergambar, membaca, menulis kalimat, SD Keterampilan membaca dan menulis penting pada era globalisasi. Dalam dunia pendidikan, keterampilan membaca dan menulis dibutuhkan untuk mempelajari mata pelajaran lain, sedangkan dalam kehidupan bermasyarakat dibutuhkan untuk bersosialisasi. Karena itulah keterampilan membaca dan menulis perlu mendapat perhatian khusus di sekolah. Hasil orientasi di lapangan pada tanggal 12 Januari 2015 dan informasi dari wali kelas I SDN Dinoyo 4 yang sekaligus sebagai guru bidang studi, siswa kelas I SDN Dinoyo 4 umumnya mengalami kesulitan dalam membaca dan menulis; guru kesulitan dalam memilih, menata materi pelajaran; guru belum pernah menggunakan permainan kartu kata bergambar dalam pembelajaran membaca dan menulis. Untuk meningkatkan keterampilan membaca dan menulis di SD perlu digunakan metode dan teknik pembelajaran yang menarik, yaitu dengan permainan kartu kata bergambar. Penelitian ini bertujuan untuk (1) mendesripsikan bagaimana memilih, menata, dan merepresentasikan materi membaca dan menulis di kelas I SDN Dinoyo 4 dengan menggunakan kartu kata bergambar (2) mendeskripsikan penggunaan permainan kartu kata bergambar dalam pembelajaran membaca dan menulis siswa kelas I SDN Dinoyo 4 (3) mendeskripsikan bagaimana meningkatkan keterampilan membaca dan menulis di kelas I SDN Dinoyo 4 dengan menggunakan permainan kartu kata bergambar. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) model kolaboratif, yaitu kerjasama antara peneliti dengan guru kelas. Keterlibatan kelas dalam proses pembelajaran mencapai 70% pada siklus 1 dan 95% pada siklus II. Keterampilan membaca kelas mencapai 75% pada siklus 1 dan 95% pada siklus II dengan peningkatan sebesar 13%. Keterampilan menulis kelas mencapai 80% pada siklus 1 dan 95% pada siklus II dengan peningkatan sebesar14%. Dari penelitian ini dapat disimpulkan bahwa penggunaan permainan kartu kata bergambar dapat meningkatkan keterampilan membaca dan menulis siswa serta memberikan nuansa belajar yang menyengkan. Melalui kartu kata bergambar siswa dapat membuat 5 kalimat sederhana dan membuat cerita sederhana. Saran kepada guru, dalam mengajar hendaknya tidak sekedar mengajarkan buku dan menggunakan teknik pembelajaran yang monoton melainkan lebih cermat dalam memilih, menata, dan merepresentasikan materi pembelajaran.

Hubungan bakat mekanik dan motivasi belajar dengan hasil belajar mata pelajaran chasis dan pemindah tenaga siswa kelas XI Teknik Kebdaraan Ringan di SMK Negeri 1 Purwosari / Saipul Bahri

 

ABSTRAK Bahri, Saipul. 2015. HubunganBakatMekanik Dan MotivasiBelajarDenganHasilBelajar Mata PelajaranChasis Dan PemindahTenagaSiswaKelas XI TeknikKendaraanRingan Di SMK Negeri 1 Purwosari.Skripsi, Program StudiPendidikanTeknikOtomotif, UniversitasNegeri Malang. Pembimbing: (1) Drs. Partono, M.Pd., (II) Drs. Ir. Mustaman, M.Pd. Kata Kunci: BakatMekanik, MotivasiBelajar, HasilBelajar Penelitianinidilakukandalamrangkameningkatkanmutukualitaskejuruan, hasilbelajaradalahsalahsatuindikatormutlak. secaragarisbesaradaduafaktor yang mempengaruhihasilbelajarsiswayaitufaktor intern danfaktorekstern. bakatmekanikdanmotivasibelajaradalahsalahsatucontohdarikeduafaktortersebut yang mungkindapatmempengaruhihasilbelajar. Penelitianinimenggunakanpendekatankuantitatifdalammengujihipotesis. Rancangan penelitian ini menggunakan rancangan penelitiandeskriptifdankorelasional. Populasidalampenelitianiniadalahsiswakelas XI TKR SMK Negeri 1 Purwosarisebanyak 37 siswa. Metodepengambilan data yang digunakanadalahpenyebarantes, angket, dandokumentasi. Berdasarkanhasilanalisis data, diketahuibakatmekanikmemilikihubungandenganhasilbelajar. Hal inijikabakatmekaniktinggimakahasilbelajarnya pun jugatinggi. Sedangkanmotivasibelajarmemilikihubungandenganhasilbelajar, semakintinggimotivasibelajarsiswamakahasilbelajarnya punjugatinggi. Hasilanalisisberikutnya (1) secaraparsialadahubunganpositifdansignifikanantarabakatmekanikdenganhasilbelajarmatapelajaranchasisdanpemindahtenagasiswakelas XI TKR SMK Negeri 1 Purwosari, halinidibuktikandarihasilanalisismenggunakan program komputerdidapattarafsignifikansinyayaitu 0,000 < 0,05. Artinyaadahubungan yang signifikan. (2) secaraparsialadahubunganpositifdansignifikanantaramotivasibelajardenganhasilbelajarmatapelajaranchasisdanpemindahtenagasiswakelas XI TKR SMK Negeri 1 Purwosari, halinidibuktikandarihasilanalisismenggunakan program komputerdidapattarafsignifikansinyayaitu 0,000 < 0,05. Artinyaadahubungan yang signifikan. (3) secarasimultanadahubunganpositifdansignifikanantarabakatmekanikdanmotivasibelajarsiswadenganhasilbelajarmatapelajaranchasisdanpemindahtenagasiswakelas XI TKR SMK Negeri 1 Purwosari, halinidibuktikandarihasilanalisismenggunakan program komputerdidapattarafsignifikansinyayaitu 0,000 < 0,05. Artinyaadahubungan yang signifikan. Berdasarkanhasilpenelitian, dapatdisimpulkanbahwaterdapathubungan yang positifantarabakatmekanikdanmotivasibelajardenganhasilbelajarmatapelajaranchasisdanpemindahtenagasiswakelas XI TKR SMK Negeri 1 Purwosari. Dengandemikianuntukmenjadikansiswaberprestasidibidangnya, perludilakukanpeningkatanbakatmekanikdanmotivasibelajarnya yang dibinaoleh guru.

Hubungan antara kemampuan membaca permulaan dan prestasi belajar siswa kelas II SDN Ciptomulyo IV Malang tahun ajaran 1994/1995 / oleh Salam

 

Hubungan antara pengalaman dan pemahaman beragama dengan kecemasan menjelang masa pensiun pada pegawai negeri sipil pemerintah Kota Pasuruan / Af'illah Vega Oktarima

 

Kata kunci: Pengalaman dan Pemahaman Beragama, Kecemasan, Pensiun. Pengalaman dan pemahaman beragama, ialah pengalaman bertingkahlaku sesuai dengan pemahaman mengenai agama, dalam bentuk perasaan dan fikiran diri dalam hubungannya dengan Tuhan yang bertujuan untuk meningkatkan taraf keimanan seseorang. Kecemasan menjelang pensiun ialah suatu respon yang tidak rasional ditunjukkan individu akibat terjadinya tekanan yang bersifat fisik maupun mental akibat ketakutan terhadap bahaya yang nyata atau tidak nyata, dan atau bahaya yang belum, sedang dan akan terjadi sebagai konsekuensi dari pensiun. Saat seseorang merasa cemas akan suatu hal yang mengancam dirinya, ia menggunakan pemahaman agamanya untuk lebih mendekatkan diri kepada Tuhan dan melakukan usaha-usaha positif yang bisa mendatangkan ketenangan, ketentraman, dan kedamaian dalam dirinya. Penelitian ini bertujuan untuk: (1) Mengetahui pengalaman dan pemahaman beragama para pegawai negeri sipil saat menjelang masa pensiun, (2) Mengetahui tingkat kecemasan para pegawai negeri sipil menjelang masa pensiun, (3)Mengetahui hubungan antara pengalaman dan pemahaman beragama dengan kecemasan pegawai negeri sipil menjelang masa pensiun. Subyek penelitian adalah seluruh Pegawai Negeri Sipil di Pemerintahan Kota Pasuruan yang akan pensiun di tahun 2011. Data penelitian diperoleh dengan menggunakan dua skala yaitu Skala Pengalaman dan pemahaman beragama dan Skala Kecemasan. Teknik analisis data yang digunakan adalah Analisis Deskriptif, sedangkan untuk mengetahui hubungan antara Pengalaman dan pemahaman beragama dengan Kecemasan adalah Analisis Korelasional Product Moment. Hasil Penelitian menunjukkan bahwa sebanyak 37 orang (92,5 %) memiliki pengalaman dan pemahaman beragama tinggi, 3 orang (7,5 %) memiliki pengalaman dan pemahaman beragama sedang, dan tidak ada yang memiliki pengalaman dan pemahaman beragama rendah. Serta sebanyak 0 % atau tidak ada yang memiliki kecemasan tinggi, 6 orang (15 %) memiliki kecemasan sedang, dan 34 orang (85 %) memiliki kecemasan rendah. Hasil penelitian korelasional Product Moment dari Karl Pearson terhadap 40 orang didapatkan nilai rxy = -0,427 dan Probabilitas error (sig.) yaitu sebesar 0,006. Karena nilai probabilitas error < 0,05 yakni 0,006, dan r hitung -0,427 (negatif). Hal ini berarti ada hubungan yang signifikan antara pengalaman dan pemahaman beragama (x) dengan kecemasan menjelang pensiun (y) pada pegawai negeri sipil Pemerintahan Kota Pasuruan diterima. Berdasarkan penelitian tersebut peneliti menyarankan kepada beberapa pihak yaitu: (1) Bagi pegawai pegeri sipil yang akan pensiun dan memiliki tingkat pengalaman dan pemahaman beragama sedang agar lebih meningkatkan pemahaman beragamanya. Sedangkan bagi pegawai yang memiliki pengalaman dan pemahaman beragama tinggi diharapkan untuk tetap memelihara kebiasaan baiknya. (2) Bagi Pemerintah Kota Pasuruan sebagai lembaga yang menaungi Pegawai Negeri Sipil supaya membuat suatu kegiatan secara rutin bagi PNS yang akan pensiun yang bersifat keagamaan, pelatihan wirausaha, manajemen stres yang bertujuan untuk mengurangi kecemasan yang ditimbulkan oleh datangnya pensiun. (3) Bagi penelitian selanjutnya diharapkan mengembangkan penelitian ini dengan menggunakan variabel lain atau dengan menggunakan metode yang lain.

Penerapan metode cooperative learning model pembelajaran snowball throwing untuk meningkatkan hasil belajar siswa pada mata pelajaran memahami prinsip penyelenggaraan administrasi perkantoran (studi pada kelas X APK SMK Negeri 1 Jombang) / Atik Dwi Wahyuni

 

Kata kunci: Model Snowball Throwing, Hasil Belajar, PTK. Berdasarkan hasil pengamatan awal, wawancara guru dan siswa menunjukkan bahwa selama ini guru yang mengajarkan mata pelajaran Memahami Prinsip-Prinsip Penyelenggaraan Administrasi Perkantoran kelas X APK belum pernah menggunakan model Snowball Throwing dalam mengajar di SMK Negeri 1 Jombang. Pada saat belajar kelompok atau berdiskusi, anggota yang kurang aktif hanya diam saja dan tidak memperhatikan materi sedangkan anggota yang aktif tidak berusaha untuk memotivasi anggotanya untuk bekerjasama dalam mempelajari suatu materi. Sehingga tampak anggota yang aktif akan menonjol sedangkan anggota yang kurang aktif maka akan tidak paham akan materi. Hal tersebut juga berpengaruh pada hasil belajar siswa dimana siswa yang aktif maka hasil belajarnya akan memuaskan sedangkan siswa yang kurang aktif hasil belajarnya akan kurang memuaskan. Untuk mengatasi masalah tersebut, maka diperlukan suatu model pembelajaran yang dapat meningkatkan hasil belajar. Model pembelajaran yang dimaksud adalah model pembelajaran Snowball Throwing. Penelitian ini dilaksanakan pada tanggal 30 September sampai 28 Oktober 2010. Penelitian ini merupakan jenis Penelitian Tindakan kelas (PTK) dengan tujuan untuk dapat meningkatkan hasil belajar siswa yang diperoleh dari tes akhir belajar. Subyek penelitian ini adalah siswa kelas X APK SMK Negeri 1 Jombang yang terdiri dari 40 siswa. Langkah-langkah model ini ialah kelas dibagi menjadi beberapa kelompok kemudian berdiskusi mengenai materi yang sudah diterangkan oleh guru, membuat pertanyaan tentang materi dalam selembar kertas, kertas tadi diremas-remas seperti bola dan dilempar ke siswa yang lain. Kemudian siswa menjawab pertanyaan yang diperolehnya secara langsung. Pengumpulan data menggunakan tes, lembar observasi, angket, catatan lapangan dan wawancara. Hasil penelitian ini menunjukkan bahwa penerapan model Snowball Throwing yang dilakukan dalam mata pelajaran Memahami Prinsip-Prinsip Penyelenggaraan Administrasi Perkantoran siswa kelas X APK di SMK Negeri 1 Jombang dapat meningkatkan hasil belajar siswa. Dibuktikan dengan peningkatan hasil belajar sebesar 31,12% dari sebelum dilakukan tindakan dengan melihat rata-rata ulangan harian sebelumnya dengan setelah dilaksanakan tes akhir siklus 1. Sedangkan hasil belajar siswa siklus I dibandingkan siklus II terjadi peningkatan sebesar 7%. Berdasarkan hasil penelitian tersebut, dapat disarankan bahwa dalam menerapkan model Snowball Throwing hendaknya disesuaikan dengan materi yang akan diajarkan oleh guru. Bagi peneliti selanjutnya disarankan agar tidak hanya menilai hasil belajar tapi juga menilai segala aktivitas atau keaktifan setiap siswa dalam melaksanakan langkah-langkah model ini.

Pengaruh kondisi sosial ekonomi orang tua dan prestasi belajar siswa terhadap minat siswa untuk melanjutkan studi ke perguruan tinggi (studi pada siswa kelas XII APK SMK Muhammadiyah 5 Kepanjen) / Dewi Rahmawati

 

ABSTRAK Rahmawati, Dewi. 2015. PengaruhKondisiSosialEkonomi Orang Tua Dan PrestasiBelajarSiswaTerhadapMinatSiswaUntukMelanjutkanStudiKePerguruanTinggi (StudiPadaSiswaKelas XII APK SMK Muhammadiyah 5 Kepanjen), Skripsi, JurusanManajemen, FakultasEkonomi, UniversitasNegeri Malang.Pembimbing: (I) Dr. WeningPatmi. R, S.Pd, M.M(II)Drs. I NyomanSuputra, M.Si Kata Kunci :KondisiSosialEkonomi, PrestasiBelajar, MinatMelanjutkanStudiKePerguruanTinggi. Kondisisosialekonomidanprestasibelajarmerupakanfaktor-faktor yang dapatmempengaruhiminatuntukmelanjutkanstudikeperguruantinggi.Kondisisosialekonomi orang tuatinggiakanmeningkatkanminatsiswauntukmelanjutkanstudikeperguruantinggi. Begitujugadenganprestasibelajar, apabilasiswamemilikiprestasibelajar yang tinggimakaiaakanmemillikiminat yang tinggi pula untukdapatmelanjutkanstudikeperguruantinggi, namunapabilakondisisosialekonomi orang tuadanprestasibelajarrendahmakaminatsiswauntukmelanjutkanstudikeperguruantinggimenjadirendah pula. Penelitianinibertujuanuntukmengetahuipengaruhkondisisosialekonomi orang tuadanprestasibelajarsiswaterhadapminatsiswakelas XII APK SMK Muhammadiyah 5 Kepanjenuntukmelanjutkanstudikeperguruantinggi.Variabel yang ditelitiadalahkondisisosialekonomi orang tua (X1), prestasibelajar (X2), danminatsiswauntukmelanjutkanstudikeperguruantinggi (Y). Penelitianinimenggunakanrancanganpenelitianmetodedeskriptifkorelatifdenganjenispenelitiankuantitatifassosiatifdanpengambilansampelpopulasikarenajumlahrespondenkurangdari 100.Populasipadapenelitianiniadalahseluruhsiswakelas XII APK TahunAjaran 2014/2015denganjumlah 65 siswa.Pengolahan data penelitianinimenggunakananalisisregresi linier bergandadenganmenggunakan program SPSS 20. Hasildaripenelitianinimenunjukkanbahwakondisisosialekonomi orang tuasiswakelas XII APK masihrendah, prestasibelajarsiswadapatdigolongkanbaikkarenasebagianbesarmemilikinilairapor rata-rata lebihdari 80, sedangkanminatsiswakelas XII APK untukmelanjutkanstudikeperguruantinggimasihrendahhalinidibuktikandengan rasa ingintahusiswamengenaiperguruantinggimasihsangatkurang. Kesimpulandaripenelitianiniadalah: (1)Kondisisosialekonomi orang tuasecaraparsialberpengaruhpositifdansignifikanterhadapminatsiswauntukmelanjutkanstudikepeguruantinggisebesar 1,645; (2) Prestasibelajarsecaraparsialberpengaruhpositifdansignifikanterhadapminatsiswauntukmelanjutkanstudikepeguruantinggisebesar 1,235; (3)Kondisisosialekonomi orang tuadanprestasibelajarsecarasimultanberpengaruhpositifdansignifikanterhadapminatsiswauntukmelanjutkanstudikeperguruantinggisebesar 18,9%, dansebanyak 81,1% dipengaruhiolehfaktor lain diluarpenelitian. Saran bagisekolahyaitumemberikanpandanganmengenaiperguruantinggidanduniakerjasehinggasiswadapatmenentukanpilihanyang bijakuntukmenatamasadepanmereka.  

Penerapan model pembelajaran Think Pair Share dipadu dengan Problem Based Learning untuk meningkatkan partisipasi dan pemahaman konsep IPA siswa kelas VIII SMP / Elsy Dian Saputri

 

ABSTRAK Saputri, Elsy Dian. 2015. Penerapan Model Pembelajaran Think Pair Share dipadu Problem Based Learning untuk Meningkatkan Partisipasi dan Pemahaman Konsep IPA Siswa Kelas VIII SMP. Skripsi. Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam. Universitas Negeri Malang. Pembimbing (I) Dra. Sunarmi, M.Pd (II) Prof. Dr. Ir. Suhadi, M.Si Kata kunci: Think Pair Share (TPS), Problem Based Learning (PBL), Partisipasi, Pemahaman Konsep Berdasarkan hasil observasi dan wawancara guru IPA kelas VIII-H SMP Negeri 20 Malang, diperoleh informasi partisipasi siswa dalam kegiatan pembelajaran tergolong rendah. Hal ini dibuktikan dengan (1) ketuntasan klasikal ketiga aspek partisipasi siswa yaitu aspek mengerjakan tugas, usaha berdiskusi, dan keaktivan berpendapat hanya mencapai 12.5% dari 32 siswa dan (2) pemahaman konsep siswa masih rendah yang dibuktikan dengan hasil tes pada materi sistem rangka ketuntasan klasikalnya hanya sebesar 37,5%. Berdasarkan permasalahan yang ditemukan maka perlu dilakukan Penelitian Tindakan Kelas (PTK) untuk menyelesaikan permasalahan tersebut. Penelitian ini dilakukan dengan menggunakan pendekatan deskriptif kualitatif dan jenis penelitian adalah Penelitian Tindakan Kelas (PTK) serta bertujuan untuk memperbaiki permasalahan pada pembelajaran di dalam kelas. Penelitian ini dilakukan selama 2 siklus dan setiap siklus PTK terdiri atas perencanaan tindakan, pelaksanaan, observasi, dan refleksi. Tindakan pada penelitian ini adalah penerapan model pembelajaran TPS dipadu PBL. Penelitian ini dilakukan di kelas VIII-H SMP Negeri 20 Malang, semester genap 2015/2016. Data yang diambil dalam penelitian ini adalah keterlaksanaan pembelajaran TPS dipadu PBL, partisipasi siswa, dan pemahaman konsep siswa. Instrumen yang digunakan adalah lembar observasi keterlaksanaan pembelajaran, lembar observasi partisipasi siswa, dan soal tes tiap akhir siklus. Hasil penelitian dan analisis data menunjukkan bahwa pembelajaran model TPS dipadu PBL dapat meningkatkan partisipasi dan pemahaman konsep siswa. Pada siklus I presentase ketuntasan partisipasi belajar siswa dalam kegiatan pembelajaran sebesar 34.37% yang meningkat sebesar 46.88% pada siklus II menjadi 81,25%. pemahaman konsep siswa juga mengalami peningkatan sebesar 37,5% dari siklus I dengan ketuntasan belajar 53,125% menjadi 90,625%. berdasarkan hasil penelitian ini menunjukkan bahwa penerapan pembelajaran model TPS dipadu PBL dapat meningkatkan partisipasi dan pemahaman konsep IPA materi sistem ekskresi pada siswa kelas VIII-H SMP Negeri 20 Malang.

Perancangan corporate identity untuk Kafe Omah Jajan Malang / Isyanti Rahayu Savitri

 

ABSTRAK Savitri, Isyanti Rahayu. 2015. Perancangan Corporate Identity untuk Kafe Omah Jajan Malang. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Moch. Abdul Rohman, S.Sn, M.Sn, (II) Rudi Irawanto, S.Pd, M.Sn Kata Kunci: Corporate Identity, Logo, Omah Jajan, Malang Omah Jajan merupakan sebuah kafe yang terletak di Jalan Cimacan no. 6 Malang, kafe ini menyajikan berbagai macam menu makanan ringan. Omah Jajan sangat mengunggulkan cita rasa dan kualitas makanan yang disajikan, namun mengesampingkan identitas perusahaan. Corporate Identity merupakan salah satu strategi sebuah perusahaan agar berhasil dalam menarik minat konsumen dan membantu sebuah perusahaan dalam memberikan identitas khusus untuk membedakannya dengan perusahaan yang lain. Perancangan corporate identity untuk kafe Omah Jajan ini berfungsi tidak hanya sebagai pemberi identitas, tetapi juga membuat media penerapan yang tepat sehingga mempresentasikan image perusahaan kepada masyarakat. Perancangan ini menggunakan sistematika perancangan Alina Wheeler yang disesuaikan dengan kebutuhan. Teknik pengumpulan data melalui observasi, wawancara, dan dokumentasi. Dalam konsep perancangan ini mengusung konsep simple vintage dimana logo yang dirancang terdiri dari logogram dan logotype. Bentuk rumah menjadi acuan pada logogram, gaya arsitektur Jengki diangkat karena dapat menggambarkan dengan konsep simple vintage yang diusung. Setiap elemen pada logo memiliki makna tersendiri yang diharapkan mampu memberikan citra positif dan meningkatkan eksistensinya ditengah masyarakat. Pada perancangan ini menghasilkan buku Graphic Standard Manual, stationary, sign system, uniform, packaging, dan merchandise.

Pengaruh pengungkapan tanggung jawab sosial perusahaan (corporate social responsibility disclosure) terhadap kinerja keuangan perusahaan dengan kepemilikan manajerial sebagai variabel pemoderasi / Safira Triani Ayu Laksmi

 

Kata kunci: pengungkapan tanggung jawab sosial perusahaan (CSR Disclosure), kinerja keuangan, kepemilikan manajerial, variabel pemoderasi. Pengungkapan tanggung jawab sosial perusahaan (CSR Disclosure) merupakan salah satu bentuk pertanggungjawaban perusahaan terhadap stakeholders selain laporan keuangan. CSR Disclosure muncul sebagai adanya perubahan dalam paradigma teori dan praktik ekonomi bisnis. Di masa kini, perusahaan tidak hanya dipandang dengan tujuan utama memaksimalkan laba bagi pemegang saham, tetapi juga dituntut untuk memperhatikan tanggung jawab sosialnya kepada masyarakat. CSR dipandang bukan hanya sebagai biaya, tapi juga sebagai investasi jangka panjang yang dapat meningkatkan keuntungan perusahaan. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh CSR Disclosure terhadap kinerja keuangan perusahaan dan untuk mengetahui apakah kepemilikan manajerial berpengaruh sebagai variabel pemoderasi dalam hubungan antara CSR Disclosure dan kinerja keuangan perusahaan. Penelitian ini menggunakan metode sampel total dengan mengambil 10 perusahaan manufaktur yang memiliki kepemilikan manajerial dan menerbitkan informasi tanggung jawab sosial. Perusahaan manufaktur tersebut terdaftar di Bursa Efek Indonesia (BEI) periode 2005-2009. CSR Disclosure menggunakan proksi CSRI dan kinerja keuangan diproksi dengan rasio profitabilitas berupa ROE dan ROA. Metode analisis penelitian adalah menggunakan Moderated Regression Analysis (MRA). Hasil penelitian ini menunjukkan bahwa (1) CSR Disclosure berpengaruh signifikan terhadap ROE perusahaan, (2) CSR Disclosure berpengaruh signifikan terhadap ROA perusahaan, (3) kepemilikan manajerial berpengaruh tidak signifikan sebagai variabel pemoderasi dalam hubungan antara CSR Disclosure dan ROE perusahaan, (4) kepemilikan manajerial berpengaruh tidak signifikan sebagai variabel pemoderasi dalam hubungan antara CSR Disclosure dan ROA perusahaan. Berdasarkan hasil tersebut, dapat disarankan agar dilakukan penelitian ulang atau penelitian lebih lanjut dengan menambah jumlah sampel dan tidak terbatas pada perusahaan manufaktur saja. Penilaian CSRI dapat menggunakan GRI atau ISO 26000.

Pengaruh kebijakan utang, kepemilikan institusional dan free cash flow terhadap kebijakan dividen pada perusahaan yang terdaftar dalam Jakarta Islamic Index / Latifatu Hardina

 

Hardiana, Latifatu Eki. 2009. Pengaruh Kebijakan Utang, Kepemilikan Institusional dan Free Cash Flow terhadap Kebijakan Dividen pada Perusahaan yang terdaftar dalam Jakarta Islamic Index. Program S1 Akuntansi jurusan Akuntansi fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Sriyani Mentari, S.Pd MM, Pembimbing (II) Makaryanawati, SE MSi Ak. Kata kunci : Kebijakan Utang, Kepemilikan Institusional, Free Cash Flow, Kebijakan Dividen Kebijakan dividen merupakan bagian yang tidak dapat dipisahkan dengan keputusan pendanaan perusahaan. Kebijakan dividen merupakan keputusan apakah laba yang diperoleh perusahaan pada akhir tahun akan dibagi kepada pemegang saham dalam bentuk dividen atau akan ditahan untuk menambah modal guna pembiayaan investasi di masa yang akan datang. Tujuan penelitian ini adalah untuk mengetahui pengaruh kebijakan utang, kepemilikan institusional dan free cash flow terhadap kebijakan dividen. Serta pengaruh ketiganya secara bersama- sama terhadap kebijakan dividen. Populasi pada penelitian ini adalah perusahaan-perusahaan yang terdaftar dalam Jakarta Islamic index. Pengambilan sampel dilakukan dengan menggunakan teknik purposive sampling, yaitu perusahaan yang listing di JII tahun 2004-2006 dan membagikan dividen selama tiga tahun berturut-turut pada periode tersebut. Data yang digunakan adalah data sekunder yang diperoleh dari ICMD. Analisis data yang digunakan dalam penelitian ini adalah analisis regresi linear berganda. Hasil penelitian menunjukkan kebijakan utang tidak berpengaruh signifikan terhadap kebijakan dividen, hal ini dikarenakan manajemen yang tetap membayarkan dividen agar investor tetap menilai baik keadaan perusahaan dan untuk menjaga reputasi perusahaan di mata investor. Kepemilikan institusional tidak berpengaruh signifikan terhadap kebijakan dividen, hal ini dikarenakan adanya perangkapan manajemen oleh pemilik, sehingga tidak terjadi konflik antara manajemen dengan pemilik, sehingga tidak berpengaruh terhadap rasio pembayaran dividen. Sedangkan free cash flow berpengaruh signifikan terhadap kebijakan dividen, di mana free cash flow yang tinggi oleh manajer cenderung digunakan untuk reinvestasi daripada dibayarkan sebagai dividen. Kesimpulan dari penelitian ini adalah kebijakan utang dan kepemilikan institusional tidak berpengaruh signifikan terhadap kebijakan dividen, sedangkan free cash flow berpengaruh signifikan terhadap kebijakan dividen. Saran untuk penelitian selanjutnya adalah dengan menambah variabel penelitian, jumlah sampel dan tahun penelitian. Sementara bagi investor yang akan menanamkan modalnya kepada suatu perusahaan sebaiknya tidak hanya mendasarkan pada rasio pembayaran dividen saja namun juga perlu memperhatikan faktor lain seperti prospek perusahaan.

Pengaruh interpersonal dan intrapersonal intelligence terhadap prestasi belajar siswa mata pelajaran kewirausahaan SMK PGRI 2 Kota Malang / Retno Haryani

 

Haryani, Retno. 2014. Pengaruh Interpersonal dan Intrapersonal Intelligence terhadap Prestasi Belajar Siswa Mata Pelajaran Kewirausahaan SMK PGRI 2 Kota Malang. Skripsi, Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Dr. Wening Patmi Rahayu, S.Pd, M.M. (II) Drs. H. Gatot Isnani, M.Si. Kata kunci: interpersonal intelligence, intrapersonal intelligence, prestasi belajar siswa     Dunia pendidikan dan keluhan yang berasal dari peserta didik, orang tua, maupun pendidik mengenai bagaimana peserta didik dapat menerima pelajaran dengan baik tidak dapat dipisahkan. Hal ini mendorong dilakukannya penelitian untuk melihat faktor-faktor yang membuat peserta didik dapat menerima pelajaran dengan baik. Salah satu temuan yang sangat bermanfaat adalah bahwa setiap individu memiliki tidak hanya satu jenis kecerdasan tetapi lebih, yang disebut kecerdasan majemuk. Kecerdasan majemuk secara keseluruhan menawarkan beragam jalan menuju kesuksesan dan prestasi, masing-masing kecerdasan memainkan peran penting. Interaksi manusia yang berhasil dalam bentuk apa pun memerlukan kemampuan untuk mengenal untuk mengenal diri sendiri dan bekerja sama dengan orang.     Interpersonal dan intrapersonal intelligence sangat perlu dikembangkan oleh siswa. Dengan kecerdasan-kecerdasan tersebut siswa dapat mengetahui potensi dan kelemahan yang ada dalam diri, sehingga akan mampu mengembangkannya dan siswa akan memahami bagaimana berhubungan baik dengan orang lain. Hal ini akan membantu siswa untuk mendapatkan pengetahuan yang dibutuhkannya. Penelitian ini memiliki tujuan yaitu untuk mengetahui: (1) Interpersonal dan intrapersonal intelligence, serta prestasi belajar siswa mata pelajaran kewirausahaan. (2) Pengaruh interpersonal dan intrapersonal intelligence secara parsial terhadap prestasi belajar siswa mata pelajaran kewirausahaan. (3) Pengaruh interpersonal dan intrapersonal intelligence secara simultan terhadap prestasi belajar siswa mata pelajaran kewirausahaan.     Penelitian ini merupakan penelitian kuantitatif, dengan rancangan penelitian eksplanasi, yaitu penelitian yang bertujuan untuk menguji suatu teori atau hipotesis guna memperkuat atau menolak teori atau hipotesis hasil penelitian yang sudah ada. Variabel bebas dalam penelitian ini adalah interpersonal intelligence (X1) dan intrapersonal intelligence (X2), sedangkan variabel terikatnya adalah prestasi belajar siswa mata pelajaran kewirausahaan Populasi dalam penelitian ini adalah siswa kelas X yang berjumlah 244 siswa dengan sampel yang digunakan sebanyak 143 siswa. Pengambilan sampel ini menggunakan teknik proportional random sampling.     Skala yang digunakan adalah skala Likert dengan lima skala ukur dimulai dari opsi sangat setuju, setuju, cukup setuju, tidak setuju, dan sangat tidak setuju. Sedangkan prestasi belajar klasifikasinya adalah rendah sekali, rendah, cukup tinggi, tinggi, dan sangat tinggi. Jenis datanya adalah data ordinal yang diperlakukan sebagai data interval. Untuk sumber data berasal dari data primer dan sekunder yang dimana data primer berasal dari responden sedangkan data sekunder berasal dari nilai kognitif siswa pada rapor semester ganjil. Teknik pengumpulan data menggunakan metode kuesioner dan metode dokumentasi. Dalam penelitian ini angket dibagikan selama dua hari pada tanggal 2 dan 3 April 2014, yaitu dengan cara semua siswa dikumpulkan dalam kelas masing-masing dan semua populasi mengisi angket. Sedangkan metode dokumentasi digunakan untuk memperoleh data mengenai jumlah siswa maupun gambaran umum siswa kelas X serta nilai kognitif pada rapor semester ganjil. Untuk uji kelayakan instrumen digunakan uji validitas dan reliabilitas dengan bantuan SPSS 19 for Windows. Dalam penelitian ini menggunakan beberapa model uji asumsi klasik, yaitu: (1) Uji normalitas. (2) Uji heteroskedastisitas. (3) Uji multikolinearitas.      Hasil uji asumsi klasik menunjukkan bahwa: (1) Hasil uji normalitas menunjukkan data dalam penelitian ini berdistribusi normal terlihat dari titik-titik yang menyebar di sekitar garis diagonal pada gambar P-P Plot of Regression Standardized Residual. (2) Hasil uji multikolinearitas menunjukkan tidak terjadi gejala multikolinearitas. (3) Hasil uji heteroskedastisitas menunjukkan titik-titik pada gambar scatterplot tidak membentuk suatu pola tertentu dan menyebar acak, sehingga dalam penelitian ini tidak terjadi gangguan heteroskedastisitas. Jadi, persamaan regresi layak untuk digunakan. Hasil analisis deskriptif menunjukkan bahwa: (1) Interpersonal intelligence pada siswa dapat diklasifikasikan baik. (2) Intrapersonal intelligence siswa adalah baik. (3) Sebagian besar siswa memiliki prestasi belajar yang tinggi. Berdasarkan hasil uji hipotesis menunjukkan bahwa: (1) Tidak ada pengaruh positif yang signifikan antara Interpersonal intelligence terhadap prestasi belajar siswa mata pelajaran kewirausahaan. (2) Ada pengaruh positif yang signifikan antara Intrapersonal intelligence terhadap prestasi belajar siswa mata pelajaran kewirausahaan. (3) Ada pengaruh positif yang signifikan antara interpersonal dan intrapersonal intelligence terhadap prestasi belajar siswa mata pelajaran kewirausahaan.     Berdasarkan hasil penelitian ini, peneliti menyarankan: (1) Bagi Kepala Sekolah bisa menjadikan penelitian ini sebagai bahan pertimbangan dalam dunia pendidikan ke depan untuk lebih membantu dalam memperlancar kegiatan belajar siswa baik dalam bidang akademik maupun non akademik, maka diperlukan kecerdasan interpersonal dan intrapersonal agar siswa senantiasa mampu mengembangkan potensi yang dimilikinya. (2) Bagi orang tua dan guru untuk melakukan pembinaan kecerdasan interpersonal dan intrapersonal demi peningkatan prestasi peserta didik. (3) Peneliti yang tertarik untuk melanjutkan penelitian ini, sebaiknya melakukan penelitian terhadap kecerdasan ganda lainnya yang juga dapat mempengaruhi prestasi belajar seperti kecerdasan bahasa, kecerdasan visual spasial, dan kecerdasan lain yang telah banyak ditemukan oleh ilmuan.

Studi tentang kegiatan laboratorium dan demonstrasi sebagai faktor penunjang pengajaran IPA-Fisika di S.M.P. Negeri Kotamadya Malang / oleh Flora Widyaningsih

 

Pengembangan multimedia interaktif pembelajaran menulis teks prosedur kompleks untuk SMA kelas X / Ariffa Husnul Huda

 

ABSTRAK Huda, Ariffa Husnul. 2015. Pengembangan Multimedia Interaktif Pembelajaran Menulis Teks Prosedur Kompleks untuk SMA Kelas X. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Maryaeni, M.Pd., (II) Dr. Gatut Susanto, M.M., M.Pd. Kata Kunci: multimedia interaktif, menulis, teks prosedur kompleks Teknologi di Indonesia berkembang begitu pesat. Akan tetapi, perkembangan teknologi tersebut tidak banyak dimanfaatkan dalam pembelajaran. Padahal terdapat teknologi yang bisa dimanfaatkan sebagai media pembelajaran.Salah satu jenis media pembelajaran yang dalam pengoperasiannya memanfaatkan kecanggihan teknologi adalah multimedia interaktif. Pada kehidupan sehari-hari, tentunya siswa tidak terlepas dari penggunaan teknologi. Pada penggunaan teknologi tersebut diperlukan langkah-langkah dalam pengoperasiannya. Siswa menerapkan salah satu jenis teks dalam penggunaan teknologi tersebut, yakni teks prosedur. Teks prosedur berisi langkah-langkah melakukan sesuatu. Apabila dalam langkah-langkah tersebut terdapat sublangkah atau keterangan yang harus ditempuh untuk mencapai tujuan maka disebut dengan teks prosedur kompleks. Dikaitkan dengan dunia pembelajaran bahasa Indonesia, pembelajaran mengenai teks prosedur kompleks pada kurikulum 2013 terdapat pada jenjang SMA dan sederajat kelas X. Pada kurikulum tersebut, siswa diharapkan mampu menulis teks prosedur kompleks. Berdasarkan hasil wawancara dengan guru bahasa Indonesia kelas X SMAN 3 Bangkalan, proses pembelajaran menulis teks prosedur kompleks di sekolah tersebut masih konvensional. Siswa tampak bosan dan kurang bersemangat. Oleh sebab itu, guru perlu melakukan inovasi untuk menarik minat dan motivasi siswa dalam kegiatan belajar. Media pembelajaran menulis teks prosedur kompleks berbasis multimedia interaktif bisa menjadi salah satu cara untuk membangkitkan minat dan motivasi siswa serta membuat pembelajaran menjadi inovatif.Berdasarkan permasalahan yang telah diuraikan tersebut, peneliti mengembangkan multimedia interaktif pembelajaran menulis teks prosedur kompleks karena belum ada di lapangan dan keberadaannya dibutuhkan untuk penunjang proses pembelajaran menulis teks prosedur kompleks. Tujuan dari penelitian pengembangan ini adalah menghasilkan multimedia interaktif pembelajaran menulis teks prosedur kompleks yang layak dari segi isi, bahasa, dan tampilan untuk siswa SMA kelas X. Prosedur penelitian dalam pengembangan multimedia interaktif pembelajaran menulis teks prosedur kompleks ini menggunakan prosedur Plomp yang disederhanakan menjadi empat fase, yakni (1) fase investigasi awal, (2) fase desain, (3) fase realisasi/konstruksi, dan (4) fase tes, evaluasi, dan revisi. Fase kelima dalam prosedur Plomp, yakni fase implementasi tidak dilakukan karena adanya keterbatasan waktu dan biaya serta perlunya kajian yang lebih mendalam untuk eksperimen lebih lanjut. Pengembangan multimedia interaktif ini membutuhkan uji kelayakan. Uji kelayakan produk diujikan kepada ahli media pembelajaran, ahli pembelajaran, guru Bahasa Indonesia kelas X SMAN 3 Bangkalan, dan siswa SMA kelas X IPS 4 SMAN 3 Bangkalan sebanyak 25siswa. Kelayakan produk dilihat dari tigaaspek, yakni aspek isi, bahasa, dan tampilan. Pada aspek isi memperoleh persentase kelayakanmencapai 88,5%/. Pada aspek bahasa memperoleh persentase kelayakan mencapai 91,8%. Pada aspek tampilan memperoleh persentase kelayakan mencapai86,12%. Perolehan persentase pada setiap aspek tersebut menunjukkan produk ini sangat layak dan bisa diimplementasikan. Produk Multimedia Interaktif Pembelajaran Menulis Teks Prosedur Kompleks untuk SMA Kelas Xini bisa dimanfaatkan oleh guru Bahasa Indonesia, siswa, dan peneliti lain. Pertama, guru bisa menggunakan produk tersebutuntuk mempermudah penyampaian materi pembelajaran menulis teks prosedur kompleks. Kedua, produk tersebut bisa dimanfaatkan siswa untuk dijadikan sumber belajar selain buku teks pelajaran dan bisa menggunakannya secara mandiri. Ketiga, produk tersebut bisa dimanfaatkan oleh peneliti lain untuk dijadikan bahan referensi dan bandingan dalam mengembangkan multimedia interaktif selanjutnya. Produk multimedia interaktif ini bisa disebarluaskan melalui forum MGMP, jurnal penelitian, dan kepada sesama mahasiswa.Produk ini masih belum sempurna dan perlu perbaikan. Pengembang lain diharapkan untuk mengujicobakan produk ke subjek yang lebih besar lagi dan juga menguji keefektifan produk karena dalam penelitian ini hanya sebatas mengembangkan produk yang diujicobakan kepada kelompok terbatas. Pengembang produk lebih lanjut hendaknya memperhatikan beberapa hal, antara lain (1) alokasi waktu dan biaya yang dibutuhkan untuk mengembangkan produk, (2) keterampilan pengembang, dan (3) peralatan saat pembuatan produk maupun peralatan yang dibutuhkan saat uji coba dilaksanakan.  

Aplikasi pupuk mikoriza terhadap produktivitas tanaman kacang hijau (Vigna radiata (L) Wilezeck di tanah tercekam garam / Laily Maghfiro Kamil Mastika

 

ABSTRAK Mastika, L. M. K. 2015. Aplikasi Pupuk Mikoriza terhadap Produktivitas Tanaman Kacang Hijau [Vigna radiata (L) Wilczeck] di Tanah Tercekam Garam. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Ir. Nugrahaningsih, M.P., (II) Dr. Betty Luiati, M. S. Kata kunci: mikoriza vesikular arbuskular, produktivitas kacang hijau, tanah tercekam garam. Kacang hijau atau Vigna radiata (L) Wilczeck adalah tanaman polong yang menduduki peringkat ketiga sebagai tanaman pangan setelah kedelai dan kacang tanah. Kacang hijau memiliki zat gizi yang tidak kalah dengan kedelai maupun kacang tanah. Masyarakat memanfaatkan kacang hijau sebagai bahan baku makanan, bahan campuran, pupuk hijau dan tanaman penutup tanah. Kebutuhan kacang hijau semakin meningkat seiring dengan bertambahnya jumlah penduduk dan industri makanan baik skala rumah maupun industri. Kenaikan permintaan kacang hijau belum diimbangi dengan peningkatan hasil produksi sehingga untuk menutupi kebutuhan tersebut pemerintah impor kacang hijau dari luar negeri. Usaha pemerintah untuk menekan impor adalah dengan memanfaatkan lahan marjinal seperti lahan salin atau tanah tercekam garam. Tanah tercekam garam atau tanah salin adalah tanah yang mengandung kadar garam terlarut tinggi. Budidaya tanaman kacang hijau di tanah salin menghadapi kendala tekstur tanah yang buruk dan hambatan osmotik. Penyelesaian permasalahan tersebut diatasi dengan cara menggunakan pupuk organik, salah satunya pupuk hayati mikoriza vesikular arbuskular (MVA). Jamur MVA merupakan kelompok jamur dari kelas Glomeromycota yang dapat menginfeksi perakaran tanaman dan membantu memperluas area penyerapan hara, dan meningkatkan efisensi penyerapan unsur hara, terutama fosfor. Penelitian ini dilaksanakan dengan tujuan untuk menguji pengaruh dan dosis efektif pupuk hayati mikoriza terhadap pertumbuhan dan produksi tanaman kacang hijau di tanah tercekam garam. Penelitian ini merupakan penelitian eksperimen kuantitatif dengan rancangan percobaan Rancangan Acak Kelompok (RAK). Media tanam menggunakan tanah dan pupuk kompos dengan perbandingan 2:1 dengan perlakuan 5 taraf pupuk hayati mikoriza yakni 0 g/tanaman, 3 g/tanaman, 6 g/tanaman, 9 g/tanaman dan 12 g/tanaman serta 5 ulangan tiap perlakuan. Data pengamatan dianalisis dengan sidik ragam Anava dan uji lanjut BNT 5%. Hasil analisis menunjukkan bahwa pupuk hayati mikoriza 6-9 gram merupakan dosis efektif dan efisien untuk meningkatkan produksi tanaman kacang hijau varietas VIMA 1 di tanah tercekam garam.

Sintesis dan karakterisasi senyawa kompleks dari ion [Co(C9H7N)2]2+ dan [Zn(NCS04]2 / Ahmad Murtadha 'Imaduddin

 

ABSTRAK Imaduddin, Ahmad. M. 2015. Sintesis dan Karakterisasi Senyawa Kompleks dari Ion [Co(C9H7N)2]2+ dan [Zn(NCS)4]2-. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Drs. I Wayan Dasna, M.Si, M.Ed, Ph.D, (II) Dr. Fariati, M.Sc. Kata-kata kunci: senyawa kompleks heterointi, kation [Co(C9H7N)2]2+, anion [Zn(NCS)4]2- CoCl2 telah dilaporkan dapat membentuk kompleks dengan ligan kuinolina, begitu juga ZnCl2 dengan tiosianat. Kompleks dari ion [Co(C9H7N)2]2+ (kation kompleks I) dan [Zn(NCS)4]2- (anion kompeks II) belum pernah disintesis. Tujuan penelitian adalah mensintesis, mengkarakterisasi serta memprediksi senyawa kompleks dari [Co(C9H7N)2]2+ dan [Zn(NCS)4]2- (kompleks III) pada perbandingan stoikiometri sebesar 1:1. Penelitian terdiri dari dua tahap yaitu: 1) sintesis kation kompleks I, anion kompleks II dan senyawa kompleks III; 2) karakterisasi senyawa kompleks hasil sintesis. Karakterisasi senyawa kompleks hasil sintesis dilakukan dengan cara: (1) uji titik lebur yaitu untuk mengetahui kompleks hasil sintesis merupakan senyawa murni dan baru; (2) uji Daya Hantar Listrik (DHL) untuk menentukan kompleks merupakan senyawa molekuler atau ionik; (3) analisis SEM (Scanning Electron Microscopy) untuk melihat morfologi permukaan kristal, analisis kandungan unsur dengan EDX (Energy Dispersive X-Ray) untuk memperoleh rumus empiris serta menghasilkan berbagai prediksi struktur senyawa kompleks dan (4) analisis FT-IR untuk mengetahui gugus fungsi yang terdapat dalam senyawa kompleks hasil sintesis. Prediksi struktur senyawa kompleks dihitung energi bebas dengan Spartan’14. Struktur senyawa kompleks hasil sintesis yang memungkinkan adalah struktur dengan nilai energi bebas terendah dan sesuai data karakterisasi. Senyawa kompleks hasil sintesis berupa kristal berwarna biru gelap berbentuk balok. Uji titik lebur menunjukkan bahwa senyawa kompleks melebur pada rentangan suhu 135-137oC. Berdasarkan data hasil pengukuran DHL, kompleks hasil sintesis merupakan kompleks ionik. Hasil analisis data dari EDX didapatkan perbandingan mol Co:Zn:S:N:O:K adalah sebesar 1:2:8:10:4:2 dan menghasilkan rumus empiris C29H18CoZn2K2N10O4S8. Model prediksi senyawa kompleks dibedakan berdasarkan kecenderungan pola koordinasi atom Co(II) yang berikatan dengan ligan kuinolina yaitu dengan BK = 4 dan 6. Kecenderungan ion tiosianat yang dapat membetuk jembatan juga diprediksi kompleks hasil sintesis dapat berupa senyawa molekuler heterointi. Hasil analisis FT-IR menunjukkan ligan kuinolina dan ion tiosianat terdapat di dalam senyawa kompleks hasil sintesis dengan munculnya pergeseran bilangan gelombang khas untuk gugus fungsi C=N, C≡N dan Co-O. Senyawa kompleks hasil sintesis diprediksi sebagai K2[Co(C9H7N)2(CH3OH)4][Zn(NCS)4]2 yang merupakan kompleks ionik dengan geometri Co(II) dan Zn(II) berturut-turut adalah oktahedral dan tetrahedral terdistorsi. Posisi ligan kuinolina dapat menempati posisi trans dan cis.

Pengaruh independensi dan etika profesi auditor terhadap ketaatan Standar Profesional Akuntasi Publik (SPAP) dalam pengauditan laporan keuangan (Studi empiris ganda KAP Kota Malang) / Iva Fitria Astuti

 

The implementation of the teaching of speaking to the first grade students at SMA Islam Malang / Marita Kusuma

 

Key words: Teaching Speaking, SMA Islam Malang This study was conducted to describe the teaching speaking to the first grade students of SMA Islam Malang in terms of (1) the schedule of teaching speaking English, (2) the methods used in teaching speaking English, (3) the media used in teaching speaking English, (4) the students’ practice in speaking English, and (5) the students’ ability to speak English. This study employed a descriptive study because it was designed to describe the teaching of speaking at SMA Islam Malang to construct certain information about the real phenomena faced by the school. The data were obtained through four research instruments; observations, questionnaires, interview guide, and field notes, and they were presented descriptively after being classified into related aspects. The findings showed that the implementation of teaching speaking English in this school did not have any specific schedule. The school used two different English teachers with the consideration that one teacher taught reading and writing skills, while the other taught listening and speaking skills. This differentiation was not effective because when the topic of reading and writing skills were too much, then listening, especially speaking would be taught as the non-required activity. In the teaching and learning process, the teacher used various activities and media in the classroom but the most activity used was role play while the most media used was realia. Besides learning English at school, there were several activities outside the class that students could do such as joining a group discussion or a private course to enhance their ability to speak English. Thus, there were few of students who joined such kind of courses. Joining a group discussion or a private course might affect the students’ ability to speak. They were more confident in sharing and expressing their ideas. Moreover, when it came to the students who did not join a course, they tended to keep silent and always refused to answer the teacher’s question. Finally, it is suggested that the teacher should use creative and various activities and media in the teaching and learning English to make the students more confident in expressing their ideas. Then the suggestion is also delivered to the students that they need a lot of practice speaking English into their daily activities with their friends. Other suggestion is delivered to the school that SMA Islam Malang should provide many facilities of teaching media. The school should reevaluate the English teacher’s competence by conducting a test in order to develop the student’s competence. Last, this research hopefully beneficial to the further researchers that will give more information about teaching speaking English at school.

Pengembangan brain based thematic learning model di kelas IV Sekolah Dasar / Iffah Qurrotul A'yun

 

ABSTRAK A’yun, Iffah Qurrotul, 2015. Pengembangan Brain Based Thematic Learning Model di Kelas IV Sekolah Dasar. Tesis, Program Studi Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang, Pembimbing (I) Prof. Dr. Sa’dun Akbar, M. Pd; (2) Dr. Sentot Kusairi, S. Pd, M. Si Kata kunci : Brain Based Thematic Learning Model, sekolah dasar Berdasarkan studi pendahuluan di SDN Mulyorejo 1 Kota Malang, ditemukan fakta bahwa pembelajaran tematik yang dipandu dengan buku guru dan buku siswa belum mampu melibatkan siswa dalam aktivitas belajar sesuai tuntutan teoretik, kegiatan pembelajaran belum memadai untuk mengembangkan seluruh aspek kecerdasan siswa, dan perangkat pembelajaran guru belum dapat disusun dengan baik. Penelitian dan pengembangan ini bertujuan untuk menghasilkan (1) Brain Based Thematic Learning Model berupa sintaks model pembelajaran beserta perangkatnya yang valid, efektif untuk mencapai tujuan pembelajaran, serta praktis dalam pembelajaran khususnya pada Sub Tema Keanekaragaman Hewan dan Tumbuhan, dan (2) menghasilkan panduan penggunaan model pembelajaran Brain Based Thematic Learning Model bagi guru. Metode yang digunakan dalam penelitian dan pengembangan Brain Based Thematic Learning Model merupakan modifikasi dari model pengembangan Borg & Gall. Hasil modifikasi tersebut terdiri atas 9 langkah pengembangan yaitu (1) identifikasi masalah, (2) perencanaan, (3) pengembangan produk awal, (4) validasi ahli, (5) revisi berdasarkan hasil validasi, (6) uji coba awal, (7) revisi berdasarkan penilaian dan masukan dari pengguna, (8) uji coba skala terbatas, dan (9) penyempurnaan produk akhir. Berdasarkan uji coba kelayakan produk diperoleh tingkat kevalidan Brain Based Thematic Learning Model sebesar 93,57% dengan kriteria sangat valid, tingkat kepraktisan sebesar 94,95%, dengan kriteria sangat praktis, dan tingkat keefektifan sebesar 91,09%, dengan kriteria keefektifan yaitu sangat efektif. Dari perolehan persentase tersebut dapat diketahui bahwa Brain Based Thematic Learning Model yang telah dihasilkan sangat valid secara teoretik, sangat praktis dilaksanakan dalam pembelajaran, dan sangat efektif untuk mencapai tujuan pembelajaran. Berdasarkan hasil penelitian dan pengembangan Brain Based Thematic Learning Model disarankan (1) menggunakan desain eksperimen dengan kelas kontrol, (2) mengembangkan sub tema lain atau disesuaikan dengan kebutuhan, (3) mengembangkan pada kelas lain agar diperoleh informasi kelayakan model, (4) mengembangkan CD implementasi model, sehingga guru dapat memahami langkah-langkah model dengan baik, (5) mengembangkan pada siswa dengan jumlah 20-25 agar kelas menjadi lebih proporsional, (6) mengembangkan dengan lebih mengutamakan kualitas dari pada kuantitas materi pembelajaran, sehingga alokasi waktu yang tersedia dapat dimanfaatkan secara optimal, (7) mengembangkan pada kelas yang menggunakan sistem mata pelajaran, (8) mengembangkan dengan kriteria guru yang memahami tentang teori Multiple intelligences, dan (9) mengembangkan dengan dilakukan oleh guru yang memiliki pengalaman mengajar minimal 1 tahun di kelas dengan sistem pembelajaran tematik.

Reproduksi visual spasial siswa SMK dalam mengkonstruksi kubus / Zuraidah

 

ABSTRAK Zuraidah, 2015. Reproduksi Visual Spasial Siswa SMK Dalam Mengonstruksi Kubus. Disertasi, Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Drs. Akbar Sutawidjaya, M.Ed., Ph.D., (II) Dr. I Nengah Parta, M.Si., (III) Dr. Makbul Muksar, M.Si. Kata Kunci: reproduksi, visual spasial, siswa SMK, konstruksi, kubus Reproduksi visual spasial siswa berkaitan dengan pola penalaran spasialnya. Penalaran spasial adalah pemrosesan informasi non verbal berupa gambar untuk menyelesaikan masalah. Terkait dengan hal tersebut maka penelitian ini bertujuan mendeskripsikan alur penalaran spasial siswa dalam mengonstruksi kubus. Penelitian ini menggunakan rancangan deskriptif kualitatif dengan subyek penelitian sebanyak 8 siswa Sekolah Menengah Kejuruan kelas XI bidang keahlian Tehnik Gambar Bangunan yang dipilih menggunakan teknik purposive sampling. Selain peneliti sebagai instrumen utama dalam mengumpulkan data, digunakan pula instrumen pendukung berupa tugas. Sedangkan analisis data dilakukan dengan teknik analisis perbandingan tetap. Hasil analisis penelitian ini bermuara pada empat kesimpulan. Pertama, pada penalaran spasial SE, alur penalaran spasial subjek diawali dengan menentukan titik tetap. Jika sisi depan kubus dijadikan titik tetap maka subjek membayangkan melipat jaring-jaring kearah luar. Jika sisi bawah kubus yang dijadikan titik tetap, subjek membayangkan melipat jaring-jaring kearah dalam. Kedua, pada penalaran spasial SSCC, alur penalaran spasial subjek diawali dengan melakukan rotasi terhadap jaring-jaring. Selanjutnya subjek menentukan titik tetap. Jika sisi bawah kubus dijadikan titik tetap, maka subjek membayangkan melipat jaring-jaring kearah dalam. Jika sisi depan kubus yang dijadikan titik tetap, subjek membayangkan melipat jaring-jaring kearah luar. Ketiga, pada penalaran spasial SE-SSCC, alur penalaran spasial subjek diawali dengan menentukan titik tetap dan diakhiri dengan melakukan rotasi terhadap kubus. Setelah menentukan sisi bawah kubus sebagai titik tetap, subjek membayangkan melipat jaring-jaring kearah dalam sehingga terkonstruksi kubus. Terakhir, subjek membayangkan melakukan rotasi terhadap kubus yang baru dikonstruksi tersebut. Keempat, pada penalaran spasial Dobel SSCC, alur penalaran spasial subjek diawali dengan melakukan rotasi terhadap jaring-jaring dan diakhiri dengan melakukan rotasi terhadap kubus. Setelah melakukan rotasi terhadap jaring-jaring, subjek menentukan sisi belakang atau sisi bawah kubus sebagai titik tetap. Selanjutnya, subjek membayangkan melipat jaring-jaring kearah dalam sehingga terkonstruksi kubus. Terakhir subjek membayangkan melakukan rotasi terhadap kubus yang baru dikonstruksi tersebut.

Perancangan buku cerita bergambar berbasis still life fotografi sebagai media pembelajaran Nilai Persatuan dan Kesatuan untuk anak sekolah dasar kelas rendah / Bayu Permadi W.

 

ABSTRAK Permadi W., Bayu.2015.Perancangan Buku Cerita Bergambar Berbasis Still Life Fotografi Sebagai Media Pembelajaran Nilai Persatuan dan Kesatuan Untuk Anak Sekolah Dasar Kelas Rendah. Skripsi Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing : (I) Drs. Didiek Rahmanadji, (II) Moch. Abdul Rohman, S.Sn, M.Sn. Kata Kunci : Perancangan, Buku Cerita Bergambar, Still Life, Fotografi, Media Pembelajaran, Persatuan dan Kesatuan, Anak SD. Maraknya kasus kekerasan anak oleh teman sebayanya atau sering disebut bullying menjadi keprihatinan bagi bangsa karena anak-anak merupakan generasi penerus yang seharusnya menjadi pribadi yang memiliki nilai persatuan dan kesatuan. Kurangnya peran orang tua dalam memberikan pembelajaran moral kepada anaknya juga dapat memberikan dampak buruk bagi pertumbuhan psikologi anak. Melalui buku cerita bergambar ini diharapkan dapat memberikan stimulus bagi para siswa sekolah dasar khususnya kelas 1-3 untuk lebih dapat menghargai sesama dan memiliki jiwa persatuan dan kesatuan. Perancangan ini menggunakan model perancangan prosedural. Langkah-langkah pada model perancangan ini menjelaskan secara deskriptif dengan menggariskan langkah-langkah perancangan yang sistematis dan berurutan mulai dari merumuskan masalah, menetukan tujuan, menganalisis target pengguna, pengumpulan data, merumuskan konsep perancangan, dan eksekusi desain. Data berasal dari berbagai sumber yang didapat melalui observasi, wawancara dan mengunakan studi pustaka. Teknik visualisasi menggunakan Corel Draw X3 untuk membuat karaktaer dan Photoshop CS3 untuk editing fotonya. Hasil visualisai berupa cerita dengan karakter papper toy yang di eksekusi menjadi sebuah fotografi still life. Hasil perancangan adalah buku cerita bergambar full color 34 halaman tentang nilai persatuan dan kesatuan untuk anak SD kelas rendah sebagai media pembelajaran. Buku cerita bergambar memiliki dimensi landscape dan dijilid langsung laser. Cover menggambarkan persatuan dan kesatuan. Dari perancangan ini saran yang diberikan adalah perlu meningkatkan jenis kegiatan yang mengajarkan anak tentang moral serta memperbanyak media pembelajaran yang disukai anak-anak. Perancangan ini masih perlu adanya pengembangan tindak lanjut karena tanpa melalui proses uji coba dan validasi produk. Perancangan selanjutnya dapat dilakukan kajian untuk memberikan inovasi terhadap pengembangan karakter anak yang lebih inovatif dan kreatif, sehingga kemampuan anak terus berkembang sesuai dengan perkembangan teknologi.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 |