Keefektifan konseling kelompok ringkas berfokus solusi untuk meningkatkan percaya diri siswa Sekolah Menengah Pertama / Devi Eryanti

 

ABSTRAK Eryanti, Devi, 2015. Keefektifan Konseling Kelompok Ringkas Berfokus Solusi untuk Meningkatkan Percaya Diri Siswa SMP. Tesis. Program Studi Bimbingan dan Konseling, Pascasarjana Universitas Negeri Malang. (I) Dr. M. Ramli, M. A. (II) Dr. Blasius Boli Lasan, M. Pd. Kata kunci: konseling kelompok ringkas berfokus solusi, percaya diri, sekolah menengah pertama Percaya diri dibutuhkan oleh setiap individu, termasuk remaja. Rasa percaya diri yang dimiliki remaja akan mempengaruhi pengembangan potensi yang dimilikinya apabila remaja tersebut memiliki rasa percaya diri yang rendah maka potensi yang ada didalam dirinya akan terhambat. Jika remaja memiliki kepercayaan diri yang tinggi maka potensi didalam diri remaja tersebut dapat tereksplorasi dengan baik. Penelitian ini bertujuan mengetahui keefektifan konseling kelompok ringkas berfokus solusi untuk meningkatkan percaya diri siswa SMP Negeri 5 Malang. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan eksperimen murni. Desain penelitian yang digunakan adalah pretest and posttest control group design. Subjek penelitian ini adalah 12 orang siswa yang memiliki percaya diri sangat rendah dan rendah. Data diperoleh dari hasil pretest skala percaya diri. Analisis data yang digunakan adalah uji beda Wilcoxon dan uji Two-Independent-Sample Test-Mann-Whitney U. Hasil penelitian menunjukkan bahwa konseling kelompok ringkas berfokus solusi efektif untuk meningkatkan percaya diri siswa SMP. Terlihat dari hasil analisis mean skor posttest dari kelompok eksperimen yang lebih besar daripada mean skor posttest kelompok kontrol, yakni 9,50>3,50. Selanjutnya, dilihat dari output Test Statistics menunjukkan bahwa asymp. Sig. (2-tailed) adalah 0,004, atau probabilitas di bawah 0,05 (0,004< 0,05). Saran penelitian hendaknya (1) konselor menggunakan konseling kelompok ringkas berfokus solusi untuk membantu konseli meningkatkan percaya diri, dan (2) peneliti selanjutnya melakukan penelitian dengan melibatkan subjek yang lebih banyak sehingga diperoleh generalisasi yang lebih luas.

Penetapan harga pokok produksi sebagai dasar penentuan harga jual pada perusahaan senapan angin CV. BIma Asta" Pare Kediri / oleh Moerdwiani Lestari"

 

Proses pemeriksaan perkara pidana di Pengadilan Negeri Malang (suatu tinjauan terhadap pelaksanaan Undang-undang No. 8 tahun 1981 tentang KUHAP)
oleh Agus Sugianto

 

Penyerapan tenaga kerja pada usaha tani bibit buah di kecamatan Ngunut kabupaten Tulungagung / oleh Didik Trimarsono

 

Pengaruh pemberian kredit TRI terhadap pendapatan masyarakat di wilayah kerja KUD Karya Bakti kec. Kesamben kab. Jombang
oleh Julisno Irianto

 

Studi tentang motivasi dan hubungannya dengan partisipasi siswa dalam kegiatan koperasi sekolah di SMEA negeri kabupaten Bojonegoro
oleh Muhammad Junaedi

 

The use of intralingual subtitle in animation video and Vocabulary Self-collection Strategy (VSS) to improve the 7th graders' vocabulary mastery at SMPN 13 Malang / Dias Tiara Putri Utomo

 

ABSTRAK Utomo, Dias Tiara Putri. 2015. Penggunaan Intralingual Subtitle dalam Video Animasi dan Vocabulary Self-Collection Strategy (VSS) untuk Meningkatkan Penguasaan Kosakata Siswa Kelas 7 di SMPN 13 Malang. Skripsi, Jurusan Bahasa Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing; (I) Prof Bambang Yudi Cahyono, M. Pd., MA, Ph. D., (II) Siti Muniroh, S.Pd., MA Kata kunci: penguasaan kosakata, intralingual subtitle dalam video animasi, Vocabulary Self-Collection Strategy (VSS), tanggapan siswa Sebagai salah satu dari komponen kebahasaan, kosakata merupakan komponen yang penting untuk dapat menguasai kemampuan kebahasaan. Penelitian ini dilakukan karena siswa kelas 7A, yang diajar oleh peneliti pada saat program Kajian Praktek Lapangan, memiliki masalah kosakata. Hasil tes kosakata pada observasi awal menunjukkan bahwa 23 (66%) dari 35 siswa mencapai nilai di bawah KKM untuk mata pelajaran bahasa Inggris di SMPN 13 Malang, yaitu 75. Masalah ini perlu diselesaikan karena kelas 7 harus disiapkan sebelum menghadapi jenjang yang lebih tinggi. Oleh karena itu, rumusan masalah pada penelitian ini adalah “Bagaimana penggunaan intralingual subtitle dalam video animasi dan Vocabulary Self-Collection Strategy (VSS) dapat digunakan untuk meningkatkan penguasaan kosakata siswa kelas 7 SMPN 13 Malang?” Penelitian ini adalah penelitian tindakan kelas (PTK). Penelitian ini dilaksanakan untuk dua pertemuan dalam satu siklus dan terdiri dari empat langkah (merencanakan, melaksanaan tindakan, mengamati, dan merefleksi). Subyek penelitian adalah siswa kelas 7A di SMPN 13 Malang tahun ajaran 2015/2016. Instrumen yang digunakan dalam penelitian ini adalah pedoman wawancara untuk guru bahasa Inggris, catatan observasi,video, kuesioner, dan tes kosakata. Kriteria keberhasilan yang ditetapkan oleh peneliti adalah 75% dari siswa mencapai skor sama atau lebih tinggi dari 75 dalam tes kosakata, dan 75% dari siswa menunjukkan tanggapan positif terhadap pelaksanaan strategi. Hasil penelitian menunjukkan bahwa (1) 83% dari siswa atau 29 dari 35 siswa mencapai nilai yang sama atau lebih tinggi dari nilai kelulusan, menunjukkan bahwa penggunaan intralingual subtitle dalam video animasi melalui VSS meningkatkan penguasaan kosakata siswa, (2) langkah-langkah pelaksanaan penggunaan subtitle intralingual dalam video animasi melalui VSS dirumuskan sebagai berikut. 1) Siswa menonton video animasi dengan intralingual subtitle. Namun sebelum menonton video, para siswa diminta untuk memilih satu kata dari video yang mereka dianggap penting, menarik, atau asing untuk mereka. 2) Siswa dibagi menjadi beberapa kelompok yang terdiri dari 3 sampai 4 anggota masing-masing kelompok. Jadi, ada 3 sampai 4 kata yang dipilih untuk masing-masing kelompok. 3) Siswa mengisi grafik VSS yang terdiri dari satu lingkaran dan empat kotak. 4) Setiap kelompok mempresentasikan karya untuk seluruh kelas. 5) Para siswa dan guru menganalisis daftar kata yang telah ditulis di papan tulis, dan (3) sekitar 90% dari siswa menunjukkan tanggapan positif selama proses belajar mengajar, menunjukkan bahwa penggunaan intralingual subtitle dalam video animasi melalui VSS membuat siswa menunjukkan respon positif terhadap pelaksanaan strategi. Penggunaan intralingual subtitle dalam video animasi dan Vocabulary Self-Collection Strategy (VSS) dapat menyelesaikan masalah pada penelitian ini karena siswa terlibat secara aktif dengan kata-kata dalam pembelajaran dan berpartisipasi secara langsung dalam berbagai kegiatan kelas. Berdasarkan hasil penelitian, peneliti menyarankan bahwa guru bahasa Inggris terutama guru kelas 7 untuk menerapkan penggunaan intralingual subtitle dalam video animasi melalui VSS sebagai strategi alternatif untuk mengajarkan kosakata. Peneliti juga menyarankan agar peneliti selanjutnya menguasai aplikasi subtitling sehingga mereka dapat menggunakan video apa saja yang mereka inginkan. Peneliti mengalami kesulitan dalam memilih video yang cocok karena tidak menguasai aplikasi subtitling.

Analisis nilai-nilai kesadaran bernegara masyarakat Jawa dalam cerita wayang purwa / oleh Budi Widodo

 

Aktivitas fosforilasi ATP pada protein 64 dan 33 kDa membran spermatozoa sapi Aberdeen Angus sebagai parameter kualitas sperma / Rizal Kurniawan Sakti

 

ABSTRAK Sakti, K. R. 2015. Aktivitas Fosforilasi ATP Pada Protein 64 dan 33 kDa Membran Spermatozoa Sapi Aberdeen Angus Sebagai Parameter Kualitas Sperma. Skripsi. Jurusan Biologi, Fakultas matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing : (I) Dr. Umie Lestari, M.Si, (II) Dra. Nursasi Handayani, M.Si. Kata Kunci: Analisis Protein, Protein Transmembran Spermatozoa, Aktivitas Fosforilasi, Parameter kualitas sperma. Rendahnya Inseminasi Buatan (IB) dapat dijadikan evaluasi dalam pengujian kualitas sperma. Biasanya pengujian spermatozoa sebelum IB hanyalah seputar dengan pengujian makroskopik dan mikroskopik. Selain itu, juga dapat melalui pengujian secara molekular yaitu dengan melihat prediksi kadar ATP melalui isolasi protein membran spermatozoa sapi yang digunakan dalam proses IB. Sapi yang terkait dalam penelitian ini adalah sapi Aberdeen angus. Tujuan penelitian ini adalah mengetahui aktivitas fosforilasi ATP pada protein membran spermatozoa sapi aberdeen angus sebagai parameter kualitas sperma sapi. Penelitian ini merupakan penelitian deskriptif eksploratif dengan observasi laboratoris yang dilakukan dalam bulan November-Desember 2015. Analisis protein menggunakan crude protein hasil isolasi protein transmembran spermatozoa sapi Aberdeen angus yang kemudian dilakukan analisis dengan menggunakan metode elektroforesis SDS-PAGE yang telah memunculkan pita protein spesifik dengan berat molekul 64 kDa sebagai calcium binding protein dan 33 kDa sebagai protein tirosin fosforilasi. Pita tersebut kemudian dipotong dan dilakukan analisis dengan metode elektroelusi. Protein hasil elektroelusi dilakukan perhitungan untuk mencari ATP yang bereaksi dan unit aktivitas fosforilasi. Didapatkan hasil, protein pada berat molekul 64 kDa telah memfosforilasi ATP sebesar 41 ppm dengan unit aktivitas 119,013062x103 µmol/ml/menit dan protein dengan berat molekul 33 kDa telah memfosforilasi ATP sebesar 27 ppm dengan unit aktivitas 78,374456x103µmol/ml/menit. Besarnya jumlah ATP yang difosforilasi mengindikasi bertambahnya unit aktivitas fosoforilasi serta bertambahnya kecepatan protein dalam memfosforilasi protein. Berdasarkan penelitian yang telah dilakukan dapat disimpulkan bahwa, aktivitas fosforilasi protein membran spesifik dengan berat molekul yaitu 64 kDa lebih besar daripada protein membran pada berat molekul 33 kDa yang dilihat dari banyaknya ATP yang bereaksi dan unit aktivitas protein dalam memfosforilasi gugus fosfat yang terdapat pada molekul ATP. Besarnya nilai ATP yang bereaksi sebanding dengan besarnya jumlah unit aktivitas fosforilasi dan kecepatan fosforilasi setiap protein.

Penerapan model problem solving untuk meningkatkan hasil belajar IPA kelas V SDN Tulusrejo 02 Malang / Gita Septyanna Wulandari

 

Kata kunci: Problem Solving, Hasil Belajar IPA, Sekolah Dasar Dari hasil observasi terhadap siswa dan guru diketahui bahwa pembelajaran masih berpusat pada guru. Guru masih menggunakan metode ceramah dalam menyampaikan materi, siswa hanya mendengarkan penjelasan guru, sehingga siswa kurang bersemangat dalam belajar. Guru kurang kreatif dalam menyampaikan materi, siswa hanya membayangkan apa yang sisampaikan guru tanpa memperoleh pengalaman langsung Penelitian ini bertujuan untuk mendeskripsikan: (1) Penerapan model Problem Solving dalam pembelajaran IPA materi pesawat sederhana siswa kelas V SDN Tulusrejo 02 Malang; (2) Peningkatan hasil belajar IPA materi pesawat sederhana Kelas V SDN Tulusrejo 02 Malang menggunakan model Problem Solving. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) model kolaboratif, yaitu kerjasama antara peneliti dengan guru kelas, peneliti sebagai pengajar dan guru kelas sebagai observer. Subjek penelitian dibatasi pada siswa kelas V SDN Tulusrejo 02 Malang yang berjumlah 38 siswa. Instrumen yang digunakan adalah observasi, wawancara, dokumentasi, dan tes. Hasil penelitian menyimpulkan bahwa dengan penggunaan model Problem Solving dapat meningkatkan hasil belajar IPA materi pesawat sederhana kelas V SDN Tulusrejo 2 Malang. Dalam menerapkan model Problem Solving pada materi pesawat sederhana terdapat langkah-langkah yang sistematis sehingga siswa menjadi terus termotivasi dalam pembelajaran. Hasil belajar siswa telah meningkat dari pra tindakan ke siklus 1 dan siklus 2.. Peningkatan hasil belajar IPA tersebut, terlihat hasil belajar dari pra tindakan dengan siklus 1 dan siklus 2. Hasil belajar tersebut terbukti bahwa pada pra tindakan siswa yang tuntas dengan nilai 75 adalah 13,1%, sedangkan 78,3% siswa tidak tuntas. Pada siklus 1 dengan penerapan model problem solving terlihat adanya peningkatan hasil belajar yaitu dari 38 siswa dengan nilai 75 adalah 31% siswa tuntas, sedangkan 60,4% tidak tuntas, dan pada siklus 2 dengan nilai 75 adalah 10,5% siswa tidak tuntas dan 86,9% siswa tuntas. Dari ketuntasan klasikal hasil belajar siswa yang peneliti inginkan adalah >75% dari jumlah siswa dalam kelas tuntas, tetapi dalam penerapannya pada akhir siklus 2 siswa yang tuntas dalam kelas V SDN Tulusrejo 02 Malang adalah 86,9% tuntas. Peningkatan hasil belajar dari pra tindakan sebesar ke siklus 1 adalah 17,9%, sedangkan dari pra tindakan ke siklus 2 adalah 73,8%, dari peningkatan yang dapat dikatakan cukup besar itu, maka penerapan model problem solving dapat meningkatkan hasil belajar siswa kelas V SDN Tulusrejo 02 Malang dan model problem solving sudah cocok untuk diterapkan dikelas V SDN Tulusrejo 02 Malang dengan materi pesawat sederhana.. Saran yang dapat disampaikan dari penelitian adalah sebaiknya guru kelas V SDN Tulusrejo 02 Malang untuk dapat menggunakan beberapa model pembelajaran agar siswa lebih tertarik, sehingga dapat meningkatkan hasil belajar siswa pada pembelajaran IPA. Untuk kepala sekolah SDN Tulusrejo 02 Malang agar dapat memfasilitasi siswa dalam proses pembelajaran dan untuk penelit lanjutan sebaiknya untuk penerapan model problem solving disiapkan lembar observasi aktivitas siswa yang terkait dengan model yang digunakan, hal ini dimaksudkan agar penelitian lebih berjalan dengan baik dan peneliti dapat mengetahui keberhasilan penerapan model yang digunakan.

Pengaruh perkawinan usia muda terhadap pembinaan anak bidang pendidikan formal di desa Wotgalih kabupaten Pasuruan / oleh Bayu Indrasena

 

Partisipasi pemimpin non formal dalam pembangunan masyarakat desa di desa Crabak kecamatan Slahung kabupaten dati II Ponorogo / oleh Lilik Pujowati

 

Pola tradisi paternalistik di pondok pesantren studi kasus tentang pola hubungan sosial santri-kyai di pondok pesantren al-Ishlahiyyah Kemayan-Mojo-Kediri / oleh Sriyatun

 

Paket pengembangan pelatihan mendengarkan dalam keterampilan hubungan antar pribadi bagi mahasiswa baru Jurusan PPB FIP IKIP MALANG / oleh Hasbullah Bin Haji Abu Kassim

 

Persepsi siswa tentang kemantapan aspek usaha dan hubungannya dengan partisipasi siswa dalam berkoperasi (studi kasus di SMEA Negeri 1 Malang) / oleh Suci Restianti

 

Implementasi model regresi Com-Poison untuk mengatasi kasus underdispersi pada model regresi Poison (studi kasus data kecelakaan lalu lintas tahun 2014 di Kabupaten Trenggalek) / Eva Puji Astuti

 

ABSTRAK Astuti, Eva Puji. 2015. Implementasi Model Regresi COM-Poison untuk Mengatasi Kasus Underdispersi pada Model Regresi Poison (Studi Kasus Data Kecelakaan Lalu Lintas Tahun 2014 di Kabupaten Trenggalek). Skripsi, Jurusan Matematika, Fakultas Matematika dan ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Trianingsih Eni Lestari, S.Si, M.Si. Kata Kunci: Regresi Poison Model, Underdispersi, Regresi Model COM-Poison, Kecelakaan Regresi Poisonmodel merupakan metode dasar yang dapat digunakan untuk memodelkanhubungan antara variabel dependent dan variabel independent Y yang merupakan data cacah yang mengikuti distribusi Poison. Pada regresi Poison mengasumsikan bahwa mean sama dengan varians (equidispersi). Tetapi, pada kenyataannya terdapat data yang tidak memenuhi asumsi tersebut yaitu varian lebih besar dari mean (overdispersi) atau varian lebih kecil dari mean (underdispersi). Oleh karena itu, jika regresi Poison tetap digunakan maka akan terjadiunderestimate ataustandart error menjadi lebih kecil.Pada penelitian sebelumnya kasus overdispersi ditangani dengan menggunakan regresi Binomial Negatif. Sedangkan, kasus underdispersi ditangani dengan regresi Generalized Poison (GP), tetapi hanya mampu menangani kasus dispersi pada selang (0.75,1). Oleh karena itu, muncullah model regresi COM-Poison yang mampu menangani kasus overdispersi atau underdispersi dengan tingkat dispersi yang lebih luas. Penelitian ini dilaksanakan dengan tujuan untuk mengimplementasi model regresi COM-Poison untuk mengatasi kasus underdispersi pada model regresi Poison. Penelitian ini dilakukan dengan menggunakan data kecelakaan tahun 2014 di Kabupaten Trenggalek.Pada penelitian ini memperoleh kesimpulan bahwa model regresi COM-Poison yang dapat digunakan untuk memodelkan data kecelakaan di Kabupaten Trenggalek adalah 〖log⁡(〗⁡〖λ)〗=5.5395+0.000935(x_1 )-0.00020(x_2 )dan log⁡〖(v)=〗 0.9243⟺v=2.5. Dengan persamaan penduga untuk nilai Y adalah y ̂|x=(exp⁡(5.5395+0.000935(x_1 )-0.00020(x_2 ) ) )^0.4-0.3. Model regresi COM-Poison tersebut memberikan kontribusi atau pengaruh terhadap kejadian kecelakaan di Kabupaten Trenggalek sebesar 80.08%. Sedangkan untuk 19.92% faktor penyebab terjadinya kecelakaan dipengaruhi oleh faktor-faktor lain yang tidak diteliti pada penelitian ini. Dalam model regresi COM-Poison tersebut faktor bus memiliki pengaruh yang lebih besar dibandingkan faktor pelanggaran terhadap kejadian kecelakaan di Kabupaten Trenggalek.

Hubungan antara persepsi anggota terhadap koperasi dengan tingkat partsipasinya di KWSP Tuhu Premati Wredi" kodya Malang / oleh Nunik Tubinarti"

 

Penerapan model project-based learning untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Ketawanggede 2 Malang / Dewi Nofita Sari

 

Kata kunci: Model Project-Based Learning, Aktivitas, Hasil belajar, IPA. Berdasarkan hasil observasi awal terhadap pembelajaran IPA kelas IV SDN Ketawanggede 2 Malang, terdapat permasalahan siswa pasif dalam pemebalajaran IPA dan guru masih menggunakan metode ceramah. Hasil belajar siswa masih tergolong rendah. Hal ini dapat dilihat dari rata-rata hasil belajar pratindakan pada ulangan harian yaitu 59, jauh dari ketuntasan belajar individu yang telah ditetapkan yaitu 67. Oleh karena itu peneliti menerapkan model Project-Based Learning untuk mengatasi permasalahan yang ada. Penelitian ini bertujuan untuk mendeskripsikan: (1)penerapan model proyek pada pembelajaran IPA, (2) aktivitas belajar siswa kelas IV, (3) hasil belajar IPA setelah menerapkan model pembelajaran proyek di kelas IV. Subyek dari penelitian adalah siswa kelas IV sebanyak 23 siswa yang terdiri dari 12 siswa laki-laki dan 11 siswa perempuan. Rancangan penelitian yang digunakan adalah PTK, dalam bentuk kolaboratif partisipatoris. Pelaksanaan PTK mengacu pada model siklus PTK yang dikembangkan oleh Kemmis dan Taggart, meliputi empat tahap yaitu 1) planning, 2) acting & observing, 3) reflecting dan 4) revise plan. Sedangkan teknik pengumpulan data menggunakan teknik observasi, dokumentasi, dan tes. Hasil penelitian menyimpulkan bahwa penerapan model proyek pada pembelajaran IPA siswa kelas IV dalam dua siklus dengan setiap siklus terdiri dari 2 pertemuan. Hal ini terbukti pada setiap siklus seluruh indikator dapat tercapai dengan baik sesuai RPP yang dibuat. Guru memfasilitasi dan memotivasi siswa sehingga siswa dapat membentuk pengetahuan sendiri melalui serangkaian aktivitas/kegiatan. Penggunaan model ini dapat meningkatkan aktivitas. Hal ini terbukti dari rata-rata aktivitas belajar siswa sebelumnya yaitu 81 pada siklus I meningkat menjadi 91,6 di siklus II. Hasil belajar siswa juga mengalami peningkatan. Hal ini terbukti dari rata-rata hasil belajar pratindakan pada materi "energi dan perubahannya” adalah 59 yang tuntas hanya 6 orang (26%), pada siklus I meningkat menjadi 74,5 yang tuntas 16 siswa (69,6%). Sedangkan di siklus II mengalami peningkatan lagi menjadi 89,2 yang tuntas 22 siswa (95,6%). Kesimpulannya penerapana model proyek dapat meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN ketawanggede 2 Malang. Saran bagi Kepala Sekolah agar memotivasi guru untuk lebih terfokus dalam meningkatkan aktivitas dan hasil belajar dengan menerapkan model proyek. Untuk guru dan peneliti lain dalam menerapkan model proyek tidak terpisah-pisah, sebaiknya 1 proyek minimal di selesaikan 1 siklus dan untuk siklus berikutnya diupayakan mengganti dengan kegiatan proyek lain yang sesuai dengan proyek sebelumnya.

Beberapa faktor yang berpengaruh terhadap penyerapan tenaga kerja di sektor industri kecil kulit kecamatan Magetan Kabupaten Magetan / oleh Herin Triningsih

 

Motivasi yang mendorong alumnus Jurusan Pendidikan Seni Rupa dan Kerajinan FPBS IKIP MALANG untuk berwiraswasta (studi kasus)m / oleh Sunarto

 

Kompetensi profesional guru seni rupa dalam pembelajaran seni lukis di SMA Negeri se-kabupaten Lumajang / Septian Retnani

 

ABSTRAK Retnani, Septian.2015. KompetensiProfesional Guru SeniBudayaBidangSeniRupaDalamPembelajaranSeniLukis di SMA Negeri se-KabupatenLumajang. Skripsi, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang.Pembimbing: (I) Dra. TjitjikSriwardhani, M.Pd., (II) Moch. Abdul RohmanS.Sn, M.Sn. Kata kunci :kompetensi professional guru, senilukis, SMA, Lumajang Guru professional merupakan guru yang menguasaikompetensiprofessionalnya, memiliki pengetahuan luas dan mendalam padabidangnya. Terwujudnya pembelajaran seni lukis yang berkualitas sangat tergantung pada proses pembelajaran yang berlangsung. Sedangkanpembelajaran yang berkualitassangatdipengaruhiolehkualitaspendidikitusendiribaikdalampenguasaanilmupengetahuandanpelaksanaanpembelajarannya, sehinggamenarikuntukditeliti.Penelitianinibertujuanuntukmendeskripsikanmengenaikompetensi professional guru senirupadalampembelajaransenilukis di SMANegeri se-kabupatenLumajang. Penelitian inimenggunakanjenispenelitiandeskriptifkuantitatifdenganpendekatananalisis data deskriptif. Ditujukan untuk mendeskripsikan bagaimana kompetensi profesional guru Seni Rupa dalam pembelajaran seni lukis di SMA Negeri se Kabupaten Lumajang yang meliputi: (1) PenguasaanilmupengetahuanSeniRupa. (2) PengetahuandanpemahamantentangpembelajaranSeniLukis SMA. (3) PelaksanaanpembelajaranSeniLukis SMA. Subjek penelitian sebanyak 6 guru diambil dari 6 sekolah sebagai sampeluntukmenjaring data menggunakaninstrumenangket. Analisis data deskriptifkuantitatifdenganmengunakanskalapengukuran rating scale untukmenjaring data meliputi (1) PenguasaanilmupengetahuanSenirupa. (2) pengetahuandanpemahamanpembelajaransenilukis SMA, dan (3) pelaksanaanpembelajaransenilukis di SMA. Hasil dari penelitian kompetensi profesional guru Seni Budaya bidang Seni Rupa dalam pembelajaran seni lukis di SMA Negeri se Kabupaten Lumajang sudah baik/mampu dalam berbagai hal yang ditelitikan. Penjabaran dari hasil penelitian adalah sebagai berikut: (1) Penguasaanilmusenirupakhususnyadalampembelajaransenilukis SMA yang meliputimateridankonsepsudahbaik /mampudengan rata-rata hasilpenghitungamerujukpadakriteriamampu. (2) PengetahuandanpemahamantentangpembelajaransenilukisSMAsudahbaik /mampudengan rata-rata hasilpenghitungamerujukpadakriteriamampu. (3) Pelaksanaanpembelajaransenilukis SMA sudahbaik /mampudengan rata-rata hasilpenghitungamerujukpadakriteriamampu. Saran untuk guru Seni Budaya agar memperbaiki dan meningkatkan mutu pendidikan senikhususnyadalampembelajaransenilukis SMA di kabupatenLumajangdenganpenggunaan media danmetodepembeljaran, sertaperangkatpembelajaran yang baik.

Zero-inflated poisson regression untuk memodelkan faktor-faktor yang mempengaruhi terjadinya kebakaran di Kabupaten Sidoarjo / Febri Rahmat Dona

 

ABSTRAK Dona, Febri Rahmat. 2015. Zero-Inflated Poisson Regression untuk Memodelkan Faktor-Faktor yang Mempengaruhi Terjadinya Kebakarandi Kabupaten Sidoarjo. Skripsi, Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing: Ir. Hendro Permadi, M. Si. Kata Kunci: Regresi Poison, Regresi Zero-Inflated Poisson, Kebakaran. Sidoarjo adalah kabupaten yang memiliki angka kebakaran tinggi untuk setiap tahunnya. Hampir disetiap kecamatan selama tahun 2013-2014 terjadi kebakaran. Kebakaran biasanya terjadi karena konsleting, putung rokok, kompor/LPG, BBM dan lainya serta sering terjadi pada perumahan, pabrik, lahan tebu, sawah dan pada ilalang. Banyak faktor yang mempengaruhi terjadinya angka kebakaran yang tinggi di Kabupaten Sidoarjo, faktor-faktor tersebut diantaranya banyak pabrik, padatnya penduduk serta suhu yang panas mudah menyebabkan ilalang, sawah, tebu mudah kering dan mudah terbakar. Model regresi Poison merupakan salah satu model yang digunakan untuk memodelkan hubungan antara variabel terikat berupa data diskrit yang berdistribusi Poisondengan variabel bebas berupa data campuran (kontinu dan diskrit). Terdapat asumsi yang harus dipenuhi dalam model regresi poisonyaitu variansi dari variabel terikat sama dengan rataannya (equidispersion). Namun, sering ditemukan data diskrit yang memiliki varian lebih besar dari rata-rata (overdispersi) atau varian lebih kecil dari rata-rata (underdispersi). Penelitian ini menetapkan 5 faktor yang mempengaruhi angka kebakaran di Kabupaten Sidoarjo tahun 2013-2014. Faktor-faktor itu yaitu kepadatan penduduk (X_1), jumlah pabrik (X_2),luas lahan tebu dan sawah (X_3), luas lahan kosong yang ditumbuhi ilalang (X_4) dan tahun (X_5).Berdasarkan model regresi Zero-Inflated Poisson (ZIP) didapatkan model yang terbaik yaitu angka kebakaran dipengaruhi oleh kepadatan penduduk (X_1), luas lahan tebu dan sawah (X_3), dan kode tahun (X_5) untuk membedakan selisih kejadian kebakaran setiap tahun. Model tersebut memiliki nilai AIC (257,4) terkecil dan nilai R^2 (70,86). Jadi ketiga faktor tersebut mempengaruhi angka kebakaran sebesar 70,86% dan sisanya 29,14% dipengaruhi hal lain. Model regresi ZIP yaitu λ=exp⁡(2,7614-0,00009x_1-0,03145x_3+0,05046x_5 )dan ω=exp⁡(-33,9425+0,03704x_1-29,7996x_3-42,2151x_5 )/(1+exp⁡(-33,9425+0,03704x_1-29,7996x_3-42,2151x_5 )). Model λdigunakan untuk mengitung nilai harapan angka kebakaran dan ωdigunakan untuk mengitung peluang tidak terjadi kebakaran.

Faktor-faktor yang mempengaruhi perilaku masyarakat dalam menggunakan sungai (studi kasus masyarakat tepian sungai Brantas di Kotamadya Malang) / oleh Setyo Boedi Oetomo

 

Kajian collembola pada lahan pertanian dengan pola tanam monokultur dan pola tanam polikultur di Kecamatan Bumiaji, Kota Batu, Jawa Timur / Maulinda Dwita Rijayanti

 

ABSTRAK Rijayanti, Maulinda Dwita. 2015. Kajian Collembola Pada Lahan Pertanian Dengan Pola Tanam Monokultur Dan Pola Tanam Polikultur Di Kecamatan Bumiaji, Kota Batu, Jawa Timur. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Drs. Agus Dharmawan, M.Si, (II) Dra. Hawa Tuarita, M.S Kata Kunci: Collembola, pola tanam monokultur, pola tanam polikultur Pentingnya pengelolaan pertanian yang benar akan mempengaruhi produksi tanaman dan keadaan ekosistem disekitarnya. Salah satu pengelolaan pertanian yang dapat diterapkan adalah perbaikan pada pola tanam suatu lahan pertanian yang secara langsung akan berpengaruh terhadap komunitas Collembola sebagai biota tanah yang berperan dalam kesuburan tanah. Penelitian ini dilakukan dengan pola tanam monokultur dan polikultur pada lahan pertanian di kecamatan Bumiaji, Kota Batu, Jawa Timur. Pengambilan sampel menggunakan purposing area sampling dengan volume tanah sebanyak 200cc pada setiap plot. Dilakukan pengambilan sampel tanah untuk uji N-organik sebanyak 100 gram. Jenis Collembola yang ditemukan pada kedua lahan pertanian sebanyak 10 genus, meliputi genus Homidia, Isotomiella, Onychiurus, Hemisotoma, Pseudanurophorus, Folsomia, Pseudosinella, Folsomina, dan Paranurophorus dan folsomides. Nilai indeks keanekaragaman (H’) pada lahan monokultur termasuk dalam kriteria rendah dan pada lahan polikultur termasuk dalam kriteria sedang. Berdasarkan hasil analisis Paired-Sample T Test menunjukkan bahwa nilai indeks keanekaragaman, kemerataan, kekayaan pada kedua lahan menunjukkan berbeda nyata. Hasil uji t N-Organik pada kedua lahan menunjukkan tidak berbeda nyata. Hasil analisis korelasi-regresi N-Organi terhadap keanekaragaman Collembola memiliki hubungan terhadap indeks kekayaan Collembola. Berdasarkan hasil analisis korelasi-regresi pada lahan monokltur dan pada lahan polikultur untuk faktor abiotik yang memiliki hubungan dengan nilai indeks keanekaragaman dan indeks kemerataan Collembola adalah suhu dan kelembaban.

Hubungan antara pemberian bimbingan belajar oleh orang tua dengan prestasi belajar siswa kelas V SDN Ciptomulyo 1 Kecamatan Sukun kota Malang / Ike Rinnata Septiana

 

Kata Kunci : Bimbingan Belajar Oleh Orang Tua, Prestasi Belajar Turunnya nilai UASBN pada siswa kelas VI menjadi tolok ukur sekolah dan orang tua dalam menilai prestasi belajar siswa di sekolah. Salah satu penyebab turunnya prestasi siswa di sekolah adalah kurang adanya bimbingan belajar yang diberikan orang tua kepada anaknya dalam proses belajar di rumah. Tujuan penelitian ini adalah untuk mengetahui bagaimana pemberian bimbingan belajar oleh orang tua, mengetahui hasil belajar siswa dan untuk mengetahui hubungan antara bimbingan belajar oleh orang tua dengan prestasi belajar siswa kelas V SDN Ciptomulyo 1 Malang. Manfaat penelitian ini bagi orang tua sebagai bahan masukan untuk memberikan informasi pentingnya pemberian bimbingan belajar pada anak yang berdampak pada prestasi belajarnya. Penelitian ini merupakan jenis penelitian kuantitatif dengan menggunakan rancangan penelitian deskriptif korelasional. Populasi yang dipakai adalah semua siswa kelas V SDN Ciptomulyo 1 semester gasal sebanyak 143 siswa. Teknik sampling menggunakan metode stratified random sampling untuk menentukan jumlah sampel yang diambil yaitu sebanyak 37 siswa. Pemberian bimbingan belajar oleh orang tua diukur menggunakan metode angket dan hasil prestasi belajar siswa diperoleh dari nilai raport siswa pada semester gasal. Penelitian ini menggunakan pengujian hipotesis yang diuji dengan analisis regresi sederhana yang pengolahan datanya dibantu dengan menggunakan SPSS 17.0 for windows. Hasil penelitian siswa kelas V tidak ada (0%) siswa yang mendapatkan bimbingan belajar oleh orang tua dengan klasifikasi rendah, 18 siswa (48,65%) mendapakan bimbingan belajar oleh orang tua dengan klasifikasi sedang, dan 19 siswa (51,35%) mendapatkan bimbingan belajar oleh orang tua dengan klasifikasi tinggi. Berdasarkan hasil penelitian prestasi belajar diketahui bahwa dari 37 siswa yang menjadi sampel penelitian, 15 siswa (40,54%) yang mendapatkan prestasi belajar dengan klasifikasi rendah, 11 siswa (29,73%) mendapakan prestasi belajar dengan klasifikasi sedang, dan 11 siswa (29,73%) mendapatkan prestasi belajar dengan klasifikasi tinggi. Hasil uji normalitas diketahui bahwa variabel independen dan dependen memiliki distribusi normal. Sedangkan dari pengujian hipotesis diperoleh nilai sig. (0,000) 0,05 dan thitung (4,703) > ttabel (2,030) sehingga H0 ditolak dan H1 diterima. Adapun saran dari penelitian ini ditujukan kepada guru Sekolah Dasar agar dapat memberikan masukan untuk dapat melakukan kerjasama dengan orang tua siswa dalam rangka meningkatkan prestasi belajar. Selain itu juga ditujukan bagi peneliti lanjutan disarankan untuk menambah jumlah variabel yang akan diteliti.

The effect of the use of English and Indonesian glossary on the English reading comprehension of senior high school second year students / by Patrisius Istiarto Djiwandono

 

Peramalan curah hujan harian maksimum bulanan dengan model sarima dan model exponential smoothing holt-winter pada stasiun curah hujan Sruni di Sidoarjo / Nur Fitri Ekasari Desmawati

 

ABSTRAK Desmawati, N.F.E. 2015. Peramalan Curah Hujan Harian Maksimum Bulanan dengan Model SARIMA dan Model Exponential Smoothing Holt-Winter pada Stasiun Curah Hujan Sruni di Sidoarjo. Skripsi, Jurusan Matematika, FMIPA Universitas Negeri Malang. Pembimbing: Dr. Swasono Rahardjo, S.Pd, M.Si. Kata kunci: Peramalan, Holt-Winter, SARIMA, Curah hujan Penelitian ini bertujuan untuk mengetahui hasil perbandingan peramalan model SARIMA dan model Exponential Smoothing Holt-Winter pada data curah hujan harian maksimum bulanan pada stasiun curah hujan Sruni di Sidoarjo. Penelitian ini juga menjelaskan prosedur penentuan model peramalan curah hujan dengan model SARIMA dan model Exponential Smoothing Holt-Winter. Prosedur penentuan model peramalan dengan model SARIMA, yaitu menggunakan data yang stasioner, jika belum stasioner maka perlu proses differencing dan transformasi, mengidentifikasi model dari pola ACF dan PACF, menguji signifikansi parameter model dan melakukan diagnostik dengan melihat hasil residual. Prosedur penentuan model peramalan dengan model Exponential Smoothing Holt-Winter, yaitu menentukan parameter-parameter pemulusan yang menghasilkan nilai kesalahan ramalan terkecil. Dari hasil penelitian data curah hujan harian maksimum bulanan mulai Desember 2009 sampai April 2015 dari Dinas Pengairan Sidoarjo, diperoleh model SARIMA yang sesuai adalah SARIMA(1,0,1)(1,0,1)10. Model Holt-Winter yang sesuai adalah model dengan nilai parameter pemulusan α=0,1 ,γ=0,1 dan β=0,1. Diperoleh nilai MSE untuk model Holt-Winter sebesar 112,3282. Sedangkan nilai MSE model SARIMA yaitu sebesar 89,73564. Model SARIMA(1,0,1)(1,0,1)10 memperoleh peramalan yang lebih sesuai dengan kenyataan dalam meramalkan curah hujan harian maksimum bulanan pada stasiun penakar curah hujan sruni Sidoarjo untuk periode selanjutnya.

Pengaruh motivasi, pembelajaran, dan sikap terhadap keputusan pembelian sepeda motor Honda (Studi pada konsumen sepeda motor honda di kalangan mahasiswa psikologi Universitas Negeri Malang) / Ugik Oktavianto

 

Pertumbuhan konsumen sepeda motor meningkat luar biasa. Sepeda motor Honda yang sudah lama berada di Indonesia, dengan segala keunggulannya tetap mendominasi pasar dan sekaligus memenuhi kebutuhan angkutan yang tangguh, irit dan ekonomis di tengah-tengah persaingan yang begitu tajam akibat banyaknya merek pendatang baru. Untuk menghadapi persaingan tersebut produk Honda selalu menciptakan penemuan-penemuan baru yang mana disesuaikan dengan perkembangan jaman dan keinginan dari masyarakat agar produknya tetap laku terjual. Jika berbicara tentang penjualan tentu saja berkaitan dengan konsumen dan perilakunya. Perusahaan tentu akan berusaha meningkatkan penjualan dengan berbagai cara, diantaranya memperhatikan faktor yang mempengaruhi keputusan pembelian konsumen. Motivasi, pembelajaran, dan sikap adalah determinan penting bagi keputusan pembelian suatu produk. Rancangan penelitian ini adalah penelitian deskriptif korelasional. Subjek penelitian adalah mahasiswa psikologi Universitas Negeri Malang yang berjumlah 40 orang, dengan teknik pengambilan subyek purposive. Instrumen pengambilan data berupa skala motivasi, pembelajaran, sikap, dan keputusan pembelian. Data penelitian dianalisis dengan teknik analisis korelasi dan teknik analisis regresi linier berganda. Hasil penelitian menunjukkan bahwa: (1) ada hubungan positif antara motivasi dan keputusan pembelian. Motivasi berpengaruh signifikan terhadap keputusan pembelian, variabel motivasi memberikan Pengaruh sebesar 32% terhadap keputusan pembelian; (2) ada hubungan positif antara pembelajaran dan keputusan pembelian. Pembelajaran berpengaruh signifikan terhadap keputusan pembelian, variabel pembelajaran memberikan Pengaruh sebesar 13,06% terhadap keputusan pembelian; (3) ada hubungan positif antara sikap dan keputusan pembelian. Sikap berpengaruh signifikan terhadap keputusan pembelian, variabel sikap memberikan Pengaruh sebesar 23,64% terhadap keputusan pembelian; (4) motivasi, pembelajaran, dan sikap berpengaruh signifikan terhadap keputusan pembelian. Variabel motivasi, pembelajaran, dan sikap secara simultan mampu menjelaskan variabel keputusan pembelian sebesar 68,7%, selebihnya sebesar 31,3% di jelaskan oleh variabel lain yang tidak dibahas dalam penelitian ini. Namun ketika secara bersama-sama, variabel motivasi yang lebih berpengaruh terhadap keputusan pembelian dari pada pembelajaran dan sikap. Berdasarkan hasil penelitian dapat disarankan: (1) kepada perusahaaan untuk lebih memperhatikan faktor motivasi, dengan demikian perusahaan diharapkan dapat meningkatkan motivasi konsumennya yang saat ini berada di tingkat sedang. Karena jika diperhatikan dengan baik maka motivasi meningkat dan pada akhirnya membuat keputusan pembelian naik menjadi lebih kompleks; (2) sedangkan bagi peneliti selanjutnya yang berminat membahas keputusan pembelian disarankan untuk melakukan penelitian secara lebih lengkap dan komprehensif dengan cara menambah variabel-variabel yang mempengaruhi keputusan pembelian

Dominasi partai-partai politik yang berhaluan radikal dalam pergerakan nasional dan pengaruhnya terhadap strategi politik kolonialisme Belanda / oleh Priyadi

 

Pengaruh model pembelajaran Think Talk Write (TTW) berbasis keterampilan berpikir kritis terhadap kemampuan menyusun karya ilmiah geografi siswa kelas XI IIS SMA Negeri 1 Tarik Kabupaten Sidoarjo / Desiana Merawati

 

ABSTRAK Merawati, Desiana. 2015. Pengaruh Model Pembelajaran Think Talk Write Berbasis Keterampilan Berpikir Kritis Terhadap Kemampuan Menyusun Karya Ilmiah Geografi Siswa Kelas XI IIS SMA Negeri 1 Tarik Kabupaten Sidoarjo. Skripsi, Jurusan Geografi, FIS Universitas Negeri Malang. Pembimbing: (1) Dra. Yuswanti Ariani Wirahayu, M.Si, (2) Drs. Soetjipto, T H. M.Pd Kata kunci: Model pembelajaran Think Talk Write berbasis keterampilan berpikir kritis, kemampuan menyusun karya ilmiah. Tidak semua model pembelajaran dapat mendorong siswa untuk mampu menyusun karya ilmiah. Salah satu model pembelajaran yang dapat digunakan untuk meningkatkan kemampuan menyusun karya ilmiah siswa yaitu dengan menggunakan model pembelajaran Think Talk Write berbasis keterampilan berpikir kritis. Pembelajaran menggunakan model Think Talk Write berbasis keterampilan berpikir kritis terdiri dari 3 fase yaitu berpikir berbicara dan menulis. Penelitian ini dirancang menggunakan eksperimen semu (Quasi Experiment) menggunakan desain Static Group Comparasion dan mengambil subyek penelitian dua kelas. Penentuan sampel dalam penelitian ini dilakukan dengan teknik random sampling yang diacak adalah kelasnya untuk menentukan kelas eksperimen XI IIS 3 dan kelas kontrol XI IIS 4. Instrument penelitian ini menggunakan pedoman penskoran karya tulis ilmiah sebagai pedoman dalam memberikan skor hasil karya tulis ilmiah siswa. Teknik analisis data yang digunakan adalah uji-t yang dapat diselesaikan dengan bantuan SPSS 21.00 For Windows. Hasil penelitian ini menunjukkan bahwa terdapat pengaruh penggunaan model pembelajaran Think Talk Write (TTW) berbasis keterampilan berpikir kritis terhadap kemampuan menyusun karya ilmiah geografi siswa kelas XI IIS SMA Negeri 1 Tarik. Dari hasil analisis data diketahui bahwa kemampuan menyusun karya ilmiah pada kelas eksperimen memiliki rata-rata 76,48. Sedangkan kelas kontrol yang memiliki rata-rata 58,78 dengan probabilitas 0,000, sehingga dapat disimpulkan bahwa ada pengaruh model pembelajaran Think Talk Write (TTW) berbasis keterampilan berpikir kritis terhadap kemampuan menyusun karya ilmiah geografi siswa kelas XI IIS SMA Negeri 1 Tarik Kabupaten Sidoarjo.

Hubungan tingkat pengetahuan berkoperasi anggota dengan partisipasi anggota dalam kegiatan berkoperasi di KUD Tani Bahagia kecamatan Karangan kabupaten Trenggalek / oleh Endang Ngestirahaju

 

Hubungan antara motivasi kerja, pengawasan melekat dan disiplin kerja guru sekolah dasar negeri di kecamatan Pilangkenceng kabupaten Madiun / oleh Evi Wahyu Widiastuti

 

Peran Sanggar Pasinaon Pambirawa Keraton Surakarta dalam melestarikan nilai-nilai budaya Jawa melalui tembang macapat di Kabupaten Blitar / Dwi Endah Ratnasari

 

ABSTRAK Ratnasari, Dwi Endah. 2015. Peran Sanggar Pasinaon Pambiwara Keraton Surakarta dalam Melestarikan Nilai-nilai Budaya Jawa melalui Tembang Macapat di Kabupaten Blitar. Skripsi, Program Studi Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Unversitas Negeri Malang. Pembimbing: (1) Drs. Suparlan Al Hakim, M.Si (2) Siti Awaliyah, S.Pd, M.Hum. Kata Kunci: sanggar seni, nilai-niai budaya jawa, tembang macapat Sanggar Pasinaon Pambiwara Keraton Surakarta merupakan salah satu sanggar yang ikut serta dalam pelestarian kebudayaan jawa di Kabupaten Blitar. Saat ini perkembangan arus globalisasi dan pertukaran informasi berjalan sangat cepat. Pada saat ini banyak kebudayaan modern yang cenderung kebarat-baratan masuk di negara Indonesia, hal ini berbanding lurus dengan tata nilai yang berkembang digenerasi muda khusunya di pulau jawa. Kekuatan dan kemampuan budaya lokal serta adanya tata nilai yang berlaku di masyarakat merupakan salah satu faktor yang dapat dijadikan perisai dalam menghadapi era globalisasi. Namun jika sampai kearifan budaya lokal ini hilang atau musnah maka nilai-nilai kebudayaan dan kepribadian masyarakat akan terkikis. Disini sanggar pasinaon pambiwara keraton Surakarta berperan untuk terus melestarikan terus budaya Jawa. Tujuan dari penelitian ini adalah untuk: (1) Mendeskripsikan latar belakang didirikannya sanggar Pasinaon pambiwara keraton surakarta di kabupaten Blitar., (2) Mendeskripsikan ragam nilai budaya Jawa yang dipelajari di sanggar pasinaon pambiwara keraton Surakarta, (3) Mendeskripsikan ragam tembang macapat sebagai media pelestarian nilai-nilai budaya Jawa, (4)Mendeskripsikan peran sanggar pasinaon pambiwara keraton Surakarta dalam melestarikan nilai-nilai budaya Jawa melalui tembang macapat, (5)Mendeskripsikan kendala yang dihadapi oleh sanggar Pasinaon pambiwara keraton Surakarta, (6) Mendeskripsikan Bagaimana upaya dalam mengatasi kendala yang dihadapi. Untuk mencapai tujuan tersebut, peneliti dalam melakukan penelitian menggunakan pendekatatan kualitatif dan jenis penelitiannya kualitatif deskriptif, informan dalam penelitian ini yaitu pengurus sanggar pasinaon pambiwara keraton Surakarta. Prosedur pengumpulan data yang digunakan dalam penelitian ini yaitu observasi, wawancara, dan dokumentasi. Analisis data yang dilakukan dengan cara pengumpulan data, reduksi data, display data, dan kesimpulan/verifikasi. Untuk menjamin keabsahan yang diperoleh, peneliti melakukan: (a) uji kredibilitas, yaitu dengan cara perpanjangan pengamatan, peningkatan ketekunan dalam penelitian, dan triangulasi. Berdasarkan analisis tersebut, diperoleh kesimpulan hasil penelitian sebagai berikut: Pertama, Latar belakang didirikannya sanggar pasinaon pambiwara keraton Surakarta di kota Blitar karena adanya ketakutan akan kepunahan nilai-nilai kebudayaan Jawa yang ada di kota Blitar yang disebabkan oleh dampak negatif era globalisasi. Maka pengurus sanggar saat itu bekerja sama dengan Dinas Pendidikan daerah kota Blitar mendirikan sanggar pasinaon pambiwara keraton Surakarta. Kedua, Pembelajaran di sanggar pasinaon pambiwara keraton Surakarta dilakukan setiap 2 kali dalam seminggu. Proses pembelajaran di sanggar terbagi menjadi 3 tahapan yaitu: (1) tahap pembukaan/awal, (2) tahap inti, dan (3) tahap penilaian dan penutup. Ketiga, Ragam nilai yang terdapat di sanggar pasinaon pambiwara keraton Surakarta ada 3 jenis nilai yaitu nilai religius Jawa, nilai filosofis Jawa dan nilai etis Jawa. Keempat, Ragam tembang jawa yang sering di tembangkan oleh guru macapat adalah tembang dhandhanggula dan tembang pucung. Kelima, beberapa kegiatan yang dilakukan sanggar pasinaon pambiwara keraton Surakarta dalam melestarikan nilai-nilai budaya Jawa melalui tembang macapat, yaitu: (1) latihan rutin menembang macapat, (2) menembangkan tembang macapat sebelum pembelajaran di mulai, (3) mengikuti perlombaan kebudayaan, (4) menjadi pembawa acara dalam acara pernikahan. Keenam, Kendala yang dihadapi yaitu: (1) keterbatasan biaya atau dana (2) jumlah siswa yang terbilang sedikit, (3) tidak mempunyai tempat sendiri, dan (4) kesulitan siswa dalam memahami bahasa Jawa krama. Ketujuh, Upaya yang dilakukan untuk mengatasi kendala yaitu: (1) memperkenalkan sanggar kepada masyarakat melalui berbagai cara, (2) terus membuka penerimaan siswa-siswi baru, (3) mencari dana tambahan atau donatur agar dapat membangun atau membeli tempat, dan (4) menyediakan buku atau media yang membantu siswa dalam memahami bahasa Jawa krama. Berikut ini saran yang diberikan peneliti setelah melakukan penelitian dan pembahasan yang telah diuraikan pada bab sebelumnya: (1) Bagi anggota sanggar pasinaon pambiwara keraton Surakarta agar dapat terus melestarikan budaya Jawa (2) Bagi Dinas Pendidikan dan Kebudayaan daerah kota Blitar diharapkan Pemerintah lebih dapat memperhatikan sanggar-sanggar seni yang ada di kota Blitar (3) Bagi masyarakat kota Blitar Masyarakat kota Blitar juga berperan dalam melestarikan kebudayaan Jawa yang ada di kota Blitar, memberikan contoh sikap dan tutur kata yang sesuai dengan kebudayaan Jawa. (4) Bagi peneliti selanjutnya Diharapkan untuk dapat menjadi penelitian terdahulu dan dapat lebih kritis lagi dalam menganalisis Peran Sanggar Pasinaon Pambiwara Keraton Surakarta Dalam Melestarikan Nilai-Nilai Budaya Jawa Melalui Tembang Macapat Di Kabupaten Blitar.

Pengaruh current ratio dan debt to equity ratio terhadap return on equity dimoderasi CSR pada perusahaan manufaktur yang listing di BEI Tahun 2014 / Nuriyatul Laily

 

ABSTRAK Laily, Nuriyatul.2015.Pengaruh Current Ratio dan Debt to Equity Ratio terhadap Return on Equity Dimoderasi CSR pada Perusahaan Manufaktur yang Listing di BEI Tahun 2014. Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing:(I) Prof. Dr. H. Bambang Banu Siswoyo, M.M., (II) Dr. Ely Siswanto, S.Sos., M.M. Kata Kunci:return on equity, current ratio, debt to equity ratio, corporate social responsibility. Pertumbuhan sektor manufaktur yang melebihi pertumbuhan produk domestik bruto menyebabkan estimasi kebutuhan investasi untuk sektor tersebut meningkat, sehingga peluang investasi juga meningkat. Profitabilitas perusahaan yang dapat dicerminkan melalui Return on Equity (ROE) menjadi salah satu daya tarik investor untuk menanamkan dananya pada perusahaan yang memiliki nilai ROE tinggi. ROE mencerminkan kemampuan perusahaan dalam menghasilkan laba bersih dan memberi keuntungan bagi pemiliknya. Tujuan penelitian ini untuk mengetahui (1) kondisi ROE, CR, DER, dan CSR, (2) pengaruh langsung CR terhadap ROE, (3) pengaruh langsung DER terhadap ROE, (4)apakah CSR memoderasi pengaruh CR dan DER terhadap ROE. Penelitian ini menggunakan pendekatan kuantitatif dengan desain asosiatif kausalitas. Populasinyaadalah perusahaan manufaktur yang listing di BEI tahun 2014 sebanyak 141 perusahaan. Teknik pengambilan sampelmenggunakan purposive sampling sehingga diperoleh 38 perusahaan. Instrumen penelitian yang digunakan adalah dokumentasi. Analisis menggunakan regresi linier berganda dan regresi moderasi menggunakan uji residual denganbantuansoftware SPSS 21.0 dengan taraf signifikansi 5%. Hasil penelitian menunjukkan bahwa: (1) Kondisi variabel ROE, CR, DER, dan CSR sebagian besar berada pada klasifikasi rendah, (2) CR berpengaruh positif signifikan terhadap ROE, (3) DER berpengaruh positif signifikan terhadap ROE, (4) CSR tidak dapat memoderasi pengaruh CR dan DER terhadap ROE. Dengan demikian dalam penelitian ini CSR bukan sebagai variabel moderator. Perusahaan hendaknya lebih efektif dan optimal dalam mengelola modal dan hutangnya agar laba yang diperoleh perusahaan maksimal.Investor hendaknya lebih selektif sebelum memutuskan berinvestasi dengan melihat kemampuan perusahaan dalam mengelola utang dan produktivitasnya, khususnya melihat laba atau pengembalian yang diterima perusahaan. Peneliti berikutnya, hendaknya memperpanjang periode penelitian sehingga akan didapat hasil penelitian yang lebih akurat, dan apabila memilih CSR sebagai variabel penelitian agar menggunakan biaya yang dialokasikan pada CSR sebagai indikator penilaian karena lebih memberikan pengaruh terhadap profitabilitas perusahaan.

Perbandingan sistem distrik dan sistem proporsional dalam pelaksanaan pemilihan umum di Indonesia
oleh Abdul Halim

 

Pengembangan media pembelajaran audio/radio mata pelajaran bahasa Indonesia kelas VIII Sekolah Menengah Pertama di SMPN 4 Probolinggo / Wulan Rahmahdani

 

Kata Kunci : Pengembangan media pembelajaran, Media Audio/Radio, Bahasa Indonesia Perubahan dan perkembangan di beberapa bidang dalam kehidupan selalu terjadi dari masa ke masa, terutama dibidang ilmu pengetahuan dan teknologi. Perkembangan ilmu pengetahuan dan teknologi yang begitu pesat perlu diimbangi dengan pembaharuan dibidang-bidang lain termasuk dalam bidang Pendidikan. Selain itu, Anderson, ( dalam Munadi 2008:65) mencoba menghubungkan program audio dengan tujuan pembelajaran kognitif, psikomotorik dan afektif. Untuk tujuan kognitif, audio dapat digunakan untuk mengajar pengenalan kembali atau pembedaan rangsang audio yang relevan, contohnya : 1) memperdengarkan suara-suara tanda bahaya tertentu atau alat-alat lain sehingga siswa dapat mengambil tindakan tertentu. 2) mengajarkan pengenalan kembali dialek dan istilah yang berhubungan dengan pekerjaan atau untuk memperdengarkan suara lapangan disertai suara latar belakangnya. 3) memberikan latihan pendengaran, untuk belajar mengingat dan mengucapkan kata-kata. Tujuan dari penelitian ini adalah menghasilkan produk media audio/radio pembelajaran khusus untuk pembelajaran Bahasa Indonesia pokok materi drama kelas VIII di SMPN 4 Probolinggo berupa CD pembelajaran. Metode pengembangan yang diambil oleh penulis adalah metode R&D, yaitu metode penelitian yang digunakan untuk menghasilkan produk baru atau menyempurnakan produk yang telah ada agar dapat diuji keefektifannya serta dapat dipertanggungjawabkan. Hasil pengembangan diperoleh dari 3 ahli media, 2 ahli materi, uji coba kelompok kecil berjumlah 5 orang siswa, kelompok klasikal berjumlah 15 orang siswa, serta uji coba individu berjumlah 3 orang siswa. Berdasarkan hasil uji coba yang telah dilakukan terhadap ahli media diperoleh rata-rata 75%, ahli materi rata-rata 73%, siswa/audiens perorangan74.4%, siswa/audiens kelompok kecil 70% yang dapat diinterpretasikan dalam kriteria valid, sedangkan siswa/audiens kelompok klasikal diperoleh rata-rata 83% dapat diinterpretasikan dalam kriteria sangat valid. Hasil belajar siswa individu mendapat peningkatan rata-rata 72.5%, kelompok kecil rata-rata 73.5% dan kelompok klasikal diperoleh rata-rata 70%. Untuk mendapatkan penelitian yang lebih akurat, disarankan untuk meneliti dan membandingkan beberapa media yang dikenal selama ini, sehingga guru dapat memilih media pembelajaran yang tepat sehingga dapat meningkatkan hasil belajar selain itu, Waktu yang disediakan harus cukup, pemilihan karakter suara harus sesuai dan tepat, lebih menguasai program pembuatan media audio/radio, persiapan saat pembuatan dan penelitian harus maksimal serta saat pemutaran media harus fokus.

Kinerja pelayanan angkutan umum bus Antar Kota Dalam Propinsi (AKDP) trayek Bojonegoro-Surabaya / Surya Anita Rachmawati

 

ABSTRAK Rachmawati, Surya, Anita. 2015. Kinerja Pelayanan Angkutan Umum Bus Antar Kota Dalam Propinsi(AKDP) Trayek Bojonegoro-Surabaya. Skripsi, Program Studi S1 Pendidikan Teknik Bangunan, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. H. Sugiyanto, S.T, M.T, (II) Pranoto, S.T., M.T. Kata Kunci: kinerja pelayanan, angkutan umum Sarana angkutan umum harus dimaksimalkan sebaik mungkin, selain untuk menarik pengguna jasa angkutan umum serta dapat memberikan dampak positif terhadap perkembangan angkutan umum untuk masa mendatang, karena saat ini banyak masyarakat yang lebih memilih menggunakan kendaraan pribadi. Masalah yang muncul dari bus antar kota trayek Bojonegoro-Surabaya yaitu ketika penumpang harus menunggu waktu yang cukup lama saat operator bus mencari penumpang, atau biasa disebut dengan istilah “ngetem”, kemudian ketika melajukan kendaraan yang terlalu kencang, sehingga sopir bus ugal-ugalan ketika dijalan , hal-hal ini yang membuat sebagian penumpang terkadang malas menggunakan bus sebagai sarana perpindahan tempat. Mempertimbangkan masalah ini, maka diperlukan kinerja pelayanan angkutan umum bus trayek Bojonegoro-Surabaya. Penelitian ini dilakukan dengan tujuan untuk mendeskripsikan kinerja pelayanan angkutan umum bus antar kota dengan trayek Bojonegoro-Surabaya, yang mana kinerja pelayanan mencangkup aksesibilitas, kerapatan,kecepatan, headway, faktor muat (load factor), waktu tunggu, utilitas, dan waktu perjalanan. Pengumpulan data menggunakan metode penyebaran angket untuk mendapatkan informasi mengenai aksesbilitas, wawancara terhadap supir untuk mengetahui besaran utilitas bus, dan survei on board untuk mendapatkan jumlah penumpang, waktu antara (headway), kecepatan perjalanan, aksesibilitas menuju terminal. Analisis data menggunakan alat bantu berupa software Microsoft excel. Hasil penelitian ini menunjukkan bahwa kinerja pelayanan angkutan umum bus antar kota trayek Bojonegoro-Surabaya cukup baik bila ditinjau dari segi aksesibilitas dan headway, dan tidak tidak ideal ketika ditinjau dari segi besarnya kerapatan yang terlalu kecil 0,1491 kend/km dan kurang dan kurang dr standar yang telah di tentukan, dan untuk kecepatan rata-rata bus 38,26 km/jam yang belum memenuhi standar yang ada 25 km/jam (Dirjen Perhubungan Darat). Kinerja angkutan umum yang ditinjau dari waktu tunggu yang tidak melebihi 10-20 menit (World Bank), dan waktu perjalanan yang tidak melebihi waktu maksimal 2-3 jam (Dirjen Perhubungan Darat), sementara utilitas yang mencapai 490 km/kend/hari dalam kondisi jaringan jalan yang baik tidak ideal dengan standart yang ada 230-260 km/kend/hari (World Bank), dan load factor rata-rata 64,75% dan 65,20% yang kurang dari 70% (Dirjen Perhubungan Darat) juga mengakibatkan kurang idealnya kinerja pelayanan bus.

Penerapan pembelajaran kooperatif model TAI (Team Assisted Individualization) untuk meningkatkan motivasi dan hasil belajar biologi siswa kelas XI Ipa 1 MAN 3 Malang / Diana Kusumaningrum

 

Kata kunci: TAI, motivasi, hasil belajar. Berdasarkan hasil observasi yang dilakukan pada tanggal 31 Agustus 2010 di kelas XI IPA 1 MAN 3 Malang diketahui motivasi siswa dalam pelajaran biologi masih kurang. Kurangnya motivasi ditunjukkan oleh kejadian sebagai berikut: 1) kurang aktifnya siswa dalam menjawab pertanyaan dari guru, 2) sedikitnya siswa yang bertanya kepada guru apabila mengalami kesulitan dalam materi yang dipelajari, 3) ketidaktepatan mengumpulkan tugas serta 4) sifat menggantungkan pekerjaan kelompok kepada salah satu anggota kelompoknya. Untuk mengatasi permasalahan tersebut, maka perlu dilakukan penelitian tentang penerapan pembelajaran yang dapat meningkatkan motivasi dan hasil belajar siswa, yaitu dengan penerapan pembelajaran kooperatif TAI (Team Assisted Individualization). Melalui penerapan pembelajaran TAI diharapkan dapat meningkatkan motivasi dan hasil belajar biologi siswa kelas XI IPA 1 di MAN 3 Malang. Penelitian ini merupakan penelitian tindakan kelas (Classroom Action Research) yang dilaksanakan dalam 2 siklus tindakan, setiap siklus terdiri atas tiga pertemuan (6 jam pelajaran). Subjek penelitian yang digunakan dalam penelitian tindakan kelas ini yaitu siswa kelas XI IPA 1 semester ganjil tahun ajaran 2010/2011 MAN 3 Malang yang berjumlah 33 siswa, terdiri 14 siswa laki-laki dan 19 siswa perempuan. Dalam penelitian ini data yang diperoleh berupa motivasi dan hasil belajar siswa serta data pendukung berupa wawancara guru beserta siswa dan catatan lapangan. Motivasi belajar siswa diukur berdasarkan peningkatan dari skor angket motivasi belajar siswa sebelum tindakan dibandingkan dengan skor angket motivasi belajar setelah pemberian tindakan serta peningkatan persentase motivasi yang diketahui berdasarkan lembar observasi yang diisi oleh observer selama proses pembelajaran berlangsung, sedangkan hasil belajar siswa diukur berdasarkan rata-rata skor tes akhir siklus secara klasikal serta ketuntasan belajar siswa pada masing- masing siklus. Instrumen penelitian yang digunakan dalam penelitian ini adalah soal tes, lembar observasi motivasi siswa, dan catatan lapangan. Berdasarkan hasil penelitian diketahui bahwa penerapan pembelajaran kooperatif TAI: 1) dapat meningkatkan motivasi dan hasil belajar biologi siswa kelas XI MAN 3 Malang. Peningkatan motivasi belajar siswa ditunjukkan dengan peningkatan sebesar 24,55% untuk attention; 34,15% untuk relevance; 31,55% untuk confidence; dan 16,42% untuk satisfactio; sedangkan peningkatan motivasi berdasarkan angket sebesar 0,55 untuk attention; 0,69 unuk relevance; 0,6 untuk confidence dan 0,46 untuk satisfaction; 2) belum dapat meningkatkan hasil belajar siswa XI IPA 1 MAN 3 Malang. Rata-rata hasil belajar siswa siklus I adalah 86,56 dan rata-rata hasil belajar secara siklus II adalah 80,54. Persentase ketuntasan siswa siklus I adalah 90,90 % sedangkan persentase ketuntasan siswa siklus II adalah 63,64%. Berdasarkan kesimpulan di atas, maka disarankan:1) guru mata pelajaran biologi di MAN 3 Malang dapat menggunakan model pembelajaran Team Assisted Individualization untuk meningkatkan motivasi dan hasil belajar siswa, 2) hasil penelitian ini hendaknya dapat dijadikan masukan untuk melakukan penelitian lebih lanjut tentang kecermatan pengelolaan waktu, ketepatan pelaksanaan langkah-langkah pembelajaran serta variasi kegiatan pembelajaran dalam Team Assisted Individualization.

Pemrograman komputer tentang analisis hasil ulangan harian dan analisis butir soal serta pengelolaan nilai kelas untuk guru SLTP dan SMU / oleh Ratmanto

 

Studi tentang kegiatan belajar mengajar mahasiswa IKIP MALANG pada pelaksanaan praktek pengalaman lapangan di Sekolah Teknologi Menengah Swasta se kodya Malang
oleh Gatot Kusjono

 

Penerapan model pembelajaran kolaboratif untuk meningkatkan kualitas hasil belajar IPA siswa kelas V SD Ma'arif Jogosari Pandaan PAsuruan / Diana Johartono

 

Kata Kunci: pembelajaran, kolaboratif, hasil belajar. Pembelajaran kolaboratif adalah suatu aktifitas pembelajaran dimana siswa terlibat dalam kerja tim untuk mencapai tujuan pembelajaran yang ditetapkan. Dalam aktifitas pembelajaran tersebut terdapat elemen-elemen yang merupakan ciri pokok pembelajaran kolaborasi, meliputi: adanya saling ketergantungan yang positif, akuntabilitas individual, memajukan interaksi tatap muka, penggunaan ketrampilan kolaborasi yang sesuai dan adanya proses kelompok. Pembelajaran kolaboratif memiliki ciri-ciri yaitu struktur tujuan, tugas dan penghargaannya bersifat kolaboratif yang berbeda dengan pembelajaran yang bersifat individualistik dan kompetitif. Pendekatan dalam penelitian ini adalah pendekatan deskriptif kualitatif yang digunakan untuk mendapatkan gambaran secara jelas dan nyata tentang peristiwa-peristiwa yang nampak dalam proses pembelajaran yang berlangsung. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang dilakukan di SD Ma arif Jogosari Pandaan melalui dua siklus dan setiap siklus terdiri dari dua kali pertemuan. Data yang diambil meliputi: (1)Penerapan pembelajaran kolaboratif, (2)Partisipasi siswa selama diskusi dan presentasi kelompok melaui observasi, (3)Kualitas hasil belajar siswa yang diperoleh melalui pre tes dan post tes, (4)Angket mengenai respon siswa terhadap Mata pelajaran IPA setelah diterapkan model pembelajaran kolaboratif. Hasil penelitian ini menunjukkan bahwa dengan diterapkannya pembelajaran kolaboratif pada Mata Pelajaran IPA di kelas V hasil belajar siswa mengalami peningkatan. Adapun penerapan model pembelajaran kolaboratif dilakukan dilakukan melalui tahap-tahap: 1) Menentukan tujuan belajar 2) Membagi siswa ke dalam kelompok yang heterogen berdasarkan hasil pre tes dan jenis kelamin 3) Melakukan diskusi kelompok dan mencatat hasil diskusi tersebut 4) Laporan dikumpulkan kemudian dikoreksi dan dikomentari, selanjutnya dikumpulkan pada pertemuan berikutnya. Respon siswa terhadap pembelajaran kolaboratif sangat baik dimana siswa merasa senang belajar IPA karena berguna bagi kehidupan kelak. Siswa berusaha membeli buku-buku IPA sehingga bisa mempelajari terlebih dahulu di rumah. Siswa menayakan pada guru atau teman jika ada materi yang belum dimengerti dan siswa mengikuti pelajaran dari awal sampai akhir pembelajaran. Siswa merasa senang belajar IPA menggunakan model kolaboratif dari pada ceramah karena siswa lebih bersemangat mempelajari materi. Hasil belajar siswa setelah diterapkannya pembelajaran kolaboratif yang tuntas belajar pada siklus I sebesar 61,5% (24 siswa) dan sebesar 82,05(32 siswa) pada siklus II.

Perbedaan tempat tinggal kegiatan dan pengaruhnya terhadap prestasi belajar siswa SMA Assa'adah Sampurnan Bungah Gresik
oleh AH. Ibrahim

 

Penerapan model pembelajaran controversial issues untuk meningkatkan motivasi dan hasil belajar IPS siswa kelas IVB di SDN Kasin kota MAlang / Novita Verdiantika

 

Kata Kunci: Model Pembelajaran Controversial Issues, motivasi belajar, hasil belajar, IPS Berdasarkan observasi awal pada pembelajaran IPS yang dilakukan peneliti di kelas IVB SDN Kasin Kota Malang, menunjukkan bahwa motivasi belajar dan hasil belajar siswa masih rendah sebesar 55,96% sehingga belum mencapai KKM yang ditentukan oleh SDN Kasin Kota Malang yaitu 76 pada mata pelajaran IPS. Rendahnya motivasi ditunjukkan pada kurangnya keaktifan siswa pada saat kegiatan pembelajaran. Untuk memecahkan permasalahan tersebut, proses belajar mengajar dengan menerapkan model pembelajaran Controversial Issues dimana materi pelajaran berupa isu-isu kontroversial yang terkait dengan kehidupan lingkungan sekitar siswa akan lebih membantu siswa dalam memahami materi yang diberikan oleh guru. Sehingga siswa akan termotivasi dalam belajarnya dan akan meningkatkan hasil belajarnya pula. Pendekatan yang digunakan dalam penelitian ini adalah deskriptif kualitatif, jenis penelitiannya kualitatif, sedangkan rancangan penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang menggunakan model Kemmis dan M.CTaggart. Langkah PTK ini meliputi 2 siklus, setiap siklus terdiri dari 4 taap yaitu perencanaan tindakan, pelaksanaan tindakan dan observasi tindakan, refleksi tindakan, dan perbaikan rencana. Subyek penelitian adalah siswa kelas IVB SDN Kasin Kota Malang sebanyak 47 siswa. Teknik pengumpulan data yang digunakan adalah dengan teknik observasi, wawancara, dokumentasi, dan tes. Hasil penelitian menunjukkan bahwa penerapan model pembelajaran Controversial Issues pada pembelajaran IPS telah berhasil meningkatkan motivasi dan hasil belajar siswa kelas IVB SDN Kasin Kota Malang. Hal ini dilihat dari perolehan observasi tentang motivasi dan hasil belajar siswa yang terus meningkat. Hasil rata-rata motivasi siswa pada siklus I sebesar 59,37 % dan pada siklus II menjadi 81,7%. Sementara untuk hasil belajar siswa, ketuntasan pada siklus I sebesar 69,66% dan ketuntasan pada siklus II meningkat menjadi 81,3%. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa penerapan model pembelajaran Controversial Issues dapat meningkatkan motivasi dan hasil belajar siswa kelas IVB SDN Kasin Kota Malang pada mata pelajaran IPS. Selain itu disarankan dalam menerapkan model pembelajaran Controversial Issues, sebaiknya menyajikan isu-isu kontroversial yang mudah dipahami siswa, kemudian isu-isu yang berbeda dan menarik. Hal ini bertujuan agar siswa lebih berminat dan termotivasi untuk membahas isu-isu kontroversial tersebut. Selain itu sebaiknya menggunakan media dan sumber belajar yang berhubungan dengan materi agar siswa dapat lebih mudah dalam memahami materi yang sedang dipelajarinya. Sumber belajar yang digunakan tidak hanya dari buku penunjang, tetapi bisa dengan menggunakan media elektronik maupun media cetak.

The effectiveness of the interactive approach for the teaching of English reading comprehension by Kusni

 

Penerapan CTL (Contextual Teaching and Learning) untuk meningkatkan aktivitas dan hasil belajar siswa kelas V pada pembelajaran sains "Sifat-sifat cahaya" di SDN Pohsangit ngisor Kabupaten Probolinggo / Rilvan Uzwardani

 

Kata Kunci : Penerapan CTL, Aktivitas, Hasil Belajar. Pendidikan saat ini dalam peranan pemerintah mengupayakan agar pendidikan lebih memiliki makna yang berfungsi, dan lebih maju untuk perkembangan zaman, khususnya dalam kehidupan sehari-hari. Pada kenyataannya proses belajar mengajar pada pembelajaran sains di SDN Pohsangit Ngisor, peran siswa hanya terikat dengan apa yang guru inginkan dalam pembelajaran bukan dari pengetahuan siswa sendiri yang muncul. Sehingga hal itu akan mempengaruhi peningkatan aktivitas dan hasil belajar siswa. Maka diperlukan konsep belajar mengajar yang membantu guru mengaitkan antara materi yang diajarkannya dengan situasi dunia nyata dan mendorong siswa membuat hubungan antara pengetahuan yang dimilikinya dengan penerapannya dalam kehidupan sehari-hari yaitu melalui pembelajaran kontekstual. Tujuan dari penelitian ini adalah: (1) melalui penerapan CTL diharapkan dapat meningkatkan aktivitas siswa dalam pelaksanaan pembelajaran Sains. (2) melalui penerapan CTL diharapkan dapat meningkatkan hasil belajar dalam pelaksanaan pembelajaran Sains. Penelitian ini menggunakan pendekatan penelitian tindakan kelas (PTK) dalam penerapan CTL pada pembelajaran sains siswa kelas V dengan pokok bahasan sifat-sifat cahaya yang dilaksanakan pada 2 siklus. Dengan teknik pengumpulan data menggunakan metode observasi, wawancara, dokumentasi dan test. Dilaksanakan pada semester genap tahun ajaran 2010/2011. Dalam pelaksanaan tindakan siklus I terdapat kekurangan yang peneliti temukan yaitu pada aspek appersepsi atau motivasi, pengelolaan kelas yang dilakukan guru belum maksimal, waktu yang kurang efisien, siswa kurang aktif dalam bertanya dan menjawab, pemodelan pembelajaran oleh guru yang kurang. Maka dilakukan perbaikan yaitu guru harus lebih kreatif, guru harus lebih memperhatikan lingkungan kelas yang kondusif dengan membimbing siswa agar siswa berani bertanya dan menjawab. Sehingga pada pelaksanaan tindakan siklus II proses belajar mengajar sudah lebih baik dengan didapatkan hasil belajar lebih baik pula. Berikut data penilaian aktivitas dan hasil belajar siswa kelas V SDN Pohsangit Ngisor Kabupaten Probolinggo dalam pembelajaran sains pokok bahasan sifat-sifat cahaya (1) aktivitas belajar siswa selama proses belajar mengajar berlangsung pada siklus I aktivitas belajar siswa dengan penilaian kriteria siswa yang sangat aktif 11,1 %, aktif 55,5%, cukup aktif 22,2%, kurang aktif 11,1; (2) penilaian sikap aktivitas siswa dalam diskusi kelompok menununjukkan nilai rata-rata baik 53,7%, cukup 40 %, kurang 6,2%; (3) mengalami peningkatan pada pelaksanaan siklus II menjadi siswa yang sangat aktif 22,2 %, aktif 66,6 %, cukup aktif 11,1%, kurang aktif tidak ada; (4) penilaian sikap aktivitas siswa dalam diskusi kelompok menunjukkan nilai rata-rata baik 72,5%, cukup 25,7 %, kurang 1,7%; (5) hasil belajar siswa selama proses belajar mengajar berlangsung menunjukkan peningkatan pada siklus I menunjukkan ketuntasan siswa 74,3%; (6) ketidaktuntasan 25,7%; (7) pelaksanaan siklus II menunjukkan 88,6%. Dengan ketidaktuntasan siswa 11,4%. Berdasarkan hasil penelitian, saran yang dapat diajukan adalah sebagai berikut : (1) dalam proses pembelajaran CTL diharapkan peran guru lebih kreatif dalam memotivasi siswa (2) proses pembelajaran yang baik diperlukan media pembelajaran yang menarik (3) perlu diadakan penelitian lebih lanjut untuk mengetahui keefektifan pembelajaran CTL sebagai upaya untuk meningkatkan aktivitas dan hasil belajar siswa.

Pengaruh pemberian tugas dalam pengajaran PMP terhadap prestasi belajar bidang studi PMP siswa SMP Ma'arif Sumurber Panceng Gresik tahun ajaran 1993/1994 / oleh Abu Bakri

 

Hubungan antara kemampuan berfikir formal siswa MAN 3 Kediri kelas II dengan prestasi belajar untuk materi hukum Gay-lussac dan hukum Avogadro serta identifikasi kesulitan-kesulitan siswa dalam menyelesaikan permasalahan kimia yang berhubungan dengan kedu / Cholisoh

 

Peramalan penjualan semen jenis Portland Pozzoland Cement (PPC) zak 40 kg dengan model sarima dan model exponential smoothing holt-winters (studi kasus PT Semen Indonesia (Persero) Tbk) / Eriska Nur Laili

 

Penelitian kemampuan membaca dalam hati siswa kelas VI SD Negeri wilayah Malang kota VI kodya Malang
oleh Abd. Syukur Ibrahim

 

Pengaruh model latihan lob terhadap peningkatan keterampilan teknik dasar pukulan lob pada peserta ekstrakurikuler bulutangkis di SMA Negeri 4 Pasuruan / Gyta Krisdiana Cahyaningrum

 

ABSTRAK Cahyaningrum, Gyta Krisdiana. 2015. Pengaruh Model Latihan Lob terhadap Peningkatan Keterampilan Teknik Dasar Pukulan Lob pada Peserta Ekstrakurikuler Bulutangkis di SMA Negeri 4 Pasuruan. Skripsi, Jurusan Ilmu Keolahragaan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Dr. Sapto Adi, M.Kes., (II) Dr. Saichudin, M.Kes. Kata Kunci: media pelatihan dan drilling lob, keterampilan pukulan lob. Bulutangkis merupakan permainan yang dimainkan menggunakan sebuah raket dan shuttlecock yang dipukul melewati net. Dalam permainan bulutangkis, pukulan lob merupakan salah satu teknik dasar yang memiliki peranan penting dalam permainan bulutangkis. Berdasarkan hasil observasi penelitian pada kegiatan ekstrakurikuler bulutangkis di SMA Negeri 4 Pasuruan menunjukkan gerakan pukulan lob yang dilakukan belum sesuai dengan indikator pada teknik dasar dalam melakukan pukulan lob. Salah satu cara untuk meningkatkan kemampuan keterampilan teknik dasar pukulan lob yaitu dengan menggunakan model latihan lob.Tujuan dari penelitian ini adalah untuk mengetahui perbedaan pengaruh model latihan lob dengan media pelatihan berupa tayangan video dan drilling lob terhadap peningkatan keterampilan teknik dasar dan kemampuan pukulan lob pada peserta ekstrakurikuler bulutangkis di SMA Negeri 4 Pasuruan. Rancangan penelitian yang dipakai adalah the non-randomized control group pretest posttest designyang termasuk dalam penelitian ekperimensemu denganpopulasi penelitian pada peserta ekstrakurikuler SMA Negeri 4 Pasuruan berjumlah 37 orang dan sampel penelitian yang digunakan sebanyak 30 orang dan dibagi dalam dua kelompok dengan menggunakan teknik purposive sampling. Instrumen yang digunakan dalam penelitian adalah 1) analisis gerak pukulan lob, 2) tes pukulan lob forehand bulutangkis. Dari hasil pengujian hipotesis melalui uji t:1) hasilanalisis gerak keterampilan pukulan lobpada kelompok perlakuandiperoleh t hitung 46,540 > 2,145 t tabel,pada kelompok kontrol diperoleh t hitung sebesar 21,500 > 2,145 t tabel, selisih hasil analisis gerak pada kedua kelompokdiperoleh t hitung 20,088> 2,145 t tabel, 2) hasil kemampuan keterampilan pukulan lob pada kelompok perlakuandiperoleh 30,386 > 2,145 t tabel, pada kelompok kontrol diperoleh t hitung 25,947 > 2,145 t tabel, selisih hasil kemampuanpukulan lob pada kedua kelompok diperoleh t hitung 14,127> 2,145 t tabel. Uji hipotesis 1) dan 2) menunjukkan H0 ditolak, artinya model latihan lobberpengaruh nyata terhadap peningkatan keterampilan dasar teknik pukulan lob forehand bulutangkis bagi peserta latihan ekstrakurikuler bulutangkis SMA Negeri 4 Pasuruan. Berdasarkan hasil penelitian tersebut,dapat disimpulkan bahwa model latihan lob dengan media pelatihan berupa tayangan video dan drilling lob menunjukkan adanya perbedaan pengaruh terhadap pre-tes dan pos-tes,baik kelompok perlakuanmaupun kelompok kontrol pada peningkatan keterampilan teknik dasar dan kemampuan pukulan lob pada peserta ekstrakurikuler bulutangkis di SMA Negeri 4 Pasuruan.

Hubungan antara fleksibilitas dan efektifitas gaya kepemimpinan kepala sekolah dengan disiplin kerja guru SD se kecamatan Pedan kabupaten Klaten / oleh Sri Martini

 

Penerapan model inductive thinking dengan menggunakan kliping untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Ketawanggede 2 kota Malang / Nirmala Puspita Sari

 

Kata kunci: Model Inductive Thinking, Aktivitas, Hasil Belajar, PKn Berdasarkan hasil observasi awal terhadap pembelajaran PKn kelas V SDN Ketawanggede 2 Malang, terdapat permasalahan siswa pasif dalam pembelajaran PKn. Siswa tidak diberikan kesempatan untuk mencari sumber sendiri yang berkaitan dengan materi pelajaran PKn. Hasil belajar siswa rata-rata masih tergolong rendah. Hal ini dapat dilihat dari rata-rata hasil belajar pratindakan yaitu 40,38, jauh dari ketuntasan klasikal yang telah ditetapkan 69. Oleh karena itu peneliti menerapkan model inductive thinking dengan menggunakan kliping untuk mengatasi permasalahan. Penelitian ini bertujuan untuk mendeskripsikan: (1)penerapan model Inductive Thinking dengan menggunakan kliping dalam meningkatkan aktivitas dan hasil belajar PKn pada materi”Kebebasan Berorganisasi” siswa kelas V SDN Ketawanggede 2 Kota Malang. (2)penerapan model Inductive Thinking dengan menggunakan kliping dapat meningkatkan aktivitas belajar PKn pada materi”Kebebasan Berorganisasi” siswa kelas V SDN Ketawanggede 2 Kota Malang. (3)penerapan model Inductive Thinking dengan menggunakan kliping dapat meningkatkan hasil belajar PKn pada materi”Kebebasan Berorganisasi” siswa kelas V SDN Ketawanggede 2 Kota Malang. Rancangan penelitian ini merupakan penelitian tindakan kelas (PTK) secara kolaboratif dengan pendekatan kualitatif, untuk memperbaiki kinerja guru sehingga hasil belajar siswa meningkat. Prosedur tindakan kelas (PTK) terdiri dari dua siklus, masing-masing siklus menggunakan langkah-langkah: (1) perencanaan; (2) pelaksanaan; (3) observasi dan; (4) refleksi. Subyek dari penelitian adalah siswa kelas V sebanyak 26 siswa yang terdiri dari 14 siswa laki-laki dan 12 siswa perempuan. Sedangkan teknik pengumpulan data menggunakan teknik observasi, tes tulis, wawancara dan dokumentasi. Hasil penelitian menyimpulkan dengan menerapkan model inductive thinking menggunakan kliping dapat meningkatkan aktivitas dan hasil belajar PKn materi pokok ”Kebebasan Berorganisasi” siswa kelas V SDN Ketawanggede 2 Malang. Aktivitas belajar siswa dilihat dari prosentase dari siklus I yaitu 85% meningkat menjadi 94,5% di siklus II. Hasil belajar siswa yang dapat di tunjukkan dari adanya peningkatan pada pratindakan nilai rata-rata 40,38 meningkat menjadi 57,48 di siklus I dan siklus II nilai rata-rata meningkat sebesar 82. Saran untuk kepala sekolah adalah agar dapat memotivasi guru untuk meningkatkan aktivitas dan hasil belajar siswa. Bagi guru agar menerapkan model inductive thinking dalam pembelajaran khususnya PKn. Untuk penelitian selanjutnya hendaknya dapat memperbaiki kekurangan yang ada pada penelitian sebelumnya sehingga pembelajaran diharapkan berjalan seoptimal mungkin.

Gagasan emansipasi wanita dalam kumpulan puisi Mimpi dan pertensi" karya Toeti Heraty (tinjauan semiotik)
oleh Mintarti"

 

Kemampuan mengembangkan paragraf bahasa Indonesia siswa kelas V Sekolah Dasar Negeri XII Sragen kabupaten Sragen tahun ajaran 1994/1995
oleh Syamhudi

 

Penggunaan kata tugas dalam karangan siswa kelas V Sekolah Dasar Negeri kendalpayak 02 kecamatan Pakisaji kabupaten Malang tahun ajaran 1994/1995 / oleh H.m. Thoha AR

 

Peningkatan keterampilan gerak dasar lokomotor menggunakan metode bermain dalam pembelajaran pendidikan jasmani siswa kelas IIIC SDN Krian 3 Kabupaten Sidoarjo / Ikee Proklamasi Agustini

 

ABSTRAK Agustini, I. P. 2015. Peningkatan Keterampilan Gerak Dasar Lokomotor Menggunakan Metode Bermain Dalam Pembelajaran Pendidikan Jasmani Siswa Kelas III C SDN Krian 3 Kabupaten Sidoarjo. Skripsi, Jurusan Pendidikan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Drs. Agus Tomi, M.Pd, (II) I Nengah Sudjana, S.Pd.,M.Pd. Kata kunci: gerak dasar lokomotor, metode bermain, pendidikan jasmani Berdasarkan observasi awal dengan melakukan wawancara terhadap kepala sekolah, guru dan siswa kelas III C serta melakukan pengamatan pada saat pembelajaran pendidikan jasmani sedang berlangsung di SDN Krian 3 Kabupaten Sidoarjo ditemukan masalah bahwa pembelajaran pendidikan jasmani mengalami kendala dalam proses belajar mengajar diakibatkan sarana dan prasarana yang dimiliki sekolah kurang memadai. Terdapat 20 siswa (47,62%) dari 42 siswa (100%) memiliki masalah dalam mengikuti proses pembelajaran karena mengaku bosan terhadap pelajaran pendidikan jasmani sehingga siswa mengalami kesulitan dalam meningkatkan keterampilan gerak dasarnya. Tujuan dari diadakannya penelitian ini adalah untuk memecahkan masalah tersebut dengan menerapkan metode pembelajaran yang menarik untuk siswa yaitu menggunakan metode bermain. Penelitian ini merupakan penelitian tindakan kelas yang mempunyai untuk memberikan solusi untuk permasalahan dalam proses pembelajaran dan meningkatkan kualitas pembelajaran agar mencapai tujuan pembelajaran. Penelitian tindakan kelas ini menggunakan 2 siklus dalam penerapannya. Penelitian dilakukan di SDN Krian 3 Kabupaten Sidoarjo pada siswa kelas III C yang berjumlah 42 siswa dari tanggal 15 April 2015 sampai 6 Mei 2015. Penerapan siklus 1 pada pertemuan pertama mendapatkan hasil ketuntasan dari pre-test dan post-test sebesar 57% dan mengalami peningkatan pada pertemuan kedua dengan mendapatkan hasil pencapaian ketuntasan sebesar 76% serta dengan hasil persentase sebesar 90% dari pre-test pada pertemuan ketiga. Hasil presentase ketuntasan mengalami peningkatan pada post-test dari perlakuan tindakan siklus 2 dan mendapatkan hasil persentase sebesar 97%. Dengan hasil dari penerapan 2 siklus pada penelitian ini maka terbukti bahwa metode bermain dapat meningkatkan keterampilan gerak dasar lokomotor siswa kelas III C di SDN Krian 3 Kabupaten Sidoarjo. Penelitian yang telah dilaksanakan ini diharapkan mampu memberi inovasi baru dalam penerapan metode belajar bagi guru, menjadi panduan belajar bagi siswa dan menjadi tolak ukur untuk bisa segera diperbaiki kekurangan-kekurangan dalam penerapannya bagi peneliti.

Pengembangan media pembelajaran berbasis WEB pada matapelajaran sejarah kelas VII semester 2 SMP Negeri 1 Kertosono Kb. Nganjuk / Yanita Kartikasari Subiyanto

 

Kata kunci: Pengembangan, Media Pembelajaran, Berbasis Web, Sejarah. Media pembelajaran berbasis Web adalah media pembelajaran yang disiapkan, dijalankan dan dimanfaatkan dengan media web. Pengembangan media pembelajaran Sejarah berbasis web adalah suatu media yang dibuat atau dikembangkan dengan menggunakan web pada mata pelajaran Sejarah dan dijalankan menggunakan jaringan Local Area Network (LAN). Berdasarkan hasil observasi di SMP Negeri 1 Kertosono diperoleh hasil bahwa SMP Negeri 1 Kertosono sekarang telah memenuhi Rint isan Sekolah Bertaraf International dan telah memiliki ruang kelas yang mernenuhi syarat penyelenggaraan proses belajar mengajar serta keterbiasaan siswa menggunakan internet. Namun pada pelajaran Sejarah metode pembelajaran masih secara tradisional yaitu menggunakan bahan ajar cetak sehingga terkadang timbul rasa bosan dan kurang memotivasi siswa dalam belajar Sejarah. Dengan ini pengembang mengembangkan Media Pembelajaran Berbasis Web Matapelajaran Sejarah Kelas VII Semester II SMP Negeri 1 Kertosono sebagai inovasi pembelajaran Sejarah di sekolah tersebut. Pengembangan ini dilaksanakan dengan tujuan untuk mengembangkan media pembelajaran berbasis web matapelajaran Sejarah dan mengetahui validitas media pembelajaran berbasis web matapelajaran Sejarah di SMP Negeri 1 Kertosono. Media pembelajaran berbasis web ini mempunyai kelebihan dan kelemahan yaitu, (1) dapat digunakan secara individu sehingga siswa lebih leluasa dalam memanfaatkan pengerjaannya, (2) tidak membutuhkan waktu yang lama dalam mengerjakan media ini, (3) web yang menjadi media pembelajaran ini bersifat dinamis dapat diubah dan dikelola sesuai kebutuhan dan dapat digunakan secara berulang, (4) dilengkapi materi-materi dan informasi tentang pelajaran materi Sejarah. Sedangkan kelemahan dari media ini adalah (1) media pembelajaran berbasis web ini dibutuhkan pembuatan ulang saat materi pada buku ajar Sejarah acuan SMP Negeri 1 Kertosono berubah, (2) hanya dapat digunakan pada sekolah yang mempunyai fasilitas internet, (3) kelemahan dalam mengakses web dikarenakan masih menggunakan hostingan free, (4) lemahnya animasi yang digunakan. Pengumpulan data dilakukan dengan menggunakan angket validasi, pre test dan post test, pengembangan media pembelajaran berbasis web kepada ahli media, ahli desain, ahli isi, dan responden (siswa) kemudian data tersebut diolah untuk mengetahui tingkat kevalidan media pembelajaran berbasis web matapelajaran Sejarah. Hasil pengembangan media pembelajaran berbasis web matapelajaran Sejarah pokok bahasan Masa Perkembangan Islam di Indonesia di SMP Negeri 1 Kertosono ini memenuhi kriteria valid dengan hasil uji ahli media mencapai tingkat kevalidan 85,22 % dengan tingkat keefektifitasan 82,14%, keefisiensian 82,14%, dan kemenarikan 78,57%; ahli desain mencapai tingkat kevalidan77,5 % dengan tingkat keefektifitasan 67%, keefisiensian 91,6%, dan kemenarikan 85%; ahli isi mencapai tingkat kevalidan 84,37% dengan tingkat keefektifitasan 85%, keefisiensian 80%, dan kemenarikan 85%; uji responden (siswa) perseorangan mencapai tingkat kevalidan 72,91%, uji responden kelompok kecil mencapai tingkat kevalidan 82,70%, dan uji responden lapangan mencapai tingkat kevalidan 80% dengan tingkat keefektifitasan 81,77%, keefisiensian 81,50% dan kemenarikan 76,60%. Disamping itu, nilai peningkatan hasil belajar siswa pada uji coba perseorangan mencapai 60%, uji coba kelompok kecil mencapai 59% dan uji coba lapangan mencapai 60%. Berdasarkan hasil pengembangan telah dilakukan, dapat disimpulkan bahwa Media Pembelajaran Berbasis Web Matapelajaran Sejarah Kelas VII Semester 2 SMP Negeri 1 Kertosono, valid/layak digunakan sebagai media pembelajaran.

Pengaruh pemberian deksametason terhadap kerusakan ginjal tikus jantan (Rattus norvegicus) galur wistar / Anisa Fitria

 

ABSTRAK Fitria, Anisa. 2015. Pengaruh Pemberian Deksametason terhadap Kerusakan Ginjal Tikus Jantan (Rattus norvegicus) Galur Wistar. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dra. Susilowati, M. S, (II) Nuning Wulandari, S.Si., M.Si Kata Kunci:deksametason, kerusakan tubulus proksimal, diameter tubulus proksimal Deksametason merupakan salah satu obat kortikosteroid yang beredar bebas di pasaran dan relatif banyak digunakan oleh masyarakat. Penggunaan deksametason yang tidak sesuai aturan dan berlebihan, akan menyebabkan kerusakan pada organ-organ tertentu, salah satunya ginjal. Kerusakan ginjal diindikasikan dengan adanya nekrosis sel dan ukuran diameter tubulus proksimal. Tujuan dari penelitian ini adalah untuk mengetahui efek deksametason terhadap nekrosis sel tubulus proksimal dan diameter tubulus proksimal pada ginjal tikus jantan. Penelitian ini dilakukan di Unit Pemeliharaan Hewan Coba FMIPA Universitas Negeri Malang dan Sub Laboratorium Fisiologi Hewan dan Manusia pada bulan Januari-Februari 2015. Hewan coba yang digunakan adalah tikus jantan galur wistar dengan umur ± 3 bulan dan berat badan 150-170 gram. Tikus dibagi ke dalam 3 kelompok perlakuan (dosis 0 mg/kgbb,dosis 0,135 mg/kgbb, dan dosis 0,54 mg/kgbb) dengan tiga kali ulangan. Dekametason diberikan 1 kali per hari selama 10 hari. Pemberian dilakukan pada pagi hari pukul 06.30 – 07.00. Pada hari ke-11 tikus dibedah untuk diambilorgan ginjalnya. Ginjal dipotong untuk dibuat preparat histologi dengan pewarnaan HE untuk melihat nekrosis sel, dan perubahan diameter tubulus proksimal. Berdasarkan hasil penelitiandiketahui bahwa, deksametason dosis (0,54 mg/kbb) berpengaruhterhadap nekrosis sel ginjal dan berbeda signifikan. Deksametson juga berepengaruh terhadappembengkakandiameter tubulus proksimal ginjal tikus sebesar 35,07µ. Perlakuan dosis 0,135 mg/kgbb dengan dosis 0,54 mg/kbb tidak berbeda signifikan.  

Korelasi antara kondisi lingkungan sosial siswa dengan hasil belajar matapelajaran teknologi informasi dan komunikasi (TIK) kelas VIII SMPN 3 Blitar / Dedy Ariyanto

 

Kata Kunci: Kondisi Lingkungan Keluarga, Teman Sebaya, Kondisi Lingkungan Sekitar, Kondisi Lingkungan Sosial, Hasil Belajar Kondisi lingkungan sosial yang baik akan dapat meningkatkan hasil belajar yang diperoleh siswa. Dalam penelitian ini kondisi lingkungan sosial dibagi menjadi tiga indikator yaitu keadaan keluarga, teman sebaya, kondisi lingkungan sekitar siswa. Keadaan keluarga adalah keadaan keluarga dimana siswa tersebut tinggal serumah, teman sebaya adalah teman sepermainan siswa sehari-hari baik di rumah maupun disekolah, kondisi lingkungan sekitar siswa adalah kondisi-kondisi disekitar siswa yang mempengaruhi proses belajarnya. Kondisi lingkungan sosial yang baik akan dapat meningkatkan hasil belajar yang diperoleh siswa. .Kondisi lingkungan sosial disini adalah kondisi lingkungan tempat tinggal siswa kelas VIII SMPN 3 Blitar. Tujuan penelitian ini adalah (1) Mengetahui hubungan antara keadaan keluarga siswa dengan hasil belajar mata pelajaran TIK, (2) Mengetahui hubungan antara kondisi teman sebaya dengan hasil belajar mata pelajaran TIK, (3) Mengetahui hubungan antara kondisi lingkungan sekitar siswa dengan hasil belajar mata pelajaran TIK, (4) Mengetahui kondisi lingkungan sosial siswa dengan hasil belajar mata pelajaran TIK kelas VIII SMPN 3 Blitar. Untuk mencapai tujuan penelitian, rancangan penelitian yang digunakan adalah deskriptif korelasional yang bertujuan untuk mendeskripsikan ada atau tidaknya korelasi antara kondisi lingkungan sosial siswa denngan hasil belajar mata pelajaran teknologi informasi dan komunikasi (TIK). Variabel bebas penelitian ini adalah kondisi lingkungan sosial (X) dan variabel terikatnya adalah hasil belajar (Y) . Subjek dalam penelitian ini adalah siswa-siswi kelas VIII SMP Negeri 3 Blitar tahun ajaran 2010/2011 yang berjumlah 60 orang. Pengumpulan data dilakukan dengan instrumen kuesioner dan hasil ujian tengah semester (UTS) mata pelajaran TIK. Teknik analisis data yang digunakan adalah persentase dan korelasi Tata Jenjang dari Spearman yang dioperasikan dengan program SPSS 15,0 for windows. Hasil analisis menunjukkan bahwa: (1) antara kondisi lingkungan keluarga dengan hasil belajar siswa pada matapelajaran TIK kelas VIII SMPN 3 Blitar, bernilai sebesar 0,305 dengan probabilitaas (Sig.) 0,018. Berdasar nilai probabilitas (Sig.) < 0,05, maka H0 yang berbunyi "tidak terdapat korelasi yang signifikan antara kondisi lingkungan keluarga dengan hasil belajar dalam matapelajaran TIK siswa kelas VIII SMPN 3 Blitar" ditolak, dan H1 yang berbunyi "terdapat korelasi yang signifikan antara kondisi lingkungan keluarga dengan hasil belajar dalam matapelajaran TIK siswa kelas VIII SMPN 3 Blitar" diterima ; (2) antara kondisi teman sebaya dengan hasil belajar siswa pada matapelajaran TIK kelas VIII SMPN 3 Blitar, sebesar 0,422 dengan probabilitas (Sig.) 0,001. Berdasar nilai probabilitas (Sig.) < 0,05, maka H0 yang berbunyi "tidak terdapat korelasi yang signifikan antara kondisi teman sebaya dengan hasil belajar dalam mata pelajaran TIK siswa kelas VIII SMPN 3 Blitar" ditolak dan H1 yang berbunyi " terdapat korelasi yang signifikan antara kondisi teman sebaya dengan hasil belajar dalam mata pelajaran TIK siswa kelas VIII SMPN 3 Blitar" diterima; (3) antara kondisi lingkungan sekitar dengan hasil belajar siswa pada matapelajaran TIK kelas VIII SMPN 3 Blitar, bernilai sebesar 0,483 dengan probabilitas (Sig.) 0,000. Berdasar nilai probabilitas (Sig.) < 0,05, maka H0 yang berbunyi "tidak terdapat korelasi yang signifikan antara kondisi lingkungan sekitar dengan hasil belajar dalam mata pelajaran TIK siswa kelas VIII SMPN 3 Blitar" ditolak dan H1 yang berbunyi terdapat korelasi yang signifikan antara kondisi lingkungan sekitar dengan hasil belajar dalam mata pelajaran TIK siswa kelas VIII SMPN 3 Blitar" diterima; (4) ) antara kondisi kondisi lingkungan sosial siswa dengan hasil belajar siswa pada matapelajaran TIK kelas VIII SMPN 3 Blitar, bernilai sebesar 0,414dengan probabilitaas (Sig.) 0,001. Berdasar nilai probabilitas (Sig.) < 0,05, maka H0 yang berbunyi "tidak terdapat korelasi yang signifikan antara kondisi lingkungan sosial siswa dengan hasil belajar dalam matapelajaran TIK siswa kelas VIII SMPN 3 Blitar" ditolak, dan H1 yang berbunyi "terdapat korelasi yang signifikan antara kondisi lingkungan sosial siswa dengan hasil belajar dalam matapelajaran TIK siswa kelas VIII SMPN 3 Blitar" diterima. Dari hasil penelitian diatas dapat disimpulkan bahwa seluruh variabel yaitu kondisi keluarga, teman sebaya, kondisi lingkungan sekitar, dan kondisi lingkungan sosial siswa memiliki korelasi yang signifikan terhadap hasil belajar TIK kelas VIII SMPN 3 Blitar. Kondisi lingkungan sosial siswa merupakan keadaan dimana siswa tersebut hidup bermasyarakat, belajar, dan melakukan kontak sosial dengan sekitar. Keberhasilan studi siswa juga dipengaruhi keadaan sekitar, jika keadaan sekitar kondusif untuk belajar maka kemungkinan besar siswa akan berhasil, tapi jika tidak kondusif kemungkinan besar siswa akan gagal dalam belajar. Perkembangan teknologi yang begitu pesat perlu adanya kontrol dari masyarakat agar siswa bisa menggunakan teknologi tersebut secara positif. Berdasarkan temuan penelitian, ada beberapa saran yang akan disampaikan sebagai berikut: (1) untuk orang tua agar dapat menciptakan suasana belajar yang kondusif dirumah, (2) untuk siswa agar siswa-siswi dapat menyesuaikan diri dengan lingkungan sosialnya, (3) untuk masyarakat agar membantu untuk menyediakan suasana kondusif untuk belajar di lingkungan sekitar, (4) untuk sekolah harus menyadari bahwa siswanya berasal dari lingkungan yang berbeda-beda, sehingga harus bisa memberikan cara pengajaran yang mencakup untuk keseluruhan siswa, (5) untuk guru bisa memiliki metode pengajaran yang bisa membuat siswa mampu mengikuti pelajaran dengan sempurna, (6) untuk peneliti selanjutnya agar menggunakan instrumen yang lainnya selain kondisi keluarga, teman sebaya, dan kondisi lingkungan sekitar.

Hubungan antara cara belajar kognitif dengan hasil belajar fisika pada pokok bahasan optika kelas IIA-1 semester di SMA Muhammadiyah I Jombang / oleh Mohammad Nur Hasan Baihaqie

 

Pelaksanaan layanan bimbingan kelompok dalam bidang bimbingan pribadi-sosial di SMUN kodya Malang
oleh Muhammad Iksan

 

Model epidemik SEIQJR untuk menganalisis laju penyebaran penyakit ebola di Republik Sierra Leone / Kresentia Peppy Rahayu

 

ABSTRAK Rahayu, Kresentia Peppy. 2015. Model Epidemik SEQIJR untuk Menganalisis Laju Penyebaran Penyakit Ebola di Republik Sierra Leone. Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (I) : Drs. Tjang Daniel Chandra, M.Si, Ph.D, (II) Dahliatul Hasanah, S.Si, M.Math Sc Kata Kunci: Virus Ebola, Model SEQIJR, Sistem Persamaan Diferensial Nonlinier, Titik Kesetimbangan Sistem Persamaan Diferensial Nonlinier, Bilangan Reproduksi Ebola merupakan penyakit yang disebabkan oleh virus dari keluarga Filoviridae yang terdiri dari tiga genus yaitu Cuevavirus, Marburgvirus dan Ebolavirus. Virus ini dikaitkan sebagai penyebab penularan luas demam berdarah di Benua Afrika, dengan tingkat kematian yang tinggi, antara 53-90% (Sanchez dkk.,2007). Hingga saat ini belum ditemukan cara pengobatan yang tepat untuk menangani Ebola. Belum ada pula vaksin yang tepat untuk manusia. Karena itu, dilakukan langkah untuk mengontrol laju penyebaran Ebola, yakni mengkarantina orang yang diduga terinfeksi virus dan mengisolasi orang-orang yang telah terinfeksi virus serta telah menunjukkan gejala. Untuk jenis wabah demikian, telah diformulasikan model matematika epidemik SEQIJR, yakni model yang dipengaruhi oleh faktor karantina isolasi. Model ini pertama kali diperkenalkan tahun 2004 untuk mengontrol wabah SARS yang terjadi selama tahun 2002-2003 (Gumel, dkk., 2004). Model SEQIJR yang digunakan dalam tulisan ini merupakan model deterministik (compartmental models) dan mengabaikan faktor demografis (kelahiran, kematian, imigrasi, emigrasi, dsb). Total populasi (N) dibagi menjadi beberapa subpopulasi yaitu subpopulasi rentan (S), subpopulasi laten (E), subpopulasi karantina (Q), subpopulasi menunjukkan gejala (I) , subpopulasi isolasi (J), dan subpopulasi meninggal (R). Dengan menggunakan Kriteria Routh-Hurwitz dapat ditentukan bahwa titik kesetimbangan bebas penyakit (S,E,Q,I,J,R)=(N,0,0,0,0,0) akan stabil jika R_C<1 dan R_0<1. Studi kasus dilakukan menggunakan data masyarakat yang terjangkit virus Ebola di Republik Sierra Leone selama bulan Januari hingga Juni 2015 yang diperoleh dari laman resmi WHO (World Health Organization) menghasilkan R_0=4,95>1 dan R_C=3,91>1 yang memungkinkan sistem menjadi tidak stabil sehingga wabah tetap ada di masyarakat. Namun, karena nilai R_C

Peranan petugas bimbingan dalam pelaksanaan kerjasama antara sekolah menengah kejuruan (SMK) dengan dunia kerja di kodya Malang
oleh Sopan

 

Pengaruh perfectionisme, self efficacy dan motivasi berprestasi terhadap prokrastinasi akademik mahasiswa UIN Syarif Hidayatullah Jakarta / Wahidah Fitriani

 

ABSTRAK Wahidah Fitriani. 2015. Pengaruh Perfectionisme, Self Efficacy danMotivasi Berprestasi terhadap Prokrastinasi Akademik Mahasiswa UIN Syarif Hidayatullah Jakarta. Disertasi. Program Studi Psikologi Pendidikan, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Wayan Ardhana, MA., (II) Dr. H. Triyono., M.Pd., (III) Dr. Imanuel Hitipeuw, MA. Kata Kunci: Perfectionisme, self efficacy, motivasi berprestasi dan prokrastinasi akademik Penelitian ini dilatarbelakangi oleh tingginya angka keterlambatan studi, artinya mahasiswa terlambat menyelesaikan kuliah tingkat sarjana melebihi 5 tahun. Jumlah mahasiswa yang lulus kuliah tepat waktu umumnya lebih sedikit dibandingkan jumlah mahasiswa yang terlambat lulus. Penelitian ini bertujuan untuk menguji apakah model teoritik pengaruh perfectionisme, self efficacy, dan motivasi berprestasi terhadap prokrastinasi akademik mahasiswa UIN Syarif Hidayatullah Jakarta yang dibangun dalam penelitian ini mendapat dukungan empirisdan menguji apakah ada pengaruh antar faktor dalam model. Model teoritik pengaruh antar variabel dalam penelitian ini didasarkan pada teori prokrastinasi akademik dari Fiore (2007) dan Solomon &Rothblum (1984). Kegunaan penelitian ini akan memberikan gambaran yang lebih menyeluruh dan kompleks mengenai pengaruh perfectionisme, self efficacy, dan motivasi berprestasi terhadap prokrastinasi akademik mahasiswa UIN Syarif Hidayatullah Jakarta. Penelitian ini dilaksanakan dengan rancangan causal relationship-explanation terhadap 295 sampel mahasiswa UIN SyarifHidayatullah Jakarta. Data dikumpulkan dengan 4 skala yang semuanya memiliki nilai unidimensionalitas konstruk (GFI) lebih besar dari 0.900, dan nilai reliabilitas komposit dan Alpha Cronbach lebih besar dari 0.700. Data dianalisis dengan Structural Equation Modeling (SEM) menggunakan program Amos 20. Hasil penelitian menunjukkan bahwa model struktural telah layak (GFI= 0.969 > 0.900) dan memperoleh dukungan data empiris (α˛ = 69.789 < 220.991 dengan p = 0.119> 0.05. Ini berarti terbukti bahwa Ho yang menyatakan tidak ada perbedaan antara model struktural dengan data empiris dalam penelitian diterima atau dengan kata lain model struktural yang dibangun telah mendapatkan dukungan empiris, sedangkan H1 yang menyatakan ada perbedaan antara model struktural dengan data empiris dalam penelitian terbukti ditolak.Dengandemikian model strukturaldalampenelitiandidukungoleh data empiris. Selainitu, hasil penelitian menunjukkan bahwa, 1) Perfectionisme mempengaruhi secara positif efikasi diri 2)Perfectionisme mempengaruhisecara positif prokrastinasi akademik3) Self efficacy mempengaruhisecara positif motivasi berprestasi, dan4) Self efficacy mempengaruhisecara negatifprokrastinasi akademik. Perilaku prokrastinasi akademik mahasiswa tidak hanya disebabkan oleh faktor internal dari mahasiswa, namun juga melibatkan faktor-faktor lain yang tidak kalah penting perannya bagi keberhasilan akademik mahasiswa, seperti dosen, karyawan, orang tua mahasiswa dan pimpinan perguruan tinggi. Oleh karena itu, peneliti menyarankan agar pihak-pihak tersebut juga perlu digunakan sebagai sumber data bagi penelitian selanjutnya. Disamping itu, variabel iklim kampus dan pelayanan akademik, tingkat kesulitan tugas, rasio perbandingan jumlah dosen dan karyawan di perguruan tinggi, sarana dan prasarana juga menarik dan perlu diteliti lebih lanjut guna memahami secara lebih komprehensif penyebab munculnya perilaku prokrastinasi akademik pada mahasiswa.

Hubungan antara pemberian informasi perguruan tinggi dengan arah pilihan fakultas di perguruan tinggi pada siswa SMUN I Karangnongko Klaten
oleh Roro Sri Wahyuni

 

Commisives and directives seen in Spongebob Squarepants: Sponge out of water movie / Soelis Handayani

 

ABSTRAK Handayani, S. 2015. Komisif dan Direktif pada film ‘SpongeBob SquarePants: Sponge out of Water’. Skripsi. Jurusan Sastra Inggris. Fakultas Sastra. Universitas Negeri Malang. Pembimbing 1: Maria Hidayati, S.S, M.Pd, Pembimbing 2: Dr. Hj. Emalia Iragiliati, M.Pd Kata Kunci: Tindak tutur, tindak ilokusi, komisif, direktif, SpongeBob SquarePants Penelitian ini membahas mengenai tindak tutur, khususnya komisif dan direktif pada film SpongeBob SquarePants: Sponge out of Water yang mana berhubungan dengan studi pragmatic. Menurut Austin yang di kutip oleh Thomas (1996:49) ada tiga komponen utama dari tindak tutur, yaitu lokusi, illokusi dan perlokusi. Setiap komponen mempunyai masing-masing tingkatan. Kemudian, Menurut Searle yang di kutip oleh Cummings (2005:120) mengembangkan tingkatan tindak ilokusi menjadi lima macam, yaitu representative, komisif, direktif, ekspresif dan deklaratif. Yule (1996:54) mengemukakan bahwa komisif dan direktif memiliki karakteristik dan fungsi umum yang sama. Dengan menggunakan metode diskriptif-kualitati dan mengacu pada teori tersebut, penulis menganalisa tindak ilokusi komisisf dan direktif untuk mengetahui kaitannya. Setelah menonton dan mentranskrip film, peneliti membagi data berdasarkan alur yang mempunyai lima tahap introduction, rising action, climax, falling action dan denouement. Setelah itu peneliti menganalisanya menggunakan teori dari Searle. Peneliti menunjukan hasil tipe komisif ada di introduction, rising action dan climax. Tipe yang paling dominan adalah berjanji dengan lima ujaran (35.7%), kemudian diikuti oleh empat ujaran mengancam (28.6%), tiga ujaran sukarela (21.7%) dan satu ujaran dari menolak dan menawarkan dengan persentase masing-masing 7%. Sementara itu, ada delapan tipe direktif di seluruh film. Tipe yang paling sering muncul adalah bertanya dengan tiga puluh delapan ujaran (35.8%), diikuti dengan tiga puluh dua ujaran memerintah (30.1%), Sembilan belas ujaran menyarankan (17.9%), tujuh ujaran membujuk (6,6%), memperingati, mengemis dan meminta dengan masing-masing tiga ujaran (2,8%) dan memaksa dengan satu ujaran (0.9%). Bertanya dan memerintah lebih dominan di film ini. bertanya mengimplikasikan keingintahuan karakter; dari bertanya, dapat membantu menyampaikan cerita dan membantu penonton untuk mengerti situasi yang terjadi di film. Sedangkan memerintah lebih mempunyai fungsi menunjukkan karakter dari penutur bahwa mereka mempunyai kekuatan yang lebih Untuk menyimpulkan penelitian ini, ujaran-ujaran yang di katakana oleh karakter menunjukkan bahwa pembicara memungkinkan membuat pendengar melakukan sesuatu melalui komisif jika perlokusionari dari komisif berhasil. Tetapi tidak semua komisif membawa direktif. Dibandingkan dengan hasil studi yang sebelumnya, penelitian ini memnunjukkan hasil yang hampir sama di fungsi tindak ilokusinya. Penelitian ini diharapkan dapat digunakan sebagai referensi mengenai studi pragmatik terutama tentang komisif dan direktif untuk para mahasiswa linguistik. Namun ruang lingkup penelitian ini terbatas karena sumber data yang di ambil dan pembahasannya. Untuk peneliti selanjutnya, disarankan untuk mengkesplor dari sumber lain seperti percakapan di televisi, radio, iklan, koran dan lain-lain. Bahan diskusi juga dapat mengambil dari tipe ilokusi yang lain.

Efektifitas penggunaan siaran televisi pendidikan sekolah dalam proses pembelajaran fisika di kelas II SMP 14 Malang / oleh Istiani

 

Pengukuran kinerja perusahaan dengan pendekatan balanced scorecard (studi pada PT. Tegar Murni Utama) / Mukhammad Ikbal Riza Zulfi Nasrulloh

 

ABSTRAK Nasrulloh, Muhammad Ikbal Riza Zulfi. 2015. Pengukuran Kinerja Perusahaan Dengan Pendekatan Balanced Scorecard pada PT. Segar Murni Utama. Skripsi. Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Sri Pujiningsih, S.E., M.Si., Ak.. (II) Sriyani Mentari, S.Pd, M.M. Kata Kunci : Pengukuran Kinerja Perusahaan, Balanced Scorecard. Kondisi persaingan bisnis saat ini telah menuntut perusahaan untuk meningkatkan kinerjanya. Kondisi kinerja perusahaan saat ini hanya bisa diketahui dengan melakukan pengukuran kinerja PT. Segar Murni Utama secara keseluruhan. Pengukuran tersebut bertujuan untuk membantu perusahaan untuk menentukan rencana strategik dan pengambilan keputusan dimasa mendatang. Pengukuran kinerja tradisional sudah dianggap tidak sesuai dengan kondisi saat ini karena hanya fokus pada perspektif keuangan. Balance Scorecard merurpakan salah satu jenis pengukuran kinerja yang terdiri dari empat perspektif yaitu keuangan, pelanggan, proses bisnis internal, serta petumbuhan dan perkembangan. Tujuan dari penelitian ini adalah untuk mengetahui kinerja PT. Segar Murni Utama dengan menggunakan pendekatan Balance Scorecard. Dalam penelitian ini peneliti menggunakan data primer dan skunder. Data primer adalah data yang didapatkan oleh peneliti melalui wawancara dengan beberapa kepala bagian, karyawan, dan pelanggan. Data skunder adalah data dokumen perusahaan yang berupa laporan keuangan dan data karyawan. Dalam pengukuran kinerja dengan pendekatan Balance Scorecard menggunakan ukuranreturn on investmen, return on total asset, rasio likuiditas, dan rasio solvabilitas untuk pengukuran perspektif finansial. Ukuran untuk perspektif customer yaitu retensi pelanggan, akuisisi pelanggan, dan kepuasan pelanggan. Ukuran untuk perspektif proses bisnis internal yaitu proses inovasi, proses operasi, dan layanan purna jual. Dan ukuran untuk perspektif pembelajaran dan pertumbuhan yaitu kepuasan karyawan, retensi pekerja, dan produktivitas pekerja. Berdasarkan analisis kinerja yang dilakukan peneliti menunjukkan bahwa kinerja PT. Segar Murni Utama adalah cukup baik. Perspektif keuangan dinilai baik. Perspektif pelanggan dan perspektif bisnis internal adalah baik namun perspektif pembelajaran dan pertumbuhan dinilai kurang baik karena tingkat kepuasan dan produktivitas pekerja dinilai kurang. Dalam penelitian ini hanya menggunakan tiga periode data keuangan yang diteliti karena adanya ketrbatasan penelitian. Selain itu jumlah informan yang diwanwancarai hanya sesuai dengan kebutuhan penelitian.  

Persepsi dan partisipasi mahasiswa dalam pelaksanaan metode mengajar diskusi pada mata kuliah bidang studi Program Studi Pendidikan Administrasi Perkantoran Jurusan Pendidikan Dunia Usaha FPIPS IKIP MALANG semester I 1992/1993
oleh Febriar Handayani

 

Manajemen kurikulum pelatihan di Autotronic Department (studi kasus di Pusat Pengembangan dan Pemberdayaan Pendidikan dan Tenaga Kependidikan/Vocational Education Development Center Malang) / Candra Iswahyudi

 

ABSTRAK Iswahyudi, Candra. 2015. ManajemenKurikulumPelatihan di Autotronic Department (StudiKasus di PusatPengembanganPendidikdan Tenaga Kependidikan/Vocational Education Development Center Malang). Skripsi, JurusanAdministrasiPendidikan. FakultasIlmuPendidikan, UniversitasNegeri Malang. Pembimbing: (I) Prof. Dr. M. Huda A.Y.,M.Pd, (II) RadenBambangSumarsono, S.Pd, M.Pd. Kata kunci: Pelatihan, Autotronic Department, PPPPTK/VEDC Malang, ManajemenKurikulumPelatihan. Autotronic Departmentberdiripadatahun 2004 di lingkunganVocational Education Development Center (VEDC) Malang. SebelumberdirisendiriAutotronic Departmentmerupakanbagiandariotomotifataumenginduk di otomotif, karenaperkembanganotomotif yang dialamisaatinilebihkeelektricalmakatercetuslahgagasanuntukmendirikandepartementsendiri. KurikulumAutotronic Departmentditerapkanlangsungterhadap para guru-guru yang mengikutipelatihan. Kurikulum yang diterapkan juga sesuaidengankondisi yang ada di luar. Kurikulumtersebutdisusunolehdepartemensendiridanuntukpengesahankurikulum yang diterapkanlangsungdaripemerintah. Selainitudalampenerapannya, menggunakanmetodeteam teaching yang memudahkanpengajardanpesertadalam proses pembelajaran. Penelitianinidilaksanakandengantujuanuntukmendiskripsikanbeberapabeberapahal,yaitu: perencanaankurikulumpelatihan, pengorganisasiankurikulumpelatihan, pelaksanaankurikulumpelatihan, evaluasikurikulumpelatihanAutotronic Department, faktorpendukungdanpenghambatdalammanajemenkurikulumpelatihanAutotronicDepartement, upayamengatasihambatandanpemberdayaanpendukungdalammanajemenkurikulumpelatihanAutotronicDeparment. Penelitianinimenggunakanpendekatankualitatifdenganjenispenelitianstudikasus. Hasilpenelitiandipaparkandalambentukbahasaatau kata-kata danbagan. Pengumpulan data digunakandenganmenggunakanteknikobservasiwawancaramendalamdandokumentasi. Dalampenelitianinipenelitibertindaksebagaiinstrumenkunciatauinstrumenutama. Untukpengecekankeabsahantemuan, penelitimelakukanketekunanpengamatan, triangulasi, member check, danperpanjanganpengamatan. Kegiatananalisis data dilakukandenganreduksi data, display data,danverifikasi data. Hasilpenelitianmemperolehenamkesimpulansebagaiberikut. Pertama, Kurikulum yang diterapkan di Autotronic Departmentmerupakangabunganantarakurikulum yang ada di Autotronic Departmentdengankurikulum yang berlaku. Penyusunankurikulummelibatkansemuapihaksepertiinstruktur, KepalaDepartemen, Wakil KepalaDepartemen, dananggota lain. PerencanaankurikulumAutotronic Departmentmeliputianalisiskebutuhan, rapatterstruktur, danpengambilankeputusan. Kedua, Proses pengorganisasiankurikulumpelatihan di Autotronic Departmentmelakukanpembagiantugasmelaluirapat agar semuapetugas yang ada di departementersebutmengertiapasajatugasdanwewenangmasing-masingpegawai.Semuakegiatanpengorganisasiandilakasanakandengan proses rapat-rapatterstrukturdemi tercapainyatujaun yang diharapakan. Ketiga, pelaksanaankurikulumnyadilakukan di duatempat, jikateoridilakukandikelas-kelas yang sudahditentukandanpraktekmenggunakan area bengkelataupunbisa juga menggunakan area kelas.Keempat, proses evaluasipelaksanaan program yang dilaksanakanadaangket yang diberikanolehbagianevaluasidari VEDC Malang yang diisioleh para pesertapelatihan.Dalamangkettersebutmencakup proses pelaksanaannya, instrukturdalammengajar, waktu yang diberikan, saranadanprasarananya, media-media penunjanglainnya, dan lain sebagainya. Kelima, adabeberapafaktorpendukung yang ada di Autotronic Department,saranadanprasaranasudahmumpunidantersediasepertiadaberbagaimobil yang menjadialatperaga, tempat yang mendukungpelaksanaankurikulumpelatihan, dansebagainya. Instruktur yang memilikikompetensisesuaidenganbidang yang diajarkan.Pesertapelatihan yang kebanyakanadalah guru dan rata-rata telahmemilikikompetensipenunjang.Selainfaktorpendukungada juga beberpafaktorpenghambat, anggarandaripemerintahbelumada, pesertadiklat yang belummelikikompetensitentanghal yang didiklatkandaninstrukturmendapatkantugasmendadak yang tidakbisaditinggalkanatausakit. Keenam, adabeberapaupayauntukmengatasihambatan yang ada di Autotronic Department, darisegipendanaan yang belumadadepartemenmenunggusampaidanatersebutbisaditurunkan. Dari segipeserta yang tidakmemilikikompetensidasar, para instrukturharusmenjelaskanlebihrincilagi. Dari segiinstrukturmerubahsistempengajaran. Sedangkanuntukpemberdayaanpendukungyaitumelakukanperawatansaranadanprasaranasesuaidenganjadwal yang telahdianggarkan. Menyediakandiklat-diklatuntukinstruktur agar bisamengembangkankompetensi yang diamiliki. Menjagahubunganbaikdengan para pesertapelatihan, para instrukturhanyasebagaifasilitator yang bertugasmemberikaninformasidanuntuksalingshearingantarainstrukturdanpeserta. Berdasarkankesimpulan-kesimpulantersebut, penelitimemberikan saran-saran sebagaiberikut. (1) BagiDirektur VEDC Malang, hasilpenelitianinidapatdijadikansebagaireferensiuntukmengembangkankurikulumpelatihan-pelatihanlainnya, yaitudenganmembentukkurikulumsecarautuhdengansehingga para intrukturlebihmudahuntukmelakukansistembelajarmengajar. (2) BagiKepalaDepartemenhendaknyapenelitianinidapatdijadikansebagaibahanreferensitambahanuntukmengembangkankurikulumpelatihan agar lebihefektifdanefisiendalampelaksanaannya, sertamemeperbaikisistempengelolaankurikulumpelatihanbaikperencanaan, pelaksanaan, maupunevaluasi. (3) BagijurusanAdministrasiPendidikandiharapkanmemberikanperhatiankepadapendidikan non-formal khususnyapadamanajemenkurikulumpelatihan. (4) Bagipenelitilain yang sejenisdiharapkandapatmengembangkanhasilterkaitmanajemenkurikulumpelatihanbaik di Autotonic Departmentataupun di lembaga lain denganbidang yang sama, sehinggadapatdijadikansebagaibahanperbandingandanreferensidalammanajemenkurikulumpelatihan.

Efektifitas teknik pengajaran SQ3R dalam pengajaran membaca pemahaman bahasa Arab bagi siswa kelas III di Madrasah Tsanawiyah Hasyim Asy'ari Batu / oleh Dwi Rahayu

 

Studi tentang sikap dan minat siswa mengikuti kegiatan ekstrakurikuler kesenirupaan sebagai bagian dari pendidikan Seni Rupa di SMUN I Turen Kabupaten Malang / oleh Aminatul Ahmadi

 

Peningkatan hasil belajar PKn melalui model TGT (Teams Game Tournaments) bagi siswa kelas IV SDN Tondowulan II Jombang / Aris Sandhi Sucahyono

 

Kata Kunci: hasil belajar, PKn, TGT Pembelajaran yang dilaksanakan di kelas IV SDN Tondowulan II yang masih menggunakan metode ceramah dalam pembelajaran ternyata membuat aktivitas belajar siswa kurang maksimal yang berdampak pada hasil akhir pembelajaran masih jauh dibawah nilai minimal yang ditargetkan sekolah. Penelitian ini bertujuan (1) mengetahui bagaimanakah pelaksanaan pembelajaran PKn dengan menerapkan TGT (Teams Game Tournaments) di kelas IV SDN Tondowulan II Jombang, (2) mengetahui keberhasilan pembelajaran TGT (Teams Game Tournaments) dalam meningkatkan hasil belajar siswa pada mata pelajaran PKn kelas IV SDN Tondowulan II Jombang tahun pelajaran 2010/2011, (3) mengetahui dampak TGT (Teams Game Tournaments) terhadap aktivitas belajar siswa selama proses belajar mengajar di kelas IV SDN Tondowulan II Jombang Metode yang digunakan dalam penelitian ini adalah deskriptif kualitatif berdasarkan pada temuan-temuan yang muncul dilapangan. Rancangan yang digunakan adalah PTK dengan dua siklus. Masing-masing siklus terdiri atas (a) Perencanaan, (b) Pelaksanaan, (c) Observasi, dan (d) Refleksi. Instrumen yang digunakan adalah (a) Tes Tertulis, (b) Wawancara, (c) Pedoman Observasi, dan (d) Dokumentasi. Hasil penelitan ini menunjukkan bahwa (1) pelaksanaan pembelajaran PKn dengan menerapkan TGT (Teams Game Tournaments) adalah belajar secara mandiri dan diskusi kelompok, permainan dan turnamen, (2) pembelajaran kooperatif model TGT (Teams Game Tournaments) terbukti dapat meningkatkan hasil belajar siswa pada mata pelajaran PKn kelas IV SDN Tondowulan II Jombang, yaitu dari rerata skor 67,28 dan daya serap klasikal 28% pada pra siklus setelah tindakan pada siklus I menjadi rerata skor 70,56 dan daya serap klasikal 64%, dan rerata skor 85,32 dan daya serap klasikal 84% pada siklus II, (3) dampak pembelajaran model TGT (Teams Game Tournaments) terhadap aktivitas belajar siswa adalah semangat belajar siswa menjadi lebih meningkat. Kesimpulan dari penelitian ini adalah (1) Pelaksanaan pembelajaran PKn dengan menerapkan TGT (Teams Game Tournaments) di kelas IV SDN Tondowulan II Jombang adalah pembelajaran yang dilaksanakan dengan cara kelompok diskusi dan langkah-langkahnya terdiri dari penyajian kelas, kerja kelompok, turnamen dan penghargaan kelompok, (2) Pembelajaran kooperatif model TGT (Teams Game Tournaments) dapat meningkatkan hasil belajar PKn siswa, yaitu berdasar pada paparan data prasiklus jumlah rerata skor 67,28 dan daya serap klasikal 28%, dan setelah diadakan tindakan pada siklus I rerata skor meningkat 70,56 dan daya serap klasikal meningkat menjadi 64%. Jumlah rerata skor dan daya serap mengalami peningkatan lagi pada siklus II yaitu 85,32 dan 84%, (3) Dampak TGT (Teams Game Tournaments) terhadap aktivitas belajar siswa selama proses belajar mengajar di kelas IV SDN Tondowulan II Jombang adalah suasana kelas makin menyenangkan dengan adanya belajar sambil bermain pada saat diskusi kelompok dan terutama pada saat turnamen, pengaruh lainnya khususnya pada saat kerja kelompok adalah tampak adanya peningkatan interaksi antar siswa dalam kelompok. Disarankan (1) kepada guru agar dapat menerapkan pembelajaran kooperatif model TGT (Teams Game Tournaments) agar pembelajaran lebih menyenangkan, siswa menjadi lebih aktif dalam belajar dan kerjasama dalam pembelajaran khususnya dalam kegiatan diskusi dapat meningkat, (2) Untuk memahami lebih mendalam tentang penerapan pendekatan pembe­lajaran kooperatif model TGT (Teams Game Tournaments) dengan cara guru diharapkan terlebih dahulu mengerti dan memahami apa saja hal-hal yang harus diperhatikan dalam melaksanakan TGT (Teams Game Tournaments). Selain itu, hendaknya guru mengenal siswa secara perorangan dan lingkungan anak.

Penguasaan mufrodat siswa kelas II Program Keagamaan Madrasah Aliyah (MA) Al-Ma'arif Singosari Kabupaten Malang / oleh Ahmad Junaidi

 

Penerapan model pembelajaran problem based learning dengan student achievement division untuk meningkatkan hasil belajar biologi siswa kelas X MIA 1 SMA Laboratorium UM / Prayoga Tri Budiarsa

 

ABSTRAK Budiarsa, Prayoga Tri. 2015. Penerapan Model Pembelajaran Problem Based Learning dipadukan dengan Student Teams Achievement Division untuk Meningkatkan Hasil Belajar Biologi Siswa Kelas X MIA 1 SMA Laboratorium UM. Skripsi, Jurusan Biologi, Program Studi Pendidikan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (I) Dr. Susriyati Mahanal, M.Pd, (II) Drs. H. Triastono Imam Prasetyo, M.Pd Kata kunci: model pembelajaran PBL, STAD, hasil belajar. Berdasarkan hasil observasi di kelas X MIA 1 dan wawancara dengan guru biologi diketahui sebagai berikut. 1) Sikap belajar peserta didik masih rendah. 2) Peserta didik belum bias merumuskan masalah dan mengajukan hipotesis. 3) Kemampuan kerjasama peserta didik masih kurang. 4) Rasa ingin tahu peserta didik masih kurang. 5) Nilai ulangan harian bab dunia hewan kelas X MIA 1 masih tergolong rendah, dari 27 siswa 56% yang tuntas dengan Kriteria Ketuntasan Minimal (KKM) sebesar 75. Salah satu alternatif untuk mengatasi hal tersebut adalah menerapkan model pembelajaran PBL dipadukan dengan STAD. Tujuan dari penelitian ini adalah untuk mendeskripsikan peningkatan hasil belajar siswa kelas X MIA I SMA Laboratorium UM melalui penerapan model Pembelajaran PBL dipadukan dengan STAD. Jenis penelitian adalah Penelitian Tindakan Kelas (PTK) dengan 2 siklus. Setiap siklus terdiri dari 4 tahap yaitu perencanaan tindakan, pelaksanaan tindakan, observasi dan refleksi. Materi yang diajarkan adalah Ekosistem pada siklus 1 dan Pencemaran Lingkungan pada siklus 2. Hasil penelitian menunjukkan bahwa hasil belajar yang terdiri dari sikap ilmiah dan hasil belajar kognitif meningkat dari siklus 1 ke siklus 2. Berdasarkan lembar observasi sikap ilmiah siswa dari siklus I ke siklus II: (a) rasa ingin tahu meningkat dari 37,5% menjadi 62,1%; (b) jujur meningkat dari 68,6% menjadi 97,1%; (c) tekun meningkat dari 66,7% menjadi 69,5%; (d) teliti meningkat dari 61,3% menjadi 69,5%; (e) tanggung jawab meningkat dari 68,6% menjadi 75,3%. Berdasarkan angket sikap ilmiah siswa sebelum dan sesudah tindakan juga meningkat pada tiap indikator yaitu: (a) rasa ingin tahu dari 78,2% menjadi 82,8%; (b) jujur dari 74,1% menjadi 84,8%; (c) tekun dari 72,4% menjadi 79,6%; (d) teliti dari 75,6% menjadi 80,2%; (e) tanggung jawab dari 71,2% menjadi 82,2%. Hasil belajar kognitif secara klasikal dari siklus I ke II meningkat 62,07 menjadi 75,8%. Hasil belajar siswa kelas X MIA I SMA Laboratorium UM yang terdiri dari sikap ilmiah dan hasil belajar kognitif mengalami peningkatan melalui penerapan model pembelajaran PBL dipadukan dengan STAD. Saran untuk guru agar menggunakan model pembelajaran PBL dipadukan dengan STAD.

Perbedaan sikap terhadap pelestarian lingkungan antara siswa SMTA umum dengan SMTA kejuruan se kecamatan Magetan, kabupaten Magetan / oleh Indri Handayani

 

Penggunaan analisis CHAID untuk segmentasi pelanggan kredit motor (studi kasus di PT. FIF Cabang Kepanjen) / Moch. Raharjo Wicaksono

 

ABSTRAK Wicaksono M, R,. 2015. Penggunaan Analisis CHAID untuk Segmentasi Pelanggan Kredit Motor (Studi Kasus di PT. FIF Cabang Kepanjen). Jurusan Matematika Fakultas MIPA Universitas Negeri Malang. Pembimbing: Dr. Abadyo, M.Si. Kata Kunci: CHAID Kasus kredit macet merupakan masalah klasik pada bidang kredit. Banyak faktor yang dapat menyebabkan suatu kegiatan kredit itu menjadi bermasalah atau kredit macet. Solusi untuk mengurangi banyaknya kredit yang bermasalah pada permasalahan kredit macet ini yaitu diperlukan segmentasi calon kreditur yang tepat, mengingat bahwa kreditur merupakan kunci utama dalam kegiatan pengkreditan. Dalam penelitian - penelitian mengenai segmentasi terdapat dua metode pendekatan yaitu metode interdependensi dan dependensi. Salah satu analisa yang cocok untuk meneliti mengenai segmentasi yang menggunakan pendekatan dependensi adalah analisis CHAID (Chi-Squared Automatic Interaction Detection analysis). Analisa CHAID dapat menghasilkan suatu diagram pohon keputusan yang menyediakan informasi tentang hubungan antara variabel terikat terhadap variabel bebas serta informasi mengenai karakteristik segmen. Analisa CHAID mampu menangani variabel monotomik, bebas, dan mengambang. Pada kasus kredit macet di PT. FIF Cabang Kepanjen, analisis CHAID digunakan untuk menentukan segmentasi pelanggan kredit motor berdasarkan status kredit pelanggan sebagai variabel terikat dan profil pelanggan sebagai variabel bebas. Segmentasi pelanggan dengan analisa CHAID dilakukan untuk mengidentifikasi segmen pelanggan yang memiliki rasio kredit macet yang paling rendah. Berdasarkan hasil analisa CHAID didapatkan tiga segmen yang berbeda. Segmen pelanggan dengan karakteristik status pelanggan baru atau pelanggan baik yang menempati rumah pribadi adalah segmen yang memiliki rasio kredit macet yang paling rendah.

Hubungan pengetahuan tentang media instruksional, sikap terhadap media instruksional, dan frekuensi pemakaian media instruksional oleh guru-guru SD di SDN se kecamatan Klojen kotamadya Malang
oleh Kastur

 

Implementasi model pembelajaran kooperatif tipe Think Pair Share (TPS) dalam meningkatkan aktivitas belajar dan sikap positif siswa pada mata pelajaran akuntansi kelas XI AK SMK Muhammadiyah 3 Singosari / Ihsanul Winda Sari

 

ABSTRAK Sari, Winda Ihsanul. 2015. Implementasi Model Pembelajaran Kooperatif Tipe Think Pair Share (TPS) Dalam Meningkatkan Aktivitas Belajar dan Sikap Positif Siswa Pada Mata Pelajaran Akuntansi Kelas XI AK SMK Muhammadiyah 3 Singosari. Skripsi Program Studi Pendidikan Akuntansi Jurusan Akuntansi Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (1) Sriyani Mentari, S.Pd., M.M (2) Sawitri Dwi Prastiti, S.E., M.Si., Ak Kata kunci : model pembelajaran kooperatif tipe Think Pair Share (TPS), aktivitas belajar siswa, sikap positif siswa Penelitian ini bertujuan untuk meningkatkan aktivitas belajar siswa dan sikap positif siswa melalui penerapan model pembelajaran kooperatif tipe Think Pair Share (TPS) pada siswa kelas XI AK SMK Muhammadiyah 3 Singosari. Penelitian ini termasuk jenis Penelitian Tindakan Kelas (PTK) dengan pendekatan penelitian kualitatif. Penelitian ini terdiri dari 2 siklus dimana dalam masing-masing siklus terdapat 2 pertemuan. Subyek penelitian ini adalah siswa keas XI AK dengan jumlah siwa 44 siswa yang terdiri dari 4 siswa laki-laki dan 40 siswa perempuan di SMK Muhammadiyah 3 Singosari. Pengumpulan data dalam penelitian ini melalui observasi dan wawancara. Hasil penelitian ini menunjukkan bahwa penerapan model model pembelajaran kooperatif tipe Think Pair Share (TPS) dapat meningkatkan aktivitas belajar dan sikap positif siswa dari siklus I ke siklus II. Meningkatnya aktivitas belajar siswa ditandai dengan kesediaan siswa untuk membawa sumber belajar, siswa mudah menemukan pokok bahasan dengan sumber belajar yang dibawa, siswa fokus dengan menggunakan sumber belajar yang dibawa, siswa bersedia membaca materi dan soal yang diberikan guru atau membaca sumber belajar yang dibawa dengan antusias, mampu memecahkan soal atau masalah secara mandiri, dan siswa menganalisis soal sesuai petunjuk atau langkah-langkah yang diberikan guru. Meningkatnya sikap positif siswa ditandai dengan siswa memperhatikan materi akuntansi yang disajikan oleh guru, siswa bersemangat memecahkan soal atau masalah akuntansi yang diberikan oleh guru, siswa bersemangat mencari jawaban soal dari sumber belajar yang dibawa, siswa mampu bekerjasama atau berdiskusi dengan kelompok, dan siswa berpartisipasi dalam mengikuti pembelajaran akuntansi. Berdasarkan hasil penelitian, saran yang bisadiberikan dalam pelaksanaan model pembelajaran kooperatif tipe Think Pair Share (TPS) yaitu siswa dapat lebih aktif lagi dalam kegiatan pembelajaran dan dalam proses pembelajaran guru memberikan kesempatan kepada siswa untuk memunculkan ide-ide ataupun pertanyaan-pertanyaan baik secara lisan maupun tertulis sehingga dapat meningkatkan aktivitas belajar dan sikap positif siswa.

Fungsi organisasi sosial sebagai media informasi program pembangunan bagi pemuda dan orang dewasa di desa Wonodadi kecamatan Udanawu kabupaten Blitar
oleh Ahmad Zein

 

Pengembangan media pembelajaran administrasi sarana dan prasarana menggunakan multimedia berbasis Corel Videostudio Pro X7 untuk meningkatkan hasil belajar siswa (studi pada siswa kelas XI Kompetensi Keahlian Administrasi Perkantoran di SMK Negeri 1 Ngawi) / Ulfah Nur F

 

Pengembangan kemampuan profesional guru
studi kasus pada SMU Krisna Putra I Jatiwuni
oleh Sri Gatihandajani

 

Pengembangan bahan ajar menggunakan pendekatan saintifik untuk mengeksplisitkan hakikat sains (NOS) dan ber[ikir kritis pada materi kelarutan dan hasil kali kelarutan / Muhammad Solihhuddin

 

ABSTRAK Solihhuddin, Muhammad. 2015. Pengembangan Bahan Ajar Menggunakan Pendekatan Saintifik untuk Mengeksplisitkan Hakikat Sains (NOS) dan Berpikir Kritis pada Materi Kelarutan dan Hasil Kali Kelarutan. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Prof. Sri Rahayu, Ph.D, (II) Drs. Prayitno, M.Pd. Kata kunci:bahan ajar, literasi sains, pendekatan saintifik, hakikat sains (NOS), berpikir kritis Pemerintah Indonesia melakukan reformasi di bidang pendidikan dengan menerapkan kurikulum 2013 yang menggunakan pendekatan saintifik. Pendekatan tersebut diyakini dapat meningkatkan literasi sains siswa di Indonesia yang saat ini masih tergolong sangat rendah.Menurut penilaian OECD melalui PISA, literasi sains siswa Indonesia menduduki peringkat 64 dari 65 negara. Hal ini dimungkinkan karena sebagian besar bahan ajar yang ada termasuk bahan ajar Kimia SMA/MA tidak memuat aspek hakikat sains (NOS) secara eksplisit dan kurang melatih kemampuan berpikir kritis. Oleh karena itu, perlu dikembangkan bahan ajar yang memuat hakikat sains (NOS) secara eksplisit dan mampu melatih kemampuan berpikir kritis. Penelitian ini bertujuan untuk menghasilkan prototipe bahan ajar menggunakan pendekatan saintifik untuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis pada materi kelarutan dan hasil kali kelarutan, serta mengetahui kelayakan prototipe bahan ajar tersebut melalui validasi ahli (2 orang dosen Jurusan Kimia) dan praktisi (1 orang guru mata pelajaran Kimia SMK dan 1 orang guru mata pelajaran Kimia SMA/MA). Penelitian pengembangan untuk menghasilkan prototipe bahan ajar ini menggunakan model 4D (four D model) yang dikemukakan oleh Thiagarajan (1974). Model 4D ini terdiri dari tahap pendefinisian (define), perancangan (design), pengembangan (develop), dan penyebaran (disseminate).Namun, pengembangan yang dilakukan hanya terbatas pada tahap define, design, serta develop karena keterbatasan waktu, tenaga, dan biaya.Data yang diperoleh pada pengembangan ini berupa data kuantitatif berdasarkan skor angket tanggapan dari validator ahli dan praktisi yang disusun dalam skala Likert, serta data kualitatif berdasarkan tanggapan dan saran-saran perbaikan yang diisi oleh validator ahli dan praktisi. Prototipe bahan ajar yang dihasilkan dari pengembangan ini terdiri dari buku siswa dan buku guru. Buku siswa memuat materi kelarutan dan hasil kali kelarutan,sedangkan buku guru berisi panduan guru, panduan materi, silabus, RPP, dan instrumen penilaian. Hasil validasi bahan ajar menunjukkan bahwa buku siswamemenuhi kriteria sangat layak (80,83%)dan buku guru juga memperoleh kriteria sangat layak (80,83%).Berdasarkan hasil tersebut dapat disimpulkan bahwa prototipe bahan ajar menggunakan pendekatan saintifikuntuk mengeksplisitkan hakikat sains (NOS) dan berpikir kritis pada materi kelarutan dan hasil kali kelarutansangat layak untuk diuji lapangan.

Studi pendapat tentang tugas kepala sekolah dalam bidang teknis administratif dan teknis edukatif di sekolah dasar negeri kodya Malang / oleh Bintri Novia

 

Studi tentang kegiatan guru dalam pengelolaan kelas di SMA negeri se kabupaten Mojokerto
oleh Mahfudi

 

Pengembangan multimedia pembelajaran berbasis WEB mata pelajaran teknologi informasi dan komunikasi di SMA An-Nur Bululawang Malang / Muhammad Abdul Ghofur

 

Kata kunci: Pengembangan, Multimedia Pembelajaran, Berbasis Web, TIK, Sadiman Salah satu media pembelajaran yang berkembang pada saat ini adalah teknologi informasi yang wujudnya berupa web dan salah satu teknologi informasi yang mendukung pembelajaran adalah komputer, khususnya pembelajaran berbasis web. Web dapat disajikan dengan perpaduan gambar, tulisan dan gerak yang berguna untuk mempermudah pemahaman belajar dan juga bisa diakses tidak harus di satu tempat atau terpaku pada lokasi tertentu, selama bisa tergabung dalam jaringan. Sehingga bisa dikatakan web bisa dimanfaatkan dimana saja dan kapan saja, ketika memang pembelajaran itu dibutuhkan. Berdasarkan hasil observasi di SMA An-Nur Bululawang Malang dalam pencapaian nilai harian belajar siswa dalam ulangan harian dipandang masih belum memenuhi target SKM mata pelajaran TIK yakni 70 sedangkan siswa ratarata nilainya 50-60. Hal ini disebabkan oleh beberapa faktor, diantaranya pola pembelajaran yang masih bersifat konvensional, sekolah memberikan batasan dalam akses internet karena ditakutkan siswa yang berstatus santri menggunakan internet untuk mengakses situs porno atau untuk hal-hal yang negatif dikarenakan memang belum tersedianya teknisi tenaga ahli dalam pengontrolan akses internet, maka dari itu siswa belum bisa memanfaatkan internet secara maksimal dalam pembelajaran, serta jumlah siswa yang lebih banyak dari setiap kelas rata-rata 40 siswa dibandingkan jumlah komputer yang tersedia 20 unit, sehingga masih perlu adanya upaya peningkatan hasil belajar salah satunya dengan variasi dalam pembelajaran di sekolah. Web pembelajaran diharapkan menjadi pilihan yang dapat digunakan sebagai media pembelajaran. Karena media web ini bisa diakses melalui jaringan yang sudah dimiliki oleh sekolah, sehingga siswa bisa belajar secara mandiri. Selain itu media web sudah diorganisasikan dan dikombinasikan dengan materi gambar, suara, video tutorial dan soal latihan di sajikan secara interaktif memberikan pembelajaran yang menarik, dan dapat mempermudah guru dalam penyampaian pesan pembelajaran kepada siswa dalam memahami materi, serta memotivasi belajar siswa sehingga diharapkan dapat meningkatkan prestasi hasil belajar siswa. Berdasarkan permasalahan itu, maka pengembang memandang perlu memproduksi media pembelajaran yang dapat digunakan pada proses belajar mengajar dengan menggunakan multimedia pembelajaran berbasis web. Adapun tujuan dari pengembangan media pembelajaran ini untuk menghasilkan produk multimedia pembelajaran berbasis web yang memberikan variasi dalam pembelajaran serta untuk mengetahui validitas multimedia pembelajaran berbasis web mata pelajaran Teknologi Informasi dan Komunikasi, kelas XI semester 2 dengan materi pokok software pengolahan angka Microsoft excel 2003 dan untuk mengetahui apakah produk yang dibuat memberikan variasi baik dari segi media maupun metode pembelajaran yang dihasilkan maupun dalam meningkatkan hasil belajar siswa. Multimedia pembelajaran berbasis web ini dikembangkan dengan mengadaptasi model pengembangan Sadiman yang terdiri dari 9 langkah, yaitu (1) identifikasi kebutuhan, (2) perumusan tujuan, (3) perumusan materi, (4) perumusan alat pengukuran keberhasilan, (5) desain (storyboard), (6) produksi, (7) validasi, (8) revisi. (9) produk siap dimanfaatkan Pengumpulan data dilakukan pengembang dengan menggunakan angketvalidasi, pre test dan post test, kepada ahli media, ahli materi, dan audien kemudian data tersebut diolah untuk mengetahui tingkat kevalidan media pembelajaran serta meningkatnya hasil belajar siswa sesudah menggunakan multimedia pembelajaran berbasis web. Hasil pengembangan Multimedia pembelajaran berbasis web untuk mata pelajaran Teknologi Informasi dan Komunikasi tentang software pengolahan angka microsoft excel 2003 di SMA An-Nur Bululawang Malang ini memenuhi kriteria valid dengan hasil uji ahli materi mencapai tingkat kevalidan 97,5%, ahli media mencapai tingkat kevalidan 87,5%, dan uji responden (siswa) Perseorangan mencapai tingkat kevalidan 90%, kelompok kecil mencapai tingkat kevalidan 76,75%, dan hasil uji lapangan mencapai tingkat kevalidan 80,7%. Dan dari hasil nilai uji coba siswa post test di bandingkan dengan pre test, pada uji coba perseorangan 29%, uji coba kelompok kecil 26%, dan uji coba lapangan 23,3%.Menunjukkan peningkatan hasil belajar siswa. Berdasarkan hasil pengembangan telah dilakukan, dapat disimpulkan bahwa multimedia pembelajaran berbasis web untuk mata pelajaran Teknologi Informasi dan Komunikasi tentang software pengolahan angka microsoft excel 2003 di SMA An-Nur Bululawang Malang, dapat meningkatkan hasil belajar siswa sehingga bisa dikatakan valid/layak digunakan sebagai media pembelajaran. Saran pengembang bagi pengembang produk selanjutnya yakni mengkaji lebih dalam pada saat pemilihan materi, pemilihan software yang digunakan, komposisi warna, gambar dan menyediakan teknisi untuk mengatur jaringan internet untuk mengontrol secara berkelanjutan pada penggunaan internet sehingga pengaksesan internet bisa dimanfaatkan dalam pembelajaran dan kemudian memberikan balikan yang akan di dapat oleh siswa agar menghasilkan media yang layak disajikan dalam bentuk multimedia pembelajaran berbasis web.

Robot berkaki pemadam api dengan remote control berbasis mikrokontroler AT89C51 / oleh Abidin dan Agus Salim

 

Pengaruh minat memilih program keahlian Administrasi Perkantoran dan motivasi belajar terhadap prestasi belajar (studi pada siswa kelas XI program keahlian Administrasi Perkantoran SMK Muhammadiyah 3 Singosari) / Adhitya Admadhani

 

Kata Kunci: minat, motivasi belajar, prestasi belajar. Dalam keseluruhan proses belajar mengajar terjadi interaksi antara berbagai komponen. Masing-masing komponen diusahakan saling mempengaruhi sehingga dapat tercapai tujuan pendidikan dan pengajaran. Ini berarti bahwa berhasil tidaknya pencapaian tujuan pendidikan banyak bergantung kepada bagaimana proses belajar yang dialami siswa sebagai anak didik. Dengan belajar, maka kemampuan mental siswa semakin meningkat.Tidak bisa disangkal bahwa dalam belajar seseorang dipengaruhi oleh beberapa faktor. Sehingga penting bagi siswa untuk mengetahui faktor-faktor tersebut. Hal ini juga lebih penting tidak hanya bagi siswa tetapi juga bagi seorang guru di dalam mengatur dan mengendalikan faktor-faktor yang mempengaruhi belajar, sehingga dapat terjadi proses belajar mengajar yang optimal,faktor-faktor tersebut diantaranya adalah minat memilih program keahlian dan motivasi belajar. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui seberapa besar pengaruh minat memilih program keahlian Administrasi Perkantoran dan motivasi belajar terhadap prestasi belajar pada siswa program keahlian Administrasi perkantoran di SMK Muhammadiyah 3 Singosari. Penelitian ini menggunakan rancangan penelitian deskriptif korelasional, dan populasi dalam penelitian ini adalah seluruh siswa program keahlian Administrasi Perkantoran di SMK Muhammadiyah 3 Singosari yang berjumlah 198 siswa sedangkan jumlah sampelnya adalah 63 siswa yang diambil dari seluruh siswa kelas XI program keahlian Administrasi Perkantoran. Teknik pengumpulan data penelitian ini adalah angket dan dokumentasi. Teknik analisis data yang digunakan adalah analisis regresi linear berganda. Hasil analisis menyatakan bahwa secara simultan terdapat pengaruh positif yang signifikan antara minat memilih program keahlian Administrasi Perkantoran dan motivasi belajar terhadap prestasi belajar dengan hasil perhitungan R square (R2) sebesar 0,245 atau 24,5%, dengan nilai Fhitung (9,751) > Ftabel(3,150). Sedangkan secara parsial terdapat pengaruh positif yang signifikan antara minat memilih program keahlian Administrasi Perkantoran dengan nilai thitung(2,268) > ttabel(2,000),dan terdapat pengaruh positif yang signifikan antara motivasi belajar dan prestasi belajar dengan nilai thitung(2,291) > ttabel(2,000). Berdasarkan hasil analisis maka dapat disimpulkan bahwa: (1) Ada pengaruh yang signifikan antara minat memilih program keahlian administrasi perkantoran terhadap prestasi belajar; (2) Ada pengaruh yang signifikan antara motivasi belajar terhadap prestasi belajar; dan (3) Ada pengaruh yang signifikan antara minat memilih program keahlian administrasi perkantoran dan motivasi belajar terhadap prestasi belajar. Berikut ada beberapa saran yang perlu diperhatikan oleh berbagai pihak guna meningkatkan minat memilih program keahlian dan motivasi belajar siswa: (1) Mengadakan kegiatan akademis yang dapat menumbuhkan minat siswa pada bidang perkantoran. Caranya adalah dengan meningkatkan pembelajaran yang berpusat pada siswa, dan berorientasi pada praktek; (2) Meningkatkan fungsi dan jumlah fasilitas sarana dan prasarana laboratorium serta melengkapinya, dan mengadakan perbaikan untuk penggantian terhadap alat-alat praktek yang rusak dan sudah tidak layak pakai; (3) Setiap siswa hendaknya mampu untuk membangkitkan motivasi dalam dirinya sendiri, baik itu berupa motivasi instrinsik maupun motivasi ekstrinsik. Sehingga kegiatan belajar akan dapat berjalan dengan baik dan siswa akan dapat mencapai prestasi belajar yang optimal; (4) Dalam menyampaikan materi hendaknya guru menyajikannya semenarik mungkin dengan menggunakan berbagai macam metode mengajar, agar tercipta suasana kelas yang menyenangkan. Selain itu guru juga hendaknya melakukan pendekatan secara individu kepada siswanya yang mengalami kesulitan dalam belajar sehingga dengan adanya kerja sama yang baik antara guru dan siswa diharapkan nantinya minat dan motivasi siswa akan meningkat dan prestasi belajar siswa di sekolah akan meningkat pula.

Hubungan antara sikap badan pada waktu mengetik dan pretasi belajar mengetik manual pada siswa kelas II rumpun perkantoran Sekolah Menengah Ekonomi Tingkat Atas Negeri Malang / oleh Kristina Indarti Nur Pertiwi

 

Penggunaan preposisi dalam karangan siswa kelas VI SDN 44 kotamadya Parepare tahun ajaran 1995/1996 / oleh Odding Maesarah

 

Peningkatan pemblajaran IPA siswa kelas V SDN Pisang Candi 2 Malang melalui model inside outside circle (IOC) / Ida Iriana

 

Kata Kunci: Model Inside Outside Circle (IOC), Pembelajaran IPA. Berdasarkan studi pendahuluan terhadap pelaksanaan pembelajaran IPA di kelas V SDN Pisang Candi 2 Malang, diperoleh permasalahan sebagai berikut: (1) pelaksanaan pembelajaran IPA menggunakan metode diskusi namun guru masih terlalu banyak menjelaskan materi, (2) aktivitas belajar siswa dalam pembelajaran IPA kurang maksimal, dan (3) hasil belajar siswa dalam pembelajaran IPA belum mencapai SKBM. Penelitian ini bertujuan untuk mendeskripsikan: (1) penerapan model IOC dalam pembelajaran IPA pada siswa kelas V SDN Pisang Candi 2 Malang, (2) aktivitas belajar IPA melalui penerapan model IOC, dan (3) hasil belajar IPA melalui penerapan model IOC pada siswa SDN Pisang Candi 2 Malang. Inside Outside Circle (IOC) merupakan salah satu model pembelajaran kooperatif, yaitu para siswa membentuk kelompok, mencari informasi, membentuk lingkaran kecil dan besar, bertukar informasi, diskusi kelompok, serta mempresentasikan hasil diskusi. Penelitian ini menggunakan pendekatan kualitatif. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK). Subyek penelitian ini adalah siswa kelas V SDN Pisang Candi 2 Malang yang berjumlah 28 siswa. Instrumen yang digunakan untuk mengumpulkan data yaitu lembar observasi, tes, dan dokumentasi. Hasil penelitian ini menunjukkan bahwa model pembelajaran IOC dapat meningkatkan pembelajaran IPA kelas V SDN Pisang Candi 2 Malang. Hal ini ditunjukkan dengan meningkatnya aktivitas guru dalam penerapan model IOC. Pada siklus 1 mendapatkan rata-rata (88,89%) meningkat pada siklus 2 menjadi (95,55%). Peningkatan aktivitas belajar siswa dapat dilihat dari rata-rata siklus 1 (60,28%) meningkat pada siklus 2 menjadi (77,67%) peningkatan hasil belajar siswa dapat dilihat dari nilai rata-rata hasil belajar siswa yang meningkat dari pra tindakan (55,17%), siklus 1 (44,64%) meningkat pada siklus 2 menjadi (87,49%). Berdasarkan hasil penelitian ini, disarankan: (1) bagi Kepala Sekolah. Hendaknya selalu membimbing guru untuk melaksanakan pembelajaran yang berpusat pada aktivitas siswa, (2) diharapakan guru menerapkan model IOC dalam pembelajaran khususnya mata pelajaran IPA tentang struktur bumi, (3) dan bagi peneliti lain, diharapkan untuk meneliti model IOC pada mata pelajaran lain.

Urutan perolehan kesesuaian dalam struktur kalimat bahasa Arab tulis siswa kelas III SMA negeri di kodya Malang
oleh Moh. Kholiq

 

Pemanfaatan layanan bimbingan konseling UPT-BK IKIP MALANG oleh mahasiswa
oleh Abdul Hamid

 

Analisis kontrastif sintaksis bahasa Arab dan bahasa Indonesia
oleh Fadilatus Sa'adah

 

Pengembangan bahan ajar pada materi hukum-hukum dasar kimia berbasis discovery learning untuk kelas X Program IPA Sekolah Menengah Atas / Aidha Fajariana Prikarti Salam

 

A study on the frequency of occurence of English tenses in social science and business textbooks / by Dwi Kusmawati

 

A study of metacognitive reading skills of the third year English Department students of IKIP MALANG / by Kusumawardhani

 

The effectiveness of the teacher's written remarks in improving SMA student's achievement in English / by Muhtarom

 

The ability to distinguish gerund from active participle of 1993 English Department students at IKIP MALANG / by Sri Astiti Widayanti

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 |