Penerapan model latihan untuk meningkatkan teknik forehand smash bulutangkis bagi atlet PB Semeru Puger Kabupaten Jember usia 12-15 tahun / Yonatan Teguh Vernando

 

ABSTRAK Vernando, Yonatan Teguh. 2015. Penerapan Model Latihan Teknik Forehand Smash untuk Meningkatkan Teknik Forehand Smash Bulutangkis pada Atlet PB Semeru Puger Kabupaten Jember Usia 12-15 Tahun, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan Universitas Negeri Malang, Pembimbing: (I) Dr. Sapto Adi, M. Kes. (II) Usman Wahyudi, S.Pd., M.Pd. Kata Kunci: forehand smash, permainan bulutangkis. Forehand smash adalah pukulan yang dilakukan terhadap shuttle cock yang berada di kanan atas kepala (bagi yang tidak kidal). Untuk melakukan pukulan forehand smash perlu diperhatikan untuk tahapan dalam gerakannya, yaitu: (1) sikap awal, (2) sikap perkenaan, (3) sikap akhir. Pada observasi awal dilaksanakan pada hari selasa, tanggal 18 Agustus 2015 saat atlet PB Semeru Puger usia 12-15 tahun melakukan latihan teknik bulutangkis, didapat persentase kebenaran pada saat melakukan teknik pukulan forehand smash adalah 54,81%. Adapun observasi yang kedua yaitu pada hari Sabtu, tanggal 22 Agustus 2015 saat atlet PB Semeru Puger usia 12-15 tahun melakukan latih tanding antar atlet, didapatkan untuk persentase keberhasilan atlet dalam melakukan teknik pukulan forehand smash adalah 47,47%. Penelitian ini bertujuan untuk meningkatkan keterampilan teknik pukulan forehand smash melalui penerapan model latihan bagi atlet PB Semeru Puger Kabupaten Jember usia 12-15 tahun. Instrumen yang digunakan dalam penelitian ini adalah model latihan, lembar observasi, catatan lapangan dan dokumentasi. Rancangan penelitian yang digunakan dalam penelitian ini adalah Penelitian Tindakan Olahraga (PTO). Penelitian Tindakan Olahraga ini dilakukan dalam dua siklus, setiap siklus terdiri dari 4 tahap, yaitu: (1) perencanaan, (2) pelaksanaan, (3) observasi, (4) refleksi. Subjek dalam penelitian ini adalah atlet bulutangkis PB Semeru Puger Kabupaten Jember usia 12-15 tahun. Teknik pengumpulan data dalam penelitian ini menggunakan observasi (pengamatan). Setelah dilakukan perlakuan dengan 2 siklus, yang terdiri dari 3 kali pertemuan tiap siklus dengan 9 orang atlet yang terdiri dari 7 atlet putera dan 2 atlet puteri. Persentase kebenaran teknik forehand smash setelah dilakukan tindakan mencapai 90 %. Dilihat dari hasil tersebut yang diperoleh dari tindakan siklus 2, maka tujuan penelitian ini telah tercapai, dan tidak perlu menuju tindak lanjut pada siklus berikutnya. Berdasarkan hasil pelaksanaan penelitian yang telah dilakukan, maka dapat disimpulkan bahwa penerapan model latihan forehand smash dapat meningkatkan teknik forehand smash bagi atlet PB Semeru Puger Kabupaten Jember usia 12-15 tahun.

Penelitian kemampuan menggunakan kata penghubung siswa kelas 6 SD negeri kecamatan Mojoroto kodya Kediri
oleh Asul Wiyanto

 

Hubungan keaktifan ekstrakurikuler dan kebiasaan belajar dengan prestasi belajar siswa SMA Negeri 1 Malang / Santi Anggraini

 

Kata Kunci: kegiatan ekstrakurikuler, kebiasaan belajar, prestasi belajar Kegiatan ekstrakurikuler atau pengembangan diri merupakan kegiatan pendidikan di luar mata pelajaran sebagai bagian integral dari kurikulum sekolah/ madrasah. Kegiatan ini bertujuan untuk mengekspresikan diri sesuai dengan kebutuhan bakat dan minat peserta didik sesuai dengan kondisi sekolah/ madrasah. Banyak siswa yang kurang mengetahui bakat dan minat yang ada pada dirinya sehingga siswa juga kurang maksimal dalam pemilihan kegiatan ekstrakurikuler yang ada di sekolah. Dalam hal ini konselor mempunyai peran yang sangat penting yaitu dalam pelaksanaan layanan penempatan dan penyaluran yang memungkinkan siswa memperoleh penempatan dan penyaluran yang tepat sesuai dengan kemampuan, bakat, minat dan ciri-ciri pribadinya, selain kegiatan ekstrakurikuler yang mendukung peningkatan hasil belajar siswa, kebiasaan belajar juga memiliki hubungan yang erat dalam hal peningkatan hasil belajar siswa. Dengan demikian untuk memperoleh hasil belajar yang baik maka diperlukan pengelolaan kegiatan ekstrakurikuler dan kebiasaan belajar yang baik pula. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui tingkat keaktifan siswa dalam kegiatan ekstrakurikuler, kebiasaan belajar dan prestasi belajar siswa SMA Negeri 1 Malang, selain itu juga untuk mengetahui apakah terdapat hubungan keaktifan dalam kegiatan ekstrakurikuler dengan prestasi belajar siswa, hubungan kebiasaan belajar dengan prestasi belajar siswa serta hubungan keaktifan dalam kegiatan ekstrakurikuler dan kebiasaan belajar dengan prestasi belajar siswa SMA Negeri 1 Malang tahun ajaran 2010/2011. Penelitian ini menggunakan rancangan penelitian deskriptif korelasional. Populasi dalam penelitian ini adalah seluruh siswa kelas X dan XI SMA Negeri 1 Malang yang aktif mengikuti kegiatan ekstrakurikuler tahun pelajaran 2010/2011. Sampel penelitian ini diambil dengan menggunakan Proporsional Random sampling (sampel acak sesuai proporsi tertentu). Pengumpulan data dilakukan dengan menggunakan angket penilaian. Analisis data dilakukan dengan teknik statistika deskriptif, uji validitas, uji reliabilitas, product moment, uji F dan uji asumsi klasik. Berdasarkan hasil analisis tersebut diperoleh enam kesimpulan yaitu (1) Rata-rata siswa kelas X dan XI SMA Negeri 1 Malang cukup aktif dalam mengikuti kegiatan ekstrakurikuler. (2) Rata-rata siswa kelas X dan XI SMA Negeri 1 Malang memiliki kebiasaan belajar yang baik. (3) Rata-rata siswa kelas X dan XI SMA Negeri 1 Malang memiliki prestasi belajar yang cukup tinggi. (4) Ada hubungan yang signifikan antara keaktifan dalam kegiatan ekstrakurikuler dengan prestasi belajar siswa SMA Negeri 1 Malang. (5) Ada hubungan yang signifikan antara kebiasaan belajar dengan prestasi belajar siswa SMA Negeri 1 Malang. (6) Ada hubungan yang signifikan antara keaktifan dalam kegiatan ekstrakurikuler dan kebiasaan belajar dengan prestasi belajar siswa SMA Negeri 1 Malang. Berdasarkan hasil penelitian ini diajukan beberapa saran yaitu: (1) Dengan melihat hasil penelitian ini pihak sekolah diharapkan dapat membantu memperbaiki kebiasaan belajar siswa agar prestasi yang diperoleh lebih baik lagi (2) Dari hasil penelitian ini diharapkan konselor lebih meningkatkan perannya dalam membantu permasalahan yang berkaitan dengan prestasi belajar siswa (3) Bagi siswa diharapkan dapat mengetahui lebih banyak lagi berbagai informasi mengenai pentingnya mengembangkan kebiasaan belajar dan kegiatan ekstrakurikuler dalam meningkatkan prestasi belajar. (4) Bagi peneliti selanjutnya diharapkan dapat menggunakan variabel-variabel yang lain.

Hubungan etos kerja dan pemanfaatan teknologi informasi dengan konerja guru bersertifikat di SD Negeri eks RSBI/SBI Malang / Nurul Fajar Puji Lestari

 

ABSTRAK Lestari, N.F.P. 2015. Hubungan Etos Kerja dan Pemanfaatan Teknologi Informasi dengan Kinerja Guru Bersertifikat di SD Negeri eks RSBI/SBI Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Fattah Hanurawan, M.Si, M.Ed, (II) Farah Farida Tantiani, S.Psi., M.Psi. Kata kunci: etos kerja, pemanfaatan teknologi informasi, kinerja, guru bersertifikat. Penelitian ini bertujuan untuk mengetahui hubungan etos kerja dan pemanfaatan teknologi informasi dengan kinerja guru bersertifikat di SD Negeri eks RSBI/SBI Malang. Penelitian ini menggunakan rancangan deskriptif korelasional. Data penelitian berupa data primer dari skala etos kerja dan skala pemanfaatan teknologi informasi yang dikembangkan oleh peneliti, serta data sekunder dari dokumentasi PKG (Penilaian Kinerja Guru) semester gasal tahun ajaran 2013/2014. Untuk mengukur etos kerja peneliti menggunakan skala etos kerja, untuk pemanfaatan teknologi informasi menggunakan skala pemanfaatan teknologi informasi. Tiap instrumen disebarkan kepada 30 guru SD Negeri bersertifikat yang ada di tiga sekolah yakni SDN Kauman 1 Malang, SDN Tunjungsekar 1 Malang, dan SDN Model Tlogowaru Malang dengan teknik tryout terpakai disebabkan terbatasnya jumlah guru SD Negeri bersertifikat di tiga sekolah tersebut. Karakter subjek penelitian ini adalah: Populasi dari seluruh guru bersertifikat di SDN eks RSBI/SBI Malang. Hasil validitas pada skala etos kerja terdapat 11 aitem dari 24 aitem dengan reliabilitas 0,720. Validitas skala pemanfaatan teknologi informasi 39 aitem dari 48 aitem dengan reliabilitas sebesar 0,958. Berdasar hasil analisa menggunakan data yang valid dalam penelitian ini diperoleh 4 kesimpulan: (1) Etos kerja guru bersertifikat di SD Negeri eks RSBI/SBI Malang umumnya berada dalam klasifikasi tinggi sebesar 63,33%. (2) Pemanfaatan teknologi informasi guru bersertifikat di SD Negeri eks RSBI/SBI Malang umumnya berada dalam klasifikasi rendah sebesar 56,67%. (3) Kinerja guru bersertifikat di SD Negeri eks RSBI/SBI Malang berada dalam klasifikasi tinggi 73,33%. (4) Tidak ada hubungan antara etos kerja dan pemanfaatan teknologi informasi dengan kinerja guru bersertifikat di SD Negeri eks RSBI/SBI Malang. Saran pada peneliti selanjutnya yang membahas tentang etos kerja, pemanfaatan teknologi informasi dan kinerja pada guru SD Negeri bersertifikat diharapkan untuk lebih memperluas kajian terkait etos kerja, pemanfaatan teknologi informasi dan kinerja guru, bisa meneliti subjek dengan jumlah populasi yang lebih besar dan lebih luas, menggunakan instrumen kinerja yang disesuaikan dengan teori dalam kajian pustaka, menggunakan instrumen pemanfaatan TI yang didasari oleh aspek-aspek dari pemanfaatan TI, serta meneliti variabel-variabel lain yang belum diteliti.

Tinjauan pemakaian afiks pada bahasa Tengger dan bahasa Jawa (sebuah analisis perbandingan afiks)
oleh Anang Fatoni

 

Kemampuan latihan pola kalimat siswa kelas IV SD negeri wilayah VI kotamadya Malang
oleh Masnur Muslich

 

Hubungan antara lingkungan kerja dan semangat kerja pegawai dengan produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo / Kholiq Kariyanto

 

Kata kunci: lingkungan kerja, semangat kerja, produktivitas kerja Pegawai Negeri Sipil (PNS) di suatu lembaga pemerintahan bukan hanya sebagai pegawai negara melainkan juga sebagai abdi masyarakat yang bekerja untuk kepentingan masyarakat. Sebagai aparatur negara, pegawai merupakan tulang punggung penyelenggaraan roda pemerintahan. Untuk mendukung hal tersebut kantor harus mempunyai lingkungan kerja yang baik dan kondusif. Bukan hanya lingkungan kerja fisik yang berupa sarana kantor yang harus diperbaiki melainkan juga lingkungan kerja non fisik yang berupa hubungan sosial dalam kantor. Dengan adanya lingkungan kerja yang baik, akan mempengaruhi semangat kerja pegawai sehingga apa yang dihasilkan akan semakin baik, dengan hasil yang baik dari kerja pegawai maka lembaga pendidikan akan senantiasa dipuji dan dijadikan panutan buat lembaga-lembaga yang dinaunginya. Setiap lembaga dituntut untuk menangani dengan serius mengelola sumber daya manusia dengan berusaha meningkatkan performa pegawai tersebut. Maka dari itu penulis tertarik untuk melakukan penelitian dengan judul "Hubungan Lingkungan Kerja dan Semagat Kerja Pegawai dengan Produktivitas Kerja Pegawai di Dinas Pendidikan Kota Probolinggo". Tujuan penelitian ini adalah selain untuk mendeskripsikan tentang lingkungan kerja, semangat kerja dan produktivitas kerja, juga mengetahui adanya hubungan secara langsung yang signifikan antara lingkungan kerja dengan semangat kerja pegawai, hubungan secara langsung yang signifikan antara lingkungan kerja dengan produktivitas kerja pegawai, hubungan secara langsung yang signifikan antara semangat kerja pegawai dengan produktivitas kerja pegawai, hubungan secara tidak langsung yang signifikan antara lingkungan kerja dengan produktivitas kerja pegawai melalui semangat kerja pegawai di Dinas Pendidikan Kota Probolinggo. Metode penelitian ini menggunakan pendekatan kuantitatif dengan metode penelitian deskriptif korelasional karena untuk memperoleh gambaran tentang hubungan antara lingkungan kerja dan semangat kerja pegawai dengan produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo. Dalam penelitian ini pengambilan data menggunakan angket yang diketahui populasi penelitian berjumlah 117 pegawai yang bekerja di Dinas Pendidikan Kota dengan jumlah sampel 54 pegawai. Untuk menganalisis data penelitian, peneliti menggunakan metode analisis jalur (path analysis) karena untuk mengetahui hubungan antara dua variabel atau lebih. Hasil penelitian menunjukkan bahwa: (1) berdasarkan hasil analisis deskriptif, dapat diketahui bahwa lingkungan kerja fisik lengkap dan lingkungan kerja non fisik juga sangat baik. Jadi dapat disimpulkan lingkungan kerja dalam keadaan sangat baik. Hal ini menandakan lingkungan kerja di Dinas Pendidikan Kota Probolinggo sudah dalam keadaan sangat baik; (2) berdasarkan hasil analisis deskriptif, dapat diketahui bahwa semangat kerja pegawai di Dinas Pendidikan Kota Probolinggo dalam keadaan sangat tinggi, karena responden dengan skor rata-rata menyatakan sangat tinggi dengan semangat kerjanya; (3) berdasarkan hasil analisis deskriptif, dapat diketahui bahwa produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo dalam keadaan sangat tinggi, karena pegawai dengan skor rata-rata menyatakan sangat tinggi dengan produktivitas kerjanya; (4) terdapat hubungan secara langsung yang signifikan antara lingkungan kerja dengan semangat kerja pegawai di Dinas Pendidikan Kota Probolinggo. Hal ini berarti semakin baik keadaan lingkungan kerja pegawai, maka akan semakin tinggi pula semangat kerja pegawai di Dinas Pendidikan Kota Probolinggo; (5) terdapat hubungan secara langsung yang signifikan antara lingkungan kerja dengan produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo. Hal ini berarti semakin baik keadaan lingkungan kerja pegawai, maka akan semakin tinggi pula produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo; (6) terdapat hubungan secara langsung yang signifikan antara semangat kerja dengan produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo. Hal ini berarti semakin meningkat semangat kerja pegawai, maka akan semakin meningkat pula produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo; dan (7) terdapat hubungan tidak langsung yang signifikan antara lingkungan kerja dengan produktivitas kerja melalui semangat kerja pada pegawai di Dinas Pendidikan Kota Probolinggo. Hal ini berarti semakin baik keadaan lingkungan kerja semakin tinggi pula semangat kerja pegawai dan semangat kerja pegawai yang tinggi akan menimbulkan produktivitas kerja pegawai yang tinggi pula di Dinas Pendidikan Kota Probolinggo. Dari penelitian ini penulis menyimpulkan bahwa lingkungan kerja di Dinas Pendidikan sudah sangat baik, semangat kerja pegawai dan produktivitas kerja pegawai juga dalam keadaan tinggi. Dalam penelitian ini ditemukan ada hubungan yang signifikan antara lingkungan kerja, semangat kerja pegawai dan produktivitas kerja pegawai di Dinas Pendidikan Kota Probolinggo. Dalam penelitian ini penulis juga memberikan saran bagi: (1) Dinas Pendidikan Kota Probolinggo, Kepala Dinas Pendidikan Kota Probolinggo selaku atasan para pegawai di kantor harus menjaga agar keadaan lingkungan kerja yang berupa lingkungan kerja fisik dan non fisik terus tetap dipertahankan dalam keadaan baik; (2) Jurusan Administrasi Pendidikan, hasil penelitian ini diharapkan dapat menambah informasi bagi jurusan tentang hubungan lingkungan kerja dan semangat kerja dengan produktivitas kerja yang dapat dijadikan referensi untuk penelitian yang sama dan untuk menambah pembendaharaan kepustakaan jurusan; dan (3) Peneliti lain, sebagai bahan informasi bagi peneliti lainnya yang ingin lebih mendalami tentang hubungan lingkungan kerja dan semangat kerja pegawai dengan produktivitas kerja pegawai dan juga bisa digunakan sebagai bahan kajian untuk menelitian selanjutnya dalam meneliti masalah yang sepadan.

Penguasaan kosakata bahasa Indonesia dalam bidang IPS siswa kelas III SMP negeri Binangun kabupaten Blitar tahun ajaran 1994/1995 / oleh Siti Chaulandari

 

Pengaruh peran dosen pembimbing dan guru pamong terhadap prestasi Praktik Pengalama Lapangan (PPL) mahasiswa Program Studi Pendidikan Teknik Otomotif FT UM angkatan 2011 / Vindiarta Jaka Hermawan

 

ABSTRAK Hermawan, Vindiarta Jaka. 2015. Pengaruh Peran Dosen Pembimbing Dan Guru Pamong Terhadap Prestasi Praktik Pengalaman Lapangan (PPL) Mahasiswa Program Studi Pendidikan Teknik Otomotif FT UM Angkatan 2011. Skripsi, Jurusan Teknik Mesin Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Drs. H. Paryono, ST.MT. (II) Drs. H. Agus Sholah, M.Pd. Kata Kunci: PPL, Dosen Pembimbing dan Guru Pamong Setiap lembaga pendidikan khususnya lembaga pendidikan tinggi, mempunyai tujuan utama yaitu mampu menciptakan lulusan yang berkualitas, berilmu, kreatif, produktif, cakap, dan mampu bersaing di dunia kerja. Suatu kegiatan yang secara langsung dan khusus mempersiapkan mahasiswa untuk menjadi guru yang baik dan terampil adalah melalui Praktik Pengalaman Lapangan (PPL). Prestasi PPL yang didapat mahasiswa dipengaruhi oleh berbagai faktor , diantaranya adalah peran Dosen Pembimbing dan Guru Pamong. Penelitian ini bertujuan Untuk mengetahui tentang pengaruh peran Dosen Pembimbing dan Guru Pamong terhadap prestasi PPL mahasiswa program studi pendidikan teknik otomotif FT UM angkatan tahun 2011. Penelitian ini menggunakan pendekatan kuantitatif dalam menguji hipotesis. Rancangan penelitian ini menggunakan rancangan penelitian deskriptif dan korelasional. Populasi dalam penelitian ini adalah mahasiswa program studi pendidikan teknik otomotif angkatan tahun 2011 yang berjumlah 89 mahasiswa, sedangkan sampel yang digunakan berjumlah 47 mahasiswa dengan metode pengambilan sampel adalah Simple Random Sampling . Metode pengambilan data yang digunakan adalah angket dan dokumentasi. Berdasarkan data hasil pengujian menunjukkan bahwa variabel peran dosen pembimbing mempunyai pengaruh yang signifikan terhadap prestasi PPL begitu pula variabel peran guru pamong mempunyai pengaruh yang signifikan terhadap prestasi PPL dan secara simultan variabel independen peran dosen pembimbing dan guru pamong mempunyai pengaruh yang signifikan dan berhubungan positif terhadap variabel dependen prestasi PPL . Nilai Adjusted R Square sebesar 0,304 menunjukkan bahwa variabel dependen prestasi PPL dapat dijelaskan oleh variabel independen sebesar 30,4 % sedangkan sisanya 69,6 % dijelaskan oleh variabel lain yang tidak dimasukkan dalam model. Berdasarkan hasil penelitian dapat disarankan agar penelitian selanjutnya menggunakan populasi dan sampel yang lebih luas dan menambah variabel independen.

Analisis kesalahan struktur kalimat bahasa Indonesia dalam karangan siswa kelas IV SDN 2 Banjar Bali kabupaten Buleleng pada tahun ajaran 1995/1996
oleh Ni Nyoman Garminah

 

Pemurnian parsial selulase Bacillus circulans menggunakan metode fraksinasi amonium sulfat fraksi 0-10%, 10-40%, 40-60%, 60-100% dan karakterisasi kinetiknya / Kurnia Ayu Syafitri

 

ABSTRAK Syafitri, KurniaAyu. 2015. PemurnianParsialSelulaseBacillus circulansMenggunakanMetodeFraksinasiAmoniumSulfatFraksi0-10 %, 10-40%, 40-60 % 60-100 % danKarakterisasiKinetikanya. Skripsi, Jurusan Kimia, FMIPA, UniversitasNegeri Malang. Pembimbing: (1) EviSusanti, S. Si., M. Si., (II) Dr. Suharti ,S.Si., M. Si. Kata Kunci:pemurnianparsial,selulase, pengendapan, kinetikaenzim. Penggunaanekstrakkasarselulasepadaduniaindustrikurangdiminatikarenaaktivitasdanstabilitasnyarendah.Olehkarenaitu, perludilakukanpemurnianuntukmeningkatkanaktivitasdanstabilitasselulase.Tujuandaripenelitianiniadalahuntukmengetahui (1) aktivitasspesifik, tingkatkemurnian, danyieldproteinselulaseBacillus circulans yang dimurnikandariekstrakkasarnyasecaraparsialmenggunakanmetodefraksinasiamoniumsulfatpadatingkatkejenuhan 0-10 %, 10-40 %, 40-60 %, 60-100 % dan (2) karakterisasikinetikanyameliputipenentuan KmdanVmakselulaseBacillus circulans yang memilikiaktivitasspesifiktertinggipadasubstratkertassaring. Penelitianinibersifateksploratifdanterdiridaribeberapatahapyaitu (1) produksiekstrakkasarselulaseBacillus circulans, (2) penentuanaktivitasspesifikekstrakkasarselulaseBacillus circulans, (3) pemurnianselulaseBacillus circulansmenggunakanmetodefraksinasiamoniumsulfat, (4) penentuanaktivitasspesifik, tingkatkemurnian, danyieldproteinhasilpemurnianpadatingkatkejenuhan0-10 %, 10-40 %, 40-60 %, 60-100 %dan (5) penentuankinetikanyameliputipenentuan KmdanVmakselulaseBacillus circulansyang memilikiaktivitasspesifiktertinggi, aktivitasCMCase,avicelase, β-glukosidasedanselulase total diukurberdasarkangulapereduksi yang dihasilkan. Kadar gulapereduksiditentukandenganmetodeSomogyi-Nelson.Kadar protein ditentukandenganmetode Lowry.Tingkat kemurnianmerupakanperbandinganantaraaktivitasspesifikenzimsetelahdimurnikandenganaktivitasspesifikenzimsebelumdimurnikan.Yieldproteinmerupakanperbandinganantaraaktivitas total enzimsetelahdimurnikandenganaktivitas total ekstrakkasardikali 100%. Hasilpenelitianmenunjukkanbahwa, fraksiII (10-40%)selulaseBacillus circulansmemilikiaktivitasspesifik, tingkatkemurnian, danyieldprotein tertinggiberturut-turutsebesar 4288 U/mg, 1,63 kali, dan 8,55 % untukaktivitasCMCase; 4142,6 U/mg, 2,02 kali, dan 10,6 % untukaktivitasavicelase; 5750,5 U/mg, 2,06 kali, dan 10,8 % untukaktivitas β-glukosidasedan 2145,21 U/mg, 2,44 kali, dan 12,85 % untukaktivitasselulase total.Besarnyanilai KmdanVmakselulaseBacillus circulansfraksi II padasubstratkertassaringberturut-turutadalah 52 mg dan 325 U/mL

Strategi pengorganisasian program kerja organisasi siswa intra sekolah: studi multi situs di SMAN 1 dan SMAN 3 Kota Malang / Vidya Ayu Tyagita Putri Irawati

 

Kata kunci: strategi pengorganisasian, program kerja OSIS Menurut Hadari (2003:43) menjelaskan bahwa "Strategi dapat diartikan sebagai siasat, teknik dan taktik utama dalam menggempur atau menghadapi musuh untuk memenangkan sebuah peperangan sebagai tujuan". Pembinaan kesiswaan merupakan kondisi sekolah dan masyarakat dewasa yang pada umumnya masih dalam taraf perkembangan, maka upaya pembinaan kesiswaan perlu diselenggarakan untuk menunjang perwujudan sekolah sebagai Wawasan Wiyatamandala. Strategi pengorganisasian program kerja OSIS merupakan suatu teknik atau taktik dari kegiatan OSIS untuk mencapai tujuan yang telah ditetapkan secara efektif dan efisien. Kegiatan OSIS merupakan suatu kegiatan yang berguna dalam mengembangkan bakat dan minat siswa dalam berorganisasi di setiap kegiatan yang diselenggarakan dan mengembangkan jiwa sosial yang lebih baik lagi di lingkungan sekolah serta lingkungan masyarakat sekitar. Kegiatan OSIS menjadi salah satu kegiatan ekstrakurikuler unggulan yang ada di SMAN 1 dan SMAN 3 Kota Malang, hal tersebut dapat dilihat dari tingginya partisipasi setiap siswa dari kedua sekolah itu untuk mengikuti kegiatan OSIS di masing-masing sekolah tersebut. Berdasarkan informasi yang diperoleh, maka dilakukan penelitian untuk mengetahui strategi pengorganisasian program kerja OSIS di SMAN 1 dan SMAN 3 Kota Malang. Fokus penelitian untuk mengetahui tentang strategi pengorganisasian program kerja OSIS, pelaksanaan pengorganisasian program kerja OSIS, kendala pengorganisasian program kerja OSIS, dan mengatasi kendala pengorganisasian program kerja OSIS. Penelitian ini dilakukan dengan pendekatan kualitatif, yaitu sebagai prosedur penelitian yang menghasilkan data deskriptif berupa kata-kata tertulis atau lisan dari orang-orang dan perilaku untuk diamati yang diperoleh dari beberapa informan yaitu kepala sekolah, wakil kepala sekolah bagian kesiswaan, ketua umum OSIS serta guru yang membina dan mengikuti kegiatan OSIS dan informan lain yang terlibat dalam manajemen kegiatan OSIS di kedua lembaga tersebut dengan menggunakan alat bantu berupa catatan lapangan, alat rekam, maupun dokumentasi yang diarahkan pada latar dan individu terhadap fenomena sosial. Jenis rancangan penelitian ini sesuai dengan fokus penelitian yang mencari informasi berdasarkan objek yang diteliti adalah multi situs. Multi situs adalah suatu kasus yang sama dalam suatu penelitian, tetapi lokasi penelitian yang berbeda namun memiliki persamaan dalam penelitian. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian pada saat wawancara, tindakan yang dilakukan oleh subjek penelitian, dan dokumen yang berkaitan dengan kegiatan OSIS. Temuan penelitian di SMAN 1 Malang yaitu: (1) strategi penyusunan program kerja OSIS yang ada dilaksanakan sesuai dengan struktur organisasi dan dibuat oleh tim (Pembina OSIS dan Pengurus OSIS), (2) pelaksanaannya terdapat faktor-faktor yang mendukung dan menghambat serta dilakukannya pendekatan pengurus OSIS terhadap warga sekolah (siswa), hal tersebut dilakukan bertujuan untuk dapat mempermudah mereka berkoordinasi dan berkomunikasi antar anggota OSIS maupun dengan Pembina OSIS serta dengan pihak sekolah agar kegiatan OSIS ini dapat berjalan dengan lancar dan dapat tercapai sesuai dengan tujuan yang telah ditetapkan, (3) kendala dalam kegiatan pengorganisasian program kerja OSIS hanya masalah finansial untuk kegiatan OSIS, (4) program kerja OSIS ini tidak ada kesulitan dalam mengatasi kendala. Karena, pengurus OSIS sendiri masih mampu menghadapi kendala yang ada. Sehingga, pihak sekolah tidak terlalu ikut terlibat dalam penyelesaian kendala tersebut. SMAN 3 Malang: (1) program kerja OSIS terstruktur atau terencana dalam proses penyusunan program kerja OSIS yang dilakukan pengurus OSIS yang kemudian dikonsultasikan dengan Pembina OSIS, setelah itu rancangan kegiatan tersebut diajukan kepada wakil kepala sekolah bagian kesiswaan yang kemudian di ajukan kepada kepala sekolah, (2) pelaksanaannya dilakukan pendekatan secara kolektif dan kolegial artinya kegiatan dirumuskan atau dicetuskan, ditawarkan ke anggota melalui sharing, dirapatkan bersama dengan pengurus OSIS, dimasukkan ke dalam kegiatan OSIS, kemudian memberikan informasi atau publikasi kepada para siswa, (3) kendala yang dialami kebanyakan tentang waktu pelaksanaan kegiatan, sedangkan kendala yang lain hanya masalah sponsor atau dana dalam mengadakan suatu kegiatan, dan (4) mengatasi kendala dengan cara mematuhi peraturan yang sudah ditetapkan oleh kepala sekolah. Kesimpulan dari hasil penelitian ini adalah strategi pengorganisasian program kerja OSIS SMAN 1 Malang: (1) perumusan program kerja OSIS secara terstruktur dan dibuat oleh tim (Pembina OSIS dan Pengurus OSIS). Tujuannya agar kegiatannya bisa sukses dan lancar untuk ke depannya, (2) pelaksanaan kegiatannya, mekanisme atau tata aliran yang dilakukan adalah siswa membuat proposal kemudian diketahui oleh Pembina OSIS, Waka Kesiswaan dan Kepala Sekolah. (3) kendalanya masalah finansial atau sumber dana untuk pelaksanaan kegiatan OSIS dari sekolah dan sponsor, dan (4) jika tidak bisa mengatasi finansial, pihak sekolah ikut turun dan akhirnya dibantu sekolah untuk mengantisipasi. SMAN 3 Malang: (1) program kerja OSIS Terstruktur atau terencana setiap tahunnya dilakukan laporan pertanggungjawaban serta dilakukan evaluasi sebelumnya untuk penambahan program kerja pada kegiatan OSIS yang akan datang, (2) pelaksanaannya dilakukan pendekatan secara kolektif dan kolegial artinya kegiatan dirumuskan atau dicetuskan, ditawarkan ke anggota melalui sharing, dirapatkan bersama dengan pengurus OSIS, dimasukkan ke dalam kegiatan OSIS, kemudian memberikan informasi atau publikasi kepada para siswa, (3) kendala yang dialami kebanyakan tentang waktu pelaksanaan kegiatan, sedangkan kendala yang lain hanya masalah sponsor atau dana dalam mengadakan suatu kegiatan, dan (4) mengatasi kendala dengan cara mematuhi peraturan yang sudah ditetapkan oleh kepala sekolah.

Analisis wacana bahasa Indonesia dalam naskah berita acara perkara perceraian Pengadilan Agama Malang tahun 1996 / oleh Pujiati

 

Makna simbolik upacara Bubak Kawah di Kota Batu / Intania Rizka Syafitri

 

ABSTRAK Syafitri, Intania Rizka. 2015. Makna Simbolik Upacara Bubak Kawah di Kota Batu. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Sunoto, M.Pd. (II) Dr. Nita Widiati, M.Pd. Kata Kunci: sastra lisan, makna simbolik, upacara Bubak Kawah Subjek penelitian ini adalah upacara Bubak Kawah. Upacara Bubak Kawah merupakan serangkaian upacara pernikahan. Upacara Bubak Kawah dilakukan setelah melakukan prosesi upacara pernikahan serah-serahan, peningsetan, siraman, adol dawet, paes, midodareni, ijab kabul, dan temu manten. Upacara Bubak Kawah merupakan upacara yang dilaksanakan oleh orang tua mempelai perempuan. Upacara Bubak Kawah untuk anak perempuan yang pertama dinamakan bukak ponjen, sedangkan untuk anak perempuan yang terakhir dinamakan tutup ponjen. Upacara Bubak Kawah diikuti oleh kedua mempelai beserta orang tua dan kerabat dekat. Penelitian ini bermaksud mengungkap makna simbolik pada uba rampe, prosesi upacara Bubak Kawah, dan makna pada tuturan dukun manten upacara Bubak Kawah. Tujuan tersebut ditempuh penelitian kualitatif dengan kegiatan mengobservasi prosesi upacara Bubak Kawah, wawancara mendalam mengenai uba rampe, dan membaca berulang tuturan yang digunakan. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Data dalam penelitian ini berupa (1) prosesi upacara Bubak Kawah yang meliputi perilaku budaya, pilihan benda simbolik, dan penataan benda dan (2) tuturan dukun manten upacara Bubak Kawah yang meliputi kata simbolik, klausa simbolik, dan tatanan simbolik. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, dan angket. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri. Untuk menjaga keabsahan data, dilakukan kegiatan triangulasi data. Dengan tindakan tersebut, diperoleh hasil penelitian sebagai berikut. Pertama, makna simbolik pada uba rampe dan prosesi upacara Bubak Kawah. Makna simbolik pada uba rampe upacara Bubak Kawah yaitu (1) untuk mendapat berkah, (2) agar berpikir luas, (3) suci hatinya, (4) untuk membuka rezeki dari seluruh keluarga kedua mempelai, (5) agar cinta mereka menghasilkan buah kasih yang bermanfaat bagi keluarga dan masyarakat, (6) agar kedua mempelai hidup menjadi suami istri yang baik dan bermanfaat bagi orang lain, (7) kesederhanaan, dan (8) kesucian. Makna simbolik pada prosesi upacara Bubak Kawah yaitu (1) segala sesuatunya harus dimulai dengan baik-baik, (2) menyatukan tulang rusuk yang berbeda, (3) harapan agar pernikahannya selalu mendapatkan kebahagiaan dan dihindarkan dari mara bahaya, (4) agar dijauhkan dari mara bahaya dan hal buruk lainnya yang mengganggu pernikahan, (5) rejeki yang diberikan Allah kepada kedua mempelai, (6) keluarga ikut membantu mengambil rezeki yang diberikan Allah, (7) segalanya dibuka dan ditutup dengan hal yang baik, dan (8) sudah siap untuk menjalani kehidupan baru. Kedua, mengenai makna pada tuturan dukun manten upacara Bubak Kawah yaitu (1) harus ada syarat-syarat yang dipenuhi, (2) membuka air yang keluar dari rahim, (3) selamatan penutup, (4) meminta pertolongan kepada Tuhan Yang Maha Esa, (5) anak yang sudah menemukan jodohnya, (6) penyatuan antara laki-laki dan perempuan, dan (7) harapan untuk meminta keselamatan dan belas kasihan dari Tuhan yang meridhoi, semoga selalu menjadi suami istri yang jauh dari mara bahaya, terhindar dari musibah, selalu diberi rezeki yang barokah, semoga panjang umur serta lancar mencari rezeki untuk kebutuhan hidup, dan kedua mempelai rukun sampai tua nantinya. Penelitian ini diharapkan diharapkan dapat menambah pengetahuan, wawasan, dan data tertulis tentang makna simbolik upacara Bubak Kawah sehingga mampu menumbuhkembangkan rasa cinta bagi remaja di daerahnya terhadap nilai-nilai luhur tradisi daerah sendiri. Penelitian ini juga diharapkan dapat memperkaya khazanah kebudayaan nusantara, sekaligus menunjang perkembangan sastra daerah yang ada di Indonesia. Serta melestarikan budaya dan tradisi adat di Indonesia.

Unsur serapan bahasa Asing dalam bahasa Indonesia pada Surat Perintah Kedinasan di lingkungan Sekolah Peluru Kendali (Serudal) Malang / oleh Susi Darihastining

 

Pengaruh pembelajaran dan hasil belajar kewirausahaan terhadap intensi berwirausaha pada mahasiswa Manajemen Fakultas Ekonomi Universitas Negeri Malang / Swacahyani Rachmania Pradani

 

Pengembangan media pembelajaran M-learning sistem operasi di DMK Negeri 5 Malang Jurusan Teknik Komputer dan Jaringan / Sony Aditya

 

ABSTRAK Aditya, Sony. 2015. Pengembangan Media Pembelajaran M-Learning Sistem Operasidi SMK Negeri 5 Malang JurusanTeknikKomputer Dan Jaringan. Skripsi. Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang. Pembimbing: (1)Dr. Ir. H. Syaad Patmanthara, M.Pd(2)Heru Wahyu Herwanto, S.T., M.Kom. Kata kunci :pengembangan, media pembelajaran, android, sistemoperasi, smk Materisistem operasimerupakansalahsatukompetensi yang harusdipahamiolehsiswa SMK JurusanTeknikKomputer dan Jaringan. Didalamsistem operasi, kegiatanpembelajarandidominasiolehkegiatanpraktekinstalasisistemoperasi sehingga diperlukan adanya pengetahuan tentang perintah – perintah dasar instalasi.Tujuan dari pengembangan ini adalah untuk mengembangkan media pembelajaran sitem operasi berbasis mobileyang dapat digunakan sebagai media pendukung pada mata pelajaran sistem operasi di SMK Jurusan Teknik Komputer dan Jaringan. Media Pembelajaran inibertujuanuntukmenarikminatsiswadanmemberikankemudahanbagisiswadalammemahamimateri. Penelitian ini menggunakan model pengembangan oleh Sadiman. Model pengembangan ini dipilih karena adanya proses revisi yang bisa diulangi dari tahapan tertentu. Tahapan-tahapan pada model pengembangan Sadiman adalah sebagai berikut: (1) identifikasi kebutuhan; (2) perumusan tujuan pembelajaran; (3) perumusan materi pembelajaran; (4) perumusan alat ukur keberhasilan; (5) penulisan naskah media; (6) uji coba; (7) revisi; (8) naskah siap diproduksi dan dimanfaatkan. Pengujian dilakukan pada tiga subjek uji coba, yakni ahli materi, ahli media, dan siswa. Pengujian pada ahli materi menunjukkan hasil sebesar 99.4%. Pengujian pada ahli media memperoleh hasil sebesar 95.06%. sedangkan uji coba pada siswa memperoleh skor 94.28%. Dari keseluruhan uji coba yang telah dilakukan, maka diperoleh skor sebesar 96.52% atau termasuk dalam kategori layak untuk digunakan berdasarkan kriteria tingkat kelayakan (Arikunto, 2006). Dengan demikian dapat disimpulkan bahwa media pembelajaran yang dikembangkan sudah layak untuk diterapkan dalam kegiatan belajar mengajar.

Hubungan antara komponen operasi matematika denhan kemampuan menyelesaikan soal-soal fisika materi usaha dan energi siswa kelas I catur wulan 2 SMU Negeri 2 Malang / oleh Wowok Adi Wibowo

 

Integral fourier / oleh Ulfi Kurnia N.

 

Rancang bangun pengembangan mesin pemarut kelapa portable / Ezra Dody Ismawanto

 

ABSTRAK Ezra Dody Ismawanto. 2015. Pengembangan TeknologiMesin Pemarut Kelapa Portable Sebagai Sarana membantu Industri Rumahan. Tugas Akhir, Progam Studi D3 Teknik Mesin Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Drs. Siswanto ,M.A. (II) Drs. Yuni Sunarto Kata Kunci : Pengembangan Mesin Pemarut Kelapa Portable Tugas Akhir Mesin Pemarut Kelapa Portable yang memiliki panjang 367 mm, lebar 175 mm, tinggi 345 mm, daya motor 1/4 HP, kapasitas mesin 5 kg/menit. Tujuan alat ini adalah alat yang digunakan untuk menyerut atau memarut bahan kelapa yang akan dijadikan bahan utama pengolahan makanan. Dalam pengoprasiannya mesin pemarut kelapa portable tersebut menggunakan pisau berbentuk tabung yang mempunyai gerigi sisi tajam yang menempel pada hoper in, prosesnya kelapa dimasukan pada hoper in dan didorong menggunakan tangan ketika kelapa melewati pisau yang menempel pada hoper akan terjadi penyerutan. Metode pengembangan alat ini adalah dapat diproduksi secara masal, dan dikembangkan dengan kapasitas yang lebih besar dengan daya yang sama. Hasil uji coba menunjukkan hasil serutannya baik dan sangat cepat dan efisien waktu. Kesimpulan: Mesin pemarut kelapa portable ini memiliki kapasitas 300 kg/jam dengan daya 0,25 PK dapat dipergunakan oleh industri rumahan maupun UKM (Usaha Kecil Menengah) warung makan, dengan harga yang relatif murah, dan ukuran yang tidak terlalu besar dan praktis mesin pemarut kelapa portable ini bisa dimiliki oleh perseorangan atau kelompok.

Integral ukuran sebagai perluasan integral riemann
oleh Sujianto

 

E-Learning UM ditinjau dari persepsi dosen dan mahasiswa akuntansi Universitas Negeri Malang / Nita Rahayu Saraswati

 

Pelaksanaan pembelajaran PKn kelas tinggi di SDN Karangrejo 03 Kecamatan Garum Kabupaten Blitar / Yogi Hermawan

 

Kata Kunci: Pembelajaran, PKn, Sekolah Dasar, Kelas Tinggi Aspek pembelajaran memegang peran penting dalam pelaksanaan proses belajar mengajar. Dalam hal ini, bahan ajar,metode, dan media mempunyai andil yang cukup besar dalam kegiatan belajar mengajar. Setiap guru harus mampu menguasai kelas belajar yang dtunjukkan melalui penerapan metode-metode yang ada dan dapat memilih metode maupun media yang relevan agar bisa mencapai tujuan belajar. Adanya kendala dalam aspek pembelajaran diakibatkan oleh beberapa faktor, antara lain: (1) Guru, tidak menguasai bahan ajar materi dan cara penyampaian; (2) Siswa, tidak mempunyai kemauan, kemampuan, kesiapan dan kondisi belajar yang baik; (3) Sekolah, sarana dan prasarana untuk belajar mengajar kurang termasuk juga sumber belajar berupa buku panduan. Penilaian dimanfaatkan untuk mengetahui sejauh mana kemampuan siswa dalam menuntaskan materi.Guru berperan sebagai fasilitator dalam proses pembelajaran serta bertanggung jawab dalam hasil belajar anak didiknya. Guru kelas melakukan persiapan berupa perencanaan dalam bentuk perangkat pembelajaran, pengembangan motivasi, dan pengelolaan kelas. Pelaksanaan KBM berpedoman dari RPP dengan catatan menyesuaikan dengan kondisi (fleksibel). Penelitian ini bertujuan untuk mengetahui perencanaan pelaksanaan pembelajaran Pendidikan Kewarganegaraan (PKn) pada kelas tinggi di SDN Karangrejo 03, mengetahui pelaksanaan pembelajaran Pendidikan Kewarganegaraan (PKn) pada kelas tinggi di SDN Karangrejo 03, mengetahui hambatan yang dihadapi guru kelas dalam pelaksanaan pembelajaran Pendidikan Kewarganegaraan (PKn) di SDN Karangrejo 03, mengetahui alternatif solusi dalam mengatasi hambatan pada pelaksanaan pembelajaran Pendidikan Kewarganegaraan (PKn) di SDN Karangrejo 03. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Disebut pendekatan kualitatif karena data yang dihasilkan bukan dalam bentuk angka-angka tetapi berupa kata-kata tertulis atau lisan. Jenis penelitian ini adalah deskriptif yaitu suatu penelitian yang detail atas satu latar atau satu subyek atau satu tempat penyimpanan data atau satu peristiwa tertentu. Informan terdiri dari guru Pendidikan Kewarganegaraan (PKn) dan siswa. Pengumpulan data dilakukan dengan teknik observasi, wawancara dan dokumentasi. Analisis data yang digunakan dengan cara: reduksi data, penyajian data dan kesimpulan atau verifikasi data. Untuk menjamin keabsahan data maka dilakukan: ketekunan pengamatan dan triangulasi. Hasil penelitian ini menunjukkan bahwa: (1) Perencanaan pembelajaran PKn pada kelas tinggi di SDN Karangrejo 03, dalam pelaksanaan pembelajaran PKn terutama untuk kelas tinggi difokuskan pada persiapan perangkat pembelajaran. Dalam penelitian ini, menunjukkan bahwa kematangan suatu perencanaan berpengaruh cukup besar pada kelangsungan dan kelancaran KBM (2) Pelaksanaan pembelajaran PKn pada kelas tinggi di SDN Karangrejo 03, khususnya di gugus V untuk kelas tinggi diajarkan oleh guru kelas, sesuai dengan kurikulum, berpedoman pada perangkat pembelajaran tetapi bersifat fleksibel/kondisional dalam penerapannya, menggunakan media pembelajaran sederhana dan metode ceramah variasi, dikte/mencatat, tanya jawab, diskusi kelompok, dan penugasan. Pembelajaran terdiri dari tahap awal (kegiatan apersepsi), tahap inti (penerapan metode dan pemanfaatan media), serta tahap akhir (penutup) (3) Hambatan dalam pelaksanaan pembelajaran PKn pada kelas tinggi di SDN Karangrejo 03, mencakup aspek pembelajaran meliputi bahan ajar, pelaksanaan KBM (4) Upaya guru untuk mengatasi hambatan yang ada dalam pelaksanaan pembelajaran PKn pada siswa kelas tinggi di SDN Karangrejo 03, mengutamakan perencanaan meliputi persiapan pembelajaran (RPP dan penguasaan materi) disertai memperbaiki kekurangan yang ada seperti model maupun media pembelajaran, meningkatkan pengelolaan kelas seperti upaya memotivasi siswa melalui pendekatan sosial, serta membina hubungan yang baik dengan pihak yang terkait dalam KBM Berdasarkan kesimpulan yang telah dipaparkan di atas, maka peneliti dapat memberi saran bagi guru Pendidikan Kewarganegaraan (PKn) diharapkan lebih meningkatkan pengetahuan dan kemampuannya sebagai seorang tenaga pengajar yang profesional.

Studi tentang perbandingan pengaruh antara nilai bidang studi kimia pada STTB SMA dan pada danem terhadap nilai hasil belajar kimia dasar I mahasiswa Fakultas Perikanan Unlam angkatan tahun 1983-1986 / oleh Erminawati

 

Pengaruh ukuran perusahaan, profitabilitas, solvabilitas, jenis industri dan kualitas Kantor Akuntan Publik (KAP) terhadap audit report lag (studi empiris pada perusahaan manufaktur dan finansial yang listing di BEI tahun 2014) / Abian Julia Latifa

 

ABSTRAK Latifa, Abian Julia. 2016. Pengaruh Ukuran Perusahaan, Profitabilitas, Solvabilitas, Jenis Industri, dan Kualitas Kantor Akuntan Publik (KAP) terhadap Audit Report Lag (Studi Empiris pada Perusahaan Manufaktur dan Finansial yang Listing di BEI Tahun 2014). Skripsi. Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing : (I) Hj. Yuli Widi Astuti, S.E., M.Si., Ak, (II) Dr. H. Cipto W, S.E., M.Pd., M.Si., Ak, CA. Kata Kunci: Ukuran Perusahaan, profitabilitas, solvabilitas, jenis industri, kualitas KAP, Audit Report Lag (ARL). Laporan keuangan merupakan salah satu instrumen penting dalam mendukung keberlangsungan suatu perusahaan, terutama pada perusahaan yang telah go public. Semakin pesat perkembangan perusahaan-perusahaan yang go public, semakin tinggi pula permintaan atas audit laporan keuangan yang menjadi sumber informasi utama bagi para investor. Ketepatan waktu (timeliness) pelaporan merupakan atribut kualitatif utama dalam laporan keuangan, sehingga laporan keuangan harus disampaikan tepat waktu (timely disclosure) agar dapat bermanfaat bagi para pengguna laporan keuangan dalam analisis dan pengambilan keputusan-keputusan ekonomi. Ketepatan waktu publikasi laporan keuangan perusahaan dapat mengalami keterlambatan yang diakibatkan oleh keterlambatan perusahaan dalam menerbitkan laporan keuangan dan lamanya auditor dalam menyelesaikan pekerjaan audit. Lamanya waktu penyelesaian audit yang dilakukan oleh auditor, dilihat dari perbedaan tanggal tutup tahun buku laporan keuangan sampai dengan tanggal opini auditor dalam laporan keuangan yang telah di audit. Penelitian ini bertujuan untuk menguji pengaruh ukuran perusahaan, profitabilitas, solvabilitas, jenis industri, dan kualitas KAP terhadap audit report lag. Populasi dari penelitian ini adalah perusahaan manufaktur dan finansial yang listing di Bursa Efek Indonesia tahun 2014. Pengambilan sampel menggunakan metode purposive sampling. Sampel dalam penelitian ini berjumlah 163 perusahaan. Terdiri dari 104 perusahaan manufaktur dan 59 perusahaan finansial. Analisis dilakukan dengan menggunakan ananlisis regresi berganda. Hasil penelitian menunjukkan bahwa secara parsial terdapat tiga variabel yang berpengaruh signifikan negatif terhadap audit report lag yaitu variabel ukuran perusahaan, profitabilitas, dan jenis industri. Sedangkan untuk variabel solvabilitas dan kualitas KAP tidak memiliki pengaruh secara signifikan terhadap audit report lag. Hasil pengujian secara simultan menunjukkan bahwa seluruh variabel independen berpengaruh signifikan terhadap audit report lag dengan pengaruh sebesar 26,5% yang ditunjukkan oleh nilai Adjusted R Square. Berdasarkan hasil penelitian maka disarankan kepada perusahaan untuk tetap menyampaikan laporan keuangan secara lengkap dan tepat waktu serta menjaga relevansi laporan keuangan tersebut. Sedangkan untuk peneliti selanjutnya, dapat mengembangkan variabel yang diperkirakan mempengaruhi audit report lag, dan juga dapat menggunakan proksi lain agar hasil penelitian tersebut dapat dibandingkan dengan penelitian ini.

Studi gangguan ion seng pada penentuan serapan besi dalam sistem kompleks besi (II)-1,10-fenantrolin secara spektrofotometri / oleh Nur Sa'adah

 

Manajemen program kelas akselerasi (studi kasus di Sekolah Menengah Pertama Negeri 1 Turen) / Dwi Wahyono

 

ABSTRAK Wahyono, Dwi. 2014. Manajemen Program Kelas Akselerasi(Studi Kasus di SMP Negeri 1 Turen). Skripsi, Jurusan Administrasi Pendidikan Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Djum Djum Noor Benty, M. Pd, (II) Dr. H. Ahmad Yusuf Sobri, S.Sos, M.Pd Kata Kunci: manajemen, program kelas akselerasi Manajemen merupakan suatu proses mulai dari perencanaan, pengorganisasian, penggerakan, sampai dengan pengawasan. Manajemen memiliki peranan penting dalam keberhasilan suatu program. Program Kelas Akselerasi merupakan program percepatan yang ditujukan bagi peserta didik yang memiliki kecerdasan lebih untuk mengembangkan potensinya dan menempuh pembelajaran yang lebih pendek daripada pembelajaran pada umumnya. Manajemen yang baik, pastinya berdampak dengan hasil yang baik pula. Proses manajemen pada program kelas akselerasi di SMP Negeri 1 Turen meliputi, perencanaan, pengorganisasian, penggerakan, serta pengawasan program. Fokus penelitian ini antara lain: (1) Bagaimana perencanaan program kelas akselerasi di SMP Negeri 1 Turen, (2) Bagaimana pengorganisasian program kelas akselerasi di SMP Negeri 1 Turen, (3) Bagaimana penggerakan program kelas akselerasi di SMP Negeri 1 Turen, dan (4) Bagaimana pengawasan program kelas akselerasi di SMP negeri 1 Turen. Penelitian ini menggunakan observasi partisipasi nihil, yaitu observasi penuh tanpa partisipasi. Penelitian menggunakan observasi partisipan ini, peneliti bertindak sebagai pengamat, mengamati sasaran tanpa menimbulkan perhatian sasaran, sehingga data yang diperoleh akan lebih lengkap, tajam, dan sampai mengetahui pada tingkat makna dari setiap perilaku yang tampak. Temuan dalam penelitian ini yaitu: (1) Fungsi perencanaan program kelas akselerasi di SMP Negeri 1 Turen, adanya perencanaan program kelas akselerasi yang diselenggarakan oleh pihak sekolah untuk satu tahun ajaran dan prinsip dalam proses perencanaan program kelas akselerasi di SMP Negeri 1 Turen, (2) Fungsi pengorganisasian program kelas akselerasi di SMP Negeri 1 Turen, adanya struktur organisasi pada setiap jenis kegiatan, guru tidak melalui proses seleksi, hanya didasarkan pada kecakapan, dan adanya pendelegasian terhadap tugas dalam pelaksanaan program akselerasi, guru pengajar diberikan S.K dan schedule dalam satu tahun ajaran (3) Fungsi penggerakan program kelas akselerasi di SMP Negeri 1 Turen meliputi proses penggerakan program dalam satu tahun ajaran, dengan mempertimbangkan beberapa aspek,yaitu IQ minimal 130 dan nilai akademis mata pelajaran 8,00. Pelaksanaan kelas akselerasi dimulai pada tahun ajaran 2012/2013, dan (4) Fungsi pengawasan program kelas akselerasi di SMP Negeri 1 Turen, dilakukan secara langsung dan tidak langsung, yaitu langsung oleh pihak sekolah dan tidak langsung dari pihak luar,yaitu PKLK. Pengawasan dilakukan setiap 1 bulan sekali, serta evaluasi program secara keseluruhan dilaksanakan pada akhir Tahun Ajaran. Saran dalam penelitian ini yaitu: (1) Kepala SMP Negeri 1 Turen yaitu hendaknya sistem pengelolaan terhadap program kelas akselerasi di sekolah hendaknya selalu diunggulkan dan ditingkatkan agar selalu bertahan dan berkualitas sehingga menjadi lebih baik dan sempurna dalam program kelas akselerasi selanjutnya,untuk lebih memahami dan menggali potensi kemampuan siswa pada program kelas akselerasi, mungkin lebih maksimal lagi jika guru pengajar melalui seleksi sesuai standar pengajar kelas akselerasi, dengan begitu potensi yang sebenarnya dari siswa kelas akselerasi ini lebih bisa dimaksimalkan, , (2) Kepada Guru SMP Negeri 1 Turen, senantiasa memberikan dukungan dan motivasi yang tinggi terhadap program kelas akselerasi yang diselenggarakan oleh sekolah agar siswa lebih berprestasi tidak hanya di bidang akademik, tetapi di bidang non akademik juga. (3) Kepada Ketua Jurusan Administrasi Pendidikan, hasil penelitian ini hendaknya menjadi tambahan referensi atau bahan kajian pengembangan ilmu manajemen pendidikan dan lebih meningkatkan kompetensi mahasiswa dalam memahami manajemen program kelas akselerasi. (4) Kepada Peneliti lain, diiharapkan dapat memberikan wawasan dan informasi mengenai penelitian yang sejenis sehingga lebih memaksimalkan hasil yang diperoleh peneliti selanjutnya.

Pertumbuhan zooplankton copepoda selama pemupukan sampai waktu tebar benur di tambak udang Mangunhardjo Kodya Probolinggo Jatim / oleh Riskiyah

 

Pola kalimat bahasa Indonesia dalam karangan siswa kelas VII MTs Akmaarif 01 Singosari / Devilla Widya Aryanti

 

ABSTRAK Aryanti, Devilla Widya. 2015. Pola Kalimat Bahasa Indonesia dalam Karangan Siswa Kelas VII MTs Almaarif 01 Singosari. Jurusan Sastra Indonesia. Fakultas Sastra Universitas Negeri Malang. Pembimbing (1) Dr. Sunaryo Hs., S.H. MHum (2) Dr. Mudjianto, M.Pd. Kata Kunci: struktu frasa, fungsi sintaktis, pola kalimat Kalimat merupakan rangkaian kata-kata yang disususn berdasarkan kaidah tata kalimat yang menduduki fungsi sintaktis tertentu. Fungsi sintaktis yang terdapat pada kalimat yaitu fungsi subjek (S), predikat (P), objek (O), pelengkap (Pel), dan keterangan (Ket). Rangkain kata-kata yang menduduki fungsi sintaktis pada sebuah kalimat disebut dengan pola kalimat. Sekurang-kurangnya kalimat dalam ragam lisan maupun tulis harus memiliki pola subjek (S) dan predikat (P). Jika tidak memiliki unsur tersebut, maka kalimat menjadi tidak bermakna. Penelitain ini bertujuan untuk (1) mendeskripsikan struktur frasa dalam kalimat karangan siswa, (2) mendeskripsikan fungsi-fungsi sintaktis kalimat dalam karangan siswa, dan (3) mendeskripsikan pola kalimat dalam karangan siswa. Penelitian ini menggunakan pendekatan kualitatif dengan sesain penelitian deskriptif. Penelitian ini menggunakan tiga instrument, yaitu tes, panduan pengumpulan data, dan petunjuk analisis data. Berdasarkan analisis data, ditemukan tiga hasil penelitian. Pertama, struktur frasa kalimat dalam karangan siswa, yaitu struktur frasa fungsi S berupa kata, kelompok kata, dan bervalensi kata atau FB, struktur frasa fungsi P berupa kata, kelompok kata, dan bervalensi kata atau FB, struktur frasa fungsi O berupa kata, kelompok kata, dan bervalensi kata atau FB, strukur frasa fungsi Pel berupa kata, kelompok kata, dan bervalensi kata atau FB, dan struktur frasa fungsi Ket berupa kata dan kelompok kata. Berdasarkan pembentuk fungsi sintaktis S, P, O, Pel, dan Ket ditemukan struktur frasa fungsi sintaktis S berupa frasa benda (FB), kata benda (KB) dan klausa, struktur frasa fungsi P berupa frasa benda (FB), frasa kerja (FK), frasa sifat (FS), frasa bilangan (FBil), kata benda (KB), kata kerja (KK), dan kata sifat (KS), struktur frasa fungsi O berupa frasa benda (FB) dan kata benda (KB), struktur frasa fungsi Pel berupa frasa benda (FB), frasa sifat (FS), frasa bilangan (FBil), frasa depan (FD), kata sifat (KS), dan kata kerja (KK), dan struktur frasa fungsi Ket berupa frasa benda (FB), frasa sifat (FS), frasa depan (FD), dan kata sifat (KS). Kedua, fungsi-fungsi sintaktis kalimat dalam karangan siswa, yaitu kalimat-kalimat yang memiliki fungsi sintaktis subjek (S), predikat (P), objek (O), pelengkap (Pel), dan keterangan (Ket). Unsur-unsur sintaktis pembentuk kalimat tersebut dapat dibedakan menjadi unsur wajib yaitu unsur S dan P dan unsur tak wajib yaitu O, Pel, dan Ket. Ketiga, pola kalimat dalam karangan siswa, pola kalimat tunggal dan pola kalimat luas. Siswa sebagai pembelajar yang aktif disarankan agar banyak berlatih menulis kalimat dengan memperhatikan pola kalimat yang digunakan dan lebih mempelajari kaidah-kaidah tata kalimat dan tata bahasa Indonesia yang baik dan benar. Guru sebagai pendidik disarankan agar turut melatih keterampilan menulis siswa terkait penggunaan pola kalimat dengan cara memberikan latihan menulis karangan dengan memperhatikan kaidah-kaidah tata kalimat dan tata bahasa Indonesia yang baik dan benar serta mengoreksi kembali kalimat-kalimat dalam karangan siswa agar terjadi perbaikan pada proses belajar mengajar selanjutnya.

Peran orang tua dalam menanamkan nilai-nilai demokrasi pada anak usia dini di Desa Banjarejo Kecamatan Donomulyo Kabupaten Malang / Romiatin

 

Kata Kunci : Peran Orang tua, Nilai-nilai Demokrasi, Anak Usia dini. Berdasarkan hasil observasi dan wawancara dengan kepala Desa Banjarejo Kecamatan Donomulyo Kabupaten Malang diperoleh informasi bahwa orang tua di desa tersebut sudah memahami konsep demokrasi. Dari 7.215 jumlah penduduk yang berada di Desa Banjarejo5.898 penduduk telah ikut berperan serta dalam pemilihan kepala desa. Masyarakat di desa tersebut hidup dengan rukun dan saling tolong-menolong, anak-anak di Desa Banjarejo juga patuh kepada orang tua. Kepatuhan anak terhadap orang tua dapat dilihat dari perilaku anak yang selalu mengikuti keinginan orang tua, seperti rajin sekolah, selalu membantu orang tua membersihkan rumah, tidak berkelahi dengan teman dan selalu merapikan barang miliknya sendiri dengan teratur. Salah satu faktor yang mempengaruhi kepatuhan anak terhadap peraturan yang berlaku adalah peran orang tua dalam menanamkan nilai demokrasi pada anak usia dini. Masalah yang dikaji dalam penelitian ini adalah: (1) Bagaimana upaya yang dilakukan orang tua dalam menanamkan nilai-nilai demokrasi pada anak usia dini, (2) Faktor apa yang menghambat proses penanaman nilai-nilai demokrasi pada anak usia dini, (3) Upaya apa yang dilakukan orang tua untuk mengatasi hambatan-hambatan dalam penanaman nilai-nilai demokrasi pada anak usia dini. Penelitian ini menggunakan pendekatan penelitian kualitatif, yaitu pendekatan yang menekankan pada usaha untuk menelaah suatu fenomena sosial secara wajar dan alami melalui pengamatan, wawancara atau metode penggalian data kualitatif lainnya secara mendalam. Jenis penelitian yang digunakan adalah penelitian deskriptif kualitatif dengan teknik observasi, wawancara, dan dokumentasi. Sumber data dalam penelitian ini adalah para orangtua di Desa Banjarejo yang memiliki anak usia 5-6 tahun, yaitu Bapak dan Ibu Wandi, Bapak dan Ibu Slamet, Bapak dan Ibu Hariyanto, Bapak dan Ibu Suwani, Bapak dan Ibu Misman, Bapak dan Ibu Safari, Bapak dan Ibu Wariadi. Hasil penelitian ini menunjukkan bahwa: (1) upaya yang dilakukan orang tua dalam menanamkan nilai-nilai demokrasi bagi anak usia dini di lingkungan keluarga sudah cukup maksimal, penanaman nilai menyelesaikan pertikaian secara damai pada anak usia dini dilakukan dengan melerai anak agar tidak bertengkar kemudian menasehati dan membujuk anak agar berbaikan menyuruh anak untuk segera minta maaf dan tidak bertengkar lagi, penanaman nilai penggunaan paksaan sesedikit mungkin pada anak usia dini dilakukan dengan cara membujuk dan merayu anak agar tidak memaksakan kehendaknya segera dipenuhi, penanaman nilai persatuan pada anak usia dini dilakukan dengan dengan menasehati agar dalam bermain tidak memilih-milih teman dan memberikan pemahaman pada anak bahwa sesama manusia harus hidup rukun, penanaman nilai musyawarah pada anak usia dini dilakukan dengan dengan mengajak anak berdialog dan berkomunikasi meminta pendapat mengenai keinginan atau masalah-masalah yang dihadapi anak, penanaman nilai keadilan pada anak usia dini menjelaskan alasan orang tua memberikan tugas yang berbeda antara tugasnya dengan tugas anggota keluarga lain dan melarang anak untuk iri pada kasih sayang yang diberikan orang tua pada anak-anaknya, penanaman nilai memajukan ilmu pengetahuan pada anak usia dini dilakukan dengan menyuruh anak menonton tayangan berita di televisi dan menanyakan hal yang tidak dimengerti oleh anak kepada orang tua. Apabila anak sudah cukup umur untuk memasuki usia sekolah, maka orang tua akan memasukkan anak ke lembaga pendidikan, penanaman nilai menghormati kebebasan orang lain pada anak usia dini dilakukan dengan menasehati agar anak tidak mengganggu orang lain, (2) Faktor penghambat penanaman nilai demokrasi pada anak usia dini adalah kurangnya kerjasama antara ayah dan ibu dalam menasehati anak, kurangnya contoh/teladan yang baik dari orang tua dan kurangnya ketegasan orang tua dalam menasehati anak, (3) Upaya yang dilakukan orang tua dalam mengatasi hambatan penanaman nila-nilai demokrasi pada anak usia dini adalah dengan menjalin hubungan kerjasama antara ayah dan ibu dalam menasehati dan mendidik anak, memberi contoh/teladan yang baik bagi anak, dan bersikap tegas kepada anak. Berdasarkan hasil penelitian ini, peneliti mengajukan saran: (1) Bagi jurusan Hkn disarankan untuk mengadakan program yang menunjang pendidikan demokrasi, (2) Para Orang tua disarankan untuk meningkatkan perannya sebagai pendidik dalam keluarga supaya dapat mendidik anaknya menjadi lebih baik, dengan cara mempertahankan dan lebih mengoptimalkan upaya penanaman nilai-nilai demokrasi pada anak yang telah dilakukan, selain itu orangtua harus membiasakan diri bersikap sesuai dengan nilai-nilai demokrasi sehingga akan ditiru anak, (3) Bagi peneliti selanjutnya, disarankan untuk melengkapi kekurangan yang telah ada untuk mengembangkan ilmu tentang pendidikan demokrasi di lingkungan keluarga dan melaksanakan penelitian selanjutnya untuk meneliti masalah yang sama dengan menggunakan rancangan penelitian yang lain, serta menambah rumusan masalahnya.

Inventarisasi jenis-jenis ikan hasil tangkapan nelayan di pangkalan pendaratan ikan Pondokdadap kecamatan Sumbermanjing Wetan kabupaten Malang / oleh Yulia Indrawati

 

Interaksi sosial pada penganut Islam Fundamental di Kota malang / Kasropin Nugroho

 

ABSTRAK Nugroho, Kasropin. 2015. Interaksi Sosial pada Penganut Islam Fundamental di Kota Malang. Skripsi, Jurusan Psikologi Fakultas Pendidikan Psikologi Universitas Negeri Malang. Pembimbing (I) Diyah Sulistiyorini, S.Psi, M.Psi , (II) Farah Farida Tantiani, S.Psi., M.Psi Kata Kunci : interaksi sosial, penganut Islam fundamental Interaksi sosial adalah hubungan antara individu dengan individu, individu dengan kelompok, atau kelompok dengan kelompok yang paling tidak harus memenuhi syarat adanya kontak sosial dan komunikasi. Interaksi sosial menjadi hal penting bagi setiap orang, termasuk penganut Islam fundamental yang secara definitif merupakan seseorang yang bergabung dengan organisasi yang menginginkan hukum Islam ditegakkan secara sosial politik atau menyeluruh. Penelitian ini merupakan jenis penelitian kualitatif dengan pendekatan penelitian fenomenologis dan analisis yang bersifat deskriptif. Penelitian ini dilakukan pada dua organisasi yaitu Hizbut Tahrir Indonesia (HTI) dan Gerakan Tarbiyah. Subjek penelitian pertama dan kedua berasal dari HTI, sebagai Ketua dan anggota. Subjek penelitian ketiga adalah anggota Gerakan Tarbiyah. Hasil penelitian ini yaitu, kontak sosial subjek pertama dan kedua adalah kontak sosial primer dan bersifat positif. Pada subjek ketiga, cenderung tidak memunculkan kontak sosial. Pada aspek komunikasi subjek pertama memiliki komunikasi yang intensif, sedangkan pada subjek kedua memiliki komunikasi yang terbatas. Pada subjek ketiga cenderung tidak memunculkan komunikasi. Interaksi sosial subjek satu dan subjek dua adalah interaksi sosial asosiatif berupa kerja sama dengan bentuk kerukunan atau gotong royong yang pada tataran sebagai ketua dan anggota organisasi, subjek satu menjalankan norma marhalah tafa’ul ma’a al-ummah dan marhalah at-tasqif, dan subjek dua menjalankan norma marhalah at-tasqif. Pada subjek tiga, interaksi sosial yang muncul adalah interaksi sosial disosiatif dengan bentuk kontravensi yang pada tataran sebagai anggota Gerakan Tarbiyah menjalankan norma islah an-nafs. Saran dari hasil penelitian ini, bagi pemerintah kota Malang sekiranya membuat kegiatan-kegiatan yang dapat melekatkan hubungan antar kelompok agama dan masyarakat diluar kelompok agama. Pemerintah kota Malang menjadi fasilitator untuk pelaksanaan kegiatan-kegiatan tersebut. Kegiatan dapat berupa mengadakan kegiatan keagamaan seperti buka puasa bersama, diskusi keagamaan, diskusi kenegaraan, dan bersih desa. Kemudian saran kepada peneliti lain agar dapat mengembangkan penelitian terpaut interaksi sosial pada anggota organisasi Islam fundamental yang lain.

Pengaruh perendaman dalam larutan kalsium klorida (CaCl2) terhadap kandungan vitamin C pada cabai rawit (Capsicum frutescens L.) selama pengeringan / oleh Anissa'tus Sholikhah

 

Pengembangan lembar kerja proyek untuk meningkatkan kemampuan berpikir kreatif siswa kelas VII SMP pada materi energi / Tanalina Husna Alsana

 

ABSTRAK Alsana, Tanalina Husna. 2015. Pengembangan Lembar Kerja Proyek Untuk Meningkatkan Kemampuan Berpikir Kreatif Siswa Kelas VII SMP Pada Materi Energi. Skripsi, Jurusan Fisika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Supriyono Koes Handayanto, M.Pd, M.A., (II) Nugroho Adi Pramono, S.Si, M.Sc. Kata kunci: lembar kerja siswa, model pembelajaran berbasis proyek, kemampuan berpikir kreatif Pembelajaran sains tidak hanya fokus pada hasil yang diperoleh siswa melainkan juga proses yang dijalankan siswa, proses yang dimaksud salah satunya adalah cara berpikir. Sebuah aspek penting dari berpikir adalah untuk dapat berpikir kreatif. Karakteristik berfikir kreatif yakni dapat berfikir secara divergen atau dapat menghasilkan banyak jawaban untuk pertanyaan yang sama, ini sangat berkaitan dengan pembelajaran sains dalam menghasilkan alternatif pemecahan masalah. Siswa menunjukkan kemampuan memecahkan masalah lebih baik saat pembelajaran berbasis proyek dari pada kelas yang lebih tradisional. Berdasarkan pengamatan pada buku teks pelajaran dan penelitian pengembangan yang ada, pembelajaran berbasis proyek dalam meningkatkan kemampuan berpikir kreatif siswa belum tercapai, sehingga perlu pengembangan lembar kerja proyek untuk meningkatkan kemampuan berpikir kreatif. Penelitian dan pengembangan ini menggunakan 5 langkah Research and Development yang dikemukakan oleh Borg dan Gall meliputi studi pendahuluan dan pengumpulan informasi, perencanaan, pengembangan produk awal, uji coba produk tahap awal, dan revisi produk utama. Instrumen pengumpulan data berupa angket validasi dan angket uji coba. Data yang diperoleh adalah data kuantitatif berupa penilaian menggunakan skala Likert dan data kualitatif berupa saran dan komentar. Data kuantitatif dianalisis menggunakan teknik perhitungan nilai rata-rata. Hasil penelitian dan pengembangan berupa lembar kerja proyek untuk meningkatkan kemampuan berpikir kreatif. Berdasarkan validasi, lembar kerja proyek memperoleh nilai rata-rata 3,35 dengan kriteria layak digunakan, buku petunjuk pembelajaran proyek memperoleh nilai rata-rata 3,38 dengan kriteria layak digunakan, dan website memperoleh nilai rata-rata 3,28 dengan kriteria layak digunakan. Berdasarkan uji coba terbatas diperoleh penilaian siswa terhadap lembar kerja proyek memperoleh nilai rata-rata 3,71 dengan kriteria mudah digunakan. Lembar kerja proyek dapat meningkatkan kreativitas siswa sebagaimana ditunjukkan pada komponen lembar kerja proyek yakni adanya bahan belajar yang disarankan, komponen ini dapat memicu kemampuan berpikir kreatif siswa pada aspek kemampuan berpikir lancar karena memberikan kesempatan kepada siswa menginterpretasikan fenomena. Komponen lembar kerja proyek dapat memicu kreativitas siswa telah di validasi dengan nilai rata-rata 3,20 dengan kriteria cukup layak digunakan dalam meningkatkan kreativitas siswa.

Garis singgung elips
oleh Suwarji

 

Materi bacaan dalam buku teks BIPA Lentera Indonesia 3 untuk pembelajar BIPA / Mutia Fadhila

 

ABSTRAK Fadhila, Mutia.2015.Materi Bacaan dalam Buku Teks BIPA Lentera Indonesia 3 untuk Pembelajar BIPA. Skripsi, Jurusan SastraIndonesia, Fakultas Sastra,Universitas Negeri Malang.Pembimbing: (I)Dr. Widodo HS, M.Pd., (II) Dr. Gatut Susanto, M.M., M.Pd. Kata kunci: materi bacaan, buku teks, pembelajar BIPA Materi bacaan merupakan salah satu input keterampilan berbahasa yang penting untuk diajarkan pembelajar BIPA, sebab materi bacaan menjadi sumber informasi untuk memahami makna dalam suatu bacaan. Melalui materi bacaan, pembelajar dapat mengenalsimbol-simbol tertulis yang diawali dengan segmen terkecildalam teks, kemudian dibangun agar mencakup ke unit yang lebih besar, dan memahami isi tersurat maupun tersirat dalam sebuah teks. Hal tersebut dapat digunakan sebagai tolok ukur ataubahan sejauh mana materi bacaan yang disajikan dalam buku teks BIPA Lentera Indonesia 3. Oleh karena itu, materi bacaan dalam buku teks BIPA Lentera Indonesia3perlu dikaji dan ditelaah dari kelayakan dan keefektifan penggunaannya. Penelitian ini bertujuan untuk mendeskripsikan materi bacaan buku teks BIPA Lentera Indonesia3 yang mencakup topik bacaan dan gradasi bacaan.Penelitian ini menggunakan pendekatan kualitatif dengan desain penelitian deskriptif. Data penelitian ini adalah data tertulis berupa paparan yang mendeskripsikan dua hal. Pertama, topik bacaan penelitian ini berupa kutipan teks, kalimat, dan kata kunci yang mengarah pada budaya masa lampau. Kedua, gradasi bacaan meliputi judul, kutipan teks, kata, kalimat, dan latihan pemahaman bacaan.Sumber data penelitian ini adalah buku teks BIPA Lentera Indonesia 3, karangan Tim BIPA Pusat Bahasa. Buku teks ini diperuntukkan bagi pembelajar BIPA tingkat lanjut. Instrumen yang digunakan pada penelitian ini adalah pedoman analisis dokumen dalam bentuk tabel pengumpul data sebagai instrumen pendukung. Berdasarkan analisis data, diperoleh dua hasil penelitian. Pertama, topik bacaan dalam buku teks BIPA Lentera Indonesia 3 memuat 10 topik bacaan yang berkaitan dengan wujud budaya, yaitu mata pencaharian, sistem kemasyarakatan, sistem bahasa, kesenian, sistem pengetahuan, religi, dan peralatan kehidupan manusia. Topik bacaan tentang kesenian muncul pada unit 1 dan 2 yang membahas tentang kesenian budaya Betawi dan seni rupa. Topik bacaan tentang sistem kemasyarakatan muncul pada unit 3, unit 6, dan unit 7 yang membahas tentang sistem kekerabatan, sistem kenegaraaan, dan organisasi sosial. Topik bacaan tentang sistem bahasa muncul pada unit 4 yang membahas tentang bahasa daerah di Indonesia. Topik bacaan tentang mata pencaharian muncul pada unit 5, unit 8, dan unit 9 yang membahas tentang sistem ekonomi dalam lingkup perdagangan, perikanan, dan perkebunan. Topik bacaan tentang teknologi muncul pada unit 10 yang membahas tentang teknologi buatan Habibie. Kedua, gradasi bacaandalam buku teks BIPA Lentera Indonesia 3 bervariasi dari aspek kata, kalimat, dan latihan pemahaman bacaan.Dilihat dari aspek kata, pembelajar BIPA tingkat lanjut dapat menemukan berbagai kosakata baru, kata berimbuhan, dan kata yang sifatnya sederhana-kompleks, sedangkan dari aspek kalimat, pembelajar dapat menemukan unsur-unsur pembangun kalimat, struktur pembangun kalimat, dan penggunaan kata hubung dalam kalimat. Pada aspek latihan pemahaman bacaan, latihan bersifat literal, kritis, dan kreatif. Berdasarkan hasil penelitian dapat dikemukakan beberapa saran.Pertama, bagi pengajar BIPA disarankan untuk berusaha mengembangkan kualitas dalam menguasai pembelajaran BIPA.Kedua, bagi pembelajar yang ingin mendalami materi budaya disarankan membaca buku teks ini sebagai bahan rujukan dalam mempelajari hal-hal yang berkaitan dengan praktik tata cara hidup orang-orang Indonesia yang akhirnya membentuk terminologi “Budaya Indonesia. Bagi pembelajar yang tidak ingin mendalami budaya, materi ini dapat dijadikan acuan untuk menambah pengetahuan dan konsep tentang budaya Indonesia.Ketiga, bagi peneliti lain disarankan dapat melakukan penelitian lebih lanjut mengenai buku teks dengan rumusan masalah atau aspek yang lebih kompleks dari penelitian ini.Keempat, bagi penulis buku dan bahan ajar, disarankan untuk mengembangkan metode, strategi, bahan, dan buku ajar yang sesuai untuk materi bacaan bagi pembelajar BIPA.

Upaya pengembangan seni budaya daerah melalui pembelajaran PLS (studi kasus di Kota Administratif Ternate Kabupaten Maluku Utara) / oleh Mansur Hasan

 

Hubungan citra tubuh dengan sikap terhadap perilaku diet siswi Jurusan Kecantikan SMKN 3 Malang / Tamimatul Fitriah

 

ABSTRAK Fitriah, Tamimatul. 2015. Hubungan antara Citra Tubuh dengan Sikap terhadap Perilaku Diet Siswi Jurusan Kecantikan SMKN 3 MALANG . Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing : (I) Drs. Fattah Hidayat, S.Psi.,M.Si (II) Pravissi Shanti, S. Psi.,M.Psi Kata Kunci: citra tubuh, sikap terhadap perilaku diet, siswi jurusan kecantikan Sikap terhadap Perilaku diet merupakan evaluasi pengalaman yang diarahkan oleh seseorang terhadap respon atau reaksi dalam pembatasan asupan makanan yang dimiliki untuk membuat badan terlihat lebih ideal. Respon kognitif, emosi pribadi, dan perilaku yang diarahkan pada dimensi diet inilah yang banyak mendasari para remaja memberikan sikap terhadap perilaku diet.Banyak faktor yang mendasari pemberian sikap terhadap perilaku diet dan salah satunya adalah citra tubuh. Citra tubuh merupakan salah satu faktor penyebab perilaku makan menyimpang disamping faktor genetik dan kepercayaan diri yang rendah. Penilaian akan pentingnya citra tubuh inilah yang menjadi faktor penyebab dalam pemberian sikap terhadap perilaku diet. Tujuan dari penelitian ini adalah untuk mengetahui (1) gambaran citra tubuh yang dimiliki oleh siswi jurusan Kecantikan di SMKN 3 Malang, (2) gambaran sikap terhadap perilaku diet siswi jurusan Kecantikan di SMKN 3 Malang, dan (3) melihat apakah ada hubungan antara citra tubuh dengan sikap terhadap perilaku diet siswi jurusan Kecantikan di SMKN 3 Malang. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan deskriptif dan korelasional. Populasi dalam penelitian ini adalah siswi jurusan Kecantikan di SMKN 3 Malang. Subjek penelitian ini berjumlah 60 siswi yang diperoleh dengan purposive sampling. Instrumen yang digunakan dalam penelitian ini adalah skala Citra Tubuh sebanyak 29 aitem dengan reabilitas 0,842 dan skala sikapterhadap perilaku diet sebanyak 23 aitem yang memiliki koefisien reabilitas sebesar 0,811. Hasil penelitianmenunjukkan (1) gambaran citra tubuh siswi jurusan Kecantikan di SMKN 3 Malang termasuk kategori tinggi, (2) gambaran sikap terhadap perilaku diet siswi jurusan Kecantikan secara umum berada dalam kategori tinggi. (3) Ada hubungan positif yang signifikan antara citra tubuh dengan sikap terhadap perilaku diet siswi jurusan Kecantikan SMKN 3 Malang dengan tingkat koefesien korelasi sebesar 0,440 dan p<0,05. Diharapkan bagi siswi jurusan Kecantikan diberikan bekal untuk dapat merawat bentuk tubuh mereka dengan cara yang lebih positif. Pemberian seminar akan cantik yang sehat dapat membantu para siswi untuk lebih berhati-hati dengan memilih cara yang benar dalam mempraktekkan Kecantikan itu sendiri.

Pembelajaran persamaan garis lurus mendasarkan pada kesulitan siswa kelas 2 SLTP / oleh M. Coesamin

 

Perbandingan pemikiran Tjokroaminoto dan Haji Misbach tentang Pergerakan Nasional dan kaitannya bagi pembelajaran sejarah / Muchammad Fahri

 

ABSTRAK Fahri, Muchammad.2015.Perbandingan Pemikiran Tjokroaminotodan Haji.Misbach Tentang Pergerakan Nasional Dan Kaitannya Bagi Pembelajaran Sejarah, Skripsi, JurusanSejarah, FakultasIlmuSosial, UniversitasNegeri Malang. Pembimbing Dr. Ari Sapto, M.Hum. Kata Kunci:Pemikiran, Tjokroaminoto, H. Misbach, Pergerakan Nasional. Pergerakan nasional merupakan sebuah era dalam kemunculan aktivis pemikir-pemikir atas kemerdekaan Indonesia. Pergerakan nasional merupakan bentuk dari sebuah aksi perlawanan atas kolonial Belanda. Pemikiran atas kemerdekaan Indonesia merdeka adalah sebuah bentuk kesadaran rasa nasionalisme dalam mengatasi sebuah permasalahan di Hindia-Belanda. Kebijakan kolonial Belanda dalam negeri jajahan, menjadikan kesadaran sosial dalam melakukan pergerakan dengan tujuan melepaskan dari belenggu penindasan. Penelitianiniberusahamencarijawabanataspertanyaan : (1)bagaimanapemikiran Tjokroaminotodan HajiMisbach ? (2) bagaimanaaksi TjokroaminotodanHajiMisbachdalam mewujudkan pemikirannya? (3) bagaimanapengaruh Tjokroaminotodan HajiMisbach dalam pergerakan nasional ? Tema penelitian ini adalahsejarahpemikiranyaitumengkajisejarah ide atausejarahintelektual, sedangkanmetode penelitian yang digunakanadalahmetodepenelitiansejarah. Adapun tahapandalam metode penelitiansejarahantara lain: pemilihantopik, pengumpulan sumber, kritik sumber, penafsiran, dan penulisan sejarah. Berdasarkanhasilanalisisdaripenelitian:Pertama, kebijakan politik pemerintah kolonial Belanda di Hindia-Belanda yang sifatnya mengeksplotaisi tanah pribumi yang dianggapmenguntungkanbagiKerajaanBelanda. Hal ini menjadikan lahirnya aktivis pergerakan atas kebijakan kolonial Belanda yang dirasa ingin memperjuangkan nasib bangsanya. Kedua, agama sebagai kekuatan moral dalam pergerakan untuk membebaskan dari belenggu penindasan. Peranan agama dan pergerakan nasional merupakan nilai-nilai yang terkandung dalam aktivitas politik. Ketiga, pengaruh pemikiran barat terhadap aktivis pergerakan menjadikan sebuah singkretisme dalam perjuangan atas kolonial Belanda. Pengaruh pemikiran barat dalam pergerakan nasional menjadikan pemikiran revolusioner masyarakat pribumi untuk melawan kolonial Belanda demi kemerdekaan bangsa. Berdasarkan penelitian ini, saran yang dapatdiberikanadalahdiperlukankajianmendalammengenai pengaruh Islam politik dalam peranan kehidupan sehari-hari. Kesadaran berfikir atas agama sebagai modal awal untuk melawan bentuk penindasan. Peranan agama dalam politik tak hanya sebagai simbol suatu keyakinan, melainkan sebagai bentuk awal dalam melakukan gerakan pembebasan. Nilai-nilai dalam ajaran agama adalah suatu bentuk kekuatan politik, dalam melakukan bentuk usaha melawan penindasan dalam hal politik, ekonomi, sosial dan budaya.

Pembelajaran menulis deskripsi dengan strategi aktivitas menulis terbimbing bagi siswa kelas 4 SD Sumbersari IV Kotamadya Malang / oleh Abdul Khalik

 

Pengembangan modul berbasis mind map pda standar kompetensi menggunakan sistem operasi untuk siswa kelas X sekolah menengah atas / Aria Indah Susanti

 

Kata kunci : modul, mind map, sistem operasi. Berdasarkan wawancara, metode mengajar yang digunakan pada kelas X SMA Negeri 3 Bangkalan pada mata pelajaran TIK adalah metode ceramah. Selain itu siswa tidak memiliki buku pegangan atau sumber lainnya untuk dijadikan sumber belajar. Jadi guru berperan sebagai sumber belajar di kelas. Modul merupakan salah satu jenis bahan ajar yang banyak digunakan dalam proses pembelajaran sebagai salah satu sumber belajar. Mind map merupakan salah satu teknik meringkas bahan yang akan dipelajari dan memproyeksikan masalah yang dihadapi ke dalam bentuk peta atau teknik grafik sehingga lebih mudah memahaminya. Mind map sering diterapkan sebagai model pembelajaran Dari alasan tersebut, dikembangkan modul berbasis mind map sebagai bahan ajar siswa. Modul ini telah melalui 2 tahap uji coba. Dari hasil uji coba tahap I atau validasi isi disimpulkan bahwa modul dinyatakan valid karena semua komponen dalam tiap aspek penilaian bahan ajar (aspek kelayakan isi, aspek penemuan terbimbing, keterbacaan, sajian, dan tampilan) dinyatakan valid atau sangat valid dan juga dinyatakan bahwa bahan ajar yang dikembangkan cukup bagus. Sedangkan dari hasil uji coba tahap II atau validasi empirik disimpulkan bahwa bahan ajar yang dikembangkan sudah cukup baik, menarik, dan memotivasi siswa, sehingga layak digunakan oleh siswa sebagai sumber belajar. Penelitian ini termasuk jenis penelitian eksperimen semu (Quasi Eksperimental Design) bentuk nonequivalent Control Group Design. Populasi dalam penelitian ini adalah seluruh siswa kelas X SMA Negeri 3 Bangkalan semester 2 tahun ajaran 2010/2011 yang terdiri dari 8 kelas dan masing-masing kelas berisi 40 siswa kecuali kelas X-2, X-6, dan X-7 berisi 39 siswa. Sedangkan sampel penelitian ini adalah kelas X-2 sebagai kelas kontrol dan X-6 sebagai kelas eksperimen. Pengambilan sampel menggunakan teknik cluster random sampling. Variabel terikat dalam penelitian ini adalah prestasi belajar siswa di ranah kognitif dan variabel bebas adalah penerapan modul. Dari hasil Uji-t diperoleh hasil yaitu thitung. 4,124> ttabel 1,665. Kesimpulan dari hasil analisis menunjukkan bahwa terdapat perbedaan prestasi belajar siswa di ranah kognitif antara siswa yang diajar dengan modul berbasis mind map dengan siswa yang diajar tanpa modul berbasis mind map. Peningkatan prestasi belajar siswa pada kelas eksperimen dikarenakan penyajian materi dalam modul ini lebih menarik bagi siswa dan disertai dengan soal latihan sehingga menambah minat baca dan belajar siswa.

Peran UPT-BK IKIP MALANG yang diharapkan mahasiswa dalam usaha memenuhi kebutuhannya
oleh Nanik Zuhroidah

 

Perencanaan mesin pelumat tanah untuk bata merah / oleh Suratmaji

 

Perencanaan turbocharger dengan air intercooler pada motor diesel 4 tak 6 silinder / oleh Nur Arifin

 

Coping stres mahasiswa putus cinta (suatu kajian fenomenologi terhadap pemudi dewasa awal) / Asmaul Chusna

 

Kata kunci: coping stres, mahasiswa, putus cinta. Mahasiswa tergolong dalam masa dewasa awal pada rentang kehidupannya. Salah satu tugas perkembangan yang khas dalam masa dewasa awal ini adalah orientasi pada pernikahan. Sebagai upaya pemenuhan tugas-tugas perkembangan tersebut dilakukan oleh mahasiswa salah satunya melalui jalinan hubungan pacaran (courtship). Dalam menjalani hubungan pacaran itu tidak selalu berjalan dengan baik, seringkali hubungan cinta itu kandas. Mahasiswa yang mengalami putus cinta karena diputuskan oleh pacar inilah yang menghadapi berbagai konflik intrapersonal maupun konflik interpersonal. Untuk mempertahankan kelangsungan diri dan kehidupannya, individu tersebut perlu melakukan usaha coping terhadap stressor yang menekannya. Berdasarkan fenomena tersebut, fokus penelitian ini meliputi: (1) permasalahan-permasalahan apa saja yang dialami mahasiswa putus cinta. Hal ini diteliti karena adanya asumsi yang didapat setelah diadakannya studi pendahuluan, bahwa permasalahan yang dihadapi tersebut akan melatarbelakangi dan menjadi bagian yang tidak terpisahkan dari usaha coping yang dimunculkan. (2) coping stres mahasiswa putus cinta itu dimunculkan bagaimana dalam deskriptifnya. Hal ini diteliti karena belum adanya gambaran yang spesifik dari usaha coping mahasiswa putus cinta terhadap stressornya. Metode yang digunakan dalam penelitian ini adalah kualitatif fenomenologi. Kehadiran peneliti sebagai pengamat berperan serta yang memanfaatkan sumber lain/informan untuk memperkuat data. Subjek penelitian ditentukan dengan teknik sampling purposive. Teknik pengumpulan data dalam penelitian ini menggunakan observasi, wawancara, dan telaah dokumen pribadi (life history). Analisa data dalam penelitian ini dilakukan dalam tiga tahap yaitu reduksi fenomenal, reduksi eidetis, dan reduksi transedental. Teknik pemeriksaan keabsahan datanya menggunakan ketekunan pengamatan dan triangulasi (triangulasi teknik dan triangulasi sumber). Hasil yang diperoleh dari penelitian ini adalah: 1) permasalahan yang dialami oleh mahasiswa putus cinta merupakan suatu bagian dari proses coping terhadap stressor yang dilakukan secara terus-menerus hingga mencapai suatu kondisi yang aman baik secara intrapersonal maupun interpersonal dalam diri mahasiswa yang mengalami putus cinta tersebut, 2) coping stres yang dilakukan oleh mahasiswa putus cinta meliputi coping stres melalui perasaan, coping stres melalui pikiran, dan coping stres melalui perilaku yang mana kesemua coping tersebut saling berkaitan satu sama lain dalam upaya mencapai keseimbangan intrapersonal maupun interpersonal dalam diri mahasiswa yang mengalami putus cinta tersebut. Saran dari penelitian ini ditujukan kepada peneliti selanjutnya agar diadakan penelitian terhadap fenomena mahasiswa putus cinta dengan tidak hanya melibatkan satu gender subjek penelitian saja, sehingga didapatkan pemahaman mengenai dinamika kepribadian pada mahasiswa putus cinta secara komprehensif. Juga ditujukan kepada konselor di UPT BK (Unit Pelaksana Teknis Bimbingan dan Konseling) di perguruan tinggi agar dari hasil penelitian ini dapat memperkaya khasanah wacana konselor yang mendukung optimalisasi pemberian usaha bantuan khususnya kepada mahasiswa yang mengalami putus cinta.

Perencanaan turbochanger pada motor diesel empat langkah 4 silinder dengan daya motor 110 HP / oleh Sugito

 

Perkembangan gaya hidup remaja Kota Jakarta 1980-2002 (kasus film roman picisan, Lupus, Ada Apa dengan Cinta dan muatan edukasinya) / Novia Risqi Suryani

 

ABSTRAK Suryani, Novia Risqi. 2015. Perkembangan Gaya Hidup Remaja Kota Jakarta 1980-2002 (Kasus Film Roman Picisan, Lupus, Ada Apa Dengan Cinta) serta Muatan Edukasinya. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang, Pembimbing: (I) Drs. Irawan, M. Hum. Kata Kunci : gaya hidup, remaja, film Gaya hidup adalah cara manusia mengaktualisasikan diri melalui penampakan luar. Perkembangan gaya hidup remaja kota Jakarta menarik untuk dibahas pasca oil boom 1973-1975. Oil boom yang hanya berlangsung singkat tersebut mempengaruhi gaya hidup remaja kota Jakarta pada tahun-tahun berikutnya. Gaya hidup remaja kota Jakarta setelah periode oil boom 1980-2002 terekam dalam film sehingga dalam hal ini film memiliki kapasitas dalam untuk merepresentasikan realita yang ada di masyarakat. Penulisan mengenai perkembangan gaya hidup remaja kota Jakarta 1980-2002 dipilih melalui film bertujuan untuk menganalisis beberapa hal meliputi realita gaya hidup remaja kota Jakarta 1980-2002 dan gambaran gaya hidup remaja kota Jakarta 1980-2002 dalam film. Berdasarkan tujuan tersebut bisa diketahui perbandingan realita gaya hidup dengan gaya hidup yang direpresentasikan dalam film. Aspek gaya hidup yang dianalisis adalah bahasa gaul, tempat bersosialisasi, mode pakaian, dan kehidupan percintaan remaja. Penulisan ini menggunakan metode penulisan historis. Metode penulisan historis terdiri dari lima tahap meliputi pemilihan topik, heuristik (pengumpulan sumber), verifikasi (kritik sumber), interpretasi, dan historiografi (penulisan sejarah). Berdasarkan hasil analisis tersebut diperoleh dua kesimpulan. Pertama gaya hidup remaja kota Jakarta 1980-2002 mengikuti gaya hidup Barat dapat dilihat melalui penggunaan bahasa Inggris sebagai bahasa gaul, tempat hiburan (mall, diskotek, kafe), penggunaan celana jeans sebagai mode pakaian sehari-hari, dan kehidupan percintaan yang mengarah pada sikap ekstrovert. Gaya hidup Barat tersebut tidak hanya milik golongan atas saja tetapi juga masyarakat golongan bawah juga, hanya saja dalam aspek kebudayaan yang berbeda. Mereka mengunjungi bioskop sederhana, menonton film dangdut, dan memiliki artis idola Oma Irama dan Ellya. Kedua, gaya hidup yang digambarkan dalam film adalah gambaran gaya hidup remaja kota Jakarta yang berasal dari golongan atas saja yaitu gaya hidup ala Barat seperti mengunjungi diskotek dan kafe. Gaya hidup remaja kota Jakarta yang berasal dari kalangan bawah belum tampak dalam ketiga film. Gaya hidup yang berkembang di tahun 1980-2002 merupakan pembebasan aturan pada masa Soekarno dimana segala bentuk kebudayaan Barat dilarang.

Pengaruh umur pemetikan terhadap kadar gula pereduksi biji jagung manis (Zea mays saccharata Sturt.) / oleh Siti Hamidah

 

Studi tentang pengaruh tingkatan inteligensi dan motivasi belajar biologi terhadap prestasi belajar biologi siswa kelas II SMU Negeri Pagak / oleh Naningsih

 

Penerapan logika fuzzy metode Tsukamoto untuk menentukan harga jual smartphone bekas / Sella Prasetya Santoso

 

ABSTRAK Santoso, Sella Prasetya. 2015. Penerapan Logika Fuzzy Metode Tsukamoto untuk Menentukan Harga Jual Smartphone Bekas. Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: Mohamad Yasin, S.Kom, M.Kom. Kata Kunci: Harga Jual, Logika Fuzzy, Smartphone Bekas, Tsukamoto Perkembangan smartphone yang sangat cepat memicu masyarakat untuk mengikuti dan membeli keluaran smartphone terbaru. Masyarakat akan menjual smartphone lamanya untuk kemudian beralih membeli smartphone yang lebih baru. Dalam melakukan penjualan mayoritas masyarakat akan menjualkan smartphone lamanya ke toko seluler. Namun kegiatan transaksi penjualan yang dilakukan oleh toko seluler masih menggunakan cara manual dalam penentuan harga jualnya, dimana penentuan harga jualnya hanya berdasarkan perkiraan tidak didasarkan pada kondisi smartphone dan harga jual di pasaran. Untuk mengatasi permasalahan tersebut maka dibutuhkan suatu program yang dapat membantu toko seluler dalam menentukan harga jual smartphone bekas yang akurat berdasarkan pada kondisi smartphone dan harga jual di pasaran. Salah satu cara yang bisa digunakan adalah penerapan logika fuzzy dengan menggunakan metode Tsukamoto. Dalam penelitian ini program dibuat dengan menggunakan Delphi dan database Microsoft Access. Hasil dari penelitian ini adalah program yang dapat menentukan harga jual smartphone bekas berdasarkan kondisi fisik, kondisi fitur fungsional, minat pasar dan harga beli smartphone baru. Program ini dapat membantu toko seluler dalam menentukan harga jual smartphone bekas, dimana harga jual yang dihasilkan sudah sesuai dengan kondisi smartphone dan harga jual standart smartphone di pasaran. Dengan adanya program ini maka dapat meningkatkan efektifitas dan efisiensi dalam menentukan harga jual smartphone bekas bagi toko seluler.

Kualitas tes fisika catur wulan I kelas I SMUN 2 Malang tahun ajaran 1998/1999 / oleh Susmiari

 

Pola pengembangan teks eksposisi siswa kelas X SMA Negeri 8 Malang tahun pelajaran 2014/2015 / Enif Nurul Khoirubianti

 

ABSTRAK Khoirubianti, Enif Nurul. 2015. Pola Pengembangan Teks Eksposisi Siswa Kelas X SMA Negeri 8 Malang Tahun Pelajaran 2014/2015. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri malang. Pembimbing: (I) Dr. Kusubakti Andajani, M.Pd, (II) Dr. Titik Harsiati, MPd. Kata kunci: pola pengembangan, teks eksposisi Teks eksposisi merupakan paparan bahasa yang menggunakan struktur atau pola pengembangan tertentu. Kegunaan teks eksposisi adalah untuk menjelaskan dan mengklarifikasi persoalan yang tengah dibahas dengan menyertakan beberapa pendapat penulis dalam menanggapi persoalan tersebut. Melalui kegiatan menulis teks eksposisi, siswa SMA kelas X diharapkan dapat bersikap aktif dan produktif dengan berani mengungkapkan pendapatnya secara pribadi terkait persoalan tentang topik tertentu kedalam bentuk tulis yang sesuai dengan struktur teks tersebut. Penelitian ini dilaksanakan untuk mendeskripsikan pola pengembangan paragraf tesis, argumen, dan simpulan teks eksposisi siswa kelas X SMA Negeri 8 Malang tahun pelajaran 2014/2015. Penelitian ini merupakan penelitian deskriptif kualitatif. Sumber data dalam penelitian ini adalah sumber tertulis berupa teks eksposisi yang diproduksi oleh siswa kelas X SMA Negeri 8 Malang tahun pelajaran 2014/2015. Pengumpulan data dilakukan dengan teknik dokumentasi. Data dalam penelitian ini berupa pola pengembangan paragraf tesis, argumen, dan simpulan yang diproduksi oleh siswa. Tahapan analisis data pada penelitian ini adalah identifikasi, pengkodean, klasifikasi data, pemaparan data, dan penarikan kesimpulan. Triangulasi merupakan teknik pengecekan keabsahan data yang digunakan dalam penelitian ini. Berdasarkan hasil analisis data, diperoleh tiga simpulan sebagai berikut. Pertama, pola pengembangan paragraf tesis yang digunakan oleh siswa terdiri dari satu pola sampai dua pola pengembangan paragraf. Kedua, pola pengembangan paragraf argumen yang digunakan oleh siswa terdiri dari satu pola sampai dua pola pengembangan paragraf. Ketiga, pola pengembangan paragraf simpulan terdiri dari pola penegasan kembali, pola rekomendasi, dan pola ringkasan. Saran penelitian ini ditujukan kepada dua pihak, yaitu guru bahasa Indonesia dan peneliti selanjutya. Bagi guru bahasa Indonesia disarankan agar melakukan tindak lanjut dalam pembelajaran menulis teks eksposisi, terutama pada aspek ketepatan pemilihan penggunaan pola pengembangan paragraf yang sesuai dengan pola pengembangan paragraf pada teks eksposisi. Bagi peneliti lainnya disarankan untuk mengembangkan penelitian baru yang masih berkaitan dengan permasalahan struktur isi pada teks eksposisi, khususnya yang berkaitan dengan pola pengembangan paragraf.

Pelaksanaan kegiatan praktikum biologi dan hubungannya dengan prestasi siswa di SMU Negeri se-kabupaten Klaten Jawa Tengah berdasarkan kurikulum SMU 1994 / oleh Wiwik Rumiyati

 

Pengembangan media letter sharing untuk meningkatkan keterampilan komunikasi siswa introvert / Elian Iwi Afifah

 

ABSTRAK Afifah, Elian Iwi. 2015. Pengembangan Media Letter Sharing Untuk Meningkatkan Keterampilan Komunikasi Siswa Introvert. Skripsi. Jurusan Bimbingan dan Konseling, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing : (1) Dr. H. Triyono, M.Pd. (2) Yuliati Hotifah, S.Psi.,M.Pd. Kata kunci : kepribadian introvert, keterampilan komunikasi, dan media letter sharing. Santrock (2003) menyatakan bahwa remaja mengalami perubahan dalam tiga domain, yaitu proses biologis, proses kognitif, dan proses sosio-emosional. tiga domain perubahan tersebut sangat berpengaruh terhadap keterampilan komunikasi yang ditampakkan oleh remaja. Keterampilan komunikasi merupakan salah satu cara bagi remaja untuk mengungkapkan sesuatu yang ada di fikirannya. Terdapat kecenderungan bahwa remaja yang memiliki keterampilan komunikasi yang rendah dapat dikatakan sebagai seseorang yang berkepribadian introvert. Orang yang berkepribadian introvert cenderung sulit berkomunikasi dan mengungkapkan apa yang mereka pikirkan secara lisan, sehingga cenderung memendam sendiri apa yang menjadi permasalahan mereka sendiri. Oleh karena itu, diperlukan sebuah media letter sharing. Media Letter Sharing adalah produk cetak yang digunakan dalam membantu siswa introvert untuk mengembangkan keterampilan berkomunikasinya. Cara penggunaan produk ini adalah siswa mengisi identitas terlebih dahulu kemudian menulis jawaban dari pertanyaan yang telah disediakan. Selanjutnya, konselor memberikan feedback secara tertulis. Feedback yang diberikan berupa reinforcement. Kegiatan pengisian lembar kerja letter sharing ini dilakukan setiap hari selama 14 hari dan setelah hari ke 14, konselor memberikan kesimpulan mengenai tahap perkembangan siswa. Penelitian ini merupakan penelitian pengembangan (Development Research). Langkah-langkah prosedur pengembangannya meliputi: (1) Identifikasi Kebutuhan, (2) Perumusan Tujuan, (3) Pembuatan Media, (4) Produksi Prototype Media, (5) Validasi, (6) Revisi, dan (7) Pengemasan. Lembar kerja letter sharing ini terdiri dari lembar kerja siswa dan konselor. Produk hasil pengembangan divalidasi oleh 3 dosen dan 3 konselor sebagai validator ahli dan diujicobakan terbatas kepada siswa. Hasil validasi menunjukan bahwa berdasarkan uji ahli layanan BK, termasuk dalam kategori berguna, layak, sangat tepat, dan menarik. Sedangkan berdasarkan uji calon pengguna produk, termasuk dalam kategori berguna, layak, sangat tepat, dan sangat menarik. Namun, ada catatan yang harus direvisi untuk penyempurnaan produk Dengan demikian dapat disimpulkan bahwa produk lembar kerja letter sharing ini sesuai apabila digunakan untuk memfasilitasi siswa dalam mengekspresikan keterampilan komunikasi secara tertulis.

Keanekaragaman fauna tanah pada habitat sawah, ladang dan kebun di Dukuh Mentaraman Tengan Desa Pagelaran Kecamatan Gondanglegi Kabupaten Malang / oleh Fanny Nurhaeni

 

Pengembangan variasi latihan service atas untuk peserta ekstrakurikuler bolavoli di SMK Negeri 4 Malang / Pinton Setya Mustafa

 

ABSTRAK Mustafa, Pinton Setya. 2015. Pengembangan Variasi Latihan Service Atas untuk Peserta Ekstrakurikuler Bolavoli di SMK Negeri 4 Malang. Skripsi, Jurusan Pendidikan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. M.E. Winarno, M.Pd, (II) Dr. Asim, M.Pd Kata Kunci: variasi latihan, service atas, ekstrakurikuler bolavoli Permainan bolavoli merupakan suatu permainan yang dimainkan oleh dua regu masing-masing regu terdiri dari enam orang dengan tujuan untuk menjatuhkan bola ke daerah lawan melewati atas net, dengan cara bermain yang diatur dalam peraturan tertentu. Dalam memulai permainan bolavoli maka diperlukan teknik service. Service atas adalah salah satu jenis service dengan teknik memukul bola dengan satu tangan dan perkenaan bola dengan tangan berada di atas depan kepala. Oleh karena itu kualitas service atas perlu diperhatikan dengan cara dilatih dengan baik. Berdasarkan observasi awal yang dilakukan pada kegiatan ekstrakurikuler bolavoli di SMK Negeri 4 Malang mulai tanggal 13 September 2014. Proses latihan service atas hanya dilakukan dengan cara service atas berulang-ulang di belakang garis akhir lapangan permainan bolavoli. Selain itu berdasarkan wawancara dari pelatih selama ini proses latihan service atas hanya menggunakan drill dan latihan kekuatan saja. Di samping itu berdasarkan penyebaran kuesioner kepada 36 peserta ekstrakurikuler tersebut diperoleh bahwa pelatih hanya memberikan satu jenis variasi latihan saja untuk materi service atas. Penelitian ini bertujuan untuk mengembangkan variasi latihan service atas dalam permainan bolavoli untuk peserta ekstrakurikuler bolavoli di SMK Negeri 4 Malang. Penelitian dan pengembangan ini menggunakan model prosedural dari Borg and Gall (1983:775) yang dimodifikasi dari 10 langkah menjadi 7 langkah, yaitu: (1) analisis kebutuhan, (2) pembuatan produk awal, (3) evaluasi para ahli yang terdiri dari ahli kepelatihan bolavoli dan ahli permainan bolavoli, (4) uji coba kelompok kecil (6 subjek), (5) revisi produk, (6) uji coba kelompok besar (30 subjek), (7) revisi produk akhir. Instrumen yang digunakan dalam penelitian ini berupa kuesioner terbuka dan tertutup. Analisis data menggunakan analisis kualitatif dan kuantitatif deskriptif persentase. Produk pengembangan variasi latihan service atas ini valid dan praktis digunakan untuk peserta ekstrakurikuler bolavoli di SMK Negeri 4 Malang. Produk pengembangan ini terdiri dari 9 spesifikasi produk, yaitu: (1) lempar tangkap bola satu tangan dengan jarak ± 6 meter dari net, (2) melambungkan bola secara vertikal ke atas depan kepala, (3) memukul bola dengan dipegang teman, (4) service atas mengarahkan ke lantai, (5) service atas dengan jarak ± 6 meter dari net, (6) service atas dengan diarahkan lurus, (7) service atas dengan diarahkan menyilang, (8) service atas dengan diarahkan ke sasaran teman, (9) service atas dengan berusaha menjatuhkan bola ke daerah lawan. Saran untuk penyebaran produk pengembangan lebih luas hendaknya perlu direvisi kembali dan disesuaikan dengan situasi dan kondisi yang ada. Dengan demikian produk pengembangan dapat diterapkan sesuai dengan kebutuhan yang ada di lapangan.

Metafora dalam peristiwa perkawinan adat daerah Gorontalo / by Kartin H. Lihawa

 

Pengembangan game edukasi matematika materi bangun datar dalam bentuk Teka-Teki Silang (TTS) / Iga Anastesya Puspawardani

 

ABSTRAK Puspawardani, Iga Anastesya. 2015. Pengembangan Game Edukasi Matematika Materi Bangun Datar dalam Bentuk Teka-Teki Silang(TTS). Skripsi, Jurusan Matematika, FMIPA Universitas Negeri Malang. Pembimbing Mahmuddin Yunus, S.Kom, M.Cs dan Lucky Tri Oktoviana, S.Si, M.Kom Kata Kunci : bangundatar, game, teka-teki silang Matematikamerupakansalahsatucabangilmupengetahuan yang merupakandasardarisemuailmupengetahuan.Namun, matematikaseringdianggapsebagaiilmupengetahuan yang sulitdipelajaribagisebagiansiswa.Salah satu materi yang dianggap sulit adalah materi bangun datar.Untuk itu, siswa membutuhkan gametentang materi bangun datar agar game tersebut menjadi salah satu alternatif pilihan cara belajar yang menarik bagi siswa.Game tersebut adalah game teka-teki silang yang dimainkan dengan perangkat bergerak seperti PC atau laptop. Berdasarkan uraian di atas, penelitian ini bertujuan untuk merancang dan mengembangkan game edukasi matematika materi bangun datar dalam bentuk teka-teki silang (TTS).Pembuatan gameEdukasiMatematikatentangMateriBangunDatardalamBentukTeka-TekiSilang (TTS) memanfaatkan software Adobe Flash Profesional CS6 dengan model perancangan waterfall yang terdiri dari: (1) analisis kebutuhan sistem; (2) sistem desain; (3) implementasi; (4) uji coba; (5) penyebaran; dan (6) perawatan. Pengukuran kelayakan atau kualitasgameinitelahdivalidasiolehdosen validator dantelahdiujicobakankepada 5 anakSekolahMenengahPertama (SMP) danseorangpraktisilapangan. Hasilvalidasidaridosen validator danujicobalapanganmakadidapatkan data akhirsebesar 82% untukdosen validator, 88% untukpraktisilapangandan 90% untukujicobalapangankepada 5 anakSekolahMenengahPertama (SMP). Hasil rata-rata yang diperolehdarihasilvalidasiadalahsebesar 87% dandikategorikanvaliddanlayakdigunakanterutamauntukanaksekolahtingkat SMP sederajat.

Kendala guru seni budaya dalam pembelajaran standar kompeensi ekspresi seni rupa di SMP Negeri se Kabupaten Madiun / Dwi Ana Romlah

 

Kata kunci: kendala, guru, pembelajaran, ekspresi, seni rupa. Di Kabupaten Madiun masih ada beberapa kompetensi dasar ekspresi seni rupa tingkat SMP yang belum dapat diberikan oleh guru seni budaya bidang seni rupa. Beberapa hambatan dialami oleh guru untuk membelajarkan kompetensi dasar tersebut. Penelitian ini bertujuan untuk memperoleh gambaran permasalahan atau kesulitan yang dialami guru dalam pembelajaran ekspresi seni rupa, meliputi kondisi guru mata pelajaran seni budaya, perencanaan pembelajaran oleh guru, sarana dan prasarana penunjang kegiatan pembelajaran, media pembelajaran, strategi pembelajaran, penilaian pembelajaran, minat dan motivasi siswa, dan dukungan dari kepala sekolah. Rancangan penulisan yang digunakan dalam penelitian ini adalah rancangan penelitian deskriptif kuantitatif. Deskriptif karena bertujuan untuk menggambarkan keadaan yang menjadi penyebab terhambatnya pembelajaran ekspresi seni rupa, dan kuantitatif karena data yang diolah berupa angka. Metode yang digunakan adalah kuosiner dengan instrument angket. Angket ini diberikan pada responden yang dipilih dengan teknik sampel area, dari 28 SMP Negeri di Kabupaten Madiun diperoleh 20 responden dari 20 sekolah berbeda. Data diolah dengan rumus prosentase, baik untuk pertanyaan berskala maupun tidak berskala. Hasil penelitian menunjukkan bahwa guru seni budaya di SMP Negeri di Kabupaten Madiun mengalami beberapa hambatan dalam pembelajaran standar ekspresi seni rupa, diantaranya pada kompetensi dasar mempersiapkan dan mengadakan pameran. Faktor penghambat diantaranya adalah tidak tersedianya sarana seperti ruang pembelajaran khusus dan media pembelajaran seni rupa. Selain itu, diketahui bahwa guru seni budaya bidang seni rupa bukanlah guru yang memiliki latar belakang pendidikan seni. Para guru tersebut cukup mengalami kesulitan dalam menentukan langkah-langkah kegiatan pembelajaran dan mengembangkan materi bahan ajar sesuai dengan KTSP. Namun demikian menurut guru seni budaya sebagian besar karya yang dihasilkan siswa memiliki kualitas yang bagus, dikerjakan tepat waktu, dan siswa memiliki antusiasme yang tinggi dalam mengikuti pembelajaran ekspresi seni rupa. Instrumen penilaian yang digunakan guru untuk menilai hasil belajar siswa dalam pembelajaran ekspresi seni rupa adalah pedoman pengamatan dan rubrik penilaian, namun masih ada guru yang menggunakan soal uraian. Saran-saran yang diajukan untuk mengatasi kendala tersebut diantaranya adalah bahwa guru seni rupa harus lebih kreatif dalam usahanya untuk membelajarkan kompetensi dasar seni rupa kepada siswa, sehingga siswa tidak merasa terbebani oleh pembelajaran ekspresi seni. Kepala sekolah selain memberikan dukungan moral juga sebaiknya memberikan dukungan material.

Proses rekrutmen dan seleksi tenaga fungsional akademik (dosen) (studi kasus pada salah satu perguruan tinggi negeri di Propinsi Sulawesi Utara) / oleh Djemmy Tombokan

 

Identifikasi faktor-faktor yang mendukung pemilihan karier siswa kelas X di SMK Negeri 1 Plosoklaten Kabupaten Kediri / Apris Fitrianto

 

ABSTRAK Fitrianto, Apris. 2015. Identifikasi Faktor-faktor yang Mendukung Pemilihan Karier Siswa kelas X di SMK Negeri 1 Plosoklaten Kabupaten Kediri. Skripsi, Jurusan Bimbingan dan Konseling, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Dr. Muslihati, S.Ag, M.Pd, (2) Drs. Harmiyanto, M.Pd Kata Kunci: Pemilihan Karier Dalam memilih pekerjaan atau karier yang akan ditekuni, siswa menghadapi kenyataan bahwa di masyarakat ada demikian banyak pekerjaan. Pemilihan karier adalah proses pengambilan keputusan untuk menentukan rangkaian pekerjaan, jabatan atau kedudukan yang mengarah pada kehidupan dalam dunia kerja. Penelitian ini bertujuan untuk (1) mengetahui faktor-faktor yang mendukung dalam pemilihan karier siswa SMK. Penelitian ini menggunakan rancangan penelitian kuantitatif deskriptif. Sampel dalam penelitian ini adalah siswa siswa kelas X SMK Negeri 1 Plosoklaten berjumlah 173 siswa. Instrumen penelitian adalah faktor-faktor yang mempengaruhi pemilihan karier terdiri dari faktor eksternal dan faktor internal. Pengumpulan data dilakukan dengan menggunakan angket atau kuesioner. Teknik analisis data yang digunakan adalah statistik deskriptif secara manual. Hasil penelitian menunjukkan bahwa faktor internal pemilihan karier yang paling mendukung pilihan karier siswa kelas X SMK Negeri 1 Plosoklaten, minat 7,73%, penggunaan waktu senggang 7,73%, dan faktor eksternal pemilihan karier adalah keluarga dengan nilai 76,52% dan teman sebaya 82,30%. Berdasarkan penelitian di atas, saran yang dapat diberikan antara lain: (1) Untuk konselor dapat digunakan sebagai rujukan konselor dalam upaya penjurusan siswa pada saat akan masuk di SMK Negeri 1 Plosoklaten. (2) Untuk peneliti lain sebagai rujukan dalam mengembangkan materi kemantapan pilihan karier siswa.

Korelasi antara fasilitas perkuliahan dan motivasi belajar dengan indeks prestasi mahasiswa Jurusan Teknologi Pendidikan offering A angkatan 2008 semester gasal tahun akademik 2009/2010 Universitas Negeri Malang / Shoviyul Himami

 

Kata Kunci: Fasilitas Perkuliahan, Motivasi Belajar, Motivasi Intrinsik, Motivasi Ekstrinsik, Indeks Prestasi Pendidikan tidak lepas dari kegiatan belajar mengajar. Belajar merupakan suatu proses yang dilakukan seseorang untuk mencapai sesuatu yang diinginkan. Setiap mahasiswa tentu berharap untuk mecapai hasil yang baik dan memuaskan sesuai dengan usaha yang telah mereka lakukan. Tidak dapat dipungkiri bahwa mahasiswa dalam mencapai prestasi belajar yang diharapkan dipengaruhi oleh beberapa faktor. Namun demikian, hal ini tidak hanya penting bagi mahasiswa, tetapi juga dosen yang mengatur dan mengendalikan faktor-faktor yang mempengaruhi prestasi belajar, agar dapat terjadi proses belajar mengajar yang optimal. Untuk mencapai prestasi yang memuaskan, harus didukung dengan usaha yang maksimal. Misalnya, pengadaan fasilitas yang disediakan oleh pihak lembaga dalam hal ini adalah pihak Perguruan Tinggi sebagai salah satu penyelenggara pendidikan. Keberadaan fasilitas kampus dalam hal ini pihak Jurusan terkait memiliki arti yang sangat penting, karena dapat meningkatkan aktivitas dan kreativitas belajar mahasiswa. Oleh karena itu, keberadaan fasilitas perkuliahan harus dimanfaatkan oleh mahasiswa secara maksimal. Fasilitas yang dimaksud diantaranya adalah laboratorium, perpustakaan, dan ruang media. Tersedianya fasilitas perkuliahan yang lengkap dan memadai harus didukung beberapa faktor lain yang tidak kalah pentingnya dalam pencapaian prestasi belajar yang tinggi yaitu motivasi belajar dari diri individu mahasiswa. Penelitian ini bertujuan untuk membuktikan apakah ada korelasi antara fasilitas perkuliahan dan motivasi belajar dengan prestasi belajar mahasiswa jurusan teknologi pendidikan offering A angkatan 2008 semester gasal tahun akademik 2009/2010 Universitas Negeri Malang. Variabel penelitian adalah Fasilitas perkuliahan(X1), dan Motivasi belajar mahasiswa(X2). Dengan Prestasi Belajar Mahasiswa (Y). Penelitian ini adalah Penelitian Korelasional. Subyek penelitian adalah Mahasiswa Jurusan Teknologi pendidikan offering A Angkatan 2008 semester gasal Tahun Akademik 2009/2010 Universitas Negeri Malang yang berjumlah 40 orang (18 perempuan dan 22 laki - laki). Instrumen yang digunakan adalah angket atau kuisioner.Teknik analisis data dalam penelitian ini analisis korelasi rank order (spearman rho), diolah dengan bantuan komputer program SPSS for Windows Versi 15,00. Hasil pengujian hipotesis membuktikan bahwa hipotesis nol (Ho) ditolak. Hal ini menyatakan bahwa terjadi hubungan yang signifikan antara fasilitas perkuliahan (X1) dan Motivasi belajar mahasiswa (X2) dengan indeks prestasi (Y) dan hubungan antara keduanya positif. Artinya jika fasilitas perkuliahan (X1) dan Motivasi belajar mahasiswa (X2) mengalami peningkatan, akan terjadi kecenderungan peningkatan indeks prestasi (Y) dan demikian pula sebaliknya. Hasil ini memperlihatkan bahwa variabel fasilitas perkuliahan (X1) dan Motivasi belajar mahasiswa (X2) berhubungan secara signifikan dengan indeks prestasi (Y) pada level 5 %. Adanya korelasi positif yang signifikan berarti, semakin lengkap fasilitas perkuliahan dan semakin tinggi motivasi belajar mahasiswa maka akan semakin tinggi pula Indeks Prestasi yang akan diperoleh. Penelitian ini hanya meneliti beberapa faktor yang berkaitan dengan fasilitas saja, belum menggali dan meneliti faktor-faktor lain yang berpengaruh. Oleh karena itu, disarankan agar dilakukan penelitian lebih lanjut dengan cara pengembangan variabel yang lain dan lingkup yang lebih luas sehingga dapat mencapai keberhasilan proses perkuliahan yang optimal.

Interferensi bahasa Banjar Kuala dalam bahasa Indonesia siswa kelas V SD di Martapura, Kalimantan Selatan / oleh Endang Werdiningsih

 

Strategi belajar bahasa Arab siswa MAN Kunir Wonodadi Blitar / Siti Nur Mambaus Shafa

 

ABSTRAK Shafa, S.N. Mambaus. 2015. Strategi Belajar Bahasa Arab Siswa MAN Kunir Wonodadi Blitar. Skripsi, Jurusan Sastra Arab, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (1) Dr. Nurhidayati, M. Pd dan (2) Dr. Ahmad Munjin Nasih, M. Ag. Kata kunci: Strategi Belajar Bahasa Arab, Bahasa Arab, MAN Kunir. Strategi belajar bahasa Arab adalah tindakan spesifik yang ditempuh oleh pembelajar agar kegiatan belajar bahasa Arab lebih mudah, lebih cepat, lebih menyenangkan, lebih terarah, dan lebih efektif. MAN Kunir adalah sekolah unggulan di Blitar, yang siswanya memperoleh nilai yang baik dalam mata pelajaran bahasa Arab. Penelitian ini dilakukan untuk mengetahui strategi belajar yang digunakan siswa dalam mempelajari bahasa Arab. Penelitian ini bertujuan untuk mendeskripsikan: (1) strategi belajar bahasa Arab siswa MAN Kunir Wonodadi Blitar, dan (2) Faktor-faktor yang mempengaruhi penggunaan strategi belajar bahasa Arab siswa MAN Kunir Wonodadi Blitar. Metode penelitian yang digunakan dalam penelitian ini adalah metode deskriptif kualitatif. Sumber data penelitian ini adalah siswa kelas XI MAN Kunir Wonodadi Blitar. Adapun responden dalam penelitian ini adalah guru bahasa Arab kelas XI MAN Kunir Wonodadi Blitar. Instrumen penelitian yang digunakan adalah pedoman observasi, pedoman wawancara, dan angket. Setelah pengumpulan data, dilakukan analisis data yang meliputi: klasifikasi, penyimpulan, dan penafsiran data. Hasil penelitian ini menunjukkan bahwa (1) strategi belajar bahasa Arab yang yang paling banyak digunakan oleh siswa MAN Kunir Wonodadi Blitar adalah strategi sosial. (2) faktor-faktor yang mempengaruhi penggunaan strategi belajar bahasa Arab siswa Man Kunir adalah faktor lingkungan sosial. Dalam proses belajar mengajar bahasa Arab hendaknya guru memanfaatkan strategi belajar sosial yang merupakan strategi yang paling disukai siswa karena dirasa paling mudah dan efektif. Disamping itu guru hendaknya memvariasikan pemanfaatan strategi belajar yang lain untuk memacu semangat dan menambah ketertarikan siswa terhadap pelajaran bahasa Arab. Alangkah baiknya jika guru mempersiapkan terlebih dahulu langkah-langkah pembelajaran yang akan diterapkan dengan memanfaatkan berbagai strategi belajar, agar pembelajaran yang berlangsung menjadi bervariasi dan tidak monoton, dan tujuan tercapai dengan efektif. Bagi mahasiswa dan peneliti selanjutnya, peneliti berharap agar penelitian ini menjadi panduan untuk melaksanakan tentang berbagai strategi belajar dalam proses pembelajaran dan mengkaji lebih lanjut efektivitas penggunaan strategi belajar dalam penelitian selanjutnya. Penelitian ini dapat dilanjutkan dengan cara memperluas aspek kajian tentang strategi belajar bahasa yang digunakan pebelajar bahasa Arab. Yakni dengan mengambil sumber data dari beberapa tempat untuk perbandingan hasil keberhasilan penggunaan strategi belajar bahasa.

Pengaruh volume starter pada medium limbah tahu terhadap ketebalan lapisan nata de soya / oleh Zainal Fanani

 

Implementasi algoritma Monte Carlo pada sistem informasi Penerimaan Peserta Didik Baru (PPDB) online Madrasah Tsanawiyah Kota Probolinggo / Muhammad Rizki Irwanto

 

ABSTRAK Irwanto, Muhammad Rizki. 2016. ImplementasiAlgoritmaMonte CarlopadaSistemInformasiPenerimaanPesertaDidikBaru (PPDB) Online Madrasah Tsanawiyah Kota Probolinggo. Skripsi, JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing : (I) Triyanna Widiyaningtyas, S.T., M.T, (II) M. Zainal Arifin, S.Si., M.Kom. Kata Kunci : PPDB online, pendaftaran, MTs, Algoritma Monte Carlo Penerimaan Peserta Didik Baru (PPDB)onlinemerupakansebuahsisteminformasi yang digunakanuntukpendaftaransiswabarusecara online. Sisteminformasiinimempermudahuntukmelakukanpendaftarankarenadenganadanyasisteminformasiinisemua orang bisamengaksesmelalui internet. Di Kota Probolinggo PPDB Online hanyatersediauntukSD, SMP dan SMA Negerisaja. Sedangkanuntuksekolah swasta pemerintah tidak menyediakan PPDB Online.Di Kota Probolinggo terdapat beberapa MTs swasta yang memiliki banyak peminat, sekolah tersebut yaitu MTsUnggulan Tunas Bangsa, MTs Riyadlus Sholihin, dan MTs Hidayat. Ketiga MTs initidakmempunyaisisteminformasi PPDB Online. Hal inimenyebabkansiswa SD yang inginmendaftarkeketiga MTs tersebutkesulitan, seperti proses antrian untuk pendaftaran yang sangat lama, proses perekapan data pendaftar dan hasil seleksi penerimaan peserta didik baru oleh sekolah yang cenderung masih dilakukan secara manual. Apabilasetiaptahunnya proses penerimaansiswabaruselaludilakukansecara manual, makaakanmembutuhakanwaktu yang sangat lama dalam proses penerimaanpesertadidikbarudanberbagaikesulitandaribeberapapihak yang terkait. Tujuan penelitian ini untuk menghasilkan produk Sistem Informasi Penerimaan Peserta Didik Baru (PPDB) Online untuk MTs Kota Probolinggo dengan menerapkan Algoritma Monte Carlo dan menguji kelayakan produk sistem informasi tersebut.Metodepenelitiandanpengembangan yang digunakandalampengembangansisteminformasiiniadalahmetodepengembanganwaterfall. Terdapatbeberapatahapdalammetodepengembanganwaterfall,seperti : 1) tahapdefinisikebutuhansistem, 2) tahapdesainsistemdanperangkatlunak, 3) tahapimplementasidanpengujian unit, 4) tahapintegrasidan testing sistem, 5) tahapoperasidanpemeliharaan. Pengujian sistem informasi ini menggunakan teknik pengujian black-box untuksegifungsionalitasdan usabilitas. Pada pengujian segi fungsionalitas harus mencapai 100% dan pengujian dari segi usabilitas harus sama dengan 80% atau diatas 80%. Berdasarkan uji coba yang sudah dilakukan di ketiga MTs Kota Probolinggo tersebut, didapatkan data hasil uji coba sistem informasi dari segi fungsionalitas dan usabilitas oleh ahli rekayasa web dan admin sebesar 100%. Data hasil uji coba sistem informasi oleh guru dari segi usabilitas sebesar 84,1%. Sedangkan data hasil uji coba sistem informasi oleh siswa dari segi usabilitas sebesar 87,2%. Dari data hasil uji coba diatas, dapat disimpulkan bahwa sistem informasi ini sudah valid dan siap digunakan di sekolah. Diharapkandenganadanyasisteminformasi PPDB Online untuk MTs Kota Probolinggo initerciptatransparansipenerimaansiswabarudankemudahandalamseleksisiswabaru.

Penerapan prinsip kerja sama dalam novel pop bacaan siswa SLTA / oleh Pandapotan Tambunan

 

Analisis efektivitas tindakan penagihan aktif atas pencairan tunggakan pajak (studi pada Kantor Pelayanan Pajak Pratama Malang Utara tahun 2012-2014) / Alexander Hendra Christian

 

ABSTRAK Christian, Alexander Hendra. 2015. Analisis Efektivitas Tindakan Penagihan Aktif Atas Pencairan Tunggakan Pajak.(Studi Pada Kantor Pelayanan Pajak Pratama Malang Utara Tahun 2012-2014). Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I)Dr. H. Tuhardjo, S.E., M,Si., Ak(II)Dr. Sunaryanto, M.Ed. Kata Kunci: Efektivitas, Penagihan Aktif, dan Pencairan Tunggakan Pajak Pajak merupakan sumber penerimaan pendapatan tertinggi yang berperan penting dalam pembiayaan dan pembangunan suatu negara. Banyak cara yang dilakukan Direktorat Jenderal Pajak untuk meningkatkan penerimaan negara dari sektor pajak. Salah satunya dengan melakukan penagihan aktif atas tunggakan pajak dengan surat teguran, surat paksa, surat sita, dan surat blokir. Penagihan aktif ini diharapkan dapat meminimalkan jumlah tunggakan pajak yang ada. Tujuan penelitian ini adalah untuk mengetahui tingkat efektivitas jumlah surat teguran, surat paksa, surat sita, dan surat blokir atas pencairan tunggakan pajak di KPP Pratama Malang Utara.Jenis penelitian dalam penelitian ini adalah analisis statistik deskriptif yang bersifat studi kasus untuk mengungkapkan permasalahan yang ada dengan menggunakan angka-angka, yang kemudian dianalisis untuk menjawab pertanyaan dalam rumusan masalah yang berada di Kantor Pelayanan Pajak Pratama Malang Utara. Teknik analisis data yang digunakan dalam penelitian ini adalah analisis rasio yaitu rasio efektivitas penerbitan surat teguran, surat paksa, surat sita, surat blokir dan rasio kontribusi penerimaan pencairan tunggakan pajak. Hasil penelitian menunjukkan bahwa surat teguran dan surat blokir tidak efektif terhadap pencairan tunggakan pajak, sedangkan surat paksa efektif terhadap pencairan tunggakan pajak dan surat sita sangat efektif terhadap pencairan tunggakan pajak. Hal ini disebabkan adanya ketidakpatuhan wajib pajak dalam melaksanakan kewajiban perpajakannya. Pemberian sanksi dari masing-masing surat juga menjadi salah satu alasan wajib pajak untuk tidak patuh. Hasil penelitian ini diharapkan dapat menjadi bahan pertimbangan Kepala Kantor Pelayanan Pajak Pratama Malang Utara untuk lebih meningkatkan efektivitas surat teguran, surat paksa, surat sita, dan surat blokir sehingga penerimaan pajak lebih meningkat.

Problemtika pelestarian wayang kulit di kalangan generasi muda (studi kasus di Kecamatan Ringinrejo Kabupaten Kediri) / Mifdal Zusron Alfaqi

 

Kata Kunci: Problematika Pelestarian, Wayang Kulit, Generasi muda Melestarikan kebudayaan perlu dan mendesak di lakukan, sebab kebudayaan merupakan ciri dari suatu bangsa. Salah satu yang perlu di lestarikan adalah wayang kulit. Dalam melestarikan wayang kulit memiliki banyak sekali problematika yang terjadi khususnya di kalangan generasi muda. Maka dari itu penulis ingin mencari apa yang menjadikan problematika dalam melestarikan wayang kulit di kalangan generasi muda. Adapun tujuan penelitian ini adalah untuk mendeskripsikan (1) Sejarah wayang kulit, (2) Kronologis pertunjukan kesenian wayang kulit, (3) Nilai-nilai yang terkandung dalam kesenian wayang kulit, (4) Pelestarian wayang kulit di Kecamatan Ringinrejo Kabupaten Kediri, (5) Problematika pelestarian wayang kulit di kalangan generasi muda. Untuk mengumpulkan data peneliti menggunakan rancangan penelitian deskriptif kualitatif, informan terdiri dari pemerintah Kecamatan Ringinrejo, dalang wayang kulit, dan generasi muda lima desa yang ada di Kecamatan Ringinrejo yaitu, Desa Jemekan, Desa Susuh Bango, Desa Selodono, Desa Dawung, dan Desa Ringinrejo. Pengumpulan data dilakukan dengan observasi, wawancara dan dokumentasi. Dalam penelitian ini peneliti menggunakan analisis data tema kultural (componential analysis). Untuk menjamin keabsahan data yang ditemukan, peneliti melakukan pengecekan keabsahan data sebagai berikut: (1), Ketekunan pengamatan (2). Triangulasi. Hasil penelitian dapat di deskripsikan sebagai berikut: (1) Sejarah wayang kulit ada dua versi. Versi yang pertama yaitu wayang kulit merupakan sebuah kebudayaan dan kesenian yang berasal dari India. Versi ini tokoh-tokoh dalam wayang kulit adalah Ramayana dan Mahabarata. Versi yang ke dua adalah wayang kulit berasal dari Indonesia khususnya Jawa, wayang kulit dari jawa ini di ciptakan oleh Sunan Kalijaga untuk di jadikan alat penyebaran agama Islam. tokoh-tokoh yang ada dalam wayang kulit di tambahkan tokoh "punokawan" Semar, Petruk, Gareng, Bagong serta Limbuk dan Cangek. (2) Kronologis pertunjukan kesenian wayang kulit melalui tiga tahapan: a. Pathet Nem (Jejer), b. Pathet Nyanga, c. Pathet Manyuro. (3) Nilai-nilai wayang kulit sangatlah kaya: a. Nilai gotong royong, b. Nilai kebersamaan dan kesatuan, c. Nilai budi pekerti, d. Nilai kesenian, e. Nilai pendidikan, f. Nilai politik, g. Nilai tanggung jawab, h. Nilai kemandirian. (4) Pemerintah dan para pelaku pelestarian (dalang) berusaha untuk melestarikan wayang kulit dengan sering di gelarnya pertunjukan wayang kulit terutama pada hari-hari besar. (5) Problematika pelestarian wayang kulit terkendala masalah mendasar: a. Generasi muda tidak faham dengan cerita yang di bawakan oleh dalang. b. Generasi muda tidak faham dengan bahasa yang di gunakan dalang. c. Generasi muda merasa jenuh atau bosan di karenakan wayang kulit yang kurang terpadu dengan kebudayaan modern. d. Waktu pertunjukan wayang kulit yang lama. e. Generasi muda beranggapan wayang kulit merupakan kebudayaan yang kuno. f. Generasi muda kurang mengenal dan mengerti tentang wayang kulit. g. Belum adanya perkumpulan dalang wayang di Kecamatan Ringinrejo dan sampai sekarang perkumpulan dalang langsung di bawah PEPADI, sehingga kurang terjalinnya hubungan antara pelaku pelestarian di Kecamatan Ringinrejo. Berdasarkan hasil penelitian disarankan sebagai berikut: a. Dalang lebih mendekatkan wayang kulit dengan generasi muda. b. Pemerintah Kecamatan Ringinrejo sebagai lembaga tertinggi harus mendorong dan memfasilitasi para pelaku pelestarian wayang kulit. c. Perkumpulan dalang perlu di adakan di Kecamatan Ringinrejo. d. Sering di adakannya pagelaran wayang. e. Bahasa pada wayang kulit di padukan dengan bahasa Indonesia, ada perpaduan kebudayaan lama dengan yang baru. Sehingga adanya sebuah pembaharuan wayang kulit tanpa mengurangi nilai-nilai lakon cerita wayang kulit.

Hubungan antara persepsi terhadap kepemimpinan ketua jurusan dan keefektifan mengajar dosen dengan prestasi belajar mahasiswa pada perguruan tinggi swasta di Kotamadya Banda Aceh / oleh Musdiani

 

Kajian kualitas fasilitas jembatan penyeberangan dan perilaku pengguna di Kota Malang / Muhammad Toga Wisudawan

 

ABSTRAK Wisudawan, Muhammad Toga. 2015. Kajian Kualitas Fasilitas Jembatan Penyeberangan dan Perilaku Pengguna di Kota Malang. Skripsi, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Bambang Supriyanto, S.T, M.T., (II) Ir. Henri Siswanto, M.T. Kata Kunci: kualitas, jembatan penyeberangan, perilaku pengguna, Malang Jembatan penyeberangan di Kota Malang dibuat untuk mengatasi konflik antara pejalan kaki dengan lalu lintas yang berpengaruh bagi keselamatan, keamanan, kenyamanan dan ketertiban lalu lintas, sehingga perlu ditinjau efektifitasnya. Penelitian dilaksanakan dengan tujuan untuk mengetahui kesesuaian kondisi fisik jembatan penyeberangan orang dengan peraturan Departemen Pekerjaan Umum, Direktorat Jenderal Bina Marga 1995, menilai tingkat pemanfaatan jembatan penyeberangan orang, dan mengetahui perilaku penyeberang terhadap pemanfaatan jembatan penyeberangan orang di Kota Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Objek penelitian ini adalah seluruh jembatan penyeberangan orang yang ada di Kota Malang. Pengumpulan data dilakukan dengan melakukan survai, observasi dan dokumentasi. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, dan tahap evaluasi data. Berdasarkan hasil analisis data tersebut, diperoleh tiga simpulan hasil penelitian sebagai berikut: (1) sebagian besar jembatan penyeberangan di Kota Malang masih belum sesuai dengan ketentuan yang ada, seperti tinggi ruang bebas yang hanya jembatan penyeberangan Jl. Jenderal Basuki Rahmad yang sudah sesuai dengan ketentuan yang ada. Tidak terdapatnya saluran pembuangan pada konstruksi jembatan penyeberangan yang ada di Kota Malang, (2) berdasarkan perhitungan prosentase hasil penelitian menempatkan tingkat pemanfaatan jembatan penyeberangan Jl. Jenderal A. Yani Utara keberadaanya tidak bermanfaat, begitu juga dengan jembatan penyeberangan Jl. Jenderal A. Yani, pada jembatan penyeberangan Jl. Jaksa Agung Suprapto keberadaannya sangat bermanfaat, pada jembatan penyeberangan Jl. Jenderal Basuki Rahmad keberadaan jembatan cukup bermanfaat, pada jembatan penyeberangan Jl. Merdeka Utara keberadaan jembatan bermanfaat, (3) tingkat pemanfaatan penggunaan jembatan penyeberangan ditinjau dari perilaku penyeberang yaitu, pada lokasi Jl. Jenderal Ahmad Yani Utara tergolong tinggi, begitu juga pada Jl. Jaksa Agung Suprapto dan Jl. Jenderal Basuki Rahmad sedangkan Jl. Jenderal Ahmad Yani dan Jl. Merdeka Utara tergolong rendah. Jembatan penyeberangan tetap bisa digunakan dengan pagar pengaman sepanjang 100 meter pada median, anjuran pemerintah dan ketegasan hukum, serta perawatan mengingat pentingnya faktor keamanan dan keselamatan (safety) pejalan kaki dan lalu lintas.

Perencanaan turbocooler pada motor dua tak satu silinder untuk kendaraan roda dua / oleh Tulus Suyono

 

Perencanan mesin bor untuk membuat dudukan fitting lampu listrik / oleh Agus Suroto

 

Identifikasi kesulitan belajar matematika siswa SMK Negeri 1 Kediri pada materi persamaan dan pertidaksamaan kuadrat / Ratna Widyastuti

 

Kata Kunci: Identifikasi, Kesulitan Belajar Matematika, Persamaan Kuadrat, Pertidaksamaan kuadrat. Hasil belajar antara siswa satu dengan yang lain tidaklah sama. Perbedaan hasil belajar ini dipengaruhi oleh banyak faktor antara lain: faktor internal yang bersifat psikologis dan faktor eksternal: proses belajar mengajar di sekolah, sosial dan situasional. Dari hasil wawancara dengan salah satu guru mata pelajaran matematika di SMK Negeri 1 Kediri diperoleh keterangan bahwa siswa SMK cenderung mengalami banyak kesulitan dalam belajar matematika antara lain pada materi persamaan dan pertidaksamaan kuadrat. Penelitian ini dilakukan untuk menngidentifikasi kesulitan- kesulitan yang dialami siswa pada materi persamaan kuadrat dan pertidaksamaan kuadrat sehingga diharapkan guru pengajar matematika SMK sederajat dapat menentukan langkah antisipasi sedini mungkin. Metode penelitian yang digunakan dalam penelitian ini adalah diskriptif analisis dengan pendekatan kualitatif. Kesulitan belajar yang dihasilkan dalam penelitian ini adalah (1) kesulitan dalam memahami dan menggunakan konsep yang berkaitan dengan materi persamaan kuadrat dan pertidaksamaan kuadrat, (2) kesulitan dalam menyelesaikan soal bentuk verbal yang berkaitan dengan aplikasi soal persamaan kuadrat, dan (3) kesulitan dalam melakukan operasi aritmetika terutama operasi pada bentuk pecahan dan tanda akar. Saran yang dapat diberikan dalam penelitian ini adalah identifikasi kesulitan perlu dilakukan sedini mungkin setelah materi tersebut diajarkan sampai dengan diperoleh sebuah kesimpulan sehingga dapat dijadikan pertimbangan bagi guru untuk mengantisipasi kesulitan pada bagian-bagian tertentu.

Hubungan kegiatan siswa dalam ekstra kurikuler Badan Dakwah Islam (BDI) dan perilaku keagamaan siswa kelas II SMU Negeri 4 Malang tahun pelajaran 1996/1997 / oleh Muhammad Sholichin

 

Pengaruh pendidikan, pengalaman kerja dan kecerdasan emosional terhadap pemahaman akuntansi di industri kendang Kota Blitar / Dewi Rahmawati

 

ABSTRAK Rahmawati, Dewi. 2015. PengaruhPendidikan, PengalamanKerjadanKecerdasanEmosionalterhadapPemahamanAkuntansi di IndustriKendang Kota Blitar. JurusanAkuntansi, Program PendidikanAkuntansi. Pembimbing: (1) Drs. H. Sumadi, M.M. (II) Dr. Hj. PujiHandayati, S.E., CA., CMA. Keyword: pendidikan, pengalamankerja, kecerdasanemosional, pemahamanakuntansi, industrikecildanmenengah Akuntansisebagaipenyediainformasikeuanganpadausahakecildanmenengahtidakdimanfaatkansecaramaksimal.Padahalpenggunadariinformasitersebuttidakhanyadarikalangan internal tetapijugaeksternal.Tidakdimanfaatkannyaakuntansisecaramaksimalpadabeberapapenelitiandisebabkanoleh (1)administrasi yang tidakjelassehinggamengakibatkantidakbisaterhitungnyalababersihusaha (2) tidakadanyakewajibanuntukmenyusunlaporankeuanganuntukusahakecilmenengah (3) pemahamanakuntansi yang kurangdaripihakpengelolakeuangan. Pemahamandipengaruhiolehbanyakhaltermasukpendidikan, pengalamankerjadankecerdasanemosional.Pendidikansebagaidasardaripemahamanindividu.Di sekolahmerekadiajarkanpengetahuandanketrampilan yang bergunadalammenyelesaikanpekerjaandimasamendatang.Semakin lama pemilikberkutatdenganpencatatantransaksimakasemakinpahamterhadapselukbelukdunia yang digelutinyatermasukakuntansi.Dimilikinyakecerdasanemosionalpadapemilikmakapemilikmerupakanindividu yang mampuuntukmenggunakanemosinyauntukmembimbingperilaknyakearahperbaikan, termasukperbaikandalamhalmemahamiakuntansi. Penelitianinimenggunakanjenispenelitianeksplanatifdengantiga variable bebasyaitupendidikan (X1), pengalamankerja (X2) dankecerdasanemosional (X3) dansatu variable terikat (Y) yaitupemahamanakuntansi.Hasil yang diperolehmenyebutkanbahwa (1) Pendidikanmemberikanpengaruh yang positifterhadappemahamanakuntansi di IndustriKendang Kota Blitar (2) Pengalamankerjamemberikanpengaruh yang positifterhadappemahamanakuntansi di IndustriKendang Kota Blitar, dan (3) KecerdasanEmosionalmemberikanpengaruh yang positifterhadappemahamanakuntansi di industrikendangkotaBlitar.Data dikumpulkandaripenyebarankuisionerkepadake30sampelindustri di Kota Blitar.Penelitianinimenggunakananalisisregresibergandauntukmengujisecaraparsialvariabelbebasdanvariabelterikat. Berdasarkanuraiandiatasdiharapkanpemerintahmelaluilembaga yang berwenangmelakukanpelatihanakuntansiuntukIndustridan Usaha Kecil Menengah.Bagipenelitiselanjutnya yang inginmelakukanpenelitiansejenisdapatmenggunakanvariabel lain sepertipelatihankerja, budayakerja, motivasidanetoskerjadanmenggunakansampellebihluasdenganmemasukkanusahakendang yang berada di KabupatenBlitar. 

Perbedaan pengelolaan diri antara mahasiswa biasa dan aktivis kampus di IKIP MALANG / oleh Yusuf Masngut

 

Die entwicklung des mediums quartettkarten "Ich Liebe Berlin" als tourismus-und kulturlenstoff im kurs Deutsch / Ferdiana Syahnaz Hakim Suherman

 

ABSTRAK Suherman, Ferdina Syahnaz Hakim. 2015. Pengembangan Media Kartu Kuartet “Ich liebe Berlin” Sebagai Bahan Pembelajaran Pariwisata dan Budaya Berlin Pada Mata Kuliah Deutsch 1 . Skripsi, Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Iwa Sobara, S.Pd, M.A. (II) M. Kharis, S.Pd, M.Hum. Kata Kunci: Media Kartu Kwartet, Pariwisata dan Budaya Berlin, Keterampilan Berbicara Penelitian ini bertujuan untuk mengembangkan kartu kwartet “Ich liebe Berlin” sebagai alternatif bahan ajar untuk mata kuliah Deutsch 1. Kartu kwartet “Ich liebe Berlin” merupakan sebuah permainan dengan menggabungkan pembelajaran pariwisata dan budaya kota Berlin dengan pembelajaran keterampilan berbicara sehingga pembelajaran lebih menarik. Kedua pembelajaran ini disesuaikan dengan materi pada bahan ajar Studio D A1 bab 8 yang digunakan pada mata kuliah Deutsch 1. Pada penelitian ini digunakan sebuah metode pengembangan yang dihasilkan dari kombinasi metode pengembangan Dick & Carrey dengan Sugiono. Dari hasil kombinasi pengembangan ini didapatkan sebanyak tujuh langkah metode pengembangan yang berupa : 1) identifikasi kebutuhan, 2) pengembangan materi, 3) petunjuk penggunaan,4) pembuatan media, 5) validasi, 6) revisi, dan 7) uji Coba. Sumber data dari penelitian ini didapatkan dari ahli materi, ahli media dan para mahasiswa angkatan 2015. Data-data yang didapat dari angket ahli materi, ahli media dan para mahasiswa dideskripsikan menggunakan rancangan penelitian deskriptif kualitatif. Berdasarkan hasil analisis data, ahli materi dan ahli media sangat setuju bahwa media ini dapat menjadi pendukung pembelajaran pariwisata dan budaya Berlin pada bahan ajar Studio D A1. Total persentase hasil penilaian dari kedua ahli tersebut adalah 91,7% dan 88,9%. Selain itu sebagian besar siswa tertarik dengan media ini dari segi desain maupun dari segi tujuan pembelajarannya. Sebanyak 14 dari 22 mahasiswa menyatakan sangat setuju dan delapan siswa menyatakan setuju bahwa bentuk dan tampilan kartu menarik. Selain itu terbukti bahwa, sebanyak 13 dari 22 mahasiswa sangat setuju bahwa, media ini tidak hanya dapat memperluas pengetahuan mahasiswa tentang pariwisata dan budaya Berlin, tetapi juga dapat membantu mahasiswa untuk melatih kemampuan berbicara dengan lebih menyenangkan. Berdasarkan hasil tersebut dapat disimpulkan bahwa media kartu Kuartet sudah sangat layak untuk digunakan pada mata kuliah Deutsch 1.

Pelaksanaan perkawinan beda agama di Indonesia
oleh Mochamad Hery Nurcahyo

 

Linguistic strategies to stimulate children's Korean language development shown in Korean variety show "The Return of Superman" a case study / Ratna Dewi Laksmita Wahni

 

ABSTRAK Wahni, R. D. L. 2015. Linguistic Strategies to Stimulate Children’s Korean Language Development Shown in Korean Variety Show ‘The Return of Superman’-A Case Study. Skripsi. Jurusan Sastra Inggris. Fakultas Sastra. Universitas Negeri Malang. Pembimbing: (I) Evynurul Laily Zen, S.S., M.A. Pembimbing: (II)Aulia Apriana, S.S., M.Pd. Kata Kunci: Bahasa sang ayah, Bahasa anak, Pemerolehan Bahasa. Penelitian ini bertujuan untuk mengetahui strategi linguistik yang digunakan Lee Hwi Jae, seorang pembawa acara TV, komedian, aktor dan penyanyi dari Korea Selatan, dalam merangsang setiap perkembangan bahasa Korea putra kembarnya pada variety show Korea ‘The Return of Superman’. ‘The Return of Superman’ adalah variety show Korea dimana para ayah selebriti mengasuh anak mereka selama 48 jam tanpa bantuan dari siapapun. Penelitian ini merupakan kajian psikolinguistik. Data pada penelitian ini adalah tuturan pada interaksi ayah dan anak yang ditemukan pada sumber data yaitu video dari episode yang telah dipilih. Penulis menggunakan teori Lightbown dan Spada tentang pemerolehan bahasa serta teori dari Steinberg tentang bagaimana anak belajar bahasa dalam menganalisis data. Penelitian ini merupakan studi kasus strategi linguistik dari interaksi ayah dan anak yang melibatkan tiga subjek penelitian, yakni Lee Hwi Jae, Lee Seo Eon dan Lee Seo Jun. Pada tahap pengumpulan data, penulis melakukan beberapa tahap. Tahap pertama, penulis mengambil 40 episode sebagai data penelitian. Tahap kedua, penulis membatasi data hanya pada satu keluarga yang terpilih. Tahap ketiga, penulis mengunduh video dari episode yang terpilih. Tahap keempat, penulis mentranskripsi interaksi antara ayah dan anak yang menunjukkan strategi linguistik. Tahap terakhir, penulis mengklasifikasikan data berdasarkan strategi linguistic yang diberikan oleh sang ayah dan tahap perkembangan bahasa yang dialami oleh si kembar. Dari 40 episode yang sudah dianalisis, hanya ada 21 episode yang berisi data yang akan digunakan untuk penelitian ini. Hasil analisis menunjukkan bahwa terdapat lima strategi linguistik yang cenderung digunakan oleh Lee Hwi Jae untuk menstimulasi perkembangan bahasa si kembar. Strategi tersebut adalah penggunaan bahasa anak dalam perubahan kosa kata, penerapan pendekatan keterangan, penerapan pendekatan induksi, meminta untuk melakukan sesuatu, dan yang terakhir adalah strategi linguistik dari pemberian koreksi. Berdasarkan analisis data yang dilakukan, strategi linguistik yang dilakukan oleh Lee Hwi Jae dapat dimasukkan ke dalam teori behaviourism, innatism, dan interactionist position, akan tetapi strategi tersebut lebih condong kepada teori behaviourism dan interactionist position. Penulis juga menemukan bahwa meskipun si kembar menerima rangsangan yang sama, dari ayah yang sama dan berasal dari lingkungan yang sama, mereka mempunyai kemampuan bahasa yang berbeda, yang akan menjadi tugas peneliti selanjutnya untuk mengetahui faktor penyebabnya.

Studi tentang kelompok belajar Al-Qur'an anak-anak di Kecamatan Blimbing Kodya Malang / oleh Sri Wahyuni

 

Penggunaan metode problem solving yang kontekstual untuk meningkatkan kemampuan memecahkan masalah pada kajian pemanfaatan dan pelestarian lingkungan hidup di kelas XI-IPS SMA Widyagama Malang / Tri Agustin

 

Kata kunci: problem solving, kemampuan memecahkan masalah Berdasarkan observasi awal yang dilakukan di kelas XI - IPS SMA Widyagama Malang pada tanggal 23 dan 30 Oktober 2010, diketahui bahwa dalam kegiatan pembelajaran guru telah menggunakan beberapa metode pembelajaran, tetapi siswa masih kurang aktif. Dari kegiatan wawancara dengan siswa, menunjukkan bahwa dalam pembelajaran geografi selama ini siswa hanya menghafal konsep dan kurang mampu untuk menggunakan konsep tersebut jika menemui masalah dalam kehidupan nyata, maka perlu dilakukan penelitian tentang penerapan pembelajaran yang dapat meningkatkan kemampuan memecahkan masalah siswa. Salah satunya dengan penggunaan metode problem solving. Penelitian ini merupakan penelitian tindakan kelas (Clasroom Action Research) yang dilaksanakan dalam 2 siklus tindakan. Setiap siklus terdiri atas dua kali pertemuan selama 2 jam pelajaran. Subyek penelitian yang digunakan dalam penelitian tindakan kelas ini yaitu siswa kelas XI-IPS semester genap tahun ajaran 2010-2011 SMA Widyagama Malang dengan jumlah 36 siswa, terdiri dari 17 siswa laki-laki dan 19 siswa perempuan. Dalam penelitian ini data yang diperoleh berupa kemampuan memecahkan masalah siswa. Kemampuan memecahkan masalah siswa diukur berdasarkan pengamatan selama proses pembelajaran berlangsung. Instrumen yang digunakan yaitu lembar observasi dan catatan lapangan. Hasil penelitian menunjukkan bahwa terjadi peningkatan kemampuan memecahkan masalah siswa kelas XI-IPS SMA Widyagama Malang pada siklus I dan pada siklus II. Aktivitas siswa yang menunjukkan indikator kemampuan memecahkan masalah semakin meningkat setelah dibentuk dua kelompok dengan topik yang sama, kelompok pertama sebagai penyaji dan kelompok kedua sebagai pembanding. Siswa dapat saling bertukar pendapat untuk pemilihan solusi yang tepat dalam diskusi kelas. Dapat dikatakan bahwa kemampuan siswa dalam memecahkan masalah termasuk dalam kategori baik. Berdasarkan hasil penelitian diperoleh bahwa penggunaan metode problem solving yang kontekstual dapat meningkatkan kemampuan memecahkan masalah siswa kelas XI-IPS khususnya pada kajian pemanfaatan dan pelestarian lingkungan hidup di SMA Widyagama Malang. Disarankan pada guru geografi untuk menggunakan metode problem solving pada materi lain dengan memunculkan permasalahan kontekstual yang dapat diungkap dan didiskusikan sebagai salah satu alternatif pembelajaran untuk meningkatkan kemampuan siswa dalam memecahkan masalah.

Hubungan antara pola asuh orang tua dan perilaku assertive siswa klas II SMU Negeri I Jenggawah Jember
oleh Diah Evi Cahyaningtias

 

Child-directed speech in first language acquisition: a case study / Devi Oktabrianti Anugerah Wibawati

 

ABSTRAK Wibawati, D.O.A, 2015. Child-Directed Speech in First Language Acquisition: A Case Study.Skripsi, JurusanSatraInggris, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) EvynurulLaily Zen, S.S, M.A.,(II) AuliaApriana, S.S.,M.Pd. Kata Kunci: Bahasa sang ibu, strukturbahasapengasuh Penelitianiniberhubungandenganpenggunaankaliamat yang digunakanpengasuhterhadapanak-anak yang dikenaldenganistilah "bahasa sang ibu". Penelitianinibertujuanuntukmengetahuistrukturbahasa yang digunakanpengasuhterutama proses fonologi, morfologi, dansintaksis yang digunakanolehpengaduhsaatmemproduksikalimatmereka. Penelitianinimerupakanstudikasus yang berfokuspadakasus-kasustertentuterutamapadabahasa sang ibu yang dicontohkanolehpengasuhsaatberkomunikasidengananak-anak yang merekajaga. SubyekpenelitianiniadalahNamiradanpengasuhnya. NamiraadalahanakJawa-Indonesia berumurtigatahun. Ketikapengamatandimulaidiapadausia 3,5tahundanpadasaatituselesai, diasudah 3,9 tahun. Pengumpulan data berlangsungdaribulanAgustushingga November danberadadalambentukcatatandanrekamansuara. Untukmenganalisis data, pertama, penulismencatatpercakapan yang dihasilkanataudiucapkanolehNamiradanpengasuhnya. Setelahterurutkan, kata-kata kemudianditranskrip. Kemudiandilanjutkandenganmengklasifikasikanmerekakedalamtigakategori, seperti proses fonologi, morfologi proses, dan proses sintaksis, dandengandemikian, penulisbisamenafsirkandanmenganalisis. Temuanmenunjukkanbahwapengasuh di Indonesia cenderungmenggunakan "bahasa sang ibu" kepadaanak yang merekarawat. Penulismenemukanbahwasebagiandari kata yang digunakanolehpengasuhketikamerekaberkomunikasidengananak-anakmenggunakan proses substitusi, Penulisjugamenemukanbahwapengasuhmenggunakanpengulanganketikamerekaterlibatdalamkomunikasidengananakselainmenyederhanakandanmenghapusbeberapa kata untukmembuatanak-anakmerekamemahamiapa yang merekabicarakan. Olehkarenaitudisarankankepada orang tuaataupengasuhuntukmemperhatikanpemerolehanbahasaanak-anakmereka. Tetapitidakuntuksalahmengucapkan kata-kata yang dipelajariolehanak-anakmerekakarenamerekaakandenganmudahmenirupengucapan yang salah.

Studi tentan kesukaran-kesukaran dalam mempelajari hukum-hukum dasar kimia tentang gas yang dihadapi siswa kelas II SMU Negeri 4 Malang / oleh Farisa Mahmudah

 

Identifikasi kesulitan-kesulitan belajar yang dialami siswa kelas IIA1 dan IIA2 dalam mempelajari materi redoks dan elektrokimia di SMA Negeri se kabupaten Trenggalek / oleh Nurhayati

 

Kajian analisis dampak lingkungan (andal) alih fungsi Bumi Tanjung (kawasan kampus Akademi Penyuluhan Pertanian Malang) dari kawasan pendidikan dan terbuka hijau menjadi kawasan perumahan mewah
oleh Munif Musthofa

 

Penerapan pembelajaran perkalian dan pembagian bilangan cacah dengan problem solving untuk meningkatkan prestasi belajar matematika siswa kelas III SD Insan Amanah Malang / Marta Adiprayitno

 

Kata kunci: Prestasi Belajar, Perkalian dan Pembagian bilangan cacah, Pembelajaran Problem Solving Berdasarkan hasil observasi peneliti pada bulan Juli-Agustus 2010, diketahui bahwa selama proses pembelajaran matematika di kelas III B SD Insan Amanah Malang, siswa cenderung pasif dalam proses pembelajaran. Mereka hanya mendengar dan mencatat materi yang disampaikan oleh guru. Hal tersebut disebabkan sebagian besar guru di SD Insan Amanah Malang menerapkan metode pembelajaran konvensional dalam setiap proses belajar mengajar. Sampai saat ini mereka belum menemukan suatu metode yang tepat untuk mengatasi permasalahan-permasalahan yang umum terjadi pada siswa dalam rangka upaya meningkatkan prestasi belajar siswa. Salah satu metode pembelajaran yang secara teoritis dapat digunakan untuk menyelesaikan masalah yang dialami siswa SD Insan Amanah Malang khususnya untuk materi perkalian dan pembagian bilangan cacah adalah menerapkan pembelajaran dengan problem solving. Penelitian ini bertujuan untuk mendeskripsikan langkah-langkah pembelajaran dengan problem solving model Polya sehingga dapat meningkatkan prestasi belajar perkalian dan pembagian bilangan cacah pada siswa kelas III B SD Insan Amanah Malang tahun ajaran 2010/2011. Proses pelaksanaan pembelajaran diawali dengan memberikan masalah, memahami masalah, menyusun rencana penyelesaian, melaksanakan rencana yang telah disusun , dan kemudian diakhiri dengan memeriksa kembali prosedur dan hasil penyelesaian. Metode penelitian yang digunakan adalah metode penelitian tindakan kelas yang terdiri dari dua siklus belajar. Setiap siklus terdiri dari empat tahap yaitu perencanaan, pelaksanaan tindakan, observasi, dan refleksi. Subyek penelitian adalah siswa kelas III B SD Insan Amanah Malang tahun pelajaran 2010/2011. Hasil penelitian tindakan kelas ini menunjukkan bahwa pada siklus I presentase banyak siswa yang tuntas belajar pada materi perkalian adalah 56%, artinya pembelajaran belum berhasil karena belum mencapai taraf ketuntasan 75% dari jumlah siswa. Sedangkan pada siklus II, presentase banyak siswa yang tuntas belajar pada materi pembagian adalah 76%, artinya bahwa pembelajaran dengan problem solving model Polya pada siklus II terjadi peningkatan prestasi belajar matematika siswa karena telah mencapai taraf keberhasilan lebih dari 75%. Hal ini dapat diperkuat dengan hasil observasi aktivitas guru dan siswa yang masuk dalam kategori “Sangat baik” pada siklus I maupun siklus II, serta hasil wawancara terhadap siswa yang menunjukkan bahwa secara umum siswa senang dan memberikan respons yang positif terhadap pembelajaran dengan problem solving model Polya.

Perbedaan faktor yang memotivasi siswa mengikuti bimbingan belajar di LBB Technos" Malang / oleh Rasimin"

 

The Female stereotype as rep[resented in female ghost charavters in selected horror film / Isna Zulfa Khusnawati

 

ABSTRAK Khusnawati, Isna Zulfa. 2016. Stereotip Wanita Dipresentasikan dalam Karakter Hantu Wanita dibeberapa Film yang telah Dipilih. Skripsi Sarjana, Jurusan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Dosen Pembimbing: M. Nasrul Chotib, S. S., M. Hum. Kata Kunci: hantu perempuan, stereotip perempuan, feminism. Hantu lebih sering muncul pada karya sastra dan layar kaca maupun layar lebar daripada dikehidupan sehari-hari masyarakat saat ini. Beberapa cerita hantu kemudian berkembang dan membentuk suatu gaya/aliran sastra, yang kemudian disebut horor. Salah satu ciri khas dari aliran ini adalah adanya cerita hantu didalam karya sastra. Karya sastra yang menyajikan cerita hantu tidak hanya terbatas pada karya tulis, melainkan juga pada media visual, terutama film. Film yang menampilkan hantu dalam ceritanya disebut juga dengan film horror. Kisah sosok hantu perempuan lebih banyak ditampilkan daripada kisah sosok hantu laki-laki oleh film-film horror yang menyajikan cerita hantu. Fenomena ini juga terdapat dalam film-film yang menjadi focus dalam penelitian ini, yakni; Mamá, The Grudge 3 dan Kuntilanak. Ketiga film ini menjadikan sosok perempuan sebagai hantu dan menjadikannya karakter utama dalam film. Berkaitan dengan adanya sosok hantu perempuan yang ditampilkan dalam film-film ini, maka diperlukan pembahasan mengenai adanya keterikatan antara penggambaran sosok hantu perempuan dan stereotip perempuan yang mengikuti kemunculan hantu perempuan dalam film-film ini. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan tentang adanya stereotip perempuan yang disajikan bersama dengan adanya sosok hantu perempuan dalam beberapa film yang menjadi fokus dalam penelitian ini. Tiga film ini diharapkan cukup mewakili dari banyaknya film horor yang menampilkan sosok hantu perempuan sebagai tokoh utamanya. Penelitian ini menggunakan rancangan penelitian kualitatif. Data penelitian berupa tiga film yang telah disebutkan dengan fokus pada karakter dan deskripsi hantu perempuan yang ditampilkan dalam film. Kegiatan analisis data dimulai dengan mengumpulkan beberapa artikel dan karya tulis ilmiah mengenai hantu, sosok perempuan, dan bahkan teori feminism yang membahas tentang tampilan perempuan dalam film. Berdasarkan hasil analisis data tersebut, diperoleh dua kesimpulan dari hasil penelitian sebagai berikut. Pertama, masih tetap ada stereotip perempuan sebagai sosok perempuan yang ‘baik’ dalam dalam pandangan masyarakat kita. Sosok hantu perempuan dengan penggambaran seperti dalam film merupakan gambaran dari perempuan yang ‘buruk’ dalam pandangan masyarakat. Perempuan seperti ini harus dihindari, dihilangkan dan dikucilkan ataupun dirubah jika perlu. Kedua, sosok perempuan yang ‘baik’ adalah sosok perempuan seperti yang digambarkan dalam film sebagai tokoh antagonis atau lawan dari sosok hantu perempuan. Perempuan ‘baik’ ini menggambarkan bagaimana seharusnya perempuan bersikap dan berpenampilan. Perempuan seperti ini akan dengan mudah diterima dalam masyarakat kita dimana peran laki-laki masih sangat mendominasi dalam kehidupan bermasyarakat. Pada akhirnya, penggambaran perempuan dalam kategori apapun bertujuan untuk menjadi obyek dari kepuasan laki-laki.

Pengaruh pemberitahuan rencana pengajaran harian terhadap motivasi dan prestasi belajar fisika / oleh Samsul Hadi

 

Peran pimpinan dan kepatuhan karyawan terhadap penerapan Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3) untuk mendukung tercapainya zero accident (studi pada Divisi Incinerator dan Divisi Laundry RSUD Dr. Soegiri Lamongan) / Mukhammad Mizan Zulmi)

 

ABSTRAK Zulmi, Muhammad Mizan. 2015. Peran Pimpinan dan Kepatuhan Karyawan terhadap Penerapan Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3) untuk Mendukung Tercapainya Zero Accident (Studi pada Divisi Incinerator dan Divisi Laundry RSUD Dr. Soegiri Lamongan). Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Syihabudhin, S.E, M.Si, (II) Dr. Wahju Wibowo, S.E, M.Si. Kata Kunci: Peran Pimpinan, Kepatuhan Karyawan, Sistem Manajemen K3, Zero Accident. Keselamatan dan Kesehatan Kerja sangat penting dalam pengelolaan sumber daya manusia di sebuah organisasi, hal tersebut penting mengingat semakin banyak faktor-faktor bahaya yang terdapat di tempat kerja seiring kemajuan teknologi, untuk itulah maka diperlukan pengelolaan sistem manajemen Keselamatan dan Kesehatan Kerja (SMK3) di setiap perusahaan. Penerapan Sistem Manajemen K3 haruslah didukung penuh oleh para pimpinan dalam perusahaan agar program K3 dapat berjalan efektif. Selain peran pimpinan, kepatuhan karyawan juga sangat dibutuhkan dalam penerapan Sistem Manajemen K3. Indikator keberhasilan pelaksanaan SMK3 dapat dilihat dari pencapaian zero accident atau kecelakaan nihil oleh sebuah perusahaan dalam kurun waktu tertentu. Penelitian ini dilakukan dengan tujuan untuk mendeskripsikan tentang peran pimpinan dan tingkat kepatuhan karyawan terhadap penerapan SMK3 pada sebuah perusahaan yang telah mendapatkan pencapaian zero accident. Penelitian yang dilakukan di RSUD Dr. Soegiri Lamongan ini menggunakan pendekatan deskriptif kualitatif. Teknik yang digunakan untuk mengumpulkan data dalam penelitian ini yaitu: observasi, wawancara, dan dokumentasi. Pengecekan keabsahan data yang digunakan dalam penelitian ini dilakukan dengan ketekunan pengamatan dan trianggulasi. Berdasarkan hasil analisis data tersebut dapat diperoleh hasil penelitian sebagai berikut. Pertama, Standar kecelakaan nihil yang diterapkan di RSUD Dr. Soegiri Lamongan adalah Peraturan Menteri Tenaga Kerja dan Transmigrasi Republik Indonesia Nomor PER-01/ MEN/ I /2007 tentang Pedoman Pemberian Penghargaan Keselamatan dan Kesehatan Kerja, selain itu juga menerapkan Standar Keselamatan dan Kesehatan Kerja Rumah Sakit (K3RS) berdasarkan Keputusan Menteri Kesehatan Republik Indonesia Nomor 1087/MENKES/SK/VIII/2010. Kedua, Direktur RSUD Dr. Soegiri Lamongan telah berperan besar dalam penerapan SMK3 di lingkup RSUD Dr. Soegiri Lamongan dengan melaksanakan kewajiban secara baik sesuai dengan pedoman Sistem Manajemen K3. Kepala IPL telah melaksanakan perannya dalam penerapan program K3 pada Divisi Incinerator begitu pula Kepala Sub Bidang Penunjang pada Divisi Laundry secara baik sesuai dengan tugas yang diberikan oleh Direktur. Ketiga, peraturan K3 yang digunakan sudah relevan dengan kebutuhan RSUD Dr. Soegiri Lamongan terutama pada Divisi Incinerator dan Divisi Laundry, namun penerapan peraturan K3 di RSUD Dr. Soegiri Lamongan masih belum bisa memenuhi standar penerapan SMK3 yang baik karena karyawan tidak memiliki buku panduan K3 serta tidak adanya peraturan umum K3 yang diberlakukan pada RSUD Dr. Soegiri Lamongan. Keempat, kepatuhan karyawan pada Divisi Incinerator dan Divisi Laundry terhadap peraturan K3 RSUD Dr. Soegiri Lamongan masih rendah, mengingat masih adanya pelanggaran yang terjadi yang dilakukan secara sadar oleh karyawan. Saran yang diberikan peneliti adalah : (1) Direktur RSUD Dr. Soegiri Lamongan sebaiknya menyediakan sarana K3 berupa hindrant, sprinkler dan alat detektor kebakaran untuk mengurangi dampak yang terjadi ketika suatu saat terjadi kebakaran, hal tersebut mengingat bangunan RSUD Dr. Soegiri memiliki struktur bangunan yang melebihi 1 lantai. (2) Program kerja K3 yang dilaksanakan oleh P2K3 dan MFK sebaiknya memiliki rancangan yang terpisah. (3) Penilaian kinerja K3 sebaiknya dilakukan dengan mempertimbangkan beberapa poin yang dapat dijadikan tolok ukur. (4) Peraturan K3 yang diterapkan di RSUD Dr. Soegiri Lamongan sebaiknya didukung dengan adanya Peraturan K3 Umum untuk seluruh karyawan RSUD Dr. Soegiri Lamongan serta buku panduan K3 yang dimiliki oleh semua karyawan. (5) Sebaiknya dilakukan pengawasan lebih intensif dan relugasi yang ketat untuk mengurangi pelanggaran peraturan K3 yang dilakukan oleh karyawan RSUD Dr. Soegiri Lamongan.  

Penyelenggaraan program akselerasi ditinjau dari substansi manajemen pendidikan (studi multi kasus di SMA Negeri 5 Malang dan MAN Malang 1) / Denok Dwi Anggraini

 

Kata kunci: manajemen pendidikan, program akselerasi Undang-Undang Republik Indonesia Nomor 20 Tahun 2003 tentang Sistem Pendidikan Nasional, Pasal 5 Ayat 4 yaitu "Warga negara yang memiliki potensi kecerdasan dan bakat istimewa berhak memperoleh pendidikan khusus", hal ini berarti pemerintah harus memberikan pendidikan khusus bagi peserta didik yang memiliki potensi dan kecerdasan istimewa, agar potensi yang ada pada peserta didik dapat berkembang secara optimal dan pada gilirannya memberikan kesempatan kepada peserta didik dapat tumbuh menjadi manusia yang beriman dan bertaqwa kepada Tuhan Yang Maha Esa, berakhlak mulia, berilmu, cakap, kreatif, dan mandiri. Dalam menyelenggarakan program akselerasi, sekolah penyelenggara harus dapat mengoptimalkan dan mengimplementasikan manajemen pendidikan yang meliputi manajemen kurikulum, peserta didik, pendidik dan tenaga kependidikan, sarana dan prasarana, keuangan, serta humas. SMA Negeri 5 Malang dan MAN Malang 1 telah menyelenggarakan program akselerasi dan sudah meluluskan satu angkatan. Oleh karena itu perlu mempertanyakan penyelenggaraan program akselerasi yang ditinjau dari substansi manajemen pendidikan kedua sekolah tersebut. Fokus penelitian bagaimanakah penyelenggaraan program akselerasi yang ditinjau dari (1) manajemen kurikulum; (2) manajemen peserta didik; (3) manajemen pendidik; (4) manajemen sarana dan prasarana; (5) manajemen keuangan; serta (6) manajemen humas. Pendekatan kualitatif digunakan dalam penelitian ini dengan menggunakan rancangan studi multikasus, dengan menggunakan metode komparatif konstan (constant comparative method )dikarenakan setiap temuan di lapangan secara konsisten ada perbedaan yaitu perbedaan terlihat dari kurikulum yang digunakan di masing-masing sekolah. Data yang diperoleh melalui: (1) observasi; (2) wawancara; dan (3) dokumentasi. Analisis data dilakukan dengan menggunakan pengumpulan data, penyajian data, dan penarikan kesimpulan. Teknik pengecekan keabsahan data yang digunakan adalah (1) ketekunan pengamatan ; (2) triangulasi; dan (3) pengecekan anggota (member check). Kesimpulan penelitian ini, ditemukan bahwa bentuk kegiatan substansi manajemen pendidikan dalam penyelenggaraan program akselerasi di SMA Negeri 5 Malang dan MAN Malang 1 meliputi: (1) manajemen kurikulum yaitu penggunaan KTSP yang dimodifikasi oleh masing-masing sekolah dengan dikembangkan secara berdiferensiasi, dan tetap mengacu pada pemerintah pusat, hampir semua guru menggunakan bahasa bilingual dalam pembelajaran untuk mata pelajaran hard science, sedangkan MAN 1 hanya beberapa guru yang menggunakan bahasa bilingual, serta kedua sekolah menerapkan sistem pembelajaran di luar dan juga outbond; (2) manajemen peserta didik meliputi: penerimaan peserta didik dilakukan secara objektif, dan transparan, jumlah siswa masing-masing sekolah tidak sama, tergantung dari hasil tes penerimaan siswa baru yang dilaksanakan oleh masing-masing sekolah, dan kedua sekolah mempunyai standar penilaian tersendiri, standar KKM SMAN 5 yaitu 8,0, sedangkan standar KKM MAN 1 yaitu 7,5, jika nilai siswa belum memenuhi standar, maka akan dikembalikan ke program reguler; (3) manajemen pendidik meliputi: perekrutan guru program akselerasi berdasarkan kriteria tertentu, jumlah guru akselerasi di SMAN 5 sebanyak 30 orang guru dan 3 orang dilibatkan sebagai staf pengelola, guru yang mengajar di kelas X, XI, dan XII dibedakan, sedangkan jumlah guru akselerasi di MAN 1 sebanyak 25 orang guru dengan 5 orang sekaligus sebagai staf pengelola, guru yang mengajar di kelas X, XI, dan XII tidak dibedakan, tetapi jika prestasi rendah, maka akan dipindah mengajar di reguler, peningkatan mutu guru dengan cara pelatihan dan memberikan tambahan insentif, untuk SMAN 5 insentif diberikan secara langsung setiap bulan, serta evaluasi guru dilihat dari nilai siswa; (4) manajemen sarana dan prasarana, perencanaan sarpras dengan mengadakan rapat, dan penataan lingkungan belajar menyesuaikan kebutuhan guru dan materi, sarana program akselerasi lebih lengkap dari pada program reguler, sarana dan prasarana program akselerasi di SMAN 5 dan MAN 1 relatif sama, hanya di MAN 1 ada tambahan TV dan CCTV; (5) manajemen keuangan, sumber dana berasal dari pemerintah, komite, dan SPP. SPP lebih mahal daripada regular, di SMAN 5 besarnya SPP semmua siswa aksaelerasi sama yaitu Rp 400.000,00 setiap bulan, SPP sedangkan MAN 1 besarnya SPP setiap siswa akselerasi tidak sama antara Rp 0 - Rp 400.000,00 setiap bulan, tergantung dari kemampuan orang tua, serta masing-masing sekolah memberikan beasiswa bagi siswa yang tidak mampu dan siswa berprestasi; (6) manajemen humas, senantiasa melibatkan orang tua dalam rangka meningkatkan program dan mutu sekolah, dengan frekuensi pertemuan minimal 3 kali dalam satu tahun, SMAN 5 menjadi anggota asosiasi akselerasi nasional, sedangkan MAN 1 menjadi ketua asosiasi akselerasi madrasah se Jawa Timur dan anggota asosiasi akselerasi nasional, serta kedua sekolah menjalin kerjasama dengan UMM dalam bidang psikologi, UB bidang MIPA, dan UM pengembangan kemampuan guru. Saran yang dapat diberikan diantaranya: (1) bagi Kepala SMAN 5, hendaknya lebih memantapkan program yang dibuat, sedangkan bagi Kepala MAN 1 hendaknya lebih memperhatikan manajemen program akselerasi sehingga dapat menjadi sekolah yang berkualitas; (2) bagi Ketua Program Akselerasi SMAN 5, hendaknya senantiasa melakukan perbaikan dalam kegiatan pelaksanaan semua substansi manajemen pendidikan terutama dalam sarana prasarana, sedangkan bagi Ketua Program Akselerasi MAN 1, hendaknya senantiasa melakukan evaluasi kegiatan substansi manajemen pendidikan; (3) bagi guru dan staf pengelola, hendaknya melakukan perbaikan tugas sebagai pengajar dan staf pengelola; (4) bagi Ketua Jurusan Administrasi Pendidikan, diharapkan agar menambah kajian ilmu manajemen pendidikan khususnya program akselerasi; (5) bagi peneliti lain, hendaknya melakukan penelitian pengembangan untuk mengetahui substansi manajemen program akselerasi yang akan datang, dengan memperdalam fokus penelitian dan kajian teorinya.

Pengembangan modul pembelajaran bidang studi ilmu pengetahuan sosial untuk siswa kelas enam (VI) caturwulan II sekolah dasar / oleh Juni Pramestari

 

Studi kasus latar belakang anak putus sekolah dasar pada beberapa keluarga di desa Genengan, kecamatan Pakisaji, kabupaten Malang
oleh Roisuddin

 

Perencanaan lahan parkir Kantor Desa Selorejo Kecamatan Dau Kabupaten Malang / Dessy Ekasari

 

ABSTRAK Ekasari, Dessy. 2015. Perencanaan Lahan Parkir Kantor Desa Selorejo Kecamatan Dau Kabupaten Malang. Proyek Akhir. Program Studi D3 Teknik Sipil Bangunan. Fakultas Teknik. Universitas Negeri Malang. Pembimbing: (I) Drs. Eko suwarno M.Pd Kata Kunci: Perencanaan, Pelataran Parkir, Desa Selorejo Kecamatan Dau Desa Selorejo berada di Kecamatan Dau, lokasinya berada pada daerah Kabupaten Malang bagian Utara. Lokasinya kurang lebih 17 km dari ibukota Malang dan 7 km dengan kota kecamatan terdekat. Ketersediaan tempat parkir merupakan salah satu kebutuhan dalam sistem transportasi, karena setiap perjalanan dengan kendaraan pribadi umumnya selalu di mulai dan diakhiri di tempat parkir. Pelataran parkir merupakan salah satu infrastruktur yang harus dimiliki oleh setiap kota-kota besar yang sedang berkembang seperti Desa Selorejo ini. Permasalahan yang ditinjau dalam Proyek Akhir ini adalah sebagai berikut: (1) Bagaimana desain lahan parkir, (2) Bagaimana detail teknis lahan parkir dan (3) Berapa besar anggaran biaya yang diperlukan untuk pelaksanaan lahan parkir kantor Desa Selorejo Kecamatan Dau Kabupaten Malang. Hasil perencanaan lahan parkir kantor Desa Selorejo Kecamatan Dau Kabupaten Malang adalah sebagai berikut (1) Desain parkir kantor desa Selorejo dengan total SRP yang tersedia 13 SRP untuk mobil, 2 SRP untuk bus, dan 40 SRP untuk sepeda motor (2) pada perencanaan tebal perkerasan lahan parkir kantor desa Selorejo menggunakan paving block tebal 8cm, lapis base setebal 20 cm menggunakan material batu pecah, lapis sub base setebal 17 cm menggunakan material sirtu, dan lapis sand bedding setebal 5cm (3) Anggaran Biaya yang diperlukan untuk pekerjaan perencanaan lahan parkir dengan total biaya Rp. 587.573.300,00 (Lima Ratus Delapan Puluh Tujuh Juta Lima Ratus Tujuh Puluh Tiga Ribu Tiga Ratus Rupiah). Saran Proyek Akhir ini adalah: (1) Dalam mendesain parkir dengan Pola parkir 90o banyak menghasilkan ruang parkir namun perlu diperhatikan ruang untuk manuver lebih diperbesar agar lebih mempermudahkan pengemudi untuk melakukan manuver, (2) Penentuan tebal, mutu dan bentuk Paving block sendiri harus disesuaikan dengan penggunaannya agar lebih efisien, apabila diinginkan biaya perkerasan yang murah maka paving block harus lebih tebal. (3) Sebelum melakukan perhitungan estimasi biaya sebaiknya dilakukan survei pada lokasi yang akandirencanakan agar biaya yang dikeluarkan lebih ekonomis dan efisien.

Perbedaan tingkat penguasaan pokok bahasan unsur, senyawa, dan campuran antara siswa yang diajar metode eksperimen dan metode ceramah siswa kelas I cawu I SMA Negeri 1 Kediri tahun ajaran 1994/1995 / oleh Wilis Indrawati

 

Beberapa faktor yang berhubungan dengan fertilitas penduduk di kecamatan Pamarican kabupaten Ciamis Jawa Barat / oleh Lilis Hargiani Adi

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 |