Peranan Perusahaan Perseroan (Persero) P.T. Asuransi Jiwasraya" perwakilan Malang terhadap nasabah khususnya & masyarakat umumnya / oleh Rubiyanti S"

 

Usaha Desa Sumbersari Kecamatan Klojen Kodya Malang dalam meningkatkan produksi pertanian / oleh Mu'arifah

 

Tinjauan terhadap perhitungan harga pokok pada pabrik miehun Sinar Jaya Tumpang - Malang / oleh Mawahib

 

Pengaruh jenis inokulum terhadap sifat organoleptik, sifat kimia, dan aktivitas antioksidan tempe kacang komak (Lablab purpureus (L.) Sweet) / Nur Shovia

 

ABSTRAK Shovia, Nur. 2016. Pengaruh Jenis Inokulum Terhadap Sifat Organoleptik, Sifat Kimia, Dan Aktivitas Antioksidan Tempe Kacang Komak (Lablab Purpureus (L.) Sweet). Skripsi, Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Dra. Mazarina Devi, M.Si, (II) Dr. Ir. Soenar Soekopitojo, M. Si. Kata Kunci: Kacang komak, tempe, inokulum, sifat kimia, aktivitas antioksidan. Kacang komak merupakan salah satu jenis kacang-kacangan yang potensial untuk dikembangkan menjadi produk pangan fungsional. Tempe merupakan salah satu pangan fungsional yang banyak dikonsumsi di Indonesia. Penelitian ini bertujuan untuk mengetahui pengaruh jenis inokulum terhadap sifat organoleptik yaitu uji hedonik (warna, aroma, tekstur tempe kacang komak segar),dan uji hedonik (warna, aroma, rasa, dan tekstur tempe kacang komak yang telah digoreng), sifat kimia (protein dan serat kasar), serta aktivitas antioksidan tempe kacang komak. Rancangan penelitian yang digunakan adalah Rancangan Acak Lengkap (RAL) dengan tiga jenis perlakuan yaitu inokulum pasar, inokulum usar, dan inokulum LIPI dengan dua kali pengulangan. Data dianalisis menggunakan ANOVA (Analysisof Variance). Jika terdapat perbedaan antar perlakuan, maka dilanjutkan dengan uji Duncan. Hasil penelitian menunjukkan bahwa tingkat kesukaan warna, aroma, dan tekstur tempe kacang komak segar diperoleh dari inokulum pasar. Tingkat kesukaan warna, aroma, rasa, dan tekstur tempe kacang komak yang telah digoreng tertinggi diperoleh dari inokulum pasar. Kandungan protein tertinggi diperoleh dari tempe kacang komak dengan inokulum LIPI. Kandungan serat kasar tertinggi diperoleh dari tempe kacang komak dengan inokulum pasar. Aktivitas antioksidan tertinggi diperoleh dari tempe kacang komak dengan inokulum pasar. Berdasarkan hasil penelitian, rekomendasi produk tempe kacang komak terbaik diperoleh dari tempe kacang komak dengan inokulum pasar.

Usaha peningkatan produksi kopi di perkebunan PT Sri Dewi Karangnongko Blitar / oleh Sri Agustini

 

Fungsi Bank Pasar Kosgoro bagi pedagang ketjil di Pasar Klojen Malang / oleh Sulistinah

 

Marketing pabrik rokok Harmony di Bululawang / oleh Achmad Maulan

 

Produk pengembangan bahan ajar berbasis masalah pada materi keliling dan luas segitiga untuk siswa SMP kelas VII / Hena Retnowati

 

Kata kunci : bahan ajar, berbasis masalah, keliling dan luas segitiga. Salah satu aspek yang dapat membantu proses pembelajaran berbasis masalah menjadi bermakna dan tidak terkesan hanya penyampaian informasi yang dikemas dalam suatu masalah adalah penggunaan bahan ajar yang mampu mengembangkan potensi berpikir siswa secara mandiri. Kenyataan tersebut mendorong penulis untuk melakukan penelitian produk pengembangan bahan ajar berbasis masalah pada materi keliling dan luas segitiga untuk siswa SMP kelas VII. Langkah-langkah yang dilalui dalam mengembangkan bahan ajar ini adalah pendefinisian, perancangan, pengembangan, dan pendiseminasian. Dari data angket yang diberikan kepada subjek uji ahli yakni dosen pendidikan matematika UM dan guru bidang studi matematika SMPN I Kencong Jember, dapat diketahui bahwa bahan ajar yang dihasilkan tergolong sangat valid dan sesuai dengan pembelajaran berbasis masalah. Adapun karakteristik bahan ajar hasil pengembangan antara lain: bahan ajar berorientasi kepada masalah guna memahami konsep matematika, bahan yang dipilih adalah bahan yang mampu mengorganisasi siswa untuk belajar memahami konsep matematika, bahan yang dipilih memberikan bimbingan penyelidikan individual maupun kelompok guna memecahkan masalah, bahan yang dipilih mampu mengembangkan dan menyajikan hasil karya siswa guna mengkomunikasikan gagasan, dan bahan yang dipilih memberikan kesempatan kepada siswa untuk menganalisis dan mengevaluasi proses pemecahan masalah menggunakan penalaran. Meskipun secara keseluruhan bahan ajar dikatakan sangat valid namun untuk perbaikan bahan ajar produk pengembangan, pengembang tetap melakukan tahap refeleksi. Refleksi ini berupa revisi bahan ajar berdasarkan saran dan komentar dari subjek uji ahli. Fokus utama revisi ini adalah buku siswa bagian survey I yang menurut salah satu subyek uji ahli kurang mengarah pada masalah.

Implementasi bahan ajar IPA berbasis learning cycle 3E pada bahan kajian 'materi dan perubahannya' terhadap hasil belajar siswa kelas VII SMP Negeri I Kauman Tulungangung / Intan Retma Sari

 

ABSTRAK Sari, IntanRetma.2015. ImplementasiBahan Ajar IPA Berbasis Learning Cycle 3E PadaBahanKajian ‘MateridanPerubahannya’ TerhadapHasilBelajarSiswaKelas VII SMP Negeri 1 KaumanTulungagung. Skripsi, Jurusan Kimia,FakultasMatematikadanIlmuPengetahuanAlam, UniversitasNegeri Malang. Pembimbing: (I) Drs. H. Parlan, M.Si., (II) Dr. Irma K. Kusumaningrum, S.Si., M.Si. Kata kunci: Learning Cycle 3E, implementasibahan ajar, hasilbelajar, materidanperubahannya Kurikulumbaru yang mulaidiujicobakanpadabeberapasekolahadalahKurikulum 2013.Untukmengimplementasikankurikulumtersebut, telahdikembangkanbahan ajar IPA berbasisLearning Cycle 3E padabahankajian ‘materidanperubahannya’ untuksiswakelas VII SMP olehFerdiana (2014). Bahan ajar yang dikembangkanterdiriatasbuku guru danbukusiswa, dengantingkatvalidasimasing-masingsecaraberurutanadalah 83,5% dan 85%. Namunbahanajar IPA berbasisLearning Cycle 3E tersebutbelumpernahdigunakandalam proses pembelajaran. Penelitianinibertujuanuntukmengetahuiketerlaksanaan proses pembelajarandenganbahanajardanhasilbelajarsiswa yang dibelajarkandenganbahan ajar tersebut. Penelitianinimenggunakanrancangan penelitian Quasy experimental (eksperimental semu) dengan model post-test only control group designdanrancangandeskriptif.Populasi penelitian ini adalah siswa kelas VII SMP Negeri 1 KaumanTulungagung tahun ajaran 2014/ 2015 yang terdiri dari 12 kelas. Pemilihan kelas kontrol dan eksperimen dengan menggunakan teknik cluster random sampling. Kelas VII D terpilih sebagai kelas eksperimen (dibelajarkan dengan Bahan ajar berbasisLearning Cycle3E) dan kelas VII C sebagai kelas kontrol (dibelajarkan dengan model pembelajaranekspositori). Data hasil belajar kognitif siswa dianalisis secara statistik menggunakan uji-t sedangkan data keterlaksanaan proses pembelajaran, nilai ulanganhariandannilaitugas, hasil belajar afektif dan psikomotorik siswa dianalisis secara deskriptif. Hasil penelitian menunjukkan bahwa (1) keterlaksanaan proses pembelajaranLearning Cycle 3Epadakelaseksperimen(98,14%) danekspositoripadakelaskontrol(93,36%) berlangsungsangatbaik; (2) Implementasibahan ajar IPA berbasisLearning Cycle 3E efektifmeningkatkanhasilbelajarsiswa, (3) Ada perbedaan hasil belajar kognitif antara siswa yang dibelajarkan dengan bahan ajar IPA berbasisLearning Cycle 3E dan dengan model pembelajaran ekspositori, dimana nilai hasil belajar dengan bahan ajar IPA berbasisLearning Cycle 3E(x ̅= 80,16) lebihtinggidaripadasiswa yang dibelajarkandengan model pembelajaranekspositori (x ̅= 69,96); (4) Rata- rata hasilbelajarafektifsiswa yang dibelajarkandenganbahan ajar IPA berbasisLearning Cycle 3Eadalah74,3sedangkan yang dibelajarkandengan model pembelajaranekspositoriadalah69,6; (5) Hasilbelajarpsikomotoriksiswa yang dibelajarkandenganbahan ajar IPA berbasisLearning Cycle 3E adalah79,05sedangkanyang dibelajarkandengan model pembelajaranekspositorirata-ratanyaadalah74,29.

Kerajinan batik tulis tengah sawah desa Wiyoro kecamatan Ngadirojo Kabupaten Pacitan / oleh Budi Raharjo

 

Gambaran pengelolaan hutan di daerah kesatuan kerja Malang
oleh Nanik Hartati

 

Tinjauan marketing pada perusahaan saus tembakau dan wangi-wangian God Mighty" / oleh Sutarmi Sp."

 

Pengembangan pola latihan tendangan pencak silat pada teknik tentangan "T" bagi atlet Pencak Silat Persasudaraan Setia Hati Terate Cabang Blitar / Hasim Fadil Alatas

 

ABSTRAK Alatas, Hasim Fadil. 2015. Pengembangan Pola Latihan Tendangan Pencak Silat pada Teknik Tendangan “T” bagi Atlet Pencak Silat PSHT Cabang Blitar. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Dr. Dr. Eko Hariyanto, M.Pd (II) Drs. Heru Widijoto, M.S Kata Kunci: pola latihan, pencak silat, tendangan “T” Berdasarkan observasi awal yang telah dilakukan peneliti kepada atlet dan 2 orang pelatih pencak silat PSHT Cabang Blitar pada tanggal 13 Januari 2015, melalui penyebaran angket analisis kebutuhan (need assessment) didapatkan hasil sebagai berikut: atlet pencak silat PSHT Cabang Blitar menyatakan teknik tendangan “T” sulit dilakukan dalam latihan, atlet dan pelatih pencak silat PSHT setuju dikembangkan pola latihan tendangan “T” bagi atlet pencak silat, PSHT Cabang Blitar juga membutuhkan panduan dalam melaksanakan pola latihan tendangan “T” bagi atlet pencak silat dan dikemas dalam bentuk buku panduan. Penelitian ini bertujuan mengembangkan pola latihan tendangan “T” pada olahraga pencak silat dalam bentuk yang berbeda dari yang biasa dilakukan untuk latihan tendangan “T” sebelum, sesudah maupun saat latihan yaitu dengan mengembangkan pola latihan tendangan “T” bagi atlet pencak silat. Diharapkan hasil pengembangan ini bermanfaat untuk atlet pencak silat PSHT Cabang Blitar. Metode penelitian ini mengacu pada model pengembangan research and development (R&D) dari Borg dan Gall. Sedangkan analisis yang digunakan yaitu kuantitatif dan kualitatif untuk menganalisis hasil pengumpulan data dari penelitian awal (analisis kebutuhan), evaluasi ahli, uji coba kelompok kecil dan uji coba kelompok besar. Pengembangan secara keseluruhan diperoleh hasil dengan rentang skor 70-100% sehingga dapat disimpulkan bahwa pola latihan tendangan “T” bagi atlet pencak silat PSHT Cabang Blitar menarik untuk dipelajari, mudah untuk dipahami, mudah untuk dilakukan, tepat untuk dilakukan pada olahraga pencak silat, serta bermanfaat untuk atlet pencak silat PSHT Cabang Blitar. Produk yang dikembangkan berupa pola latihan yang khusus dilakukan untuk olahraga pencak silat, pelaksanaan pola latihan ini disesuaikan dengan karakteristik olah gerak tubuh pada pencak silat yang lebih banyak menggerakan gerakan teknik tendangan “T”. Pengembangan pola latihan tendangan “T” bagi atlet pencak silat PSHT Cabang Blitar yang berupa produk dan dikemas dalam buku panduan ini diharapkan dapat dijadikan alternatif latihan sebelum, sesudah maupun saat latihan dapat membantu atlet pencak silat dalam meningkatkan keterampilan tendangan teknik tendangan “T”.

Analisis perbedaan kebangkrutan (model Altman dan Springate) sebelum dan sesudah krisis global 2008 pada perusahaan manufaktur yang listing di BEI / Intan Suryaning Natalia

 

Kata kunci: Kebangkrutan, Model Altman, Model Springate. Krisis global sebenarnya diawali di Amerika, dimana dalam tahun tersebut keuangan Amerika mengalami resesi besar-besaran dan memicu kekurangan liquiditas. Hal ini berdampak pada perekonomian negara yang lain. Krisis global menimbulkan dampak bagi negara-negara lain yang berhubungan dengan Negara asal krisis (domino efek). Penelitian ini bertujuan untuk meneliti bagaimana perbedaan tingkat kebangkrutan sebelum dan sesudah krisis global mengunakan dua model perhitungan yaitu model perhitungan Altman dan Springate. Penelitian ini termasuk dalam jenis penelitian deskriptif kuantitatif. Data yang digunakan adalah data skunder dengan teknik pengumpulan dokumentasi dan studi pustaka. Teknik penentuang sampel adalah dengan sistem purposife sampling yaitu dengan menetapkan beberapa kriteria untuk menentukan data mana yang layak dijadikan sampel penelitian. Sampel dari penelitian ini adalah perusahaan perusahaan manufaktur yang berada dalam kelompok perusahaan textile mill products, apparel and other textile products, electronic and office equipment, photographic equipment. Teknik analisis data adalah analisis statistic dengan bantuan SPSS yaitu dengan uji wilcoxon. Hasil penelitian ini menunjukkan bahwa tidak ada perbedaan yang signifikan antara tingkat kebangkrutan sebelum dan sesudah krisis global 2008 yang dianalisis dengan menggunakan model Altman, demikian juga pada model Springate tidak ada perbedaan yang signifikan. Namun bila dilihat secara deskriptif terdapat perbedaan tingkat kebangkrutan antara sebelum dan sesudah krisis. Perbedaan itu disebabkan karena beberapa perusahaan memiliki kegiatan usaha yang erat hubungannya dengan negara asal krisis (Amerika Serikat). Berdasarkan hasil penelitian ini, dapat disarankan agar para investor dan kreditur dapat menggunakan perhitungan model Springate untuk menilai kinerja perusahaan. Perhitungan model ini memberikan hasil yang lebih tajam dibandingkan dengan perhitungan model Altman. Untuk penelitian berikutnya tidak perlu berpatokan pada tahun 2008. Karena tahun 2008 bukanlah tahun yang tepat untuk dijadikan titik awal terjadinyaa krisis global di Indonesia.

Administrasi dan pengelolaan Sekolah Dasar Kristen Swasta Berbantuan Merapi I Malang / oleh Marzuki Nurdin

 

An analysis of the elementary school English textbooks / by Yandri

 

Pengembangan perangkat pembelajaran bercirikan konstruktivis tipe Gagnon dan Collay pada materi statistika / Rani Puspita Rahayu

 

ABSTRAK Rahayu, Rani. Puspita. 2016. Pengembangan Perangkat Pembelajaran Bercirikan Konstruktivis Tipe Gagnon dan Collay Pada Materi Statistika. Tesis. Program Studi Pendidkan Matematika, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. I Nengah Parta, M.Si. (2) Dr. Swasono Rahardjo, M.Si. Kata kunci : Pengembangan, Perangkat Pembelajaran, Kostruktivis tipe Gagnon dan Collay, Statistika. Pengembangan kemampuan membangun suatu pengetahuan dapat dilakukan dalam proses pembelajaran dengan cara menyajikan materi tidak dalam bentuk jadi. Harus ada aktivitas siswa dalam mengaitkan pengalaman baru dengan pengalaman yang sudah ada dikerangka berfikirnya. Dengan demikian tugas utama seorang guru adalah memfasilitasi siswa agar dapat membangun sendiri pengetahuan tersebut. Pembelajaran dengan pendekatan konstruktivisme menjadi alternatif pembelajaran dimana pengetahuan dibangun secara aktif oleh individu. Pembelajaran dengan konstruktivis Tipe Gagnon dan Collay dipilih karena secara teoritis maupun empiris mampu membantu siswa dalam membangun pengetahuannya. Plomp (2010) dipilih sebagai model pengembangan perangkat pembelajaran yang terdiri dari tiga tahap yaitu penelitian awal, pembuatan prototipe, dan penilaian. Perangkat pembelajaran yang akan dikembangkan adalah rencana pelaksanaan pembelajaran (RPP) dan lembar kegiatan siswa (LKS) bercirikan konstruktivis tipe Gagnon dan Collay. Instrumen penelitian yang dikembangkan untuk menilai kualitas dari perangkat pembelajaran antara lain: (1) lembar observasi aktivitas guru, (2) lembar observasi aktivitas siswa, (3) angket respon siswa, (4) tes penguasaan bahan ajar, (TPBA) dan (5) lembar validasi. Perangkat pembelajaran yang disusun harus memenuhi kriteria valid, praktis, dan efektif. Kevalidan produk dinilai berdasarkan hasil validasi sedangkan kepraktisan dan keefektifan produk dinilai dari hasil uji coba. Hasil validasi dari dua validator menunjukkan bahwa perangkat dan instrumen memenuhi kriteria valid. Berdasarkan uji coba lapangan pada 32 siswa kelas VII I SMPN 2 Malang, aktivitas guru masuk kategori baik sehingga perangkat pembelajaran yang dikembangkan memenuhi kriteria praktis. Perangkat pembelajaran yang dikembangkan memenuhi tiga indikator efektifitas, yaitu aktivitas siswa masuk kategori baik, ketuntasan belajar klasikal tercapai, dan respon siswa positif. Dalam hal ini perangkat pembelajaran yang dikembangkan efektif. Penerapan perangkat pembelajaran yang dikembangkan memberikan dampak pada peningkatan kemampuan siswa dalam membangun pengetahuan untuk setiap elemen konstruktivis tipe Gagnon dan Collay, keaktifan siswa di kelas, pemahaman materi terutama pada materi statistika dan motivasi belajar siswa.

Pembelajaran perkalian dan pembagian bilangan cacah dengan bantuan kalkulator pada siswa kelas II Madrasah Ibtidaiyah Abadiyah 2 Kotamadya Palembang / oleh Rusdy A.S.

 

Kajian pengaruh pemberian remidi terhadap pemahaman konsep entalpi reaksi siswa kelas II SMU Negeri Pasirian Kabupaten Lumajang tahun ajaran 1998-1999 / oleh Sriwigatiningsih

 

Pengaruh ekstrak tapak dara (Catharanthus roseus) terhadap pergerakan kromoson dan ingresi membran sel selama sitokinesis spermatosit I belalang (Gesonia mundata) /oleh Moh. Syaifuddin

 

Pengembangan media pembelajaran fisika berbasis multimedia dengan menggunakan swishmax 4 untuk membantu meningkatkan pemahaman konsep cahaya pada siswa SMP / Shokhibul Huda

 

Faktor-faktor erosi di sub daerah aliran sungai Lesti yang berpengaruh terhadap pangkalan bendungan Sengguruh di Kecamatan Kepanjen Kabupaten Malang / oleh Minto Wahyudi

 

Developing teaching materials based on a proposed English listening comprehension syllabus for secretary academy students / by Tuti Hartani

 

Pengaruh konsentrasi HCl dan lama pemanasan terhadap kadar glukosa yang dihasilkan pada hidrolisis pati dalam onggok / oleh Iffatur Rifkiyyah

 

Penerapan pendekatan sains teknologi masyarakat untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Kebonsari 4 Kota Malang / Windra Septi Mulyanti

 

Kata Kunci : Pendekatan Sains Teknologi Masyarakat, Aktivitas Belajar, Hasil Belajar Pembelajaran IPA di SD menekankan pemberian pengalaman belajar langsung melalui penggunaan dan pengembangan keterampilan proses dan sikap ilmiah. Pendekatan STM merupakan cara pandang bahwa siswa belajar, menyusun pengetahuan, melalui interaksi pribadi antara pengalaman dengan skema pengetahuannya Berdasarkan hasil observasi dalam pembelajaran IPA kelas III SDN Kebonsari 4 Kota malang dapat disimpulkan bahwa 1) guru kurang kreatif dalam menerapkan pendekatan pembelajaran, 2) media pembelajaran dan sumber belajar kurang variatif dan inovatif, 3) dalam skenario kegiatan pembelajaran keaktifan siswa kurang nampak dan 5) kepedulian siswa terhadap masyarakat dan lingkungannya rendah. Tujuan penelitian ini adalah mendeskripsikan penerapan pendekatan STM pada pembelajaran IPA, dan peningkatan aktivitas dan hasil belajar melalui penerapan pendekatan STM pada pembelajaran IPA kelas III SDN Kebonsari 4 Kota Malang. Penelitain ini menggunakan pendekatan PTK. Tahapan penelitian ini meliputi perencanaan, pelaksanaan, pengamatan, dan refleksi. Waktu penelitian bulan Pebruari sampai dengan Mei 2011 semester 2 tahun pelajaran 2010/2011. Sasaran penelitian ini adalah siswa kelas III SDN Kebonsari 4 Kota Malang sejumlah 40 siswa yang terdiri dari siswa laki-laki 19 dan siswa perempuan 21. Teknik-teknik yang digunakan dalam pengumpulan data adalah observasi, wawancara, dan dokumentasi Hasil penelitian ini adalah pada siklus-1 rerata aktivitas belajar mencapai 6,68 dan siklus-2 mencapai 7,83 yang berarti meningkat sebesar 1,15. Sedangkan pada siklus-1 rerata hasil belajar mencapai 7,24 dan siklus-2 mencapai 8,11 yang berati meningkat 0,87. Ketuntasan pada siklus-2 mencapai 100%. Penerapan pendekatan sains teknologi masyarakat dapat meningkatkan aktivitas dan hasil belajar siswa pembelajaran IPA pada kelas III di SDN Kebonsari 4 kota Malang. Dengan demikian disarankan kepada guru hendaknya menerapkan pendekatan sains teknologi masyarakat khususnya dalam mata pelajaran IPA. Karena dapat menumbuhkan keceriaan dan antusiasme siswa dalam belajar. Bagi peneliti lain, dapat dijadikan bahan pertimbangan dan acuan dalam penelitian selanjutnya.

Pengembangan modul pembelajaran tata busana standar kompetensi membuat busana bayi untuk Sekolah Menengah Kejuruan kelas X / Fitriasih Pudyo Atmaningrung

 

Kata kunci: Spektrum, Sekolah Menengah Kejuruan, Modul, Membuat Busana Bayi. Pesatnya perkembangan dunia usaha/dunia industri, menjadi salah satu alasan pemerintah untuk kembali melakukan penyempurnaan kurikulum pada tahun 2008 dengan dikeluarkannya Spektrum Keahlian Pendidikan Menengah Kejuruan yang baru dan diberlakukan pada tahun pelajaran 2008/2009 mulai kelas X. Berdasarkan spectrum terbaru, terdapat perubahan nama-nama program pendidikan SMK. Perubahan yang terjadi salah satunya adalah diberlakukannya nama standar kompetensi baru yaitu membuat busana bayi. Bahan ajar membuat busana bayi masih sangat terbatas, kalaupun ada, belum disesuaikan dengan standar kompetensi, kompetensi dasar dan tujuan intruksional yang ingin dicapai. Penelitian ini membahas tentang pengembangan bahan ajar berupa modul pembelajaran membuat busana bayi untuk SMK Kelas X semester 1 yang dapat digunakan selama 1 semester. Sekolah yang menjadi acuan pada penyusunan modul adalah SMKN 3 Malang. Modul terdiri dari 9 kegiatan belajar yaitu : kegiatan belajar 1 tentang pengetahuan dasar mengenai busana bayi, kegiatan belajar 2 tentang pembuatan popok bayi, kegiatan belajar 3 tentang pembuatan gurita bayi, kegiatan belajar 4 tentang pembuatan kemeja bayi, kegiatan belajar 5 tentang pembuatan sepatu bayi, kegiatan belajar 6 tentang pembuatan topi bayi, kegiatan belajar 7 tentang pembuatan celana popok bayi, kegiatan belajar 8 tentang pembuatan cape bayi, dan kegiatan belajar 9 (pengayaan) tentang pembuatan jaket bayi. Modul yang dikembangkan melalui tahap tinjauan ahli dan preliminary field test (uji coba terbatas). Draft modul ditinjau oleh 4 orang ahli yaitu 1 orang ahli isi/materi, 2 orang ahli media(modul), dan seorang ahli bahasa. Aspek penilaian terdiri dari beberapa indikator dan beberapa butir pertanyaan berupa angket dengan menggunakan ratingscale. Hasil tinjauan ahli isi/materi adalah 92,62% artinya draft modul yang dikembangkan valid; hasil tinjauan ahli media (modul) adalah 85,53% artinya draft modul yang dinyatakan valid; dan hasil tinjauan ahli bahasa adalah 91,17% artinya draft modul yang dikembangkan valid. Berdasarkan kriteria hasil tinjauan ahli draft modul dinyatakan valid tidak perlu dilakukan revisi sehingga dapat dijadikan sebagai produk modul, namun dikarenakan ada beberapa tanggapan dari para ahli maka penulis melakukan revisi pada draft modul yang dikembangkan. Produk modul kemudian diujicobakan melalui uji coba perseorangan dengan melibatkan 3 orang guru tata busana SMKN 3 Malang dan uji coba kelompok kecil dengan melibatkan 9 orang peserta didik di SMKN 3 Malang. Aspek penilaian pada uji coba modul adalah aspek keterbacaan. Masing-masing aspek terdiri dari beberapa indikator dan beberapa butir pertanyaan berupa angket dengan menggunakan ratingscale. Hasil uji coba perorangan adalah 93,01% dan hasil uji coba kelompok kecil adalah 85,77% artinya penilaian untuk aspek keterbacaan modul dinyatakan valid dan sesuai untuk digunakan dalam kegiatan belajar mengajar. Berdasarkan hasil persentase validasi dan uji coba, maka disimpulkan bahwa modul yang dikembangkan valid sehingga sesuai untuk digunakan sebagai bahan ajar dalam kegiatan belajar mengajar. Berdasarkan hasil penelitian ini, disarankan agar penelitian ini dilanjutkan pada tahapan penelitian lanjutan melalui kajian eksperimen dan uji coba yang lebih luas.

Penentuan kadar sianida pada air limbah pelapisan emas secara argentometri di pasar besar Kodya Malang / oleh Lusia Andriani

 

Kajian tentang alat evaluasi yang dibuat guru dan penyusunan model pengembangan alat evaluasi berdasarkan keterampilan proses untuk mata pelajaran biologi SMU / oleh Karyatin

 

Kata kunci: inkuiri terbimbing berbasis laboratorium, keterampilan proses IPA, hasil belajar. Dalam proses belajar siswa selain dilibatkan melalui proses berpikir ilmiah juga dilibatkan dalam proses bekerja secara ilmiah. Kegiatan belajar yang dapat memberi seluruh pengalaman belajar kepada siswa adalah belajar melalui penemuan (inkuiri) dan hal tersebut dilatihkan kepada siswa dengan proses bekerja secara ilmiah untuk meningkatkan pemahaman serta keterampilan proses IPA siswa. Kegiatan belajar yang terpusat pada laboratorium (laboratory based inquiry) juga memiliki potensi untuk membangun konsep belajar siswa, meningkatkan pemahaman konseptual, dan pemahaman tentang sifat Ilmu Pengetahuan Alam (IPA). Hasil studi pendahuluan dengan teknik wawancara, dokumentasi, dan observasi pada siswa kelas VIII.4 di SMP Negeri 1 Probolinggo menemukan beberapa permasalahan. Diantaranya adalah; 1) kurangnya keterlibatan siswa dalam proses merancang kegiatan percobaan, sehingga keterampilan proses IPA dan hasil belajar rendah, 2) terdapat sekitar 20% - 25% siswa kelas IX yang harus mengikuti ujian praktek ulang/remidial, 3) setiap kelas terdapat 25% - 30% hasil belajar siswa yang belum mencapai KKM 76, 4) kegiatan mempelajari materi pembelajaran belum melibatkan siswa secara aktif, sehingga sebagian besar siswa menganggap pelajaran biologi sebagai hafalan. Penelitian ini merupakan penelitian tindakan kelas (PTK) yang dilaksanakan dalam dua siklus. Masing-masing siklus terdiri dari empat kali pertemuan dengan alokasi waktu masing-masing pertemuan 2x40 menit. Pengumpulan data dilakukan dengan teknik observasi, tes hasil belajar, dokumentasi, dan catatan lapangan yang dilaksanakan mulai tanggal 20 September sampai 21 Nopember 2012. Subyek yang diteliti adalah siswa kelas VIII.4 di SMP Negeri 1 Probolinggo tahun pelajaran 2012-2013 yang berjumlah 28 siswa. Hasil penelitian menunjukkan bahwa pembelajaran inkuiri terbimbing yang berbasis kegiatan laboratorium melalui penerapan keterampilan proses IPA pada kelas VIII.4 di SMP Negeri 1 Probolinggo tahun pelajaran 2012-2013 mengalami peningkatan dalam pelaksanaannya. Persentase keterlaksanaan yang diperoleh sebesar 93,75% pada siklus I meningkat menjadi 96,00% pada siklus II. Persentase keterlaksanaan pada siklus I dan siklus II ini termasuk dalam kriteria sangat baik. Hasil penelitian juga menunjukkan bahwa pembelajaran inkuiri terbimbing berbasis kegiatan laboratorium dapat meningkatkan keterampilan proses IPA dan hasil belajar IPA(biologi) siswa kelas VIII.4 di SMP Negeri 1 Probolinggo. Peningkatan keterampilan proses IPA siswa didasarkan pada meningkatnya rata-rata persentase seluruh aspek keterampilan proses IPA siswa sebesar 75,75% dengan kriteria baik pada siklus I menjadi 87,92% pada siklus II dengan kriteria sangat baik. Meningkatnya hasil belajar IPA (biologi) siswa dapat diketahui berdasarkan peningkatan nilai rata-rata sebesar 75,00 pada siklus I dan meningkat menjadi 79 pada siklus II. Berdasarkan hasil penelitian yang telah dilaksanakan, saran-saran yang dapat disampaikan antara lain adalah: 1) pembelajaran inkuiri terbimbing berbasis kegiatan laboratorium dapat digunakan sebagai alternatif model pembelajaran oleh guru terutama mata pelajaran IPA, 2) guru pada proses pelaksanaan pembelajaran inkuiri terbimbing berbasis kegiatan laboratorium merencanakan pengelolaan waktu dengan baik, dan 3) pembelajaran inkuiri terbimbing berbasis kegiatan laboratorium melalui penerapan keterampilan proses IPA dapat dilaksanakan pada materi biologi yang lain.

Pengaruh pola asuh orang tua dan modernitas individu terhadap pemahaman dasar ekonomi (economic literacy) siswa kelas XII Sosial SMA Negeri 5 Malang tahun ajaran 2010/2011 / Binti Rohmatul Laela

 

Kata kunci: pola asuh orang tua, modernitas individu, pemahaman dasar ekonomi siswa (Economic Literacy). Kesibukan orang tua dalam bekerja mengakibatnya terpecahnya perhatian orang tua terhadap anak. Konsekuensi yang ada menjadikan anak sebagai prioritas kedua setelah prioritas bekerja. Kondisi tersebut akan berpengaruh terhadap kasih sayang dan perhatian yang dicurahkan orang tua terhadap anak. Di sudut pandang lain, perkembangan zaman yang semakin modern yang ditandai dengan berkembangnya ilmu dan pengetahuan ( IPTEK) menuntut anak untuk aktif dan dinamis dalam mengikuti perkembanngnya. Landasan untuk mengetahui prestasi belajar tercermin dalam pemahaman dasar ekonomi (Economic Literacy) siswa pada mata pelajaran ekonomi. Tujuan penelitian ini adalah untuk: a) mendeskripsikan pengaruh antara pola asuh orang tua dengan pemahaman dasar ekonomi (Economic Literacy) siswa, b) mendeskripsikan pengaruh antara modernitas individu dengan pemahaman dasar ekonomi (Economic Literacy) siswa, c) mendeskripsikan pengaruh antara pola asuh orang tua dan modernitas individu dengan pemahaman dasar ekonomi (Economic Literacy) siswa. Variabel bebas penelitian ini terdiri dari pola asuh orang tua dan modernitas individu sedangkan variabel bebasnya pemahaman dasar ekonomi siswa (Economic Literacy). Rancangan penelitian yang digunakan adalah deskriftif korelasional. Penelitian ini merupakan penelitian populasi yang mengambil semua populasi sebagai sampel yaitu sebanyak 73 anak. Penelitian ini menggunakan analisis regresi berganda untuk melihat pengaruh parsial maupun simultan pola asuh dan modernitas individu terhadap pemahaman dasar ekonomi (Eonomic Literacy) siswa kelas XII Sosial SMA Negeri 5 Malang Tahun Ajaran 2010/2011. Hasil penelitian menunjukkan bahwa sumbangan efektif pola asuh orang tua (X1) terhadap pemahaman dasar ekonomi (Y) sebesar 26,56%, sedangkan sumbangan efektif modernitas individu siswa (X2) terhadap pemahaman dasar ekonomi (Economic Literacy) sebesar 24,9%. Berdasarkan hasil penelitian dapat disimpulkan pula bahwa terdapat terdapat pengaruh positif yang signifikan secara parsial pola asuh orang tua terhadap pemahaman dasar ekonomi (Economic Literacy), terdapat pengaruh positif yang signifikan secara parsial modernitas individu terhadap pemahaman dasar ekonomi (Economic Literacy), terdapat pengaruh positif yang signifikan secara simultan pola asuh dan modernitas individu terhadap pemahaman dasar (Economic Literacy) ekonomi pada siswa kelas XII Sosial SMA Negeri 5 Malang tahun ajaran 2010/2011.

Keterisolasian siswa sebagai permasalahan dalam bimbingan dan konseling / oleh H. Kulasse Kanto

 

Upaya mengatasi kesulitan siswa dalam menyelesaikan soal cerita tentang teorema pythagoras di kelas II SLTP Negeri 03 Malang
oleh Haryanti

 

ABSTRAK Haryanti2. 002.U pa1,aM engatasKi esulitanS iswuD ulamM enyelesaikaSno alC .erita T'entan\g'e otvmuI' ylltugorusD i KclusI l fl"1'l' Negcri0 3 Mulung.S kripsi, Jurusan Pendidikan Matematika !N4lPA Universitas Negeri Malang. Pembimbin(gI) Drs.G atotM uhsetyoN, {.Sc(,l I) Drs.S udirmanM, .Si. Kata kunci: mengatasi kesulitan, kalimat rnatematika, soal cerita, pemecahan masalah Banyak sisrvay ang mengalamki esulitand alamr nenyelesaikasno alc erita tentangte oremaP ythagorasD. alam upayam engataski esulitant ersebutd igunakan strategpi emecahanm asalah. Pendekatayna ngd igunakand alamp enelitianin i adalahp endekataknu alitatif denganjenipse nelitianti ndakanp artisipanS. ubyekp enelitianin i terdjrid ari empat siswak elaslI SLTPN0 3 Malang.P engambilasnu byekp enelitiand idasarkapna da( 1) kesalahasni swap adat es awal, (2) hasil pertimbangand ari guru kelasd an peneliti. Adapunp engumpuland atanyad ilakukand enganc ara (l) pemberiant es awal, (2) mengolahh asil tes awal, (3) wawancarak epadak eempats ubyek penelitan,( 4) pemberiatnin dakand an( 5) pemberiante sa khir. Hasil penelitian ini antara lain (l) dapat diketahui letak kesulitan yang dialamis iswad alam menyelesaikasno al cerita tentangt eorenraP ythagorads an (2) gambaran penggunaan strategi pemecahan masalah dalam membantu siswa menyelesaikasno alc eritat entangte oremaP yhagora

Developing reading comprehension materials for graduate students of the State University of Malang / by Takariwati Halim

 

Implementasi model pembelajaran problem based learning untuk meningkatkan aktivitas dan hasil belajar siswa (studi pada siswa kelas X Pemasaran A1 mata pelajaran melakukan negosiasi tahun ajaran 2010/2011 di SMK PGRI 3 Malang) / Galuh Ayu Pranesthi

 

Kata kunci : Problem Based Learning (PBL), aktivitas belajar, hasil belajar siswa Berdasarkan studi pendahuluan yang dilakukan di SMK PGRI 3 Malang diketahui beberapa hambatan kegiatan pembelajaran pada kelas X Pemasaran A1 Mata Pelajaran Melakukan Negosiasi. Hambatan yang ditemui antara lain siswa yang kurang fokus pada pelajaran, sulitnya siswa untuk mengkaitkan materi pelajaran dengan masalah di dunia nyata dan nilai ulangan harian siswa banyak yang belum mencapai KKM (Kriteria Ketuntasan Minimal). Rendahnya aktivitas siswa dalam proses belajar mengajar yang ditunjukkan dari dominasi yang banyak dari guru, menyebabkan minimnya interaksi siswa dengan siswa maupun siswa dengan guru di dalam proses pembelajaran. Dengan menggunakan strategi pembelajaran Problem Based Learning diharapkan siswa dapat mengikuti pelajaran-pelajaran yang ada di kelas dan juga dapat meningkatkan hasil belajar siswa. Rumusan masalah dalam penelitian ini adalah: (1) Bagaimana implementasi model Pembelajaran Problem Based Learning pada siswa kelas X Pemasaran A1 mata pelajaran melakukan negosiasi tahun ajaran 2010/2011 di SMK PGRI 3 Malang? (2) Apakah implementasi model Pembelajaran Problem Based Learning dapat meningkatkan aktivitas belajar siswa kelas X Pemasaran A1 mata pelajaran melakukan negosiasi tahun ajaran 2010/2011 di SMK PGRI 3 Malang? (3) Apakah implementasi model Pembelajaran Problem Based Learning dapat meningkatkan hasil belajar siswa kelas X Pemasaran A1 mata pelajaran melakukan negosiasi tahun ajaran 2010/2011 di SMK PGRI 3 Malang? (4) Apakah yang menjadi faktor penghambat dan pendukung proses implementasi model Pembelajaran Problem Based Learning pada siswa kelas X Pemasaran A1 mata pelajaran melakukan negosiasi tahun ajaran 2010/2011 di SMK PGRI 3 Malang? Jenis Penelitian ini adalah Penelitian Tindakan Kelas yang dilakukan dalam 2 siklus. Setiap siklus terdiri dari 3 kali pertemuan dengan alokasi waktu setiap pertemuan 2 x 45 menit. Pada tiap siklus terdiri dari 4 tahap yaitu perencanaan, pelaksanaan, observasi dan refleksi. Subyek dalam penelitian ini adalah siswa kelas X Pemasaran A1 SMK PGRI 3 Malang yang berjumlah 29 siswa. Terdiri dari 4 siswa laki-laki dan 25 siswa perempuan. Pengumpulan data dilakukan dengan observasi, wawancara, tes, dokumentasi dan catatan lapangan. Analisis data dilakukan melalui reduksi data, display data dan penarikan kesimpulan. ii Hasil penelitian menunjukkan bahwa siswa lebih bersemangat dan antusias dalam mengikuti pembelajaran Problem Based Learning. Implementasi model pembelajaran Problem Based Learning pada mata pelajaran produktif Melakukan Negosiasi, siswa kelas X Pemasaran A1 di SMK PGRI 3 Malang ini, terbukti dapat meningkatkan aktivitas dan hasil belajar siswa. Hal ini ditunjukkan adanya peningkatan aktivitas siswa dari Siklus I ke Siklus II. Peningkatan ketuntasan belajar siswa pada ranah kognitif Siklus I sebesar 72,41% meningkat pada Siklus II menjadi 96,55%. Pada hasil belajar ranah afektif Siklus I ketuntasan belajar siswa sebesar 93,1% meningkat menjadi 100% pada Siklus II. Sedangkan hasil belajar siswa ranah psikomotor pada Siklus I sebesar 31,04 meningkat pada Siklus II menjadi 93,1%. Faktor yang menghambat adalah jumlah observer yang terbatas, artinya 1 observer mengamati 2 kelompok siswa, rendahnya rasa percaya diri siswa dan interaksi antar siswa dalam 1 kelas masih kurang. Adapun faktor yang mendukung adalah sarana dan prasarana serta kemampuan guru untuk menciptakan suasana belajar yang kondusif. Saran yang diberikan dalam penelitian ini adalah Pada tahap observasi, diperlukan instrumen penelitian yang dapat merekam setiap kegiatan penelitian misalnya selain menggunakan lembar observasi juga menggunakan handycamp. Untuk mendapatkan peningkatan hasil belajar siswa secara signifikan, peneliti memberikan saran kepada peneliti berikutnya untuk memberikan jumlah soal tes lebih dari 5 butir soal. Proses bimbingan intensif oleh peneliti untuk memotivasi siswa dalam hal mencari jawaban atas pertanyaan dan pentingnya bekerja sama dalam kelompok sangat menentukan keberhasilan pembelajaran dalam hal meningkatkan aktivitas siswa. Untuk lebih memaksimalkan observasi aktivitas siswa apabila memungkinkan setiap kelompok diamati oleh 1 orang observer dan hendaknya penelitian dilakukan bukan hanya pada mata pelajaran Melakukan Negoisasi, tetapi juga pada mata pelajaran lain yang relevan.

Studi kemelimpahan dan keanekaragaman decapoda di hutan mangrove laguna Segara Anak Taman Nasional Alas Purwo Banyuwangi / oleh Sulistyowati

 

Hubungan antara imaginary audience (penonton khayalan) dengan body image (citra tubuh) pada remaja putri / Mia Fitriani

 

Kata Kunci: imaginary audience, body image Imaginary audience adalah keyakinan remaja bahwa orang lain memperhatikan dirinya sebagaimana halnya dengan dirinya sendiri. Body image adalah gambaran yang dibuat seseorang mengenai tubuhnya. Body image bukanlah sesuatu yang bersifat tetap, melainkan dapat berubah-ubah akibat berbagai hal salah satunya media massa. Dengan semakin maraknya pesan-pesan yang disampaikan oleh media massa serta tekanan-tekanan yang berasal dari lingkungan di sekitarnya mengenai citra ideal tertentu akan menyebabkan remaja semakin memusatkan perhatiannya pada dirinya sendiri untuk mencapai citra ideal tersebut. Dalam keyakinannya bahwa ia memiliki penonton yang terus menerus mengamatinya, maka cacat sekecil apapun akan menyebabkan remaja menjadi semakin mengkhawatirkan penampilannya. Tujuan penelitian ini adalah untuk mengetahui: (1) imaginary audience pada remaja putri, (2) body image pada remaja putri, (3) hubungan antara imaginary audience dengan body image pada remaja putri. Penelitian dilakukan di SMKN 3 Malang dengan jumlah subyek penelitian sebanyak 58 orang. Rancangan penelitian yaitu penelitian deskriptif korelasional dengan teknik pengambilan sampel purposive sampling. Instrumen penelitian menggunakan skala NIAS (New Imaginary Audience Scale) dan skala body image. Data yang terkumpul dianalisa dengan teknik analisis korelasi rank Spearman. Hasil penelitian menunjukkan: (1) terdapat 5,17% siswi dengan imaginary audience sangat tinggi, 50% siswi dengan imaginary audience tinggi, 43,1% siswi dengan imaginary audience rendah, 1,72% siswi dengan imaginary audience sangat rendah; (2) 3,45% siswi dengan body image sangat tinggi, 51,72% siswi dengan body image tinggi, 44,83% dengan body image rendah, (3) dari hasil uji korelasi diperoleh r sebesar 0,630 (p=0,000<0,05), berarti ada hubungan positif antara imaginary audience dengan body image pada siswi kelas X SMKN 3 Malang. Semakin tinggi tingkat imaginary audience diikuti oleh semakin tinggi pula tingkat body image. Berdasarkan hasil penelitian adabeberapa saran, yaitu: (1) remaja putri diharapkan untuk tidak hanya memusatkan perhatian pada penampilan fisiknya dan lebih menggali potensi-potensi positif yang dimilikinya. (1) Orangtua dan sekolah diharapkan dapat memberikan dorongan dan dukungan kepada para remaja putri untuk lebih mengembangkan potensi-potensi positif lain dari remaja putri. (3) Peneliti lain disarankan untuk lebih memperluas variabel-variabel penelitian dan subyek penelitian.

Rhetorical patterns as reflected in argumentative discourse in The Jakarta Post articles / by Susilo

 

Tanggapan dan kesiapan guru fisika terhadap penambahan meteri bumi dan antariksa pada pelajaran fisika di SMU Negeri dan swasta se Kodya Malang berdasarkan kurikulum SMU 1994 / oleh Suparmi

 

Hubungan antara perilaku diet untuk penurunan berat badan dengan percaya diri pada remaja putri di Universitas Negeri Malang / Verry Kurnia Indah

 

Kata kunci: perilaku diet, penurunan berat badan, percaya diri. Saat ini banyak remaja putri yang sangat mendambakan tubuh ideal seperti para model yang sering tampil di media cetak maupun media elektronik dengan melakukan perilaku diet demi turunnya berat badan. Tujuan penelitian ini adalah untuk mengetahui: (1) tingkat perilaku diet untuk penurunan berat badan, (2) tingkat percaya diri, (3) hubungan antara perilaku diet untuk penurunan berat badan dengan percaya diri pada remaja putri di Universitas Negeri Malang. Desain yang digunakan adalah deskriptif dan korelasional dengan subyek sebanyak 90 mahasiswi UM yang ditentukan dengan teknik Quota Sampling. Data perilaku diet untuk penurunan berat badan dikumpulkan dengan skala perilaku diet untuk penurunan berat badan (koefisien validitas item antara 0,312 sampai 0,748 dan koefisien relibialitas Alpha Cronbach 0,718), dan data percaya diri dikumpulkan dengan skala percaya diri (koefisien validitas item antara 0,288 sampai 0,668 dan koefisien reliabilitas Alpha Cronbach 0,709). Hasil analisis deskriptif menunjukkan bahwa tingkat perilaku diet untuk penurunan berat badan sebanyak 6 orang (7%) termasuk dalam kategori sangat tinggi, 47 orang (52%) termasuk kategori tinggi, 31 orang (34%) termasuk kategori rendah dan 6 orang (7%) termasuk kategori sangat rendah. Sedangkan tingkat percaya dirinya menunjukkan sebanyak 0 orang (0%) termasuk kategori sangat tinggi, 42 orang (47 %) termasuk kategori tinggi, 43 orang (48%) termasuk kategori rendah, 5 orang (6%) termasuk kategori sangat rendah. Hasil penelitian kemudian dianalisis menggunakan teknik Korelasi Product Moment yang hasilnya menunjukkan bahwa terdapat hubungan negatif antara perilaku diet untuk penurunan berat badan dengan percaya diri (rxy = -0,268 sig = 0,028 < 0,05). Artinya, semakin tinggi perilaku diet untuk penurunan berat badan maka semakin rendah tingkat percaya dirinya, sebaliknya semakin rendah perilaku diet untuk penurunan berat badan maka semakin tinggi tingkat percaya dirinya. Berdasarkan hasil penelitian ini, disarankan bagi remaja putri untuk dapat mengontrol dan mengendalikan dorongan dari lingkungan maupun dari dirinya sendiri yang bersifat negatif serta membekali diri dengan pengetahuan terhadap bahaya kesehatan jika melakukan perilaku diet untuk penurunan berat badan yang salah. Untuk meningkatkan rasa percaya diri, remaja putri hendaknya mampu mengubah cara pandang dan selalu berpikir positif terhadap bentuk tubuhnya sendiri.

Proses kreatif siswa dalam menulis puisi / Yuli Dwi Pratiwi

 

ABSTRAK Pratiwi, Yuli Dwi. 2016. Proses Kreatif Siswa dalam Menulis Puisi. Tesis, Program Studi Pendidikan Bahasa Indonesia, Pascasarjana, Universitas Negeri Malang, Pembimbing (I) Prof. Dr. Maryaeni, M.Pd, (II) Prof. Dr. Heri Suwignyo, M.Pd Kata Kunci: proses kreatif, menulis puisi Kreativitas siswa dalam menulis puisi tampak pada proses kreatif dan hasil karyanya. Penelitian ini didasarkan kreativitas siswa dalam menulis puisi kurang menjadi perhatian. Penelitian ini mendeskripsikan proses kreatif siswa dalam penulisan teks puisi dan kreativitas siswa dalam teks puisi. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Kehadiran peneliti dibutuhkan selama proses wawancara. Lokasi penelitian di SMA Negeri 03 Malang. Subjek penelitian lima orang siswa dan karya puisinya. Sumber data berupa proses kreatif siswa dan teks puisi karya siswa. Data berupa aktivitas siswa yang mencerminkan proses kreatif dalam menulis puisi dan kata-kata kreatif yang terdapat dalam puisi karya siswa. Pengumpulan data dilakukan dengan teknik wawancara dan studi dokumen. Instrumen yang digunakan adalah panduan pengumpulan data dan panduan analisis data. Analisis data dilakukan dalam beberapa tahap, seleksi dan reduksi data, analisis data, penyajian data, dan penarikan kesimpulan. Pengecekan keabsahan data dilakukan dengan teknik ketekunan pengamatan dan triangulasi. Dari hasil analisis data diperoleh dua kesimpulan. Pertama, tahap pencarian ide yang dilakukan kelima subjek secara umum yaitu mendengarkan musik. Tahap pengendapan dan perenungan ide, yang dilakukan oleh kelima subjek adalah membuat catatan terlebih dahulu. Tahap penulisan, tiga dari lima subjek menulis puisi secara bertahap. Tahap editing dan revisi, kelima subjek mempertentangkan apa yang ditulis dan mengubah gaya bahasa. Kedua, puisi yang ditulis oleh (S-01) menggunakan penyimpangan leksikal, sintaksis, semantis, register, dan grafologis, dengan penyimpangan semantis yang menonjol. Puisi yang ditulis oleh (S-02) menggunakan penyimpangan leksikal, semantis, grafologis, dengan penyimpangan semantis dan leksikal yang menonjol. Puisi yang ditulis oleh (S-03) menggunakan penyimpangan leksikal, semantis, morfologis, sintaksis, dialek, grafologis, dengan penyimpangan semantis yang menonjol. Puisi yang ditulis oleh (S-04) menggunakan penyimpangan semantis, morfologis, dan grafologis, dengan penyimpangan semantis yang menonjol. Puisi yang ditulis oleh (S-05) menggunakan penyimpangan morfologis, sintaksis dan grafologis, dengan penyimpangan sintaksis yang menonjol. Berdasarkan kesimpulan penelitian, disarankan kepada guru Bahasa Indonesia untuk memberi stimulus pada siswa dalam pencarian ide sebelum menulis puisi dan memberikan contoh penyimpangan bahasa dalam puisi yang lebih beragam. Saran kepada peneliti selanjutnya agar mengembangkan berbagai metode untuk meningkatkan kreativitas siswa dalam menulis puisi.

Tinjauan kontinuitas dan gerak maju tujuan pembelajaran biologi dalam GBPP kurikulum 1993 jenjang pendidikan dasar dan menengah umum / oleh Wiwik Cutiani

 

Beberapa masalah mengenai pendaftaran hak milik atas tanah
(suatu studi di Desa Kenongo Kecamatan Tulangan Kabupaten Sidoarjo)
oleh Surya Ardyatna

 

Efektivitas penggunaan LKS dengan praktikum dan penggunaan LKS tanpa praktikum terhadap prestasi belajar fisika pokok bahasan elastisitas siswa kelas I SMUN I Gedeg Kabupaten Mojokerto / oleh Dyah Rahayu Hariyati

 

Manajemen persediaan pada perusahaan sanitair Eko Putra Malang
oleh Yudi Agus Kurniawan

 

Pengaruh pemberian tes mingguan dengan pendekatan induktif terhadap penguasaan konsep mekanika siswa SMPN 2 Kalitidu Bojonegoro / oleh Suhadi

 

Pemutusan hubungan kerja (PHK) dalam konteks kesejahteraan ekonomis masyarakat di Kecamatan Bululawang Kabupaten Malang
oleh Solfi Mas'amah

 

Pengembangan E-module materi pelatihan teknik analisis potensi wilayah dan agroekosisten berorientasi agribisnis di Balai Besar Pelatihan Peternakan (BBPP) Songgoriti Kota Batu / Ayu Dwi Wahyu Saputri

 

Dwi Wahyu Saputri, Ayu. 2012. Pengembangan E-Module Materi Pelatihan Teknik Analisis Potensi Wilayah dan Agroekosisten Berorientasi Agribisnis di Balai Besar Pelatihan Peternakan (BBPP) Songgoriti Kota Batu. Skripsi, Jurusan Teknologi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Henry Praherdiono, S. Si, M.Pd, (II) Arafah Husna, S. Pd., M.Med.Kom. Kata kunci: E-modul, Pelatihan Teknik Analisis Potensi Wilayah dan Agroekosisten Berorientasi Agribisnis. Penelitian ini merupakan penelitian pengembangan menghasilkan e-module pada mata pelatihan Teknik Analisis Potensi Wilayah dan Agroekosisten Berorientasi Agribisnis di Balai Besar Pelatihan peternakan (BBPP) Songgoriti Kota Batu. Tujuan dari penelitian ini adalah untuk mengetahui kelayakan/kevalidan e-module sebagai media pembelajaran, mengetahui respon siswa terhadap media ini, dan mengetahui apakah ada perbedaan hasil belajar siswa yang menggunakan media dibandingkan dengan yang tidak menggunakannya. Model Pengembangan yang digunakan dalam penelitian ini adalah model ADDIE (Reiser, Robert A & John V. Dempsey, 2002:18). Dalam sistematika pengembangannya, terdapat langkah-langkah yang akan dilakukan guna mencapai hasil yang diharapkan. Adapun tahap-tahap tersebut antara lain: (1) Analisis/Analysis; (2) Desain/Design; (3) Pengembangan/ Development; (4)Implementasi/Implementation; (5)Evaluasi/Evaluation. Hasil Pengembangan e-module ini memenuhi kriteria valid/layak yakni, ahli media 85,71%, ahli materi 95%, hasil uji coba perseorangan 72,91%, hasil uji coba kelompok kecil 84,72% dan hasil uji coba lapangan 82,7 %. Sedangkan untuk tes hasil belajar siswa peserta diklat terdapat 18 orang (90%) yang berhasil mencapai ketuntasan dalam belajar, dan nilai mencapai SKM (Standar Ketuntasan Minimum). Dengan demikian, e-module ini bisa dikatakan valid, dan dapat digunakan dalam proses pembelajaran. Saran yang diajukan kepada widyaiswara pengajar mata pelatihan Teknik Analisis Potensi Wilayah adalah, hendaknya e-module ini ditindak lanjuti sampai pada tahap pemanfaatan sesuai dengan kebutuhan. Sedangkan untuk pengembang selanjutnya, disarankan agar mempertimbangkan aspek alur kerja media pembelajaran yang dikembangkan agar media yang dihasilkan dapat dimanfaatkan pada strategi pembelajaran yang direncanakan.

Batu putih di kecamatan Bantur kabupaten Malang sebagai bahan campuran pembuatan beton
oleh Ariadi Pranoto

 

Analisis output tegangan sesnsor dan input tegangan aktuator berbagai putaran pada motor Honda Supra X 125 PGM FI / Moch. Rudiyanto

 

ABSTRAK Rudiyanto, Moch. 2016. Analisis Output Tegangan Sensor dan Input Tegangan Aktuator Berbagai Putaran pada Motor Honda Supra X 125 PGM FI. Skripsi, Program Studi Pendidikan Teknik Otomotif, Jurusan Teknik Mesin, Universitas Negeri Malang. Pembimbing: (1) Drs. H. Sumarli, M.Pd., M.T. (2) Drs. H. Imam Muda Nauri, S.T., M.T. Kata Kunci: Output Tegangan Sensor, Input Tegangan Aktuator Berbagai Putaran. Sepeda motor merupakan alat transportasi yang banyak digunakan masyarakat Indonesia. Perkembangan dunia otomotif akhir-akhir ini juga mengalami kemajuan pesat. Diantaranya adanya teknologi EFI (Electronic Fuel Injection). Teknologi ini sudah diterapkan di motor Honda Supra X 125.Pada penelitian ini motor Honda Supra X 125 menjadi objek penelitian. Pada motor Honda Supra X 125 PGM FI ada beberapa sensor dan aktuator,antara lain: (1) Engine oil Temperature (EOT), (2)Crankshaft Position Sensor (CKP), (3) Manifold Absolute Pressure (MAP), (4)Throttle Position (TP),(5)Intake Air Temperature (IAT), (6)Fuel Injector. Penelitian ini bertujuan untuk mengetahui output tegangan sensor dan input tegangan aktuator dalam berbagai putaran pada Motor Honda Supra X 125 PGM FI.Metode yang digunakan dalam penelitian ini adalah metode penelitian deskriptif dengan pendekatan kuantitatif. Alat yang digunakan untuk mengukur putaran mesin dalam penelitian ini adalahTachometer. Pada pengambilan data putaran mesin yang digunakan antara 1500 rpm sampai 10000 rpm dengan kenaikan 500 rpm. Data yang diperoleh dianalisis menggunakan analisis deskriptif. Hasil analisis tegangan output MAP menunjukkan tegangan output terendah 1.57 volt pada rpm 1500 dan tegangan output tertinggi 2.79 volt pada rpm 10000. Selain itu, hasil analisis output tegangan TP menunjukkan tegangan output terendah 0.62 volt pada rpm 1500 dan tegangan output tertinggi 4.20 volt pada rpm 10000. Sementara itu, hasil analisis tegangan output IAT menunjukkan tegangan tertinggi 2.88 volt pada rpm 1500 dan tegangan outputterendah 2.15 volt pada rpm 10000.Tambahan, hasil analisis tegangan output EOT menunjukkan tegangan tertinggi 2.88 volt pada rpm 1500 dan tegangan output terendah 0.54 volt pada rpm 10000. Selain itu, hasil analisis tegangan output CKP menunjukkan tegangan output terendah 0.16 volt pada rpm 1500 dan tegangan output tertinggi 0.50 volt pada rpm 10000. Hasil analisis tegangan input injektor menunjukkan tegangan terendah 0.28 volt pada rpm 1500 dan tegangan input tertinggi 2.53 volt pada rpm 10000. Hasil pengujian dapat disimpulkan bahwa kenaikan putaran mesin juga diikuti kenaikan tegangan output MAP sensor, TP sensor, CKP sensor dan Injektor. Kenaikan putaran mesin juga mengakibatkan penurunan tegangan pada sensor IAT dan sensor EOT. Sementara itu tidak semua sensor dan aktuator mengalami kenaikan atau penurunan tegangan yang diakibatkan oleh putaran mesin. Contohnya sensorTP yang dipengaruhi sudut buka katup, sensor IAT yang dipengaruhi temperatur udara pada intake dan sensor EOT yang dipengaruhi temperatur oli mesin.

Suksesi kepemimpinan nasional presiden 1996 ditinjau dari sudut hukum tata negara
oleh Evy Sophia

 

Developing a model of ESP reading materials for team-teaching using content based approach / by Wahjuningsih Usadiati

 

Peningkatan keterampilan berpikir kritis dn hasil belajar fisika menggunakan problem posing siswa kelas X.7 SMA Negeri 1 Kepanjen / Aisyatur Rodiyah

 

Kata kunci: hasil belajar, keterampilan berpikir kritis, problem posing. Berdasarkan observasi yang dilaksanakan pada bulan Maret hingga April 2011, diketahui pembelajaran di SMA Negeri I Kepanjen menggunakan metode ceramah yang diselingi tanya jawab dan diskusi sehingga pembelajaran cenderung berpusat pada guru. Keaktifan siswa dalam pembelajaran rendah, saat diajukan pertanyaan oleh guru siswa yang menjawab dan angkat tangan tidak ada atau hanya 1-3 siswa saja. Keterampilan berpikir kritis yang rendah akan berdampak pada hasil belajar siswa, hal ini ditunjukkan dengan kurangnya rerata kelas yaitu sebesar 36,77 dari SKM yang berlaku (≥75). Salah satu upaya untuk mengatasi masalah tersebut diterapkan pembelajaran menggunakan problem posing. Pembelajaran dengan problem posing merupakan suatu bentuk pembelajaran yang menekankan pada kegiatan merumuskan. Penelitian ini bertujuan untuk mengetahui apakah penerapan pembelajaran dengan problem posing dapat meningkatkan keterampilan berpikir kritis dan hasil belajar Fisika siswa SMA Negeri I Kepanjen. Jenis penelitian ini adalah penelitian tindakan kelas yang dilaksanakan dalam 2 siklus. Subyek penelitian ini adalah siswa kelas X-7 yang berjumlah 30 siswa. Data penelitian ini berupa keterampilan berpikir kritis dan hasil belajar siswa. Keterampilan berpikir kritis siswa diketahui dari hasil tes dan lembar observasi keterampilan berpikir kritis, sedangkan hasil belajar siswa diketahui dari hasil evaluasi yang dilaksanakan setiap akhir siklus. Ketuntasan belajar dianalisis dengan menggunakan hasil skor siswa mencapai ketuntasan belajar jika telah mencapai skor ≥75 dan daya serap klasikal 85% siswa yang mencapai ≥75. Hasil penelitian menunjukkan pada siklus I rata-rata kelas sebesar 77,17 menjadi 79,17 pada sikluls II. Persentase ketercapaian siklus I sebesar 86,67% meningkat menjadi 93,33% pada siklus II. Rata-rata kelas dari hasil evaluasi di setiap siklus mengalami peningkatan, pada siklus I sebesar 81,5 dan hasil belajar pada siklus II sebesar 82,67 dengan peningkatan sebesar 1,17. Ketuntasan belajar secara klasikal pada siklus I sebesar 90% dan pada siklus II meningkat menjadi 100%. Hasil penelitian menunjukkan pembelajaran dengan problem posing dalam meningkatkan keterampilan berpikir kritis siswa dan hasil belajar siswa berjalan dengan baik dengan persentase pelaksanaan pembelajaran pada siklus I sebesar 87,5% dan pada siklus II 96,79% sehingga diharapkan guru dapat menerapkan problem posing sebagai variasi dalam pembelajaran Fisika. Keterbatasan penelitian yang hanya menerapkan problem posing pada materi pemuaian dan perpindahan kalor dengan waktu penelitian yang cukup singkat, maka diharapkan dapat dilakukan penelitian lanjutan pada materi yang lain dengan menghadapkan siswa pada masalah-masalah yang ada pada kehidupan sehari-hari pada waktu penelitian yang cukup lama untuk peningkatan kualitas pendidikan Indonesia.

Pelaksanaan pengajaran bahasa Inggris berdasarkan kurikulum 1994 di Madrasah Aliyah Negeri Model Magelang Jawa Tengah / by Teguh Suyitno

 

Pengaruh service quality dan trust terhadap loyalitas nasabah tabungan Shar-E Bank Muamalat Cabang Malang / Ndaru Perdhana

 

Kata kunci: Kualitas Pelayanan (Service Quality), Kepercayaan (Tust) , loyalitas nasabah Perkembangan ilmu pengetahuan dan teknologi dewasa ini mendorong semakin kompetitif persaingan dalam dunia usaha, salah satunya usaha jasa. Perkembangan teknologi dan arus informasi membuat konsumen menuntut lebih atas sebuah barang dan jasa. Berbagai strategi dipilih oleh para marketer untuk bertahan ditengah badai persaingan global. Tujuan utama untuk mencapai loyalitas konsumen dikarenakan hal ini sangat menguntungkan bagi berusahaan. Peningkatan kualitas pelayanan (service quality) dan kepercayaan (trust) diyakini merupakan strategi untuk mendapatkan loyalitas konsumen. Bank muamalat adalah bank pertama yang mengusung konsep murni syariah islam dan tidak mengakui bunga riba yang dilarang keras dalam islam. Bank Muamalat Indonesia memulai operasinya pada tanggal 27 Syawal 1412 H atau tanggal 1 Mei 1992, salah satu produk andalan adalah tabungan Shar’e dengan mengusung tag line tag line Easy, Every where, and Ekstra ordinary menjadikan produk tabungan Shar’e dapat diterima baik oleh konsumen. Tujuan penelitian ini adalah untuk mengetahui: Bagaimanakah kondisi loyalitas nasabah tabungan Shar-E di Bank Muamalat Cabang Malang. Untuk mengetahui pengaruh service quality terhadap loyalitas nasabah tabungan Shar-E Bank Muamalat Cabang Malang. Untuk mengetahui pengaruh Trust terhadap loyalitas nasabah tabungan Shar-e Bank Muamalat Cabang Malang. Penelitian ini termasuk dalam penelitian deskriptif korelasional. Populasi yang diambil dalam penelitian ini adalah nasabah tabungan Shar’e bank Muamalat Cabang Malang. Penentuan sampel menggunakan rumus Slovin dengan persen kelonggaran ketidaktelitian yang digunakan adalah 10% sehingga diperoleh sampel sebanyak 100 orang. Teknik penentuan sampel yang digunakan adalah Proportional Random Sampling dengan menggunakan kuesioner sebagai instrumen penelitian. Kuesioner dalam penelitian ini termasuk dalam kuesioner tertutup menggunakan skala Likert dengan 5 alternatif pilihan jawaban. Untuk menguji kelayakan instrumen dilakukan uji validitas dan reliabilitas dengan sampel uji coba berjumlah 30 orang responden. Proses pengolahan data menggunakan software SPSS 13 for Windows. Berdasarkan penelitian ini hasil yang diperoleh adalah: (1) mayoritas responden menyatakan setuju dengan kualitas pelayanan yang baik dari manajemen bank Muamalat Cabang Malang (2) ada pengaruh positif yang signifikan antara kualitas pelayanan (service quality) dengan loyalitas nasabah tabungan Shar’e bank Muamalat Cabang Malang (3) mayoritas responden menyatakan setuju dengan kepercayaan antara nasabah dengan pihak manajemen bank Muamalat Cabang Malang, (4) ada pengaruh positif yang signifikan antara kepercayaan (trust) dengan loyalitas nasabah tabungan Shar’e bank Muamalat Cabang Malang. Dari penelitian menunjukkan kualitas pelayanan (service quality) memiliki pengaruh 19,12% terhadap loyalitas nasabah tabungan Shar’e bank Muamalat cabang Malang, dan kepercayaan (trust) memiliki pengaruh 29,48% terhadap loyalitas nasabah tabungan Shar’e bank Muamalat Cabang Malang. Saran yang dapat diberikan dalam penellitian ini adalah: (1) Saran ditujukan kepada produk Shar’e, hendaknya bank Muamalat lebih memperhatikan unsur kualitas pelayanan. Hal itu dapat dilakukan dengan cara meningkatkan fasilitas sarana dan prasarana dalam mendukung proses transaksi nasabah tabungan Shar’e seperti, fasilitas ruang tunggu yang lebih nyaman ditambah dengan dukungan front office dengan dukungan SDM yang lebih profesional dan ramah. (2) Dukungan teknologi untuk mendukung segala trasaksi nasabah tabungan Shar’e juga perlu untuk ditingkatkan. (3) Perusahaan harus lebih inovatif dalam strategi memperoleh nasabah. Salah satu cara yang baik adalah dengan menerapkan program member get member, yaitu nasabah yang mengajak orang lain untuk menjadi nasabah. (4) kursi di ruang tunggu yang terlalu sedikit membuat nasabah harus berdiri jika lagi banyak nasabah yang datang, permasalahan ini mestinya harus segera diatasi dengan menambah fasilitas kursi untuk para nasabah. (5) menjalin hubungan kepada nasabah secara lebih personal, meniadakan batasan-batasan antara pihak manajemen dengan para nasabah, membuat promo-promo untuk menjalin kedekatan dengan para nasabah sehingga terbentuk kepercayaan secara mendalam antara pihak manajemen bank Muamalat Cabang Malang dengan para nasabah khususnya nasabah tabungan Shar’e.

Pengaruh strategi Thinking Actively in Social Context (TASC) dipadu iMindMap pada mata pelajaran biologi untuk meningkatkan hasil belajar, ketrampilan berpikir kritis dan kreatif siswa SMAN 4 Sidoarjo / Putri Nuur Masita

 

ABSTRAK Masita, Putri Nuur. 2016. Pengaruh Strategi Thinking Actively in Social Context (TASC) dipadu iMindMap pada Mata Pelajaran Biologi untuk Meningkatkan Hasil Belajar, Keterampilan Berpikir Kritis dan Kreatif Siswa SMAN 4 Sidoarjo. Tesis. Program Studi Pendidikan Biologi, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Susriyati Mahanal, M.Pd dan (II) Dr. Hadi Suwono, M.Si. Kata Kunci: TASC, iMindMap. Keterampilan berpikir Pendidikan formal yang berlangsung kini cenderung terjebak pada mengasah aspek mengingat (remembering) dan memahami (understanding) yang merupakan low order of thinking. Pembelajaran yang lebih mengembangkan keterampilan berpikir kritis dan kreatif yang termasuk dalam high order thinking dan merupakan komponen kecerdasan abad 21 sangat diperlukan siswa untuk menghadapi tantangan masa depan. Penelitian ini bertujuan untuk mengetahui pengaruh strategi pembelajaran TASC dipadu iMindMap terhadap hasil belajar, keterampilan berpikir kritis dan kreatif siswa pada pembelajaran biologi. Penelitian ini menggunakan pendekatan quasi experiment dengan desain pretest-posttest control group design. Populasi penelitian ini adalah siswa Kelas X SMA Negeri 4 Sidoarjo, semester genap tahun pelajaran 2015-2016 sebanyak 229 siswa yang terbagi dalam 6 kelas paralel. Sampel penelitian ini adalah siswa Kelas X tahun pelajaran 2015/2016 sebanyak 2 kelas dari 6 kelas yang ada. Kelas eksperimen (X MIA 3) terdiri dari 39 siswa yang diperlakukan dengan pembelajaran strategi TASC dipadu iMindMap, sedangkan kelas kontrol (X MIA 2) terdiri dari 38 siswa yang diberikan pembelajaran konvensional (ceramah dan diskusi). Teknik pengumpulan data menggunakan tes pilihan ganda dan essay. Uji hipotesis menggunakan anakova. Data penelitian sebelum dilakukan uji hipotesis, dilakukan uji normalitas menggunakan Kolmogorov Smirnov dan uji homogenitas menggunakan Levene’s Test sebagai uji prasyarat untuk mengetahui data berdistribusi normal dan homogen. Hasil penelitian mengungkapkan bahwa ada pengaruh strategi pembelajaran TASC dipadu iMindMap terhadap hasil belajar, keterampilan berpikir kritis, dan keterampilan berpikir kreatif siswa. Strategi TASC dipadu iMindMap dapat melatihkan keterampilan berpikir kritis dan kreatif serta dapat meningkatkan hasil belajar siswa, oleh karena itu disarankan bagi guru dan pendidik untuk menerapkannya sebagai alternatif melatihkan keterampilan berpikir kritis dan kreatif siswa dalam pembelajaran.

Pengembangan model pembelajaran top rank matching questions and answers dalam mata pelajaran akuntansi untuk siswa kelas XI IPS SMA Negeri 6 Malang / Aina Na'ima Fadilla Sari

 

Na’ima F.S., Aina. 2014. Pengembangan Model Pembelajaran Top Rank Matching Questions and Answers Dalam Mata Pelajaran Akuntansi Untuk Siswa Kelas XI IPS SMA Negeri 6 Malang. Skripsi, Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Dr. Sunaryanto, M. Ed., (II) Dr. Suparti, M. P. Kata Kunci: Model Pembelajaran, Top Rank Matching Questions and Answers, Akuntansi     Pendidikan memiliki peranan yang sangat penting dalam menjamin kelangsungan hidup suatu bangsa dan negara. Salah satu tempat berlangsungnya pendidikan adalah di sekolah. Kegiatan belajar mengajar di sekolah ini seharusnya dapat membuat siswa mencapai tujuan belajarnya dengan penuh rasa puas. Namun dalam kenyataannya terdapat beberapa masalah pembelajaran yang muncul, diantaranya adalah kegiatan pembelajaran yang kurang efektif maupun membosankan menurut siswa. Untuk mengatasi permasalahan yang timbul, diperlukan guru yang tidak hanya menguasai materi, tetapi guru yang juga memiliki keragaman model atau strategi pembelajaran, karena tidak ada model pembelajaran yang dirancang untuk mencapai segala jenis pembelajaran maupun berfungsi untuk semua gaya belajar.     Tujuan dari penelitian ini yaitu untuk (1) Menghasilkan model pembelajaran yang dapat mengatasi kelemahan model pembelajaran sebelumnya, (2) Menganalisis kebutuhan pembelajaran siswa dalam mata pelajaran akuntansi kelas XI IPS SMA Negeri 6 Malang, (3) Mendesain model pembelajaran Top Rank Matching Questions and Answers yang dapat digunakan sebagai salah satu cara pembelajaran pada mata pelajaran akuntansi kelas XI IPS SMA Negeri 6 Malang, (4) Mengembangkan model pembelajaran Top Rank Matching Questions and Answers dalam mata pelajaran akuntansi kelas XI IPS SMA Negeri 6 Malang, dan (5) Menjelaskan efektifitas peningkatan hasil belajar siswa menggunakan model pembelajaran Top Rank Matching Questions and Answers.     Jenis penelitian yang digunakan adalah penelitian pengembangan dengan menggunakan model pengembangan Sugiyono. Subjek coba dalam penelitian ini adalah siswa kelas XI IPS 3 SMA Negeri 6 Malang tahun ajaran 2013/2014 yang berjumlah 28 siswa. Temuan penelitian ini menunjukkan bahwa model pembelajaran yang dikembangkan layak dan efektif untuk digunakan dalam kegiatan pembelajaran.     Saran pengembangan Produk Lebih Lanjut: (1) Model pembelajaran ini masih digunakan hanya di satu mata pelajaran dan satu sekolah. Pada pengembangan lebih lanjut, dapat menggunakan model pembelajaran ini di mata pelajaran lain maupun sekolah lain, (2) Peneliti selanjutnya dapat menguji keefektifan produk ini dengan membandingkan model pembelajaran Top Rank Matching Questions and Answers dengan model pembelajaran yang lain, (3) Peneliti selanjutnya dapat merancang model pembelajaran dengan konsep lain sehingga model pembelajaran yang dihasilkan akan lebih baik.

Problems found amd stretgies used in essay writing by the fifth semester students of the English Department in Muhammadiyah University of Malang / by Fardini Sabilah

 

Upaya meningkatkan motivasi dan hasil belajar matematika melalui pembelajaran kooperatif tipe TAI (Team Assisted Individualization) pada siswa kelas XI Ilmu Alam di SMA Brawijaya Smart School Malang / Fetty Yudha Winata Sekti

 

Kata kunci: tipe TAI, hasil belajar, motivasi Pengamatan peneliti pada siswa kelas XI Ilmu Alam di SMA Brawijaya Smart School Malang memiliki kemampuan yang heterogen. Keheterogenan ini mengakibatkan siswa dengan karakteristik kemampuan yang sama cenderung mengelompok menjadi satu, sehingga di dalam kelas yang heterogen terbentuk kelompok yang homogen. Kelompok dengan kemampuan yang baik mampu menyelesaikan tugas dengan lancar dan benar. Sedangkan pada saat siswa dikelompokkan menjadi kelompok yang heterogen, siswa melimpahkan pekerjaan mereka pada temannya yang memilki kemampuan tinggi. Hal ini menyebabkan siswa yang mencapai KKM (Kriteria Ketuntasan Minimum) hanya siswa tertentu saja. Untuk menyelesaikan masalah tersebut, peneliti menggunakan model pembelajaran kooperatif tipe TAI yaitu bentuk belajar kooperatif yang memanfaatkan potensi individu dengan didahului belajar individual di mana siswa terlebih dahulu diharuskan memahami materi dan mengerjakan soal yang ada secara individu, setelah itu siswa berdiskusi dengan teman satu kelompok untuk saling berbagi hasil pemikiran masing-masing. Model pembelajaran ini diharapkan dapat dimanfaatkan sebagai upaya meningkatkan motivasi dan hasil belajar siswa. Penelitian ini dilakukan di SMA Brawijaya Smart School, pada bulan Februari sampai Mei 2010 yang terdiri dalam dua tahap, yaitu tahap pra tindakan dan tahap tindakan. Subjek penelitian ini adalah siswa kelas XI Ilmu Alam SMA Brawijaya Smart School Malang tahun ajaran 2009/2010 sebanyak 19 siswa. Rancangan penelitian ini adalah penelitian tindakan kelas dengan pendekatan kualitatif. Penelitian ini terdiri dari siklus I dan siklus II. Hasil penelitian ini menunjukkan bahwa pembelajaran kooperatif tipe TAI dapat meningkatkan hasil belajar dan motivasi siswa dalam mengikuti pembelajaran matematika. Peningkatan ini ditunjukkan dengan rata-rata nilai kuis sebelum tindakan adalah 69,92 menjadi 78,68 pada siklus I dan 85,84 pada siklus II . Sedangkan pada motivasi siswa terjadi peningkatan yang ditunjukkan dengan rata-rata skor motivasi awal siswa adalah 2,94 yaitu dalam kategori baik menjadi 3,12 yaitu dalam kategori baik pada siklus I dan pada siklus II menjadi 3,34 yaitu dalam kategori sangat baik. Sehingga pembelajaran kooperatif tipe TAI ini layak dikembangkan dalam pembelajaran matematika.

Pengembangan buku ajar berbasis penelitian perkembangan larva ulat sutera (Bombyx mori L.) untuk matakuliah perkembangan hewan prodi pendidikan biologi S1 Universitas Jember / Sulistyo Dwi K.P.

 

ABSTRAK Putro, SulistyoDwi K, 2016. PengembanganBuku Ajar BerbasisPenelitianPerkembangan Larva UlatSutera (Bombyxmori L.) untukMatakuliahPerkembanganHewan (PH) Prodi PendidikanBiologi S1 UniversitasJember. Tesis, Program StudiPendidikanBiologi, Pascasarjana, UniversitasNegeri Malang. Pembimbing: (I) Dr. Umie Lestari, M.Si., (II) Dr. Betty Lukiati, M.Si. Kata Kunci: BukuAjarBerbasisPenelitian, HormonJuvenil, IsolasiHormon. Peranbahanajardalam proses pembelajaranbertujuanuntukmenyajikansumberinformasi, bahankajiandansumberkegiatanbagimahasiswa. Pengembanganbahan ajar berupabuku ajar berbasispenelitian yang dilakukanbertujuanuntukmenghasilkanbuku ajar matakuliahperkembanganhewan yang akandigunakansebagaisalahsatusumberbukupenunjangbelajarbagimahasiswaPendidikanBiologi S1 UniversitasNegeriJember. Materi yang akandisajikandalambuku ajar berbasispenelitiantersebutmembahastentangfenomenasuatuperkembangan larva ulatsuteramenjadidewasa yang ditinjaudarihormonberdasarkankajianbiologimolekulernya. Penelitianinimerupakanpenelitianpengembanganbuku ajar berbasispenelitianlaboratorik.Model pengembangan yang digunakandalampenelitianinimengadaptasidari model pengembanganHannafindan Peck (1988).Pemilihan model pengembanganinididasarkanataspemikiranbahwa model ini: 1) memberikesempatanuntukmelakukanrevisi (evaluasi) padasetiaptahapan, 2) model inisangatsederhananamunimplementasinyasistematik. Model pengembanganinimerupakan model desainpembelajaran yang berorientasipadaproduk.Penelitianlaboratorik yang dilakukanpadatahapanpegembanganinimeliputipemeliharaanulatsutera, purifikasihormon, isolasi protein, SDS-PAGE, dan GCMS dilakukanpadaprosedurfasedesaindanperencanaan. Berdasarkanhasilisolasidanpurifikasihormonjuvenildidapatkankomponenpenyusunsenyawahormonjuvenilulatsuteraterdapat 3 senyawa, JH I, JH II, dan JH III.JH III merupakanMethyl- (2E,6E)-(10R)-10,11-epoxy-3,7,11-trimethyl-2,6-dodecadienoate; JH IImerupakanMethyl (2E,6E,10cis) - (10R,11S)-10, 11-epoxy-3,7,11 - trimethyl - 2,6 - tridecadienoate; danJH IIImerupakanMethyl (2E,6E,10cis) - (10R,11S) - 10,11 – epoxy - 7ethyl – 3 , 11 – dimethyl - 2,6 tridecadienoate.Dari hasilberatmolekul yang diperolehdarihasilisolasi protein kelenjarcorpora allatadiperolehberatmolekulsebesar 39 kDa, dimanamenurutCusson, M, dkk. 1992, protein denganberatmolekul 39 kDapadacorpora allataberfungsisebagaibinding affinity pada proses sekresihormon juvenile perkembangan larva ulatsuterabombyxmori. Namununtukfungsikhususpadabeberapa protein yang terdapatpadacorpora allatamasihbelumbisadipastikanpadaleterlibatanyadalam proses metamorfosisulatsutera. Melaluipengembanganbuku ajar berbasispenelitian yang telahdilakukandenganmenyajikanmateri-materihasilanalisismolekuler, mahasiswasangatantusiasdanmendapatkanpengetahuandaninformasi-informasiterbaru.Hal inidikarenakanbuku ajar berbasispenelitianmasihdianggaphalbaruolehmahasiswadanmendapatresponpositifuntukmahasiswa.Berdasarkanhasilanalisismenunjukkanbuu ajar yang disusuntelahmemenuhisyaratkelayakan. Tingkat kelayakanujiterbatasperoranganmahasiswadiperolehsebesar 94,7% dengankategori valid, ujikelayakandariahli media diperolehsebesar 93,35% dengankategori valid, danujikelayakansajianmaterisebesar 80,07% dengankategori valid danlayakuntukdigunakansebagaibukupenunjangpembelajaranmatakuliahperkembanganhewan.

Promoting the mastery of language components through the mode of reading adapted stories to elementary-school-laged learners / by Sri Rachmajanti

 

Penerapan model pembelajaran langsung untuk meningkatkan hasil belajar bilangan romawi siswa kelas IV SDN Lesanpuro 1 kota Malang / Rahayu Iskandar

 

Kata Kunci: Model Pembelajaran Langsung, Bilangan Romawi, SD Kelas IV, Matematika merupakan pengetahuan yang berhubungan secara tersusun, untuk menyelesaikan masalah dalam kehidupan sehari-hari, yang dapat didefenisikan secara logika. Dalam pembelajaran Matematika, perlu menggunakan pendekatan yang bukan saja dapat meningkatkan hasil pembelajaran, tetapi juga dapat mengajarkan keterampilan bekerjasama antar siswa, agar kelak mereka mampu bersosialisasi di lingkungan masyarakat dengan baik. Permasalahan yang terjadi di kelas IV SDN Lesanpuro 1 Kedungkandang Kota Malang yaitu rendahnya hasil belajar siswa. Sehingga perlu adanya tindakan yang inovatif dalam pembelajaran. Tujuan penelitian ini adalah (a) mendeskripsikan penerapan model pembelajaran langsung untuk meningkatkan hasil belajar siswa dalam pembelajaran matematika pada siswa kelas IV SDN Lesanpuro 1 Kecamatan Kedungkandang Kota Malang (b) mendeskripsikan hasil belajar siswa melalui penggunaan model pembelajaran langsung dalam pembelajaran matematika bagi siswa kelas IV SDN Lesanpuro 1 Kecamatan Kedungkandang Kota Malang. Penelitian tindakan kelas ini diterapkan untuk mencapai tujuan pembelajaran, yaitu meningkatkan hasil belajar siswa kelas IV SDN Lesanpuro 1 Kedungkandang Kota Malang yang mencakup pemahaman konsep bilangan Romawi. Model yang digunakan adalah model pembelajaran langsung. Model pembelajaran langsung dianggap mampu meningkatkan hasil belajar siswa karena di dalamnya siswa berlatih secara terstruktur. Penelitian dikhususkan pada mata pelajaran Matematika khususnya materi pokok lambang bilangan Romawi. Rencana penelitian dengan menggunakan jenis pendekatan penelitian tindakan kelas (PTK). Subjek penelitian adalah siswa kelas IV SDN Lesanpuro 1 Kedungkandang Kota Malang yang berjumlah 46 siswa. Teknik pengumpulan data menggunakan tes dan observasi selama proses pembelajaran. Penelitian ini dilaksanakan sebanyak dua siklus melalui tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Hasil penelitian yang diperoleh adalah sebagai berikut; hasil belajar siswa yang merupakan pemahaman konsep matematika materi pokok lambang bilangan Romawi pada pra siklus menjadi 74,56% pada siklus I 81,30%, kemudian menjadi pada siklus II 90,00%.

Penerapan strategi React berbantuan media manipulatif matematis untuk memahamkan konsep luas daerah segi empat bagi siswa kelas VII2 di SMP Negeri 7 Kubung / Nike Kurnia Illahi

 

ABSTRAK Illahi, Nike Kurnia. 2016. Penerapan Strategi REACT Berbantuan Media Manipulatif Matematis untuk Memahamkan Konsep Luas Daerah Segi Empat bagi Siswa Kelas VII2 di SMP Negeri 7 Kubung. Tesis, Program Studi Pendidikan Matematika, Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Prof. Drs. Purwanto, Ph. D, (II) Prof. Dr. Cholis Sa’dijah, M. Pd, M. A. Kata kunci : Strategi REACT, Media Manipulatif, Pemahaman Konsep, Luas Daerah Segi Empat Tujuan penelitian ini untuk mendeskripsikan pelaksanaan pembelajaran dengan strategi REACT berbantuan media manipulatif yang dapat memahamkan siswa mengenai materi luas daerah segi empat. Jenis penelitian yang digunakan adalah penelitian tindakan kelas (PTK). Subjek penelitian adalah siswa kelas VII2 SMP Negeri 7 Kubung Kabupaten Solok Sumatera Barat karena siswa kelas VII2 masih sulit memahami konsep matematika dalam pelajaran sebelumnya. Perangkat dan instrumen yang digunakan dalam penelitian ini divalidasi ahli sebelum pelaksanaan penelitian ini. Hasi tes akhir pada siklus II memenuhi kriteria keberhasilan tindakan yang ditetapkan peneliti. Pelaksanaan kegiatan pembelajaran terdiri dari tiga tahapan belajar, yaitu kegiatan awal, kegiatan inti dan kegiatan akhir. Kegiatan awal terdiri dari pembentukan kelompok belajar, menjelaskan tujuan dari mempelajari luas daerah segi empat dan memberi motivasi siswa tentang manfaat belajar luas daerah segi empat. Kegiatan inti terdiri dari 1) Relating: memahamkan konsep luas daerah segi empat dengan mengaitkan pada kehidupan sehari-hari, 2) Experiencing: mengalami sendiri proses menemukan luas daerah segi empat, 3) Applying: menerapkan konsep luas daerah segi empat yang telah dipahami kedalam soal luas daerah segi empat, 4) Cooperating: bekerja secara berkelompok bersama kelompok belajar yang telah ditetapkan, dan 5) Transferring: mentrasfer pengetahuan yang dimilikinya ke dalam situasi baru untuk menyelesaikan masalah. Kegiatan akhir terdiri dari peneliti memberi respon terhadap jalannya diskusi dan pelaporan hasil kerja kelompok dan bersama siswa membuat kesimpulan hasil pembelajaran. Hasil penelitian ini adalah pembelajaran dengan strategi REACT berbantuan media manipulatif matematis dapat memahamkan siswa materi luas daerah segi empat.

Pengembangan sumber daya manusia di perguruan tinggi swasta (studi multi kasus di Universitas Muhammadiyah Mataram dan Institut Keguruan dan Ilmu Pendidikan Mataram) / Baiq Rohiyatun

 

Tesis, Program Studi Manajemen Pendidikan, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Hendyat Soetopo, M.Pd, (II) Prof. Dr. H. Ibrahim Bafadal, M.Pd. Kata Kunci: Pengembangan, Sumber Daya Manusia, Perguruan Tinggi Swasta Pengembangan organisasi merupakan bagian penting dalam sistem pendidikan di Perguruan Tinggi Swasta (PTS). Hal ini karena mempunyai pengaruh yang kuat terhadap keberhasilan pencapaian tujuan perguruan tinggi. Di dalam rangka pengembangan organisasi, PTS hendaknya mengoptimalkan layanan pendidikan dengan potensi sumber daya yang ada sesuai dengan tuntutan lingkungan internal dan eksternal. Salah satu cara dalam menggali potensi yang dimiliki oleh sumber daya manusia di perguruan tinggi adalah dengan pengembangan. Pengembangan sumber daya manusia merupakan dimensi penting dalam proses pembangunan nasional yang saling berkaitan dengan pembangunan dimensi yang lain, karena faktor yang paling menentukan keberhasilan suatu bangsa bukan kekayaan alam yang dipunyainya, melainkan kualitas sumber daya manusia yang dipunyainya. Begitupun dalam lembaga perguruan tinggi, faktor yang menentukan keberhasilan organisasai adalah kualitas Sumber Daya Manusianya terutama tenaga pengajar atau yang disebut dosen. Dosen adalah merupakan ujung tombak pelaksanaan kegiatan pendidikan yang sifat pekerjaanya selalu berkembang dan dinamis seirama dengan perubahan yang terjadi. Fokus utama dari penelitian ini adalah: pengembangan Sumber Daya Manusia (SDM) dosen di Universitas Muhammadiyah Mataram dan Institut Keguruan Dan Ilmu Pendidikan Mataram. Fokus tersebut dijabarkan menjadi sub fokus penelitian yakni: (1) Perencanaan pengembangan sumber daya Manusia dosen di Universitas Muhammadiyah Mataram dan Institut Keguruan dan Ilmu Pendidikan Mataram; (2) Tehnik-tehnik Pengembangan Sumber Daya Manusia dosen di Universitas Muhammadiyah Mataram dan Institut Keguruan dan Ilmu Pendidikan Mataram; dan (3) Tindak lanjut pengembangan sumber daya manusia dosen di Universitas Muhammadiyah Mataram dan Institut Keguruan dan Ilmu Pendidikan Mataram. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi multikasus. Tehnik pengumpulan data yang digunakan adalah: (1) wawancara mendalam; (2) observasi berperan serta dan (3) studi dokumentasi. Pemilihan informan penelitian dilakukan secara snowball sampling. Data yang terkumpul dianalisis secara deskriptif dengan alur: (1) reduksi data; (2) penyajian data; (3) penarikan kesimpulan. Agar memperoleh keabsahan data dilakukan melalui: (1) Uji Kredibilitas yang terdiri dari Triangulasi, Member cek dan diskusi teman sejawat; (2) Dependabilitas; dan (3) Konfirmabilitas. Hasil penelitian menunjukkan: pertama perencanaan pengembangan sumber daya manusia dosen dikedua perguruan tinggi swasta lokasi penelitian sesuai dengan tuntutan kebijakan pemerintah dan keinginan untuk terus eksis ditengah persaingan kualitas dari PTS yang lain. Kedua tehnik-tehnik pengembangan sumber daya manusia dosen di kedua perguruan tinggi swasta lokasi penelitian menggunakan tehnik studi lanjut, pelatihan atau penataran, workshop atau lokakarya dan seminar kesemua tehnik-tehnik tersebut ditentukan berdasarkan kebutuhan dosen dan kebutuhan lembaga perguruan tinggi. Penetapan tehnik yang digunakan melibatkan peran serta pimpinan perguruan tinggi dan unsur yayasan. Ketiga Tindak lanjut pengembangan sumber daya manusia dosen di kedua perguruan tinggi swasta lokasi penelitian menunjukkan bahwa akan dipasilitasi dalam bentuk sarana dan dana agar apa yang sudah dipelajari dalam tehnik-tehnik pengembangan SDM dapat diaplikasikan untuk peningkatan kemampuan mengajar dan ilmu spesialisasi dosen disamping itu juga faktor kompensasi akan diupayakan untuk meningkatkan motivasi kerja dan kesejahteraan dosen. Berdasarkan hasil penelitian disarankan (1) Untuk Kopertis wilayah IIIV dan DIKTI, bekerjasama dengan perguruan tinggi memberikan dana dalam rangka pengembangan kualitas dosen. Pengadaan tehnik-tehnik pengembangan dosen selain studi lanjut perlu diintensifkan penyelenggaraannya dengan mengundang dosen-dosen dari PTS-PTS yang ada, sehingga semua kebijakan maupun program yang dikembangkan tepat sasaran dan dapat ditindak lanjuti; (2) Untuk IKIP Mataram, Perguruan tinggi walaupun swasta perlu berinisiatif dengan sungguh-sungguh untuk menggunakan hasil analisis kebutuhan sebagai dasar dalam menyusun program pengembangan sumber daya manusia dosen, perguruan tinggi perlu menyusun tehnik-tehnik apa yang sesuai untuk program pengembangan sumber daya manusia dosen dan dapat bekerjasama dengan Universitas lain, DIKTI/Kopertis dan lembaga pendidikan lain untuk memberikan bimbingan berkelanjutan dalam hal pengembangan sumber daya manusia. Khusus untuk penelitian karena data yang penulis dapatkan dilapangan bahwa belum ada hasil penelitian dosen yang diseminarkan maka perlu kiranya IKIP Mataram mempublikasikan hasil penelitiannya dalam bentuk seminar; (3) Bagi UMM, walaupun swasta perlu berinisiatif dengan sungguh-sungguh untuk menggunakan hasil analisis kebutuhan sebagai dasar dalam menyusun program pengembangan sumber daya manusia dosen, perguruan tinggi perlu menyusun tehnik-tehnik apa yang sesuai untuk program pengembangan sumber daya manusia dosen dan dapat bekerjasama dengan Universitas lain, DIKTI/Kopertis dan lembaga pendidikan lain untuk memberikan bimbingan berkelanjutan dalam hal pengembangan sumber daya manusia; (4) bagi dosen, tanggung jawab dan kewajiban sebagai seorang dosen adalah melaksanakan Tri Dharma Perguruan tinggi sudah seharusnya untuk melakukan pengembangan diri tidak hanya menunggu giliran dan kesempatan dari perguruan tinggi tetapi ada inisiatif sendiri untuk mau mengembangkan diri menjadi dosen yang professional; (5) Bagi peneliti lain, dapat dijadikan acuan bagi para peneliti-peneliti selanjutnya dalam rangka perbaikan kedepan, apabila metodologi dan temuan penelitian ini dinilai kredibel dan relevan, maka dapat dimanfaatkan sebagai referensi dalam meneliti kasus sejenis pada lembaga lainya.

Sumbangan hukum Islam terhadap hukum waris di Indonesia
oleh Ahmad Jailani

 

The quality of the content of an English coursebook for senior high school / Putri Ayu Isnaini

 

ABSTRAK Isnaini, Putri Ayu. 2015. Kualitas Konten Buku Teks Bahasa Inggris untuk Sekolah Menengah Atas. Skripsi. Jurusan Sastra Inggris. Fakultas Sastra, Universitas Negeri Malang. Dosen Pembimbing: (1) Dr. Emalia Iragiliati, M.Pd. (2) Prof. Dr. Nur Mukminatien, M.Pd. Kata Kunci: konten buku teks, kualitas, sekolah menengah atas Perubahan kurikulum di Indonesia juga diikuti oleh beberapa kebijakan pemerintah, salah satunya adalah penerbitan dan pendistribusian buku teks. Bahasa Inggris untuk Kelas XI Semester 1 adalah salah satu buku teks yang disusun berdasarkan kurikulum 2013. Penelitian ini bertujuan untuk mengevaluasi kualitas konten buku teks tersebut berdasarkan lima aspek; (1) tujuan dan pendekatan, (2) konten bahasa, (3) keterampilan bahasa, (4) topik dan nilai sosial budaya, dan (5) desain dan organisasi. Metode yang digunakan di dalam penelitian ini adalah deskriptif-kualitatif. Langkah-langkah penelitian ini adalah mengumpulkan data dari konten buku teks menggunakan evaluation checklist dan panduan wawancara. Lalu, data dari evaluation checklist dianalisis menggunakan rumus untuk mendapatkan hasil dari setiap faktor skor dari buku teks. Setelah itu, menarasikan data dari wawancara. Selanjutnya, hasil dari evaluation checklist dideskripsikan dengan juga didukung oleh opini guru dan dihubungkan dengan teori dari para ahli evaluasi buku teks yang sesuai dengan hasil temuan. Hasil penelitian ini menunjukkan bahwa, berdasarkan skala 1-4, berdasarkan (1) tujuan dan pendekatan buku teks dikategorikan “sangat baik” karena memperoleh skor sebanyak 3.62, (2) konten bahasa sebanyak 2.8 dan termasuk dalam kategori “cukup”, (3) keterampilan bahasa dikategorikan “cukup” dengan skor 2.78, (4) topik dan nilai sosial budaya dikategorikan “baik” dengan skor 3.4, dan (5) desain dan organisasi dikategorikan “baik” dengan skor 3.42. Secara keseluruhan, buku teks dikategorikan “baik” karena memperoleh skor akhir 3.20. Berdasarkan hasil penelitian, dapat disimpulkan bahwa buku teks berjudul “Bahasa Inggris untuk Kelas XI Semester 1” dikategorikan “baik” karena masih terdapat kekurangan di beberapa aspek. Untuk meningkatkan kualitas buku teks, penulis buku disarankan untuk (1) menyediakan materi yang mencerminkan langkah “menanya”, (2) memberikan latihan yang lebih kontekstual untuk grammar dan vocabulary, (3) memnyediakan materi untuk listening dan menambah kuantitas latihan keterampilan bahasa dengan mempertimbangkan tingkat kesulitan khususnya untuk reading dan writing, (4) memperkaya pengetahuan budaya, serta (5) melengkapi buku teks dengan beberapa paket penunjang seperti media, alat penilaian, dan lainnya. Kedua, guru Bahasa Inggris disarankan untuk menyediakan materi tambahan dari sumber lain untuk mendukung proses pembelajaran dan untuk menutupi kekurangan buku teks khususnya materi reading dan writing. Terakhir, untuk peneliti yang akan datang, disarankan untuk mengevaluasi buku teks lain untuk jenjang pendidikan berbeda dengan memperhatikan kriteria yang akan dipilih dari para ahli evaluasi buku yang lain serta mengevaluasi lebih dalam tentang refleksi pendekatan ilmiah pada buku teks. Selain itu, peneliti yang akan datang juga disarankan untuk menggunakan instrumen yang lebih rinci dan menambahkan evaluasi dari sudut pandang siswa khususnya untuk memberi evaluasi yang lenih kuat dan valid tentang tingkat kesulitan materi dan latihan yang terdapat di buku teks.

Perkembangan fungsi kesenian kobra siswa di Kabupaten Sleman / oleh Sri Indarsih

 

Pengembangan model perangkat pembelajaran menulis cerpen dengan strategi Asah, Asih, dan Asuh (A3) di SMA / Dwi Rajab Januhadi

 

ABSTRAK Januhadi, Dwi Rajab. 2015. Pengembangan Model Perangkat Pembelajaran Menulis Cerpen dengan Strategi Asah, Asih, dan Asuh di SMA. Disertasi, Program Studi Pendididikan Bahasa Indonesia, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Maryaeni, M.Pd, (II) Prof. Dr. Djoko Saryono, M.Pd, dan (III) Dr. Hj. Yuni Pratiwi, M.Pd. Kata Kunci: perangkat pembelajaran; strategi asah, asih, dan asuh; menulis cerpen Dalam usaha merealisasikan pembelajaran menulis cerpen yang menarik dan memberikan kesempatan kepada siswa memperoleh pengalaman belajar untuk menghasilkan karya cerpen yang kreatif, salah satu aspek penting yang harus disiapkan oleh guru yakni perangkat pembelajaran. Penelitian Pengembangan Model perangkat pembelajaran menulis cerpen dengan menggunakan strategi Asah,Asih, dan Asuh (A3)di SMAdimaksudkan untuk menghasilkan perangkat pembelajaran yang dapat membantu guru menyiapkan kebutuhan tersebut. Perangkat pembelajaran yang dikembangkan mencakup (1) panduan penggunaan model perangkat pembelajaran menulis cerpen, (2) silabus pembelajaran menulis cerpen, (3) rencana pelaksanaan pembelajaran (RPP) menulis cerpen, (4) materi pembelajaran menulis cerpen, dan (5) evaluasi/penilaian pembelajaran menulis cerpen dengan strategi A3.Dalam model pembelajaran dengan strategi A3, guru lebih berperan sebagai fasilitator dan siswa belajar dalam kelompok yang aktif dengan dilandasi kebersamaan tujuan dan minat sehingga tercipta suasana asah, asih, dan asuh proses pembelajaran menulis cerpen. Siswa mempunyai kesempatan menuliskan ide-idenya dalam sebuah komunitas belajar yang dilandasi perasaan kebersamaan yang tinggi. Guru sebagai pembimbing mendampingi siswa memperoleh pengalaman kognitif, pelatihan imajinasi, serta pelatihan penggunaan bahasa lisan dan tulis dalam memproduksi cerpen. Gagasan strategi A3 selaras dengan pandangan tokoh pendidikan, Ki Hajar Dewantara (1962:13-15) yang menjelaskan bahwa pendidikan kita tidak memakai syarat paksaan akan tetapi dengan prinsip momong, among, dan ngemong. Pendidik hanya mencampuri kehidupan peserta didik ketika melakukan kesalahan. Selain itu,pendidikperlu juga menanamkan jiwa yang (1) tetep, antep, dan mantep; yakni ketetapan pikiran dan batin itulah yang menentukan kreativitas seseorang. Jika tetep dan antep itu sudah ada, maka mantep itu datang dengan sendirinya, (2) ngandel, kandel, kendel, dan bandel yakni percaya dengan pendirian yang tegak, selanjutnya kendel (berani) dan bandel (tawakal) akan menyusul sendiri, dan (3) neng, ning, nung, dan nang yakni kesucian pikiran dan kebatinan yang didapat dengan ketenangan hati, itulah yang mendatangkan kekuasaan. Bila hal tersebut ditanamkan pada semua siswa, maka akan tumbuh sikap saling memberikan kontribusi dalam menyelesaikan persoalan dalam pembelajaran antarsiswa. Dengan demikian, suasana kelas menjadi kondusif karena siswa bersikapsaling momong, among, dan ngemong yang pada prinsipnya sama dengan asah, asih, dan asuh antarsiswa. Penelitian ini dilaksanakan dengan desain pengembangan, yang mencakup tiga tahap kegiatan yaitu, prapengembangan (studi pendahuluan untuk mengumpulkan informasi kondisi awal pembelajaran menulis cerpen), pengembangan (penulisan draf model), dan uji coba (uji ahli dan uji lapangan). Uji Ahli melibatkan ahli teknologi pendidikan, ahli pembelajaran sastra, dan ahli sastra. Adapun uji lapangan melibatkan sejumlah guru mata pelajaran bahasa Indonesia dan siswa. Data berupa koreksi, saran-saran, komentar, dan kritik yang disampaikan melalui instrumen pengumpulan data, catatan yang langsung ditulis pada berkas model, disampaikan secara lisan dalam kegiatan diskusi atau wawancara, dan dituliskan pada lembar instrumen pengumpulan data. Pelaksanaan ketiga kegiatan tersebut didukung sejumlah instrumen penelitian berupa: (1) panduan pengamatan, (2) panduan wawancara, (3) rubrik penilaian model (untuk ahli, guru, dan siswa), dan (4) pedoman pengembangan. Analisis data dilakukan untuk mengkaji kelemahan dan kekuatan produk sebagai titik tolak untuk melakukan revisi. Hasil uji ahli secara umumdapat disimpulkan bahwa kualitas produk sudah memadai untuk diimplementasikan di lapangan. Saran-saran yang disampaikan ahli dalam perbaikan produk yakni (a) lebih memperjelas konsep implementasi strategi A3 dalam pembelajaran, (b) memperjelas konsep isi pada kompetensimenulis cerpen berdasarkan kehidupan orang lain,dan (c) menyelaraskan indikator dengan tujuan pembelajaran. Adapun kelebihan produk yakni strategi A3 dipandang kontekstual untuk dilaksanakan di lapangan (khususnya di lokasi penelitian) karena didukung sikap budaya (Jawa) peserta didik yang masih berkembang di lingkungan sehari-hari mereka. Hasil telaah guru dapat dismpulkan bahwa produk dapat mendukung tugas guru dalam melaksanakan pembelajaran menulis cerpen. Saran-saran revisi yang disampaikan guru yakni (a) peneliti perlu menyelaraskan antara indikator dengan tujuan pembelajaran dan (b) RPP dilengkapai dengan lembar kerja/tugas. Berdasarkan hasil uji lapangan yang melibatkan empat kelas diperoleh kesimpulan bahwa perangkat pembelajaran dapat mendukung proses belajar siswa dengan baik. Proses asah, asih, dan asuh menumbuhkan suasana belajar yang menyenangkan yang dilandasi perasaan kebersamaan yang tinggi, keinginan untuk saling mendukung, dan produktivitas hasil belajar yang memadai. Uji lapangan melalui penelitian eksperimen semu menunjukkan hasil efektif. Dari keempat analisis data statistik di empat kelas uji coba, keseluruhannya menunjukkan hasil yang sama, yaitu terdapat perbedaan yang signifikan antara nilai praasesmen dan posasesmen. Dengan demikian dapat disimpulkan bahwa model perangkat pembelajaran menulis cerpen dengan strategi A3 yang dikembangkan efektif digunakan dalam pembelajaran menulis cerpen di SMA. Produk pengembangan ini telah melalui beberapa kajian, penilaian, dan uji coba kepada subjek yang lebih tepat (ahli, guru, dan siswa), harapan pengembangan akan memperbanyak media pembelajaran ini secara umum untuk digunakan disekolah-sekolah.

Manajemen pondok pesantren dalam meyiapkan guru bantu agama di madrasah (studi kasus di Pondok Pesantren Sidogiri Pasuruan) / oleh Bashori Alwi

 

Kontribusi peran guru program sarjana mengajar dan persepsi siswa terhadap perilaku belajar siswa serta hasil belajar produktif SMK di Jawa Timur / Riana Nurmalasari

 

ABSTRAK Nurmalasari, Riana. 2016. Kontribusi Peran Guru Program Sarjana Mengajar dan Persespsi Siswa terhadap Perilaku Belajar Siswa serta Hasil Belajar Produktif SMK di Jawa Timur. Tesis, Program Studi Pendidikan Kejuruan Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Mardji, M.Kes (II) Dr. Andoko, M.T. Kata Kunci: peran guru, sarjana mengajar, persepsi siswa, perilaku belajar, hasil belajar, SMK. Salah satu permasalahan yang dihadapi pemerintah untuk mengembangkan SMK yaitu kurangnya guru produktif dan tidak meratanya sebaran guru di Indonesia. Sejak tahun 2008 Direktorat Jenderal Guru dan Tenaga Kependidikan, Direktorat Jenderal Pendidikan Dasar dan Menengah telah menggulirkan program sarjana mengajar dalam rangka membantu pemenuhan guru produktif di SMK yang masih berstatus sebagai sekolah USB (Unit Sekolah Baru). Pasca 8 tahun bergulirnya program sarjana mengajar di Indonesia, banyak perubahan yang terjadi pada SMK. Hal tersebut dapat dilihat dari semakin bertambahnya jumlah SMK dari tahun ke tahun serta proses pembelajaran yang semakin baik.Penelitian ini bertujuan untuk mengetahui kontribusi peran guru program sarjana mengajar dan persepsi siswa terhadap perilaku belajar siswa serta hasil belajar produktif SMK di Jawa Timur. Penelitian ini menggunakan pendekatan kuantitatif. Populasi dari penelitian ini yaitu siswa kelas X di SMKN 4 Bojonegoro, SMKN 1 Tuban, SMKN 3 Tuban, SMKN 3 Boyolangu Tulungagung teknik permesinan yang berjumlah 260 siswa dengan jumlah sampel 164 siswa.. Analisis yang digunakan yaitu analisis jalur (path analysis). Hasil yang diperoleh dari penelitian ini yaitu: (1) Terdapat kontribusi yang signifikan peran guru program sarjana mengajar terhadap hasil belajar program keahlian teknik permesinan SMK di Jawa Timur secara langsung sebesar 13,54% dan secara tidak langsung sebesar 19,89%, (2) Terdapat kontribusi yang signifikan persepsi siswa terhadap hasil belajar program keahlian teknik permesinan SMK di Jawa Timur secara langsung sebesar 13,91% dan secara tidak langsung sebesar 18,49%, (3) Terdapat kontribusi yang signifikan perilaku belajar terhadap hasil belajar program keahlian teknik permesinan SMK di Jawa Timur secara langsung sebesar 5,24%. Hasil penelitian ini diharapkan dapat ditindaklanjuti oleh stakeholder SMK sebagai bahan pertimbangan untuk memperbaiki kualitas penyelenggaraan pendidikan.

Pengembangan media pembelajaran audio visual mata pelajaran biologi kelas VIII semester II di SMPN 15 Malang / Maulana Andri Firmansyah

 

Kata kunci: Pengembangan, Media pembelajaran, audio visual, Biologi. Media audio visual merupakan gabungan antara suara dan rupa sehingga terbentuk media video. Media audio visual adalah merupakan media atau penggunaan materi dan penyerapannya melalui pandangan dan pendengaran sehingga membangun kondisi yang dapat membuat siswa mampu memperoleh pengetahuan, keterampilan, atau sikap. SMPN 15 Malang, sekolah yang akan dilaksanakannya pengembangan ini merupakan sekolah yang sistem pembelajarannya optimal terbukti dengan hasil belajar siswa yang memuaskan. Sekolah ini bukannya tidak memiliki permasalahan dalam proses pembelajaran, menurut observasi yang dilakukan, pembelajaran dikelas pada mata pelajaran biologi dengan materi Reaksi Fotosintesis, Sistem Pernapasan Pada Manusia dan Vertebrata, Sistem Transportasi Pada Manusia, Bagian-bagian Bunga. Guru menyampaikan materi dengan metode ceramah, ini membuat siswa salah persepsi mengenai materi yang ada dalam pembelajaran, karena materi prosedural yang mengenai sebuah proses butuh penjelasan secara detail. Adapun dengan media gambar yang terdapat dalam buku, gambar tidak dapat menunujukan secara detail proses awal sampai akhir dari materi pembelajaran tersebut, dengan itu hasil belajar siswa banyak yang dibawah standar ketuntasan minimal (SKM) yang ditetapkan sekolah. Materi Reaksi Fotosintesis, Sistem Pernapasan Pada Manusia dan Vertebrata, Sistem Transportasi Pada Manusia, Bagian-bagian Bunga merupakan materi yang membutuhkan media gerak untuk dijelaskan dalam pembelajaran, semua terkait dengan tujuan pembelajaran yang harus dicapai oleh siswa dalam materi tersebut. Dengan itu pembelajaran ini memerlukan media audio visual, karena media audio visual merupakan media yang dapat menampilkan sebuah proses dan terdapat suara untuk menjelaskan proses tersebut. Adapun tujuan pengembangan adalah menghasilkan media pembelajaran audio visual yang teruji kevalidannya serta lebih efektif dalam membantu guru untuk memecahkan masalah pembelajaran dikelas dengan membuat siswa fokus memperhatikan penjelasan materi melalui media tersebut. Media pembelajaran audio visual ini dikembangkan dengan mengadaptasi model pengembangan Sadiman yang terdiri dari 10 langkah, yaitu (1) identifikasi kebutuhan, (2) perumusan tujuan, (3) pengembangan materi, (4) mengembangkan alat pengukuran keberhasilan, (5) penulisan naskah, (6) produksi, (7) menyusun petunjuk pemanfaatan (8) uji coba, (9) revisi. (10) produk siap dimanfaatkan ii Pengembangan media pembelajaran audio visual ini dikembangkan di SMPN 15 Malang pada kelas VIII semester II mata pelajaran biologi dengan materi Reaksi Fotosintesis, Sistem Pernapasan Pada Manusia dan Vertebrata, Sistem Transportasi Pada Manusia, Bagian-bagian Bunga. Pengambilan data pada pengembangan ini menggunakan data kuantitatif dan kualitatif. Kualitatif meliputi hasil validasi ahli media, ahli materi dan audien (siswa), adapun hasil validasi tersebut adalah: ahli media dengan persentase 82,5 %, ahli materi dengan persentase 80% dan audien (siswa) dengan persentase 82,4%. Sedangkan data kuantitatif meliputi hasil pre test dan post test, adapun hasil pre test dalam persentase 44,1% dan hasil post test dalam persentase 64,6%. Berdasarkan hasil data kualitatif diatas dapat disimpulkan bahwa pengembangan media pembelajaran audio visual di SMPN 15 Malang dapat dikatagorikan layak dipergunakan dalam proses pembelajaran di kelas khususnya kelas VIII semester II mata pelajaran biologi dengan materi Reaksi Fotosintesis, Sistem Pernapasan Pada Manusia dan Vertebrata, Sistem Transportasi Pada Manusia, Bagian-bagian Bunga. Sedangkan menurut data kuantitatif diatas dapat disimpulkan bahwa media pembelajaran audio visual ini dapat dikatakan efektif karena terjadi peningkatan hasil belajar siswa. Pengembangan disini mengalami sedikit kendala dalam melaksanakan pengembangan media audio visual yakni tampilan media audio visual banyak mengalami revisi, dan pemanfaatan media kurang maksimal dalam pembelajaran. Pengembang menyarankan bagi pengembang selanjutnya lebih mengkaji lagi pemilihan materi, pemilihan software untuk mengembangkan media audio visual berikutnya dan mampu memberikan tampilan media audio visual lebih layak dan sesuai dengan materi pembelajaran. Bagi guru sebelum menampilkan media audio visual harus memperhatikan petunjuk pemanfaatan dengan seksama. Seterusnya bagi siswa agar media pembelajaran audio visual ini dapat menjadi salah satu variasi proses pembelajaran dikelas.

Dampak rayonisasi dalam penerimaan murid baru sebagai upaya peningkatan kualitas pendidikan studi kasus pada Sub Rayon 01 SLTPN Kotamadya Probolinggo / oleh Daryono

 

Pembelajaran berbasis masalah untuk meningkatkan pemahaman matematika siswa kelas IX SMP Shalahuddin Malang / Gutomo Wibi Ananggih

 

ABSTRAK Wibi Ananggih, Gutomo. 2016. Pembelajaran Berbasis Masalah untuk Meningkatkan Pemahaman Matematika Siswa Kelas IX SMP Shalahuddin Malang. Tesis. Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing : (I) Prof. Dr. Ipung Yuwono M.S., M.Sc., II) Dr.rer.nat. I Made Sulandra M.Si. Kata Kunci : Masalah, Pembelajaran, Pemahaman Berdasarkan wawancara didapatkan bahwa siswa tidak dapat menjelaskan kembali tentang materi yang baru diajarkan dan tidak dapat memberikan contoh masalah dalam kehidupan sehari-hari yang berkaitan dengan materi yang diajarkan. Hal tersebut menunjukkan bahwa siswa belum memiliki kemampuan yang menjadi indikator pemahaman. Selain itu, guru sering menggunakan model pembelajaran berbasis masalah tetapi dalam pelaksanaannya pembelajaran cenderung terpusat pada guru. Dengan demikian fakta menunjukkan terdapat permasalahan dalam pembelajaran matematika pada siswa kelas IX SMP Shalahuddin. Penelitian ini menggunakan rancangan penelitian tindakan kelas untuk menangulangi masalah pembelajaran matematika. Dalam penelitian ini, peneliti adalah instrumen utama. Hasil dari penelitian ini adalah deskripsi tindakan yang dilakukan guru dengan menggunakan model pembelajaran berbasis masalah. Pengumpulan data dilakukan dengan rekaman hasil pekerjaan LKS dan tes, serta lembar pengamatan aktivitas guru dan siswa. pengecekan keabsahan data dilakukan dengan triangulasi sumber data, data, teori dan metodologi. Hasil dari penelitian ini menunjukkan bahwa pembelajaran berbasis masalah yang telah meningkatkan pemahaman matematika siswa terdiri dari lima tahapan, yaitu: a) Membaca masalah adalah masing-masing kelompok membaca dan berdiskusi untuk memahami masalah SPLDV yang berkaitan dengan kehidupan sehari-hari; b) Mendefinisikan masalah adalah setiap kelompok menuliskan informasi dalam masalah dan target solusi yang akan dicari dengan bahasa sendiri; c) Menemukan ide “Pengilhaman” adalah kelompok diminta untuk menemukan pola dengan cara mengisi tabel pada LKS, kemudian pola yang telah ditemukan digunakan untuk menentukan model SPLDV dari masalah; d) Memecahkan masalah adalah setiap kelompok menggunakan model SPLDV yang telah didapatkan untuk mendapatkan penyelesaian dengan menggunakan metode grafik, subtitusi, atau eliminasi; e) Menyampaikan hasil belajar adalah setiap kelompok ditunjuk perwakilan untuk menyampaikan hasil pengerjaan yang dimiliki dari diskusi masing-masing kelompok. Perwakilan kelompok tidak menyampaikan secara keseluruhan hasil diskusi, melainkan hanya poin-poin hasil diskusi sesuai yang diperintah guru. Peningkatkan pemahaman matematika siswa yang ditunjukkan dengan siswa memiliki kemampuan sesuai dengan tujuh indikator pemahaman, yaitu: a) Menginterpretasi; b) Mencontohkan; c) Mengelompokkan; d) Merangkum; e) Menginferensi; f) Membandingkan; g) Menjelaskan. Setiap indikator diskor, kemudian skor diakumulasikan menjadi skor akhir siklus. Dihasilkan 83% dari seluruh siswa, yaitu 29 dari 35 jumlah siswa kelas telah memiliki skor lebih dari sama dengan 75. Bahkan terdapat dua siswa yang mendapat skor 100.

Identifikasi kemampuan siswa kelas III IPA cawu II SMUN 5 Malang tahun pelajaran 1998/1999 dalam memahami senyawa kompleks unsur-unsur transisi periode ke empat / oleh Sarah Yulias Tanti

 

Kesatuan tuturan direktif dalam interaksi pembelajaran di SMA Negeri 1 Batu / Mardiyah Putri A.

 

ABSTRAK Astuti, Mardiyah Putri. 2016. Kesantunan Tuturan Direktif dalam Interaksi Pembelajaran di SMA Negeri 1 Batu. Program Studi Pendidikan Bahasa Indonesia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Widodo, HS., M.Pd., (II) Dr. Sunoto, M.Pd. Kata Kunci: kesantunan tuturan, interaksi pembelajaran, tuturan direktif, strategi kesantunan, aspek budaya. Kesantunan tuturan dalam interaksi pembelajaran di dalam kelas dilakukan melalui bentuk tuturan direktif, memperhatikan strategi tuturan, dan dipengaruhi oleh aspek budaya. Penelitian ini dilaksanakan untuk meneliti bentuk, strategi, dan aspek budayanya. Tujuan penelitian ini adalah untuk mendeskripsikan bentuk kesantunan direktif, strategi kesantunan, dan aspek budaya Jawa dalam interaksi pembelajaran antara guru dan siswa. Pengkajian terhadap bentuk tuturan direktif, strategi kesantunan, dan aspek budaya Jawa dalam tuturan dilakukan dengan mengggunakan teori dan panduan analisis berdasarkan teori tindak tutur direktif Bach dan Harnish untuk bentuk tuturan direktif, teori kesantunan Brown dan Levinson untuk strategi kesantunan tuturan, dan teori tingkat tutur Gunarwan untuk aspek budaya Jawa. Ranah kesantunan yang diteliti adalah interaksi pembelajaran SMA Negeri 1 Batu. Data penelitian ini yakni (1) transkrip rekaman tuturan guru dan siswa, (2) catatan lapangan, dan (3) hasil wawancara. Dalam penelitian ini, perpanjangan pengamatan dan pemeriksaan rekan sejawat digunakan untuk mengecek keabsahan data. Bentuk tuturan direktif dalam interaksi pembelajaran ditandai dengan (1) direktif permintaan, (2) direktif pertanyaan, (3) direktif perintah, (4) direktif larangan, (5) direktif pemberian izin, dan (6) direktif nasihat. Hasil analisis mengenai bentuk tuturan direktif menunjukkan bahwa guru melakukan kesantunan secara dominan melalui perintah, larangan, izin, dan nasihat, sedangkan bentuk tuturan direktif dilakukan oleh guru dan siswa dengan mempertimbangkan aspek budaya. Strategi kesantunan tuturan dalam interaksi pembelajaran ditandai dengan (1) memberi perhatian, (2) melebihkan dalam memberi komentar atau pujian, (3) menegaskan, (4) menggunakan penanda sebagai anggota kelompok yang sama, (5) mengupayakan kesepakatan, (6) menghindari perbedaan pendapat, (7) mengisyaratkan kesamaan pandangan, (8) menggunakan lelucon, (9) menampilkan pengetahuan penutur dan mempertimbangkan keinginan penutur, (10) menawarkan, berjanji, (11) bersikap optimis, (12) menyertakan penutur dan petutur dalam kegiatan, (13) memberi atau meminta alasan, (14) menerima atau menampilkan sikap timbal balik atau saling, dan (15) memberi hadiah pada petutur. Hasil analisis mengenai strategi kesantunan tuturan menunjukkan bahwa guru dan siswa melakukan tuturan untuk kesantunan dengan beragam strategi. Aspek budaya dalam interaksi pembelajaran ditandai dengan (1) aspek kurmat (hormat), (2) andhap asor (rendah hati), (3) empan papan (sadar akan tempat), dan (4) tepa selira (tenggang rasa). Hasil analisis mengenai aspek budaya dalam tuturan guru dan siswa menunjukkan bahwa aspek budaya Jawa diintegrasikan dalam tuturan yang dilakukan dalam kelas. Bentuk tuturan direktif, strategi kesantunan direktif, dan aspek budaya dilakukan oleh dominan dilakukan oleh guru dan siswa untuk kepentingan tertentu. Hal itu menunjukkan eksistensi kesantunan tuturan dalam interaksi pembelajaran di SMA Negeri 1 Batu. Dari simpulan tersebut, maka disarankan kepada guru dan siswa untuk menggunakan bentuk, strategi, aspek budaya dengan cara yang kontributif dan konstruktif, sehingga dapat memberikan pencerahan baik bagi seluruh elemen dalam interaksi pembelajaran.

Aktivitas pers mahasiswa Kota Malang tahun 1992-2002 / Mohamad Fahmi

 

Kata Kunci: aktivitas, pers mahasiswa, kota Malang Aktivitas pers mahasiswa kota Malang memiliki keunikan tersendiri. Dari awal tahun 1990an sampai 2000an terjadi beberapa peristiwa yang menjadi tonggak sejarah pers mahasiswa di kota Malang. Namun, dari waktu ke waktu berbagai peristiwa yang terjadi itu sudah tidak begitu diingat oleh penggiat pers mahasiswa saat ini, apalagi masyarakat luas. Minimnya transfer informasi dari para penggiat pers mahasiswa senior kepada juniornya merupakan satu sebab aktivitas pers mahsiswa tahun 1990an dan awal 2000an semakin dilupakan. Latar belakang inilah yang mendorong peneliti untuk melakukan penelitian tentang aktivitas pers mahasiswa Kota Malang tahun 1992-2002. Rumusan masalah dalam penelitian ini adalah: (1) Bagaimana latar belakang proses berkembangnya pers mahasiswa di Kota Malang pada tahun 1992 sampai 2002?, (2) Bagaimana aktivitas pers mahasiswa di Kota Malang pada tahun 1992 sampai 2002?. Dari rumusan masalah yang ada, peneliti mempunyai tujuan sebagai berikut: Mendeskripsikan proses berkembangnya pers mahasiwa di kota Malang pada tahun 1992 sampai 2002 dan mendeskripsikan aktivitas pers mahasiswa di Kota Malang pada tahun 1992 sampai 2002. Dalam penelitian ini peneliti menggunakan metode penelitian sejarah. Metode ini memiliki 5 tahapan yaitu: (1) pemilihan topik, (2) heuristik, (3) verivikasi, (4) interpretasi, (5) historiografi. Hasil dari penelitian ini menunjukkan bahwa universitas-universitas besar di Malang baik negeri atau swasta memberikan ruang kepada penggiat-penggiat pers mahasiswa. Oleh karena itu pada awal tahun 1990an pers mahasiswa sudah tersebar di universitas-universitas Kota Malang. Seperti pers mahasiswa SiarHMP di IKIP Malang, Kavling 10, Indikator, Dianns, Solid, Manifest di Univeritas Brawijaya, Unit Aktifitas Pers Mahasiswa (UAPM) Inovasi di STAIN Malang, Mei di Universitas Islam Malang, Civitas di Universitas Merdeka Malang. Pers mahasiswa kota Malang pada tahun 1990 telah membuat wadah dalam lingkup kota Malang saja yaitu Forum Komunikasi Pers Mahasiswa Kota Malang (FKPMM). Tahun 1992 adalah tahun kebangkitan pers mahasiswa Indonesia. Tahun kebangkitan ini ditandai dengan dideklarasikannya sebuah wadah bagi pers mahasiswa di kota Malang, tepatnya di Universitas Brawijaya dalam sebuah acara lokakarya pers mahasiswa Indonesia tanggal 15 sampai 18 Oktober 1992. Wadah itu bernama Perhimpunan Penerbit Mahasiswa Indonesia (PPMI). Acara ini dihadiri oleh 72 peserta yang merupakan perwakilan dari 37 Perguruan Tinggi Negeri dan Swasta di Indonesia. Aktivitas pers mahasiswa kota Malang bisa dikatakan pada awal-awal tahun 1990an adalah fase pembangkitan. Dengan ditandai hadirnya FKPMM dan PPMI. Dari wadah-wadah ini terjadi komunikasi dan pembentukan kultur pers mahasiswa di Malang. Tahun 1995 setelah terjadi kongres PPMI di Jember, pers mahasiswa di Malang turut mengalami perubahan. Salah satu sebabnya adalah perubahan nama PPMI dari “penerbit” menjadi “pers” sehingga menjadi Pehimpunan Pers Mahasiswa Indonesia. PPMI kemudian menginstruksikan kepada seluruh kota dan dewan kota yang menjadi anggota untuk mengganti nama penerbit menjadi pers. Eksistensi pers mahasiswa kota Malang mengalami perubahan setelah pergantian rezim pemerintahan di Indonesia. Kalau pada masa Orde Baru pers mahasiswa kota Malang eksistensi dan pengaruhnya dalam gerakan mahasiswa cukup besar namun tidak demikian setelah Indonesia mengalami reformasi. Pers mahasiswa di kota Malang turut mengalami depresi dan bahkan mengalami krisis sumber daya manusia. Meskipun demikian aktivitas pers mahasiswa kota Malang tidak menjadi padam. Pers mahasiswa kota Malang masih terus kelihatan aktif bahkan dengan adanya “gerakan media” pers mahasiswa kota Malang terus bersemangat belajar dan berkarya Penelitian selanjutnya diharapkan mampu menutupi penelitian ini baik dari segi data dan sumber. Tema seperti gerakan pers mahasiswa pada masa reformasi, sejarah pers mahasiswa di masing-masing kampus belum ada yang membahasnya sehingga kesempatan melakukan penelitian bertemakan pers mahasiswa masih terbuka lebar dan yang penting penelitian selanjutnya diharapkan mampu menutupi kekurangan dari penelitian ini.

Perencanaan regulator elektronik pada mobil Mitsubishi T 120 1975
oleh Mujiono

 

Visi feminisme dalam novel-novel Indonesia karya pengarang-pengarang wanita dekade 19970-an-1990-an / oleh Aleda Mawene

 

Penerapan permainan tepuk tebak kata beruntun untuk meningkatkan kemampuan berbicara anak kelompok B di TK Dharma Wanita Persatuan III Pasuruan / Fauziah Rizky Wikandari

 

ABSTRAK Wikandari, Fauziah Rizky. 2016. Penerapan Permainan Tepuk Tebak Kata Beruntun untuk Meningkatkan Kemampuan Berbicara Anak Kelompok B di TK Dharma Wanita Persatuan III Pasuruan. Skripsi Prodi S1 – Pendidikan Guru Pendidikan Anak Usia Dini, Jurusan Kependidikan Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Tomas Iriyanto, S.Pd, M.Pd (II) Eny Nur Aisyah, S.Pd.I, M.Pd. Kata Kunci: Permainan tepuk tebak kata beruntun, kemampuan berbicara, TK B Berbicara merupakan kegiatan untuk mengekspresikan, menyatakan, mengkomunikasikan pikiran, ide, perasaan secara lisan. Ditemukan dari 23 anak sebanyak 13 anak (57%) kesulitan mengembangkan kosakata sehingga anak mengalami keterbatasan dalam membentuk kalimat. Untuk itu diperlukan pembelajaran inovatif dan menyenangkan, agar dapat meningkatkan kemampuan berbicara anak di TK Dharma Wanita Persatuan III Pasuruan. Permainan tepuk tebak kata beruntun sebagai alternatif pemecahan masalah tersebut. Tujuan penelitian ini yaitu:(1) mendeskripsikan penerapan Permainan Tepuk Tebak Kata Beruntun untuk meningkatkan kemampuan berbicara anak kelompok B di TK Dharma Wanita Persatuan III Pasuruan, (2) mendeskripsikan peningkatan kemampuan berbicara anak kelompok B di TK Dharma Wanita Persatuan III Pasuruan setelah dibelajarkan dengan Permainan Tepuk Tebak Kata Beruntun. Penelitian dilaksanakan menggunakan rancangan Penelitian Tindakan Kelas (PTK). Subyek diteliti anak kelompok B TK Dharma Wanita Persatuan III Pasuruan berjumlah 23 anak. Penelitian dilakukan bersiklus meliputi perencanaan, pelaksanaan, pengamatan, dan refleksi. Teknik pengumpulan data yang digunakan adalah observasi dan dokumentasi. Analisis data dilakukan secara deskriptif kualitatif dan kuantitatif. Permainan tepuk tebak kata beruntun dilakukan dengan mengucapkan lirik lagu yang telah didengar dan menjawab pertanyaan secara individu, sehingga anak lebih aktif dalam berbicara. Hasil belajar menggunakan permainan tepuk tebak kata beruntun menunjukkan skor rata-rata kemampuan berbicara anak pada siklus I mencapai 72,01, meningkat pada siklus II menjadi 87,78. Kemudian jumlah persentase ketuntasan kelas anak pada siklus I mencapai 52,18%, meningkat pada siklus II menjadi 86,96%. Pada siklus II sudah menunjukkan adanya peningkatan kemampuan berbicara anak sangat baik, sehingga penelitian dihentikan. Disimpulkan bahwa permainan tepuk tebak kata beruntun dapat diterapkan dengan baik dapat meningkatkan kemampuan berbicara anak. Saran untuk guru dapat menerapkan permainan tepuk tebak kata beruntun dengan menyenangkan dan inovatif untuk meningkatkan kemampuan berbicara anak. Untuk meningkatkan kemampuan berbicara anak, guru perlu memberikan dorongan, pujian, dan motivasi kepada anak.

Implementasi model investigasi matematika untuk mengefektifkan pembelajaran pengantar aljabar kelas I SD Negeri Kauman II Kodya Malang / oleh Moch. Ichsan

 

Pertanyaan pembelajaran yang mendalam untuk meningkatkan penguasaan konsep kinematika mahasiswa tahun pertama / Ismi Laili Afwa

 

ABSTRAK Afwa, Ismi Laili. 2016.PertanyaanPembelajaran yangMendalamuntuk MeningkatkanPenguasaanKonsepKinematikaMahasiswaTahunPertama. Tesis, ProgramStudiPendidikanFisika, Pascasarjana, UniversitasNegeri Malang. Pembimbing: (I) Dr. Sutopo, M.Si., (II) Dr. EnyLatifah, M.Si. Kata Kunci:pemahamankonsep, kinematika, program deep learning question Banyakpenelitiansebelumnya yang mengungkapkankesullitansiswadalammemahamikonsep-konsepdasarkinematikadanmenerapkannyapadapemecahansoal. Untukmemfasilitasimahasiswamemahamikonsepkinematikasecarabaikdanmampumemecahkanpermasalahanfisikadalamberbagaikonteksdan format representasi, melaluipenelitianinitelahdikembangkanprogrampendalamanmateriyang berisilatihan-latihansoaldisertaibalikansesegeramungkindandikemasdalambentuk program computer interaktif. Program yang dibuatdinamaiDeep Learning Question (DLQs). Penelitianinimenggunakanpendekatanmixed methoddengan desain embeded experimental untukmenggalisecaralengkapsubjekpenelitian.Subjekpenelitiansebanyak 35 mahasiswa S1 prodipendidikanfisikaUniversitasNegeri Malang.Sebelummenggunakan program, mahasiswatelahmempelajarikonsep-konsepkinematikadikelasperkuliahan regular dandiberikanpretestsoalutama. Setelahpretestutama, mahasiswamengerjakanpretestsoaltambahan. Tesutamamenggunakansoal-soalstandartfisikadasar 1, sedangkantestambahanmenggunakansoal-soal yang semuanyadihadirkanpada program DLQs. Proses mengerjakansoaltestambahandanutamadisertaidenganalasanjawaban.Selanjutnyamahasiswamenggunakan DLQs kemudiandiberikanposttestdaritesutamadantestambahan.Terdapatduaset data penelitian, pretest-postestutamadantambahan. Data yang dianalisissecarakuantitatifadalahskorpenguasaankonsepdenganpaired sample t-test. Data yang dianalisissecarakualitatifadalahdarialasanjawabanmahasiswabaikpretestmaupunposttest. Hasilpenelitianmenunjukkanskorkemampuanpenguasaankonsepmahasiswameningkatsecarasignifikan (p = 0,00)baikpadatesutamamaupuntestambahan. Effect sizedanN-Gainpadatesutamasecaraberurutansebesar 0.86(tinggi)dan0,29 (rendah)sedangkanpadatestambahansebesar 5.47 (sangattinggi)dan0.91(tinggi).Secarakeseluruhanlimakemampuanpenguasaankonsepmahasiswapadatesutama yang diujikanmeningkat.Urutankemampuanpenguasaankonsep yang meningkat paling kuatadalahkemampuanpenguasaankonsepkedua, kesatu, keempat, ketigadankelima.Kemampuanpenguasaankonsepkelimakurangmeningkathalinidisebabkanisibalikan program DLQs hanyamenjelaskansecaraumummengenaiarahpercepatansesaatbelummenguatkanpenguasaankonsepmengenaiperanpercepatansentripetalterhadapv. Apabila v meningkat maka percepatan sentripetal juga meningkat.

Relevansi penyelenggaraan pelatihan menjahit kebutuhan pasar kerja studi kasus di Loka Latihan Usaha Kecil dan Menengah Rembang / oleh Endah Iriani

 

Pengaruh rasio likuiditas, rasio solvabilitas terhadap rasio profitabilitas banking, credits agencies other thanbank, securities yang listing di BEI sebelum dan sesudah krisis global 2008 / Alindra Yanuardi

 

Kata Kunci: Return on Asset, Return on Equity, Cash Ratio, Loan to Asset Ratio, Debt to Equity Ratio, Long Term Debt to Asset Ratio, Sebelum dan Sesudah Krisis Global 2008. Kemampuan perusahaan dalam memperoleh laba disebut profitabilitas. Dalam upaya memperoleh laba, yang perlu diperhatikan adalah pengoptimalan operasional perusahaan dan efektivitas dalam menggunakan aktiva yang dimiliki perusahaan. Namun ada peristiwa penting yang perlu dicermati dan diperlukan tindakan pencegahan atau perbaikan terhadap kinerja perusahaan, yaitu krisis global. Krisis ekonomi global akan menyerang perusahaan lewat kondisi keuangan. Kekurangan dana atau uang akan menyebabkan likuiditas menurun sehingga perusahaan akan mengalami penurunan operasional dan akan menurunkan laba. Krisis global juga dapat menyebabkan beban bunga meningkat akibat adanya melemahnya kurs Rupiah terhadap US$, dan melemahnya ini diikuti meningkatnya jumlah hutang perusahaan yang berbentuk mata uang asing. Dan pada akhirnya akan mengurangi laba bersih perusahaan. Variabel yang digunakan dalam penelitian ini adalah Rasio Likuiditas (cash ratio, loan to asset ratio), rasio solvabilitas (debt to equity ratio, long term debt to asset ratio) sebagai variabel independen dan variabel dependennya adalah rasio profitabilitas (return on asset, return on equity) Tujuan penelitian ini untuk mengetahui kondisi Rasio Profitabilitas, Rasio Likuiditas, dan Rasio Solvabilitas sebelum dan sesudah krisis global 2008. Selain itu penelitian ini juga bertujuan untuk mengetahui pengaruh Rasio Likuiditas dan Rasio Solvabilitas terhadap Rasio Profitabilitas sebelum dan sesudah krisis global 2008 secara parsial. Bertujuan untuk mengetahui pengaruh Rasio Likuiditas dan Rasio Solvabilitas terhadap Rasio Profitabilitas sebelum dan sesudah krisis global 2008 secara simultan. Oleh karena itu penelitian ini menggunakan event study krisis global 2008. Populasi penelitian ini adalah perusahaan-perusahaan indutri keuangan yang telah listing di BEI sejak 2007-2009 seperti Banking, Credits Agencies Other than Bank, Securities sebanyak 60 perusahaan. Metode pengambilan sampel yang digunakan adalah purposive random sampling, dengan kriteria sampel perusahaan harus listing di BEI selama periode 2007-2009 dan perusahaan yang dijadikan sampel adalah perusahaan yang sebagian besar atau seluruh kegiatannya untuk memberikan kredit maka didapat 40 perusahaan sebagai sampel penelitian. Analisa data yang dilakukan terlebih dahulu adalah menganalisa laporan keuangan, selanjutnya mencari dan menganalisa rasio keuangan yang dijadikan variabel, setelah itu analisis regresi linier berganda dan bisa dilakukan uji hipotesis. Hasil penelitian menunjukkan bahwa nilai return on asset dan return on equity sebelum krisis global 2008 mengalami kenaikan. Selain itu cash ratio dan loan to asset ratio pada sebelum krisis global 2008 juga mengalami kenaikan dari tahun 2007-2008. Sedangkan debt to equity ratio dan long term debt to asset ratio pada sebelum krisis global 2008 juga mengalami kenaikan dari tahun 2007-2008. Dari tahun 2008-2009 diketahui return on asset sesudah krisis global 2008 atau dari tahun 2008-2009 mengalami penurunan sedangkan return on equity sesudah krisis global 2008 mengalami kenaikan. Nilai cash ratio dan loan to asset ratio sesudah krisis global 2008 juga mengalami penurunan dari tahun 2008-2009. sedangkan debt to equity ratio mengalami penurunan dari tahun 2008-2009 dan long term debt to asset ratio sesudah krisis global 2008 juga mengalami kenaikan dari tahun 2007-2008. Rasio Likuiditas (cash ratio dan loan to asset ratio) berpengaruh signifikan terhadap return on asset sebelum dan sesudah krisis global 2008. Rasio Likuiditas (cash ratio dan loan to asset ratio) tidak berpengaruh signifikan terhadap return on equity sebelum dan sesudah krisis global 2008. Rasio solvabilitas (debt to equity ratio) berpengaruh signifikan terhadap return on asset sebelum dan sesudah krisis global 2008, sedangkan Rasio solvabilitas (long term debt to asset ratio) tidak berpengaruh signifikan terhadap return on asset sebelum dan sesudah krisis global 2008. Rasio solvabilitas (debt to equity ratio) berpengaruh signifikan terhadap return on equity sebelum dan tidak berpengaruh signifikan terhadap return on equity sesudah krisis global 2008, sedangkan Rasio solvabilitas (long term debt to asset ratio) tidak berpengaruh signifikan terhadap return on equity sebelum dan sesudah krisis global 2008. Secara simultan Rasio Likuiditas dan Rasio Solvabilitas berpengaruh signifikan terhadap return on asset sebelum dan sesudah krisis global 2008, dan secara simultan Rasio Likuiditas dan Rasio Solvabilitas tidak berpengaruh signifikan terhadap return on equity sebelum dan sesudah krisis global 2008. Saran yang bisa disampaikan antara lain kepada karyawan sebaiknya lebih peka terhadap apa yang terjadi dalam perekonomian perusahaan maupun global, karena itu dapat dijadikan tambahan dalam menentukan karir ke depannya di dalam perusahaan. Bagi perusahaan sebaiknya lebih waspada terhadap isu-isu dan gejala akan terjadinya kembali krisis ekonomi global. Bagi investor dan masyarakat diharapkan lebih berhati-hati dalam menanamkan dananya di perbankan. Karena dana tersebut bisa dijadikan tambahan modal bagi perusahaan, dan apabila perusahaan tidak mampu mengembalikan dana tersebut maka dana yang sudah ditanamkan kemungkinan tidak akan kembali. Terlebih dengan adanya krisis ekonomi global yang pasti punya dampak besar bagi perusahaan. Bagi pemerintah diharapkan mampu membantu perusahaan dalam mempertahankan diri ketika terjadi krisis global utamanya dengan mengeluarkan kebijakan-kebijakan. Bagi peneliti selanjutnya sebaiknya dapat mengambil kriteria sampel yang lebih baik, supaya hasil penelitian bisa lebih akurat, signifikan, dan sesuai dengan teori yang ada.

Analisis program pemberdayaan ekonomi masyarakat pesisir di Desa Bulurejo Kecamatan Tempursari Kabupaten Lumajang / Rohmatul Aliyah

 

Pengaruh kualitas pelayanan jasa terhadap loyalitas nasabah Bank BNI 46 Malang (studi pada nasabah BNI 46 Malang Kantor Cabang Pembantu Universitas Negeri Malang) / Mohammad Iman Fahrian

 

Kata Kunci: Kualitas Pelayanan Jasa (Bukti Fisik, Keandalan, Daya Tanggap, Jaminan, empati), Loyalitas Nasabah. Pertumbuhan dunia perbankan dewasa ini semakin berkembang di Indonesia. Hal ini dengan ditandai banyak berdirinya bank - bank swasta, baik lokal maupun penanam modal asing. Semua itu tidak terlepas dari berbagai keberhasilan pembangunan dan pertumbuhan ekonomi Indonesia yang cukup pesat. Masing-masing bank berusaha untuk menarik nasabah sebanyak-banyaknya dengan meningkatkan kualitas baik dari segi pelayanan, hadiah, produk, bunga, sampai dengan pemanfaatan teknologi yang semakin berkembang. Perusahaan penyedia jasa perbankan harus mulai berkonsentrasi pada loyalitas nasabah, bukan hanya pada kepuasan nasabah semata. Karena pada saat ini perang pemasaran sudah menjadi strategi nilai, dan persaingan industri sudah menjadi persaingan nilai, maka tidaklah mencukupi bagi perusahaan perbankan untuk berkonsentrasi semata-mata pada kepuasan nasabah. Sasaran akhir perusahaan haruslah loyalitas nasabah, karena nasabah yang puas akan menjadi nasabah yang loyal. Jenis penelitian ini adalah penelitian kuantitatif digunakan untuk meneliti pada populasi atau sampel tertentu dan analisis data bersifat kuantitatif. Teknik sampel menggunakan purposive sampel sebanyak 85 responden (Nasabah BNI Kantor Cabang Pembantu Universitas Negeri Malang) sebagai populasi. Metode pengumpulan data yang digunakan dalam penelitian ini adalah menggunakan angket/kuesioner yang terdiri dari 30 item pertanyaan. Analisis data menggunakan uji asumsi klasik yaitu uji normalitas, uji multikolinieritas, dan uji heterokedastisitas serta menggunakan analisis regresi linier berganda dengan uji regresi secara parsial (uji t) dan uji regresi secara simultan (uji F). Pengolahan data yang dilakukan peneliti dibantu dengan program SPSS 16 for Windows. Hasil penelitian ini menunjukan bahwa (1) Kondisi Kualitas Pelayanan Jasa yang terdiri dari bukti fisik, keandalan, daya tanggap, jaminan dan empati dalam mempengaruhi Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang tergolong sudah baik. (2)Kondisi Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang tergolong loyal atau setia terhadap BNI 46. (3) Bukti Fisik mempunyai pengaruh positif dan signifikan terhadap Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang. Keandalan juga mempunyai pengaruh postif dan signifikan terhadap Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang. Daya Tanggap juga mempunyai pengaruh positif dan signifikan terhadap Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang. Variabel Jaminan pun juga mempunyai pengaruh positif dan signifikan terhadap ii Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang. Serta variabel Empati juga mempunyai pengaruh positif dan signifikan terhadap Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang. (4) Terdapat pengaruh yang positif dan signifikan variabel bukti fisik, keandalan, daya tanggap, jaminan dan empati secara bersama-sama terhadap loyalitas nasabah BNI Malang Kantor Cabang Pembantu Universitas Negeri Malang. (5) Berdasarkan Sumbangan Efektif (SE), variabel Daya Tanggap memilki pengaruh paling dominan terhadap Loyalitas Nasabah BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang. Sedangkan dari kelima variabel tersebut variabel Keandalan dan Jaminan mempunyai pengaruh paling kecil. Hal ini dapat dilihat dari hasil signifikansi-nya yang hanya sebesar 0,49 untuk variabel Keandalan dan 0,47 untuk variabel Jaminan. Dengan demikian disarankan (1) Agar pihak BNI 46 Malang Kantor Cabang Pembantu Universitas Negeri Malang lebih meningkatkan keandalan karyawan dalam melayani dan memenuhi kebutuhan dari para nasabah-nya. Selain itu juga harus lebih memperbaiki jaminan dari transaksi yang dilakukan nasabah, tanggung jawab karyawan dalam pelayanan serta karyawan harus lebih profesional dalam bidangnya. Karena dari penelitian ini Keandalan dan Jaminan yang di berikan BNI 46 Kantor Cabang Pembantu Universitas Negeri Malang dirasa masih kurang. (2) Demi terciptanya nasabah yang loyal terhadap BNI Malang, maka perusahaan perlu melakukan hal seperti ini : Melakukan inventarisasi terhadap nasabah-nasabah yang selama ini puas dan loyal atas pelayanan yang diberikan. Mendorong dengan cara memberikan hadiah atau bonus terhadap nasabah-nasabah yang loyal untuk mempertahankan keloyalitasanya terhadap BNI Malang. (3) Dengan kualitas pelayanan yang baik maka nasabah akan merasa puas dan dalam jangka panjang akan menumbuhkan loyalitas nasabah pada pihak penyedia jasa, dalam penelitian ini untuk mengukur pengaruh kualitas pelayanan terhadap loyalitas nasabah dilakukan secara langsung artinya tanpa melalui perantara variabel moderating yang dalam hal ini adalah kepuasan nasabah, maka disarankan perlu ada penelitian lebih lanjut dengan jumlah responden yang lebih banyak dan melibatkan variabel kepuasan pelanggan. (4) Saran bagi penelitian selanjutnya yaitu, untuk peneliti selanjutnya diharapkan lebih menyempurnakan penelitian ini dengan menanbah variabel bebas (kualitas pelayanan jasa) yang tidak terbatas pada lima variabel, yaitu bukti fisik, keandalan, daya tanggap, jaminan dan empati. Hal ini bertujuan agar penelitian yang sejenis tentang pengaruh kualitas pelayanan jasa terhadap loyalitas nasabah lebih sempurna dan bervariasi sehingga dapat dijadikan referensi penelitian-penelitian berikutnya.

Perencanaan mesin pencampur (mixer) makanan ternak ayam kapasitas 1500 kg/jam
oleh Syaiful Huda

 

Perbedaan faktor-faktor yang melatarbelakangi pengambilan keputusan memilih pasangan ditinjau dari kelestarian hubungan cinta / Mar'atush Sholihah

 

Kata Kunci: Faktor-Faktor Pengambilan Keputusan Memilih Pasangan, Kelestarian Hubungan Cinta Putusnya hubungan cinta saat masih pacaran dan kasus-kasus perceraian merupakan ketidakcocokan yang bersumber dari kesalahan memilih pasangan yang sesuai. Penelitian ini bertujuan untuk mendeskripsikan beberapa hal, untuk mengetahui faktor-faktor yang melatarbelakangi pengambilan keputusan memilih pasangan, mengetahui besar sumbangan masing-masing faktor, mengetahui perbedaan faktor-faktor antara hubungan cinta selama 1 tahun, 3 tahun dan pasangan yang sudah menikah, dan mengetahui perbedaan faktor-faktor antara jenis kelamin laki-laki dan perempuan. Penelitian ini menggunakan metode penelitian Cross-Sectional. Data penelitian berupa data kuantitatif. Pengumpulan data yang dilakukan dengan menggunakan teknik Accidental sampling. Instrument yang digunakan untuk mengumpulkan data berupa skala yaitu Skala Memilih Pasangan. Variabel bebas penelitian ini ialah lamanya hubungan cinta dan jenis kelamin dan variabel terikatnya ialah pengambilan keputusan memilih pasangan. Sampel penelitian ialah 100 mahasisiwa Fakultas Ilmu Pendidikan di Universitas Negeri Malang, yang berusia 19-24 tahun. Berdasarkan hasil analisis data tersebut, diperoleh 4 kesimpulan hasil penelitian sebagai berikut. Pertama diketahui terdapat 5 faktor yang melatarbelakangi pengambilan keputusan memilih pasangan. Meliputi faktor keamanan, faktor keintiman, faktor kesamaan, faktor kedekatan dan faktor asertif. Kedua, Masing-masing faktor hasil analisis faktor memberikan sumbangan terhadap PKMP. Faktor keamanan memberikan total sumbangan 25.122 %, faktor keintiman memberikan total sumbangan 10.961 %, faktor kesamaan memberikan total sumbangan 9.437 %, faktor kedekatan memberikan total sumbangan 5.418 %, faktor asertif memberikan total sumbangan 4.735 %. Ketiga, tidak ada perbedaan faktor-faktor yang melatarbelakangi PKMP antara hubungan cinta selama 1 tahun, 3 tahun dan pasangan yang sudah menikah. Keempat, tidak ada perbedaan faktor-faktor yang melatarbelakangi PKMP antara jenis kelamin laki-laki dan jenis kelamin perempuan. Disarankan kepada pasangan, sejak mulai berpacaran untuk lebih dahulu mempertimbangkan dengan matang faktor-faktor apa saja dalam memilih pasangannya. kepada peneliti selanjutnya, untuk menyempurnakan penelitian agar dapat menjelaskan 45.327% varian yang tidak tercover oleh penelitian ini.

Pengembangan paket pembelajaran matakuliah akuntansi keuangan I pada Program Studi Pendidikan Ekonomi Jurusan PIPS FKIP Universitas Nusa Cendana Kupang / oleh Lede Kette

 

Karakteristik tes buatan guru pendidikan pancasila dan kewarganegaraan di Sekolah Menengah Umum Negeri Kotamadya Kupang / oleh Dorcas Langgar

 

Pengembangan model pemanasan senam lantai untuk siswa SMP Negeri se Kota Malang oleh Antonius Dodi Windanto

 

Analisis kemampuan proses sixpack weibull studi kasus bobot benang sliver di PT. Industri Sandang Nasantara Lawang / Eva Widiyana

 

ABSTRAK Widiyana, Eva. 2009. Analisis Kemampuan Proses Sixpack Weibull Studi Kasus Bobot Benang Sliver Di PT. Industri Sandang Nusantara Lawang. Skripsi, Program Studi Matematika, FMIPA, Universitas Negeri Malang. Pembimbing (I) Ir. Hendro Permadi, M.Si (II) Dr. Swasono Rahardjo, S.Pd, M.Si. Kata Kunci: pengendalian kualitas statistik, distribusi Weibull, analisis kemampuan proses sixpack Weibull. Pengendalian kualitas statistik merupakan metode statistik untuk mengumpulkan dan menganalisis data dalam menentukan dan mengawasi kualitas hasil produksi.Pengendalian kualitas dapat menggunakan analisis grafik pengendali dan analisis kemampuan proses statistik dengan cara menguji distribusi data terlebih dahulu. Apabila disribusi data tidak memenuhi asumsi normal, maka salah satu pendekatan distribusi yang dapat diterapkan adalah pendekatan distribusi Weibull. Analisis kemampuan proses sixpack Weibull merupakan suatu solusi dalam menyelesaikan masalah pengendalian mutu produksi dalam suatu perusahaan. Analisis ini menampilkan enam grafik yang menggambarkan sebaran dari data-data yang diperoleh yaitu Individual Chart or Chart, Moving Range Chart, R Chart atau S Chart, Capability Histogram, Weibull Probability Plot, Capability Plot. Penulisan skripsi ini bertujuan untuk mengetahui proses produksi kualitas benang sliver menggunakan grafik pengendali distribusi Weibull dan analisis kemampuan proses sixpack Weibull sesuai dengan batas spesifikasi dari perusahaan. Hasil Overview Plot distribusi Weibull menunjukkan parameter skala = 365,512 dan parameter bentuk = 131,635. Grafik pengendali distribusi Weibull mempunyai batas-batas yaitu UCL = 374,51; CL = 363,93; LCL = 353,35. Hasil analisis kemampuan proses bobot benang sliver terkendali secara statistik dan prosesnya kurang baik, namun rata-rata hasil proses berada dalam batas spesifikasi dan sebagian di luar batas spesifikasi. Nilai Pp = 0,53 yang menunjukkan bahwa proses berjalan kurang baik dan nilai Ppk = 0,37 yang menunjukkan sebagian dari variasi proses berada di luar batas-batas yang telah ditentukan perusahaan. Hasil Expected Overall Performance menunjukkan bahwa nilai PPM < LSL = 70005,3. Hal ini berarti bahwa produk yang berada di luar batas spesifikasi bawah (LSL) 70005,3 unit per 1.000.000 produk yang dihasilkan. Sedangkan nilai PPM > USL = 2088,4, yang berarti bahwa produk yang berada di luar batas spesifikasi atas (USL) 2088,4 unit per 1.000.000 produk yang dihasilkan. PPM Total = 72093,7, yang berarti bahwa produk yang berada di luar batas spesifikasi bawah maupun atas (LSL dan USL) 72093,7 unit per 1.000.000 produk yang dihasilkan.

Hubungan kegiatan pengawasan dan motivasi kerja dengan produktivitas kerja menurut persepsi karyawan Departemen Pendidikan dan Kebudayaan di Kabupaten Bima / oleh Mariani

 

Perancangan dan perakitan pembangkit listrik tenaga surya 50 watt peak / Denny Muhammad Al Fitrah

 

Kata Kunci: PLTS, Renewable Energy, . PLTS atau Pembangkit Listrik Tenaga Surya adalah peralatan pembangkit listrik yang merubah cahaya matahari menjadi listrik. PLTS sering juga disebut Solar Cell, atau Solar Photovoltaic, atau Solar Energy. Dengan konsep yang sederhana yaitu mengubah cahaya matahari menjadi energi listrik yang mana cahaya matahari adalah salah satu bentuk energi dari Sumber Daya Alam. Cahaya matahari sudah banyak digunakan untuk memasok daya listrik di satelit komunikasi melalui sel surya. Sel surya ini dapat menghasilkan energi yang tidak terbatas langsung diambil dari matahari, tidak memerlukan bahan bakar. Sehingga sel surya sering dikatakan bersih dan ramah lingkungan. Renewable Energy atau Energi baru dan yang terbarukan mempunyai peran yang sangat penting dalam memenuhi kebutuhan energi. Hal ini disebabkan penggunaan bahan bakar untuk pembangkit-pembangkit listrik konvensional dalam jangka waktu yang panjang akan menguras sumber minyak bumi, gas dan batu bara yang makin menipis dan juga dapat mengakibatkan pencemaran lingkungan. Salah satunya upaya yang telah dikembangkan adalah Pembangkit Listrik Tenaga Surya. Pada tugas akhir ini akan membahas mengenai apa itu PLTS, bagaimana merancang sistem PLTS sesuai dengan kebutuhan, bagaimana merakit PLTS, dan melakukan uji pembebanan PLTS. Adanya tugas akhir ini diharapkan dapat memberikan pengetahuan mengenai PLTS dan bagaimana PLTS itu bekerja. Dari hasil pengujian dan pembahasan “Perancangan dan Perakitan Pembangkit Listrik Tenaga Surya” Pembangkit Listrik Tenaga Surya yang telah dirancang dengan spesifikasi panel surya 50 WP, solar charge controller SDDC 12-10A, inverter 500 W/220VAC serta baterai 65 Ah 12V telah berhasil diuji coba. PLTS ini juga dilengkapi dengan indikator tegangan yang dihasilkan panel surya dan tegangan output inverter. Berdasarkan hasil pengujian PLTS ini mampu menghasilkan rata-rata daya sebesar 311,19 W pada keadaan cuaca cerah.

Pengembangan multimedia interaktif untuk memproduksi teks negosiasi siswa SMA/MA / Ervina Rufiana Wati

 

ABSTRAK Wati, Ervina Rufiana. 2015. PengembanganMultimedia Interaktif untuk Memproduksi Teks Negosiasi Siswa SMA/MA. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Heri Suwignyo, M.Pd, (II) Drs. Dwi Saksomo, M.Si. Kata kunci: multimedia interaktif, keterampilan memproduksi, teks negosiasi Seiring dengan perkembangan dunia teknologi informasi yang maju, kini telah diperkenalkan adanya multimedia yang digunakan untuk membantu guru dan siswa dalam proses pembelajaran. Hal ini karena multimedia dapat menggabungkan aspek visual dan audio. Salah satu program komputer yang dapat dijadikan sarana untuk mengembangkan media pembelajaran adalah Adobe Flash, yaitu program animasi profesional yang berguna untuk melatih kemampuan siswa dalam memahami, memproduksi, dan melakukan negosiasi melalui tayangan video yang disajikan dalam media. Pembelajaran memproduksi teks negosiasi mengajarkan siswa untuk aktif dan kreatif dalam berkarya. Selain memproduksi teks, kemampuan siswa dalam praktik bernegosiasi dapat diasah dengan baik. Kegiatan ini dapat mengembangkan keterampilan berbahasa lisan dan menanamkan pendidikan karakter dalam diri siswa. Penelitian pengembangan ini bertujuan untuk (1) menghasilkan multimedia interaktif memproduksi teks negosiasi yang menarik dari segi tampilan, pilihan warna, dan isi media dan (2) mudah dan layak dari segi tinjauan kurikulum, isi materi, dan kemanfaatan media dalam pembelajaran. Penelitian ini menggunakan metode penelitian dan pengembangan yang diadaptasi dari model penelitian dan pengembangan Sadiman, Raharjo, & Haryono (2012). Berdasarkan model tersebut, terdapat delapan tahap prosedur penelitian dan pengembangan, yaitu (1) identifikasi kebutuhan, (2) perumusan tujuan, (3) perumusan butir-butir materi pembelajaran, (4) perumusan alat pengukur keberhasilan, (5) penulisan naskah media, (6) tes/uji coba, (7) revisi, dan (8) produk akhir. Uji coba produk dilakukan melalui empat tahapan, yaitu (1) uji kepada ahli materi, (2) uji kepada ahli media, (3) uji kepada praktisi (guru bahasa Indonesia), dan (4) uji kepada siswa (terdiri dari 12 orang siswa). Instrumen pengambilan data uji coba menggunakan pedoman wawancara dan angket. Berdasarkan hasil uji coba ini diperoleh data kuantitatif dalam bentuk skor penilaian dan data kualitatif berupa komentar dan saran perbaikan.Data yang telah diperoleh dari hasil uji coba dianalisis dengan mendeskripsikan (1) kemenarikan produk multimedia interaktif melalui validasi analisis rata-rata nilai dari ahli media dan siswa, dan (2) kelayakan produk multimedia interaktif melalui validasi analisis nilai rata-rata dari ahli media, praktisi, dan siswa. Perbaikan multimedia interaktif dilakukan berdasarkan komentar dan saran perbaikan dari ahli materi, ahli media, praktisi, dan siswa. Multimedia interaktif ini terdiri atas85 tampilan (slide) yang menyajikan tiga kompetensi dasar pembelajaran memproduksi teks negosiasi, meliputi aspek pengetahuan dan keterampilan. Pada aspek pengetahuan terdapat kompetensi dasar memahami teks negosiasi, sedangkan aspek keterampilan terdapat kompetensi dasar memproduksi dan menyunting teks negosiasi. Multimedia interaktif ini menyajikan langkah-langkah pembelajaran pada setiap kompetensi dasar, dan dilengkapi dengan soal evaluasi yang terdiri atas sepuluh soal pilihan ganda untuk menguji pemahaman siswa terhadap pembelajaran teks negosiasi. Berdasarkan uji coba multimedia interaktif kepada ahli materi, ahli media, praktisi, dan siswa, diperoleh hasil bahwa multimedia interaktif ini layak digunakan sebagai media pembelajaran oleh guru dan siswa. Dilihat dari tingkat kelayakan multimedia diperoleh nilai rata-rata 84,3%, sedangkan dilihat dari tingkat kemenarikan multimedia diperoleh nilai rata-rata 87,6%. Meskipun multimedia ini tergolong layak dan dapat diimplementasikan, perolehan data kualitatif berupa komentar dan saran perbaikan dalam angket tetap menjadi pedoman untuk memperbaiki multimedia interaktif ini. Multimedia interaktif memproduksi teks negosiasi ini dapat digunakan oleh guru sebagai pendamping dalam menyampaikan materi memproduksi teks negosiasi. Sebagai langkah pemanfaatan multimedia interaktif, guru disarankan mampu menggunakan multimedia interaktif ini agar dapat mendampingi siswa saat belajar menggunakan multimediadengan baik. Siswa pun dapat memanfaatkan multimedia interaktif ini secara mandiri untuk menambah wawasan dan pengetahuan tentang teks negosiasi. Produk multimedia interaktif ini dikemas dalam bentuk CD (Compact Disk)sehingga dapat dengan mudah digunakan sebagai multimedia yang menarik dan menyenangkan.

KWh meter digital dengan output display rupiah / Abdurrohman Mukti

 

Kata Kunci: kWh meter, Sensor, Mikrokontroler, LCD, Biaya listrik. kWh meter merupakan alat ukur pemakaian energi listrik yang sudah umum dipakai oleh pelanggan listrik. Pelanggan listrik tersebut melingkupi berbagai instansi maupun perumahan, baik rumah tangga, gedung perkantoran, industri dan lain-lain. Hal ini menunjukkan bahwa kebutuhan energi listrik sangat tinggi terlebih sekarang semakin banyak pendirian bangunan rumah-rumah atau gedung baru yang tentunya akan menambah jumlah kebutuhan listrik. kWh meter yang masih umum digunakan sekarang adalah kWh meter analog. kWh meter digital sudah ada namun pemakaianya belum tersebar pada lapisan masyarakat. Pada perancangan kWh meter digital dalam Tugas Akhir berikut merupakan pengembangan dari kWh meter yang sudah ada sebelumnya. kWh meter digital yang sebelumnya masih menggunakan sensor untuk mendeteksi putaran piringan pada kWh meter analog, atau masih mengunakan trafo arus dan resistor shunt untuk mendeteksi arus, namun perancangan kWh meter berikut menggunakan sensor arus ACS712 dengan Hall efect. Sensor arus ACS712 tersedia dalam bentuk chip kecil dan mampu mendeteksi arus mencapai maksimal 5 ampere. Sedangkan rangkaian lain yang digunakan adalah rangkaian mikrokontroller AVR Atmega8, RTC DS1302, keypad 4x4 dan layar LCD M1632. Pinsip kerja dari kWh meter digital yaitu: Proses awal dimulai dengan mendeteksi arus yang berasal dari jala-jala listrik. Lalu sinyal keluaran dari sensor arus akan berubah menjadi tegangan DC dilanjutkan masuk ke ADC mikrokontroller untuk dikonversi dari sinyal analog menjadi sinyal digital. Sinyal digital tersebut lalu diproses oleh mikrokontroler dan ditampilkan ke LCD berupa nilai energi listrik, disertai biaya pemakaiannya, jam dan tanggal pemakaian. Hasil dari pengukuran pada beban 40 watt dan 100 watt didapatkan bahwa alat ini sudah dapat berjalan dengan baik yaitu dengan berubahnya nilai daya listrik tiap menitnya. Setiap terjadi perubahan daya akan diikuti oleh perubahan tarif listriknya. Nilai tarif yang diperoleh sudah sesuai dengan nilai daya yag ditunjukan dikalikan TDL yang ditetapkan oleh PLN, dalam hal ini yaitu Rp 900. Alat ini akan memberikan kemudahan bagi pelanggan listrik. Karena pihak pelanggan langsung dapat mengetahui berapa biaya energi pemakaian listriknya dalam suatu waktu tertentu. Untuk melihat biaya pemakaian energi listrik tidak harus menunggu sampai akhir bulan. Jadi setiap peningkatan jumlah daya maka biaya listrik juga akan ikut meningkat. Hal ini akan memberi kemudahan bagi petugas PLN dalam mencatat biaya listrik pelanggan, begitu halnya bagi pihak pelanggan akan mempermudah dalam pembacaan kWh meternya.

Pengaruh budaya organisasi dan keterlibatan kerja terhadap kinerja karyawan bagian agen pada PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota / Cindera Fatikha

 

ABSTRAK Fatikha, C. 2015. Pengaruh Budaya Organisasi dan Keterlibatan Kerja terhadap Kinerja Karyawan Bagian Agen Pada PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota. Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Budi EkoSoetjipto, M.Ed., M.Si. (II) Elfia Nora, S.E., M.Si. Kata Kunci: Budaya Organisasi, Keterlibatan Kerja, dan Kinerja Karyawan. Kinerja karyawan adalah hasil seseorang dalam melaksanakan pekerjaannya yang menjadi tanggungjawabnya dalam rangka mencapai tujuan perusahaan dalam periode waktu tertentu.Kondisi objektif kinerja karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota masih kurang, hal ini disebabkan oleh pencapaian target yang tinggi. Penelitian ini bertujuan untuk mengetahui (1) kondisi budaya organisasi, keterlibatan kerja dan kinerja karyawan bagian agen pada PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang kota. (2) Pengaruh budaya organisasi terhadap kinerja karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota. (3) Pengaruh keterlibatan kerja terhadap kinerja karyawan PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota. (4) Pengaruh budaya organisasi dan keterlibatan kerja secara simultan terhadap kinerja karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota. Populasi dalam penelitian ini adalah seluruh karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota sejumlah 140 karyawan. Penentuan sampel menggunakan teknik proportionate stratified random samplingdan diperoleh 100 karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota. Teknik pengumpulan data menggunakan metode kuesioner, dokumentasi, dan observasi. Data dianalisa menggunakan regresi linier berganda. Hasil penelitian menunjukkan bahwa budaya organisasi yang diterapkan oleh karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota berada pada kriteria sangat kuat, keterlibatan kerja dan kinerja karyawan berada pada kriteria tinggi. Budaya organisasi dan keterlibatan kerja secara simultan berpengaruh positif signifikan terhadap kinerja karyawan. Hasil penelitian juga menunjukkan bahwa secara parsial budaya organisasi dan keterlibatan kerja memiliki pengaruh positif signifikan terhadap kinerja karyawan. Berdasarkan temuan tersebut, disarankan kepada karyawan bagian agen PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota berkaitan dengan kinerja karyawan agar lebih berpartisipasi aktif untuk meningkatkan kinerja karyawan, berkaitan dengan budaya organisasi lebih aktif mengadakan diskusi yang berhubungan dengan pekerjaan, dan yang berkaitan dengan keterlibatan kerja agar lebih bisa memotivasi diri sehingga lebih semangat dalam melakukan pekerjaan. Bagi peneliti selanjutnya diharapkan untuk menambah variabel lainnya seperti kepuasan kerja, stres kerja, dan komitmen organisasional agar penelitian menjadi lebih menarik dan lebih berkembang untuk diteliti.

Pengaruh blended learning berbasis schoology dan kemampuan awal siswa terhadap hasil belajar mata pelajaran pemeliharaan kelistrikan kendaraan ringan di kelas XI TKR SMK Negeri 3 Singaraja / Vincentius Tjandra Irawan

 

ABSTRAK Irawan, Vincentius Tjandra. 2016. Pengaruh Blended Learning Berbasis Schoology dan Kemampuan Awal Siswa terhadap Hasil Belajar Mata Pelajaran Pemeliharaan Kelistrikan Kendaraan Ringan di Kelas XI TKR SMK Negeri 3 Singaraja. Skripsi. Jurusan Teknik Mesin. Fakultas Teknik. Universitas Negeri Malang. Pembimbing (I) Dr. Eddy Sutadji, M.Pd, (II) : Dr. Widiyanti, M.Pd. Kata Kunci : Blended Learning, Schoology, Kemampuan Awal, Hasil Belajar Sekolah Menengah Kejuruan merupakan penyedia teknisi madya terbesar di Indonesia. Mayoritas pelajaran yang diberikan di SMK adalah praktikum. Pada kenyataannya, guru pada Mata Pelajaran Pemeliharaan Kelistrikan Kendaraan Ringan kelas XI TKR SMK Negeri 3 Singaraja memberikan 70% materi teori dan 30% praktikum pada siswa. Hal ini disebabkan kemampuan awal yang dimiliki siswa masih rendah, guru khawatir akan hasil belajar yang tidak memenuhi KKM, sehingga difokuskan pada pemberian teori agar hasil belajar memenuhi KKM. Blended Learning berbasis Schoology hadir sebagai solusi untuk memberi teori tambahan di luar jam pelajaran sekolah, sehingga pertemuan teori dapat dikurangi dan diganti praktikum. Metode penelitian yang digunakan adalah eksperimental semu dengan the nonequivalent control group design. Subjek penelitian berjumlah 64 siswa, 30 siswa XI TKR 1 sebagai kelas treatment, dan 34 siswa XI TKR 2 sebagai kelas nontreatment. Kemampuan awal didapat dengan memberi prates, dan hasil belajar didapat dengan memberi postes. Instrumen yang digunakan adalah tes multiple choice. Data pada penelitian dianalisis menggunakan SPSS versi 17 for windows. Teknik analisis data yang digunakan adalah ANAVA dua jalan. Hasil penelitian adalah (1) terdapat perbedaan hasil belajar yang signifikan antara siswa dengan model Blended Learning berbasis Schoology dan siswa dengan model Problem Based Learning (sig p = 0,000 <α = 0,05), (2) terdapat perbedaan hasil belajar yang signifikan antara siswa dengan kemampuan awal tinggi, siswa dengan kemampuan awal sedang, dan siswa dengan kemampuan awal rendah (sig p = 0,000 <α = 0,05), dan (3) tidak terdapat interaksi antara model pembelajarandan kemampuan awal siswa terhadap hasil belajar kelas XI TKR SMK Negeri 3 Singaraja Mata Pelajaran Pemeliharaan Kelistrikan Kendaraan Ringan (sig p = 0,196 >α = 0,05).

Penyusunan modul pengajaran matematika untuk kelas 2 cawu I SMU tentang ukuran gejala pusat dan perencanaan data
oleh Dyah Rini Kusumawati

 

Bentuk-bentuk bilinier dan bentuk kuadrat
oleh Wiwin Dwi Setiyaningsih

 

Sistem proteksi terhadap tegangan lebih pada gardu trafo tiang 20 KV / Moh. Ishak

 

SISTEM PROTEKSI TERHADAP TEGANGAN LEBIH PADA GARDU TRAFO TIANG 20KV Moh.Ishak Abstrak: Gangguan tegangan lebih sering terjadi pada gardu trafo tiang yang biasanya diakibatkan dua hal yang pertama dikarenakan surja petir/sambaran petir dan yang kedua akibat surja hubung/pemutusan beban. Jika gangguan ini tidak diperoteksi maka gangguan ini akan merusak peralatan gardu trafo tiang sehingga gardu tarfo tiang ini tidak dapat menyalurkan daya ke konsumen ini karena pada peralatan gardu trafo tiang mempunyai batas minimum dan batas maksimum terhadap tegangan lebih . Dalam pembahasan ini akan mengambil permasalahan tegangan tengan lebih akibat surja petir dimana tegangan lebih ini dibagi menjadi dua yaitu sambaran petir langsung dan sambaran petir tak langsung untuk memproteksi ini memerlukan peralatan proteksi yaitu untuk gangguan sambaran petir langsung alatnya kawat tanah/groundwire sedangkan gangguan sambaran petir tak langsung alatnya Arrester/lightining Arrester , peralatan diatas mempunyai funsi masing-masing dan juga tempatnya berbeda oleh karena itu perlu adanya sebuah sistem proteksi untuk mengatasi gangguan petir langsung maupun tak langsung. Rumusan masalah ini meliputi : 1. Bagaimana merancang sistem proteksi terhadap tegangan lebih menggunakan Arrester dan Kawat Tanah pada gardu trafo tiang?; 2. Bagaimana merancang sistem proteksi berdasarkan SOP Arrester dan kawat tanah?; 3. Bagaiman analisa tegangan lebih yang ditimbulkan oleh surja petir menggunakan peralatan proteksi Arrester dan Kawat Tanah pada gardu trafo tiang dengan simulasi program Matlab 6.1?. Metode ini meliputi:1. Data nilai tegangan dasar Arrester dan pelepasan Arrester dan analisa tegangan lebih menggunakan Matlab 6.1, 2. Data SOP pemasangan Arrester dan kawat, 3. Data perhitungan sambaran langsung dan sambaran tak langsung pada kawat tanah menggunakan program Matlab 6.1. Berdasarkan hasil perhitungan dan simulasi Matlab 6.1, dapat disimpulkan; 1. Dari hasil perhitungan rumus tegangan dasar Arrester dan tabel karekteristik kerja Arrester didapat 139 kV sedangkan hasil perhitungan simulasi matlab didapat tegangan pelepasan Arrester 120 kV ini dikeranakan adanya pengaruh sistem pentanahan, untuk tegangan pelepasan diatas 120 kV masih aman bagi trafo karena tidak melebihi dari BIL Trafo 20 kV yaitu 150 kV, 2. untuk perhitungan sambaran tak langsung dengan saluran kawat tanah diperoleh 38,5663 gangguan per 100 km per tahun dan tanpa kawat tanah 61,8648 gangguan per 100 km per tahun ini dikarenakan saluran kawat tanah mempunyai factor perisaian, 3. perhitungan sambaran langsung dengan tiang yang diketanahkan diperoleh 30,2134 gangguan/100km/tahun dan tiang yang tidak diketanahkan diperoleh 36,5526 gangguan/100km/tahun ini dikarenakan pengaruh tahanan kontak tiang pada tiang diketanahkan lebih rendah daripada tahanan kontak tiang yang tidak diketanhkan, 4.SOP Arrester : Arrester sedapat mungkin dipasang pada titik percabangan dan pada ujung-ujung saluran yang panjang, baik saluran utama maupun saluran percabangan, jarak Arrester yang satu dan yang lain tidak boleh lebih dari 500 meter sedangkan SOP kawat tanah: Pada tengah gawang kawat tanah harus mempunyai jarak yang cukup di atas kawat fasa untuk mencegah terjadinya loncatan api. Kata kunci: sistem proteksi, tegangan lebih, Arrester dan kawat tanah/ groundwire.

Pelaksanaan budaya demokrasi di sekolah (Studi kasus terhadap siswa SMP Negeri 4 Malang) / Luki Pramita Dewi

 

Kata Kunci: Pelaksanaan, Budaya Demokrasi, Sekolah Sekolah merupakan tonggak dasar penanaman budaya demokrasi bagi generasi penerus bangsa, karena di sinilah mereka bertemu dengan berbagai macam pikiran-pikiran, watak, karakter, budaya, dan agama. Sekolah sebagai lembaga pendidikan memiliki peran utama dalam menumbuhkan budaya demokrasi di kalangan pelajar. Oleh karena itu, sekolah harus menampilkan budaya demokratis dalam pengelolaan pendidikannya. Penelitian ini bertujuan: (1) Untuk mendeskripsikan pemahaman siswa mengenai konsep demokrasi, (2) Untuk mendeskripsikan pelaksanaan budaya demokrasi di sekolah, (3) Untuk mendeskripsikan faktor pendukung pelaksanaan budaya demokrasi di sekolah, (4) Untuk mendeskripsikan faktor penghambat pelaksanaan budaya demokrasi di sekolah, (5) Untuk mendeskripsikan solusi dalam mengatasi faktor penghambat pelaksanaan budaya demokrasi di sekolah. Penelitian ini menggunakan pendekatan studi kasus dengan jenis penelitian kuantitatif dan kualitatif deskriptif. Penelitian kuantitatif digunakan untuk mengetahui pemahaman siswa terhadap konsep demokrasi sedangkan penelitian kualitatif deskriptif digunakan untuk mengetahui pelaksanaan, faktor pendukung, faktor penghambat, dan solusi budaya demokrasi di sekolah. Subjek penelitiannya adalah siswa SMPN 4 Malang. Adapun tahapan pengumpulan data yang dipergunakan adalah angket, observasi, wawancara, dan dokumentasi. Sedangkan teknik analisis data menggunakan resuksi data, penyajian data, dan penarikan kesimpulan. Hasil penelitian yang diperoleh dari penelitian ini adalah : (1) Pemahaman siswa terhadap konsep demokrasi secara umum tergolong baik. (2) Pelaksanaan budaya demokrasi yang umumnya diterapkan di sekolah adalah pemilihan kepengurusan OSIS, pemilihan kepengurusan MPK, dan pemilihan pengurus kelas, dimana hal ini merupakan salah satu bentuk dari pembelajaran nyata dalam berpolitik secara demokratis pada tataran sekolah. Pelaksanaan pemilihan kepengurusan OSIS, kepenguruan MPK, dan pengurus kelas sudah menerapkan budaya demokrasi dengan baik hal ini terlihat dari pelaksanaan pemilihan yang berasaskan luber dan jurdil serta pelaksanaan yang mencerminkan kultur/ budaya demokrasi. (3) Adapun faktor yang mendukung pelaksanaan budaya demokrasi di sekolah antara lain: tersedianya wadah pembelajaran berorganisasi bagi siswa di sekolah seperti OSIS dan MPK; adanya keleluasaan untuk mengemukakan pendapat pada saat musyawarah; sekolah memberikan dukungan baik dari segi pendanaan kegiatan, fasilitas, dan sarana prasarana, maupun dari segi pembelajaran demokrasi hal ini terlihat dari diberikannya materi demokrasi pada mata pelajaran PKn serta materi pembinaan kesiswaan berkaitan dengan pembelajaran demokrasi; kerjasama yang baik antar siswa dengan siswa dan antara siswa dengan sekolah dalam menyelenggarakan sebuah pemilihan di sekolah; pelaksanaan kegiatan pemilihan di SMPN 4 Malang 75% melibatkan siswa secara penuh untuk berpartisipasi di dalamnya mulai dari tahap perencanaan hingga tahap pelaksanaan kegiatan; kemampuan siswa yang menunjang hal tersebut; diberikannya kesempatan yang sama kepada seluruh siswa untuk mengikuti pelaksanaan pemilihan baik itu pemilihan OSIS, MPK dan pemilihan ketua kelas. (4) Faktor penghambat dari pelaksanaan budaya demokrasi di sekolah adalah: dari segi pendanaan, sekolah hanya menganggarkan dana sesuai dengan apa yang telah direncanakan, lebih dari apa yang direncanakan sekolah tidak dapat memberikan dana; kurangnya kesadaran siswa untuk tertib pada saat melakukan musyawarah kelas; kurangnya kesadaran siswa untuk ikutserta dalam pemilihan di sekolah, salah satunya adalah pemilihan ketua OSIS; sifat malu bertanya ataupun mengemukakan pendapat yang terkadang ada di diri siswa; adanya pengaruh negatif dari guru yang terlalu keras dalam mengajar siswa juga berdampak pada terhambatnya pelaksanaan budaya demokrasi di sekolah; perbedaan pendapat yang muncul pada saat musyawarah. (5) Solusi untuk mengatasi faktor penghambat tersebut antara lain: pentingnya kesadaran diri yang harus dimiliki oleh setiap siswa pada pelaksaan kegiatan musyawarah di sekolah; pemberian peringatan pada siswa yang tidak mengikuti pelaksanaan pemilihan yang dilakukan di sekolah; keitkutsertaan guru dalam pelaksanaan jalannya musyawarah yang dilakukan oleh siswa; kesabaran guru dalam menghadapi siswa. Dari hasil penelitian ini saran-saran yang diajukan yaitu: (1) Pihak sekolah hendaknya perlu mengupayakan penerapan iklim belajar yang tepat bagi para siswa, agar dapat menanamkan sendi-sendi yang bisa membangun karakter bagaimana hidup berdemokrasi pada para siswa, (2) Untuk menyikapi tumbuhnya semangat berdemokrasi secara positif dan konstruktif sejak dini di lingkungan sekolah, maka hendaknya guru pengajar disarankan agar dapat bersifat proaktif dalam meberikan stimulus yang dapat memberikan pemahaman dan penilaian yang benar mengenai konsep budaya demokrasi pada diri siswa, serta dapat menjembatani kekurangan pngetahuan siswa dalam hal ini dengan baik.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |