Pengaruh kualitas produk terhadap keputusan pembelian konsumen (studi pada warga Perumnas Sawojajar pelanggan koran Jawa Pos Radar Malang) / Arifin

 

Kata kunci: kualitas produk, keputusan pembelian (pelanggan). Dalam era globalisasi, persaingan di dunia bisnis semakin ketat. Munculnya para pemain baru dalam industri dan bisnis sejenis menyebabkan berkurangnya pangsa pasar yang telah dikuasai. Bahkan bukan tidak mungkin akan mengeser posisi perusahaan dalam waktu singkat akibat munculnya pesaing baru yang lebih agresif. Seperti halnya dalam bidang penerbitan media cetak munculnya banyak media cetak baru dengan keunggulan-keunggulan tertentu tentunya akan mempengaruhi perilaku pembelian konsumen dan berpotensi untuk merebut pelanggan media cetak lain. Demikian halnya dengan Jawa Pos-Radar Malang merupakan perusahaan penerbit surat kabar/Koran terkemuka di Jawa Timur, juga harus mencermati selera pasar, mengingat sebagian besar masyarakat masih menjadikan koran sebagai alternatif untuk mendapatkan informasi terkini sehari-hari. Maka dari itu Jawa Pos-Radar Malang melakukan strategi agar pelanggan yang sudah ada berubah menjadi konsumen yang loyal dan menarik minat konsumen baru dengan memberikan keunggulan dalam kualitas produk yang melekat pada koran Jawa Pos-Radar Malang yang diberlakukan untuk periode waktu tertentu dan akan berubah sesuai kondisi persaingan yang sudah ada. Maka penulis tertarik untuk mengambil judul “Pengaruh Kualitas Produk terhadap Keputusan Pembelian Konsumen dalam membeli koran (Studi pada Warga Perumnas Sawojajar Pelanggan koran Jawa Pos-Radar Malang)”. Penelitian ini bertujuan untuk mengetahui (1) kondisi kualitas produk dan keputusan pembelian konsumen pelanggan Perumnas Sawojajar dalam membeli produk koran Jawa Pos-Radar Malang. (2) pengaruh kualitas produk yang terdiri dari kinerja produk (performance), keistimewaan produk (features), keandalan produk (reliability), kemampulayanan produk (service ability), dan persepsi kualitas produk (perceived quality) secara parsial terhadap keputusan pembelian koran Jawa Pos-Radar Malang di Perumnas Sawojajar. (3) pengaruh kualitas produk yang terdiri dari kinerja produk (performance), keistimewaan produk (features), keandalan produk (reliability), kemampulayanan produk (service eability), dan persepsi kualitas produk (perceived quality) secara simultan terhadap keputusan pembelian koran Jawa Pos-Radar Malang di Perumnas Sawojajar. (4) dimensi kualitas produk tersebut di atas, manakah yang paling berpengaruh terhadap keputusan pembelian konsumen Perumnas Sawojajar dalam membeli produk koran Jawa Pos-Radar Malang Penelitian ini menggunakan instrument berupa kuesioner yang kemudian hasilnya dianalisis melalui analisis regresi linier berganda. Populasi dalam penelitian ini adalah pelanggan tetap koran Jawa Pos-Radar Malang yang berlangganan pada agen Jawa Pos di Perumnas Sawojajar. Teknik pengambilan sampel dalam penelitian ini menggunakan proportional random sampling jumlah populasi 2400 responden, sedangkan jumlah sample sebesar 100. Berdasarkan hasil analisis regresi diketahui bahwa terdapat pengaruh kualitas produk yang terdiri dari kinerja produk (performance), keistimewaan produk (featurers), keandalan produk (reliability), kemampulayanan produk (service ability), serta persepsi kualitas produk (perceived quality) secara parsial terhadap keputusan pembelian koran Jawa Pos-Radar Malang di Perumnas Sawojajar. Hal ini dibuktikan dengan pengaruh kinerja produk terhadap keputusan pembelian dengan nilai t hitung > t tabel yaitu 7,944 > 1, 6669 dengan taraf signifikansi t = 0.000 0,05; pengaruh keitimewaan produk terhadap keputusan pembelian dengan nilai t hitung > t tabel yaitu -2,614 > 1,6669 dan nilai signifikasi t = 0,010 0,05; pengaruh keandalan produk terhadap keputusan pembelian dengan nilai t hitung > t tabel yaitu -2,482 > 1,6669 dan nilai signifikansi t = 0,015 0,05; pengaruh kemampulayanan produk terhadap keputusan pembelian dengan nilai t hitung > t tabel yaitu 0,883 > 1,6669 dan nilai signifikansi t = 0,379 > 1,6669 dan nilai signifikansi t = 0,379 0,05; pengaruh persepsi kualitas produk terhadap keputusan pembelian dengan nilai t hitung > t tabel yaitu -1,183 > 1,6669 dan nilai signifikansi t = 0,240 0,05. Berdasarkan nilai Fhitung sebesar 14,016 dengan tingkat signifikansi 0,000 dapat disimpulkan terdapat pengaruh kualitas produk yang terdiri dari kinerja produk (performance), keistimewaan produk (features), keandalan produk (reliability), kamampulayanan produk (service ability), serta persepsi kualitas produk (perceived quality) secara simultan terhadap keputusan pembelian koran Jawa Pos-Radar Malang. Diketahui pula bahwa nilai Adjusted R Squarer sebesar 0,397 atau 39,7% dapat diartikan bahwa variabel kulitas produk dalam mempengaruhi keputusan pembelian koran Jawa Pos-Radar Malang adalah sebesar 39,7% dan sisanya sebesar 60,3% dipengaruhi hal-hal lain yang tidak dijelaskan dalam penelitian ini Berdasarkan temuan di atas, saran yang dapat diberikan peneliti bagi pihak Jawa Pos-Radar Malang hendaknya lebih memperhatikan unsur kinerja produk yang meliputi penyajian headline , keaktulitasan berita, keragaman berita, dan keakuratan berita. Dikarenakan kinerja produk merupakan unsur yang berpengaruh dominan terhadap keputusan pembelian koran Jawa Pos-Radar Malang. Maka dari itu, disarankan agar Jawa Pos-Radar Malang dapat selalu menjaga kualitas produk dan unsur-unsur yang terkandung didalamnya sehingga dapat mempertahankan dan meningkatkan minat pembeliaan dan kesetiaan. Disamping juga menambah porsi pemberitaan, mengurangi space iklan dan tidak menaikkan harga. Sedangkan bagi peneliti selanjutnya, hendaknya peneliti selanjutnya dapat menggali variabel-variabel baru selain kinerja produk, keistimewaan produk, keandalan produk, kemampulayanan produk, dan persepsi kualitas produk yang dapat mempengaruhi keputusan pembelian, yang diperkirakan meliputi variabel kualitas layanan, atribut produk, kepuasan, aspek psikologis dan beberapa variabel lain yang dapat dijadikan temuan baru dalam penelitian selanjutnya. Peneliti yang akan datang juga diharapkan lebih selektif dalam memilih teknik pengambilan sampel, agar sampel yang diperoleh lebih mewakili populasi secara keseluruhan.

Pengaruh penggunaan wireless phone sebagai pengganti pemandu pada lari sprint 100 meter tunanetra terhadap waktu tempuh di UPT Rehabilitasi Sosial Cacat Netra (RSCN) Janti-Malang / Ericho Brian Wiratma

 

Kata Kunci: Tunanetra, lari sprint, wireless phone Lari sprint merupakan salah satu cabang olahraga atletik yang digemari dan menarik untuk ditonton. Lari sprint terbagi menjadi jarak 100 meter dan 200 meter. Lari sprint 100 meter juga dilakukan oleh tunanetra, yang berlari dengan peraturan khusus untuk penyandang cacat. Perbedaannya terletak pada tata cara berlari, dimana tunanetra berlari satu-persatu di lintasan. Tunanetra juga dibantu pemandu ketika berlari, yang dilakukan dengan beberapa metode untuk memandu. Sedangkan untuk tata cara start dan finish sama dengan lari sprint untuk pelari normal. Penelitian ini merupakan penelitian eksperimen semu, karena dilakukan tanpa adanya kelompok kontrol, dan dilakukan untuk mengetahui apakah penggunaan wireless phone memberikan pengaruh terhadap waktu tempuh pada lari sprint 100 meter tunanetra di UPT Rehabilitasi Sosial Cacat Netra (RSCN) Janti – Malang. Sampel penelitian ini berjumlah 10 orang tunanetra laki-laki. Tes lari dilakukan sebanyak dua kali untuk memperoleh data yang selanjutnya dianalisis dan digunakan untuk menarik kesimpulan. Tes awal dilakukan dengan tes lari sprint 100 meter tunanetra dengan pemandu, tes akhir dilakukan dengan tes lari sprint 100 meter tunanetra dengan menggunakan wireless phone dimana tunanetra sudah belajar bagaimana cara menggunakan wireless phone. Analisa data berupa uji normalitas kolmogorov smirnov (one sample kolmogorov smirnov), uji homogenitas (levene statistic) dan uji beda teknik wilcoxon (wilcoxon signed ranks test). Hasil penelitian menunjukan ada pengaruh penggunaan wireless phone terhadap waktu tempuh pada lari sprint 100 meter tunanetra, dari 10 sampel, 9 sampel mengalami perubahan positif dan 1 sampel mengalami perubahan negatif. Terjadi peningkatan rata-rata waktu tempuh (semakin cepat) dari 17.1105 detik menjadi 16.7340 detik. Kesimpulan dari penelitian ini adalah penggunaan wireless phone mempengaruhi waktu tempuh pada lari sprint 100 meter tunanetra di UPT RSCN Janti – malang. Penelitian ini sangat menarik untuk dilakukan, terlebih lagi apabila penelitian dilakukan tidak hanya pada tunanetra saja. Karena banyak penyandang cacat lainnya yang juga gemar berolahraga. Untuk penelitian-penelitian selanjutnya, diharapkan semakin banyak dilakukan penelitian pada olahraga penyandang cacat. Agar olahraga untuk penyandang cacat semakin dikenal oleh khalayak umum.

Pengembangan desain pembelajaran geografi dengan pendekatan konstruktivistik / Syaiful Khafid

 

ABSTRAK Khafid, Syaiful. 2015. Pengembangan Desain Pembelajaran Geografi dengan Pendekatan Konstruktivistik. Disertasi. Program Studi Pendidikan Geografi, Pascasarjana Universitas Negeri Malang. Pembimbing:(I) Prof.Dr.Sumarmi, M.Pd., (II) Dr. Achmad Amirudin, M.Pd., (III) Dr. I Nyoman Ruja, S.U. Kata kunci: desain, pembelajaran geografi, pendekatan konstruktivistik Pembelajaran geografi sebagian besar masih menggunakan desain pembela-jaran dengan pendekatan behavioristik yang menekankan bahwa belajar ialah perolehan dan penambahan pengetahuan kepada siswa. Pola pembelajaran geo-grafi yang dipergunakan masih berorientasi penyampaian materi sebagai produk, belum pada cara mendapatkan ilmu sebagai proses, dan desain pembelajaran geo-grafi belum menggunakan pendekatan konstruktivistik yang menekankan objek formalnya sehingga geographical eye belum dikuasai siswa. Tujuan penelitian ini ialah menghasilkan desain pembelajaran geografi de-ngan pendekatan konstruktivistik meliputi (1) model desain pembelajaran kon-struktivistik (DPK), (2) rencana pelaksanaan pembelajaran (RPP), (3) bahan ajar geografi (BAG), (4) lembar kegiatan siswa (LKS), dan (5) lembar evaluasi belajar (LEB). Melalui desain ini diharapkan siswa proaktif mengonstruksi ilmu geografi. Model penelitian ini menggunakan R2D2, meliputi: reflektif, rekursif, desa-in dan pengembangan yang memiliki tiga fokus yakni (1) penetapan, (2) desain dan pengembangan, dan (3) diseminasi. Reviu produk dilakukan oleh dua ahli de-sain pembelajaran geografi, uji kelompok 15 guru dengan subjek uji coba siswa kelas X MIPA-3 LM Geografi SMAN 1 Sidayu dan X IPS-1 SMAN 1 Kebomas berjumlah 64 orang. Instrumen uji coba berupa angket, observasi, dokumentasi, dan tes. Hasil reviu dan uji coba produk dianalisis dengan teknik persentase dan deskripsi kualitatif. Hasil reviu model DPK oleh pereviu 1 dinilai 80, kategori cukup layak, direvisi, sedangkan oleh pereviu 2 dinilai 88, kategori layak, tidak direvisi. Hasil reviu model RPP oleh pereviu 1 dinilai 87, kategori layak, tidak direvisi, sedang-kan oleh pereviu 2 dinilai 79, kategori cukup layak, direvisi. Hasil reviu BAG oleh pereviu 1 dinilai 80, kategori cukup layak, direvisi, sedangkan oleh pereviu 2 dinilai 91, kategori sangat layak, tidak direvisi. Hasil reviu LKS oleh pereviu 1 dinilai 82, kategori layak, tidak direvisi, sedangkan oleh pereviu 2 dinilai 92, kategori sangat layak, tidak direvisi. Hasil reviu LEB oleh pereviu 1 dinilai 80, kategori cukup layak, direvisi, sedangkan oleh pereviu 2 dinilai 100, kategori sangat layak, tidak direvisi. Hasil observasi aktivitas guru dan siswa di SMAN 1 Sidayu masing-masing mencapai 86,67%, sedangkan aktivitas guru dan siswa di SMAN 1 Kebomas mencapai 100% dan 86,67%. Sebanyak 14 tim belajar mem-peroleh rerata perkembangan nilai ≥ 25 dengan predikat super dan 2 tim belajar mendapatkan nilai berkisar 20-24 dengan predikat hebat. Respon mayoritas siswa terhadap pembelajaran konstruktivistik ialah menyenangkan. Produk DPK dan perangkat pembelajarannya telah direvisi. Guru disaran-kan menguasai: (1) prinsip pembelajaran konstruktivistik, (2) secara komprehen-sif dan terampil menerapkan produk pengembangan pembelajaran geografi, (3) filsafat konstruktivisme dan pembelajaran konstruktivistik, (4) karakteristik siswa beserta gaya belajarnya, (5) bahan ajar geografi secara luas, mendalam, holistik, dan (6) menyebarluaskan pembelajaran konstruktivistik ke MGMP Geografi.

Pengaruh debt to equity ratio (DER) dan debt to total asset ratio (DAR) terhadap earning per share (EPS) melalui return on equity (ROE) pada perusahaan food and beverages yang listing di BEI tahun 2007-2009 / Hartatiek

 

Kata Kunci: Debt To Equity Ratio (DER), Debt To Total Assets Ratio (DAR), Return On Equity (ROE), dan Earning Per Share (EPS). Tujuan perusahaan secara umum yaitu mencapai tingkat laba yang optimal. Diukur dengan Return On Equity (ROE). Banyak variabel yang dapat digunakan untuk menentukan besarnya ROE, diantaranya yaitu Debt To Equity Ratio (DER) dan Debt To Total Assets Ratio (DAR). Kedua struktur modal ini dapat mempengaruhi ROE perusahaan. Semakin efisien penggunaan hutang maka ROE perusahaan juga semakin baik. Selain mencapai tingkat laba yang optimal, tugas lain perusahaan adalah memaksimalkan nilai perusahaan yang pada akhirnya berdampak pada tingkat pengembalian yang akan didapat dari aktivitas investasinya. Jika kondisi perusahaan dikategorikan menguntungkan atau menjanjikan keuntungan dimasa mendatang, maka banyak investor yang akan menanamkan dananya untuk membeli saham perusahaan tersebut. Penelitian ini bertujuan untuk mengetahui secara langsung pengaruh DER dan DAR terhadap EPS dan tidak langsung melalui ROE pada perusahaan Food and Beverage yang listing di BEI tahun 2007-2009. Variabel bebas dalam penelitian ini adalah DER, DAR dan ROE, sementara itu variabel terikat adalah EPS. Penelitian ini merupakan jenis penelitian asosiatif yang bersifat kausalitas, sampel dalam penelitian menggunakan teknik simple random sampling dan teknik analisis data menggunakan analisis jalur (path analysis). Hasil penelitian ini menunjukkan bahwa variabel Debt To Equity Ratio (DER) tidak berpengaruh langsung terhadap Earning Per Share (EPS) tetapi berpengaruh secara tidak langsung melalui Return On Equity (ROE). Dan Debt To Total Asset Ratio (DAR) juga tidak berpengaruh langsung terhadap Earning Per Share (EPS) tetapi berpengaruh secara tidak langsung melalui Return On Equity (ROE). Berdasarkan hasil tersebut, disarankan bagi para investor untuk melihat struktur modal yang dimiliki perusahaan karena struktur modal dapat mempengaruhi profitabilitas perusahaan. Sedangkan bagi manajemen perusahaan disarankan agar lebih memperhatikan kegiatan operasional perusahaan sehingga kinerja perusahaan dapat ditingkatkan. Serta untuk para peneliti selanjutnya disarankan untuk menambah variabel lain yang diduga berpotensi mempengaruhi EPS, seperti rasio perputaran aktiva tetap, penjualan, dan perputaran modal kerja. Periode pengamatan dan sampel ditambah atau bahkan meneliti pada sektor lain untuk memperoleh hasil yang berbeda.

Peningkatan pemahaman isi cerpen melalui kegiatan membaca cepat pada siswa kelas IV SDN Pandanwangi 04 Kota Malang / Erick Muzaqi

 

ABSTRAK Muzaqi, Erick. 2016. Peningkatan Pemahaman Isi Cerpen Melalui Kegiatan Membaca Cepat Pada Siswa Kelas IV SDN Pandanwangi 04 Kota Malang. Skripsi Prodi S1 – Pendidikan Sekolah Dasar, Jurusan Kependidikan Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Rumidjan, M.Pd., (II) Dr. I Made Suardana, S.Pd., M.Pd Kata Kunci: Cerpen, Membaca Cepat, Hasil Belajar, SD Hasil observasipada 29 Januari 2016 di kelas IV SDN Pandanwangi 04. Guru hanya meminta siswa membaca, kemudian siswa diminta untuk mengerjakan soal. Guru cenderung tidak memperhatikan kemampuan siswa dalam membaca cerita. Ketika guru menugaskan untuk membaca, sebanyak 23 dari 38 siswa masih memvokalkan bacaan. Hal ini menyebabkan waktu untuk membaca menjadi lama. Selanjutnya guru memberikan soal tentang isi cerita yang dibaca ternyata hasilnya kurang maksimal Kurangnya pengetahuan tentang cara membaca yang efektif menyebabkan kurangnya pemahaman pada waktu membaca dan boros akan pemanfaatan waktu. Berdasarkan uraian tersebut tujuan dari penelitian ini adalah mendiskripsikan penerapan kegiatan membaca cepat dalam meningkatkan pemahaman isi cerpen dan mendeskripsikan peningkatan pemahaman isi cerpen melalui kegiatan membaca cepat. Penelitian ini menggunakan jenis penelitian Penelitian Tindakan Kelas (PTK). Subjek penelitian ini adalah siswa kelas IV SDN Pandanwangi 04 Kota malang yang terdiri dari 38 siswa. Langkah-langkah membaca cepat ini ialah dengan membaca dalam hati, berkonsentrasi dalam bacaan cerpen, tidak menggerakkan bibir untuk melafalkan kata, tidak menggunakan jari untuk menunjuk kata, tidak menggerakkan kepala ke kanan dan ke kiri, tidak melakukan regresi atau pengulangan kata dan melebarkan jangkauan mata 2-5 kata. Pengumpulan data menggunakan teknik observasi, tes , dan dokumentasi. Hasil penelitian ini menunjukkan peningkatan hasi belajar sebesar 16,3% dari sebelum dilaksanakannya tindakan dengan melihat tingkat keberhasilan kelas sebelum dan sesudah dilaksanakan tindakan siklus 1. Sedangkan hasil belajar siswa dari siklus 1 ke siklus 2 mengalami peningkatan sebesar 2,2% menjadi 80%. Berdasarkan hasil tersebut dapat disimpulkan bahwa penggunakan teknik membaca cepat dalam meningkatkan pemahaman isi cerpen siswa kela IV SDN Pandanwangi 04 Kota Malang dapat meningkatkan hasil belajar siswa secara signifikan. Oleh karena itu dapat disarankan bahwa untuk meningkatkan hasil belajar siswa juga dapat mempercepat siswa dalam membaca. Penggunaan teknik membaca cepat dapat di jadikan pertimbangan dalam membelajarkan siswa dalam memahami teks bacaan cerpen. Penerapan membaca cepat hendaknya dapat digunakan dalam melaksanakan dan mengembangkan penelitian serupa dengan subjek yang berbeda.

Pengaruh intensitas serangan CPMMV (Cowpea Mild Mottle Virus) terhadap munculnya perbungaan tanaman kedelai (Glycin max (L.) Meril) generasi F3 persilangan Argopuro, Anjasmoro, Gumitir, Mahameru dengan Genotipe MLGG 0021 dan MLGG 0268 / Ahmad Muhibuddin

 

Kata Kunci: galur kedelai, perbungaan, intensitas serangan. Kedelai merupakan salah satu komoditas pangan yang penting di Indonesia, baik sebagai bahan makanan maupun bahan baku industri. Kebutuhan kedelai setiap tahun bertambah seiring dengan peningkatan laju pertumbuhan penduduk dan meningkatnya kesadaran masyarakat terhadap kebutuhan protein, namun produksi kedelai dalam negeri masih rendah. Salah satu penyebab rendahnya produksi kedelai di Indonesia adalah adanya serangan berbagai penyakit, diantaranya yang disebabkan virus khususnya CPMMV. Penyakit virus pada tanaman kedelai yang disebabkan oleh CPMMV merupakan salah satu penyakit endemi pada pertanaman kedelai di Indonesia dan merupakan salah satu penyebab rendahnya hasil kedelai. Penelitian ini dilakukan untuk mengetahui pengaruh galur, intensitas serangan CPMMV, dan interaksi antara galur dan intensitas serangan CPMMV terhadap munculnya perbungaan. Penelitian ini dilakukan di kebun percobaan Balitkabi pada bulan Agustus 2009-Januari 2010. Rancangan penelitian ini adalah diskriptif kuantitatif. Variabel yang terlibat dalam penelitian ini yaitu umur perbungaan sebagai variabel terikat. Macam intensitas serangan yang terdiri dari kriteria tahan, agak tahan, agak rentan, dan rentan (berdasarkan intensitas serangan) dan macam galur (Argopuro x MLGG 0021, Argopuro x MLGG 0268, Anjasmoro x MLGG 0021, Anjasmoro x MLGG 0268, Gumitir x MLGG 0021, Gumitir x MLGG 0268, Mahameru x MLGG 0021, dan Mahameru x MLGG 0268) sebagai variabel bebas. Perhitungan statitistik penelitian ini menggunakan Anava ganda. Hasil penelitian pada tiap kategori intensitas serangan CPMMV tidak menunjukkan perbedaan yang nyata terhadap perbungaan. Galur Mahameru x MLGG 0268 memiliki waktu perbungaan paling lambat pada 46,6 hst, sedangkan galur Mahameru x MLGG 0021 perbungaannya paling cepat pada 42,3 hst. masing-masing galur pada penelitian ini menunjukkan kemunduran perbungaan akibat adanya serangan virus CPMMV. Interaksi antara masing-masing galur tidak menunjukkan perbedaan yang nyata pada tingkatan serangan terhadap munculnya perbungaan. Hasil penelitian diperoleh bahwa galur Anjasmoro x MLGG 0021 pada tingkat intensitas serangan rentan menunjukkan perbungaan paling lambat, pada kategori intensitas serangan tahan menunjukkan perbungaan paling cepat, sedangkan pada kombinasi persilangan yang lainnya masing-masing galur tidak menunjukkan perbedaan yang nyata pada tingkatan serangan.

Faktor-faktor yang mempengaruhi motivasi siswa Jurusan Teknik Gambar Bangunan dalam mengikuti pembelajaran di dalam kelas SMK Negeri 6 Malang / Yudi Julianto

 

ABSTRAK Julianto, Yudi. 2016. Faktor-Faktor yang Mempengaruhi Motivasi Siswa Jurusan Teknik Gambar Bangunan dalam Mengikuti Pembelajaran di Dalam Kelas SMK N 6 Malang. Skripsi, Jurusan Teknik Sispil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Made Wena, M.Pd., M.T. (II) Drs. Eko Suwarno, M.Ed., M.Pd. Kata Kunci: motivasi belajar, faktor internal, faktor lingkungan sekolah, faktor lingkungan keluarga Penelitian ini bertujuan untuk mengetahui faktor-faktor yang mempengaruhi motivasi belajar siswa Jurusan Teknik Gambar Bangunan SMK N 6 Malang. Rancangan penelitian ini menggunakan metode deskriptif kuantitatif, sampel penelitian ini dilakukan kepada 48 orang siswa kelas XI GB 1dan XI GB 2. Data faktor-faktor yang mempengaruhi motivasi belajar siswa diperoleh melalui kuisioner. Uji validitas dilakukan dengan teknik korelasi Product Moment dari Pearson. Sedangkan uji reliabilitas menggunakan rumus Alpha Cronbach. Teknik analisis data menggunakan teknik korelasi Product Moment dari pearson dan teknik analisis korelasi ganda yang dilanjutkan dengan analisis regresi ganda dengan tingkat signifikasi hasil analisis ditentukan sebesar 5%. Hasil penelitian ini menunjukkan bahwa faktor yang mempengaruhi motivasi belajar siswa yakni faktor internal, faktor lingkungan sekolah dan faktor lingkungan keluarga. Ketiga faktor ini sangat mempengaruhi motivasi siswa untuk belajar jurusan teknik gambar bangunan di SMKN 6 Malang. Ini terbukti dari hasil prosentase jawaban siswa berdasarkan kuisioner, 24% dari faktor internal seperti minat belajar dan adanya keinginan untuk berprestasi, 49% pengaruh dari faktor lingkungan sekolah seperti media serta materi yang dipakai oleh guru dan sarana dan prasarana yang memadai dalam pembelajaran, 27% dari faktor lingkungan keluarga yang di penuhi oleh orangtua serta perhatian orangtua dalam mendorong motivasi belajar anak. Saran bagi guru dalam kegiatan belajar mengajar diharapkan agar dapat menggunakan metode dan memberikan sesuatu yang dapat menyenangkan siswa dengan tepat, sesuai dengan materi yang akan diberikan, sebab dengan menggunakan metode yang sesuai akan dapat memancing motivasi siswa untuk mengikuti pelajaran dengan baik. Dan bagi orang tua diharapkan ikut serta berperan aktif dalam membina dan memotivasi siswa supaya selalu bersemangat belajar serta memahami apa yang akan menjadi kebutuhannya agar bisa berprestasi dengan memberikan sarana dan prasarana yang optimal serta menciptakan suasana lingkungan keluarga yang harmonis.

Analisis penggunaan koil racing terhadap daya pada sepeda motor / Joko Agung Setiyo Oetomo

 

Oetomo, Joko Agung Setiyo. 2014. Analisis Penggunaan Koil Racing terhadap Daya pada Sepeda Motor. Skripsi, Program Studi Pendidikan Teknik Otomotif, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Sumarli, M.Pd., M.T., (II) Drs. Paryono, S.T., M.T. Kata kunci: koil racing, koil standar, sistem pengapian, daya, sepeda motor     Performa mesin standar yang dirasa kurang maksimal membuat banyak dari sebagian masyarakat yang memutuskan untuk mengaplikasikan produk-produk aftermarket untuk meningkatkan performa mesin. Di dunia otomotif untuk meningkatkan performa mesin bisa dilakukan dengan memaksimalkan kinerja dari sistem pengapian guna memperbesar percikan bunga api dari busi agar campuran bahan bakar dan udara bisa terbakar dengan sempurna. Pembakaran yang sempurna akan menyebabkan kinerja motor menjadi meningkat. Oleh karena itu penggunaan koil racing sebagai piranti yang bertugas untuk memperkuat percikan bunga api pada busi diharapkan mampu meningkatkan daya secara optimal.     Penelitian ini dilaksanakan dengan tujuan: (1) Untuk mengetahui daya yang dihasilkan sebuah sepeda motor yang menggunakan koil standar (2) Untuk mengetahui daya yang dihasilkan sebuah sepeda motor yang menggunakan koil racing (3) Untuk menemukan adanya perbedaan daya yang dihasilkan antara sepeda motor yang menggunakan koil standar dengan yang menggunakan koil racing. Penelitian ini menggunakan rancangan penelitian eksperimen. Obyek dalam penelitian ini adalah sepeda motor Yamaha Vega R 110cc. Analisis data yang dipakai adalah analisis Independent Sample T Test dengan menggunakan program SPSS 17 for Windows.     Hasil penelitian menunjukkan bahwa daya terendah yang dihasilkan koil standar adalah 6,70 Hp pada putaran mesin 1500 rpm dan daya tertinggi yang dihasilkan adalah 11,17 Hp pada putaran mesin 4500 rpm. Sedangkan daya terendah yang dihasilkan koil racing adalah 7,28 Hp pada putaran mesin 1500 rpm dan daya tertinggi yang dihasilkan adalah 12,35 Hp pada putaran mesin 4500 rpm. Dengan demikian dapat disimpulkan bahwa penggunaan koil racing pada sepeda motor memberikan pengaruh yang positif terhadap daya yang dihasilkan. Dimana daya yang dihasilkan dengan menggunakan koil racing lebih tinggi daripada daya yang dihasilkan dengan menggunakan koil standar, tetapi tidak ada perbedaan daya yang signifikan antara sepeda motor yang menggunakan koil standar dengan yang menggunakan koil racing. Dengan kata lain terdapat perbedaan tetapi tidak signifikan antara penggunaan koil standar dengan penggunaan koil racing terhadap daya di putaran mesin 1500 sampai 4500 rpm pada sepeda motor Yamaha Vega R 110cc.     Dengan demikian dapat disarankan agar dilakukan penelitian lebih lanjut mengenai pengaruh penggunaan koil racing dengan variasi saat pengapian (ignition timing) terhadap emisi gas buang dan konsumsi bahan bakar.

Studi faktor-faktor yang mempengaruhi adsorpsi, isoterm adsorpsi, termodinamika dan kinetika adsorpsi malasit hijau oleh nanopartikel magnetit bersalut silika hasil sintesis secara sol-gel / Zuhriah Mumtazah

 

ABSTRAK Mumtazah, Zuhriah. 2016. Studi Faktor-faktor yang Mempengaruhi Adsorpsi, Isoterm Adsorpsi, Termodinamika dan Kinetika Adsorpsi MalasitHijau oleh Nanopartikel Magnetit Bersalut Silika Hasil Sintesis secara Sol-Gel. Skripsi, Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Hj. Fauziatul Fajaroh, M.S., (II) Dr. Nazriati, M.Si. Kata Kunci:magnetit bersalut silika, Malasit Hijau, isoterm adsorpsi, termodinamika adsorpsi, kinetika adsorpsi Proses adsorpsi untuk menurunkan kadar zat warna berbahaya seperti Malasit Hijau dalam larutan sangat dipengaruhi oleh jenis adsorben yang digunakan. Salah satu adsorben yang dapat digunakan adalah nanopartikel magnetit bersalut silika. Tujuan penelitian ini adalah mempelajari dua faktor yang mempengaruhi daya adsorpsi magnetit bersalut silika terhadap Malasit Hijau yang meliputi waktu kontak dan konsentrasi awal adsorbat. Selain itu juga dipelajari model isoterm adsorpsi, termodinamika dan kinetika adsorpsi yang terjadi. Penelitian dilakukan dengan 4 tahap. Pertama, proses sintesis nanopartikel magnetit dengan metode elektrokimia. Kedua, sintesis magnetit bersalut silika dengan metode sol-gel dengan natrium silikat sebagai sumber silika. Hasil sintesis kemudian dikarakterisasi dengan FTIR, XRD, SEM, dan BET. Ketiga, proses aplikasi nanopartikel magnetit bersalut silika sebagai adsorben Malasit Hijau pada berbagai kondisi waktu kontak dan konsentrasi awal adsorbat. Keempat, penentuan parameter kesetimbangan yang digunakan untuk studi model isoterm adsorpsi, termodinamika dan kinetika adsorpsi. Hasil penelitian menunjukkan daya adsorpsi dipengaruhi oleh waktu kontak dan konsentrasi awal adsorbat. Mekanisme adsorpsi yang terjadi memenuhi model Isoterm Freundlich daripada model Isoterm Langmuir. Proses adsorpsi berlangsung spontan dan eksotermik. Proses adsorpsi mengarah kepada model kinetika orde dua semu.

Pengembangan bahan ajar berbasis web pada materi teorema pythagoras untuk siswa kelas VIII SMP (studi kasus di SMP "Plus" Darussholah Jember) / Mariyah Ulfah Gazasifara

 

The lyrics of Seblang Bakungan: an ethnopoetic investigation / Dian Novita

 

ABSTRAK Novita, D. 2016. The Lyrics of Seblang Bakungan: An Ethnopoetic Investigation.Skripsi, Jurusan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. A. Effendi Kadarisman, Ph.D., (II) Maria Hidayati, S.S., M.Pd. Kata kunci:lirik, Seblang Bakungan, etnopuitika Penelitianinimembahaslirik dariSeblangBakungan, sebuahupacara adatmasyarakat Usingyang telah berlangsung selama 400 tahun di Banyuwangi, JawaTimur,darisudut pandangetnopuitika (Kadarisman, 1999).Kajian tentangSeblangBakungantelahditelitiolehbeberapapakarAntropologi (Wessing, 2013; Wolbers, 1992) yang pada akhirnyamenghasilkanrekonstruksi lirik yang menyuguhkancerita di baliklagu-lagu tersebut. Namun demikian, penelitianinilebihberfokuspadapemaparandokumentasilagu-lagudari ritual ini yang dilaksanakanpadatahun 2015. PenelitianinidilakukanuntukmendeskripsikanaspeklinguistikdanpuitikadarilirikSeblangBakunganyang membuatmerekaberbedadariBahasa Using sehari-haridanbagaimanaaspek-aspektersebutdapatberkontribusiuntukmendapatkanwawasanlebihdalambudaya Usingitusendiri. Untukmengatasimasalahtersebut, penelitimenggunakanmetodedeskriptif-kualitatif untuk mengumpulkan dan menganalisa data.Adapun data primer dalam penelitian ini adalah dua belas lagu, denganpara penyanyidariSeblangBakunganyang dianggap sebagaisubjekpenelitian. Rekaman audio berfungsi untukmempertahankan "keaslian" darilirik, yang kemudianditranskripsikandandisajikandalamlampiran penelitian. Temuan dari penelitian ini mengungkap (a) aspek linguistik yang ada pada lirik lagu yang mencakup perubahan semantik dan fungsi pragmatis, (b) aspek puitika yang meliputi rima, aliterasi, konsonansi, dan asonansi, dan (c) strategi dalam upaya menambah wawasan budaya Using dengan memahami peran serta pengaruh lagu dan ritus pada budaya masyarakat Using itu sendiri. Lagu “Sukma Ilang” ternyata dapat diterapkan pada kehidupan sehar-hari sebagai mantra karena mantra itu sendiri merupakan bagian dari budaya suku Using. Atasdasartemuan yang telah dipaparkan, penelitimenyarankanagarpara penelitilebihlanjutmengkaji aspekmorfosintaksis dari lirik Seblang Bakungan, sehinggakeseluruhanaspeklinguistikdari lirik lagu tersebut dapatterungkapsepenuhnya.

Analisis penerapan standar akuntansi keuangan untuk laporan keuangan pada KP-RI Dhaya Harta" Kabupaten Jombang
oleh Puji Dwi Rahayu"

 

Dengarnn akinb erkenrbangkneygai atauns ahkao perastui,r rtutaang ar I pengelolaadnil aksanakasne carale bihp rof'esionaal,k anm akinb esarB. egitup ula I dalamp enyusunaIna porank euanganya nga kand iguniikans ebagaai lai ! Pertanggungiawabdaann merupakans alahs atus urnberi nfbrrnasiy ang sangat I RentinSL.J ntukit u laporank euangany angd ibualh arr-rdsi rpatd irncngertdi an i dipahamoi leh parap emakail aporank euanganm, aka laporank euangante r-cebu1 r harus disusun berdasarkan standar akuntansi tertentu. Dimana pada bidang akuntansi telahm enetapkanS tandarA kuntansiK euangan( SAK) yang baku yangm ampu mencerminkaans pirasid an maknad ari dunia usaha,a garl aporank euangand apal dimengertdi ant idak disalahtafsirkano leh berbagaip ihal

Sistem informasi bimbingan tugas akhir dan sekripsi berbasis web di jurusan teknik elektro Universitas Negeri Malang / Maurizal Wahyu Pamungkas

 

Kata kunci: Sistem, PHP, Basis Data, MySQL, XAMPP, Macromedia Dreamweaver Bimbingan Tugas Akhir maupun Skripsi merupakan hal yang wajib dilakukan oleh mahasiswa untuk mendapatkan hasil yang maksimal. Namun laporan dari hasil bimbingan yang dilakukan masih bersifat manual. Dengan adanya Sistem Informasi Bimbingan, diharapkan dapat memberikan suatu solusi untuk menunjang sistem manual yang masih belum efektif dan efisien. Dengan adanya Sistem Manajemen Basis Data, diharapkan dapat memberikan suatu solusi untuk memperbaiki sistem manual yang masih belum efektif dan efisien. Sistem baru akan membantu proses pendataan bimbingan khususnya bagi dosen pembimbing. Metode perancangan Tugas Akhir ini meliputi merancang spesifikasi produk yang dijelaskan dalam entitas dan atribut sistem, merancang analisis desain, menggambarkan arus data dalam Data Flow Diagram (DFD), menggambarkan entity relationship diagram (ERD) dan hubungan antar entitas pembentuk sistem dan relasi antar tabel pembentuk dalam. Dalam ERD dapat digambarkan entitas-entitas pendukung sistem serta hubungan antar entitasnya, serta di lakukan pengujian pada tiap blok halaman web. Hasil yang didapat adalah sebuah sistem informasi berbasis web yang mengolah data mahasiswa bimbingan dan data bimbingan. Hal ini dimaksudkan untuk memudahkan dosen pembimbing mengontrol perkembangan mahasiswa bimbingannya. Serta mengefisiensikan mahasiswa dalam membuat kartu bimbingan. Dalam perancangan sistem informasi ini menghasilkan rancangan desain DFD, ERD dan tersusun tiga tabel pembentuk siswa yaitu, dosen, mhs dan bimbingan.

Perbedaan penerapan model cooperative learning tipe TPSQ dengan STAD terhadap hasil belajar teknik elektronika dasar kelas X Teknik Elektronika Industri di SMK Negeri 2 Singosari Kabupaten Malang / Wawan Purwanto

 

ABSTRAK Purwanto, Wawan. 2016. PerbedaanPenerapan Model Cooperative Learning tipe TPSQ dengan STAD terhadapHasilBelajarTeknikElektronikaDasarKelas X TeknikElektronikaIndustri di SMK Negeri 2 SingosariKabupaten Malang.Skripsi,JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang.Pembimbing: (I) Dr. HarySuswanto, S.T., M.T. (II) Drs. PugerHonggowiyono, M.T. Kata Kunci:TPSQ, STAD, danHasilBelajar Berdasarkanobservasi di SMK Negeri 2 SingosariKabupaten Malang, padapembelajaranTeknikElektronikaDasardiperolehhasilsebagaiberikut: (1) guru masihmenggunakan model pembelajaran yang belummenerapkanstudent center; (2) keaktifandankeseriusanpesertadidikmasihkurang; (3) pesertadidikkurangmemahamimateripembelajaran;dan (4) hasilbelajarbelummemuaskan. Berdasarkan data observasi, dari 72 pesertadidikdalamduakelas, dimanamasing-masingkelasterdiridari 36 pesertadidik, hanya 16,6% pesertadidik yang aktifdanantusiasbertanyadalammengikutipembelajaran. Hal tersebutdikarenakan model pembelajaran yang belummenerapkanprinsipstudent center, sehinggapesertadidikmenjadicepatbosan, kurangaktif, kurangantusiasdalambelajar, kurangmemahamimateripembelajaran, danmenyebabkanhasilbelajarpesertadidikpadaranahpengetahuan, sikap, danketerampilanmenjadikurangmemuaskan. Untukitu agar dapatmeningkatkanhasilbelajarpesertadidikdantercapainyatujuanpembelajaranpadamatapelajaranTeknikElektronikaDasarperludiadakanperbaikanpembelajarandenganmenggunakan model Cooperative Learningtipe TPSQdan STAD. PenelitianinibertujuanuntukmengetahuisignifikansiperbedaanhasilbelajarpadamatapelajaranTeknikElektronikaDasarantarapesertadidikpadakelasA yang dibelajarkanmenggunakan model Cooperative LearningtipeSTAD, sedangkanpadakelas Bdibelajarkanmenggunakan model Cooperative LearningtipeTPSQ.Penelitianinimenggunakandesaineksperimensemu (quasi experimental design)denganpolanonequivalent posttest only design. Variabel yang akandiukuradalahhasilbelajarpesertadidikranahpengetahuan, sikap, keterampilandan juga membandingkanhasilbelajarantarakeduakelas. Analisis data yang digunakanuntukmengujihipotesisadalahuji-t. Hasilpenelitianmenunjukkanbahwaterdapatperbedaanhasilbelajar yang signifikanpadaranahpengetahuan (sig. 0,000<0,05) dansikap (sig.0,000<0,05). Sedangkanpadaranahketerampilantidakterdapatperbedaanhasilbelajar yang signifikan (sig. 0,689>0,05). Kesimpulandaripenelitianyaituterdapatperbedaanhasilbelajar yang signifikanpadaranahpengetahuandansikap, sedangkanpadaranahketerampilantidakterdapatperbedaanhasilbelajar yang signifikanantarapesertadidikkelas A yang dibelajarkanmenggunakan model Cooperative LearningtipeSTAD dengankelas B yang dibelajarkanmenggunakan model Cooperative Learningtipe TPSQ.

Alih kode dalam komunikasi lisan informal masyarakat Pandhalungan di Perumahan Surya Asri Wonorejo, Lumajang: analisis faktor penyebab alih kode / Maristessa Harsal

 

Harsal, Maristessa. 2014. Alih Kode dalam Komunikasi Lisan Informal Masyarakat Pandhalungan di Perumahan Surya Asri Wonorejo, Lumajang. Analisis Faktor Penyebab Alih Kode. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. A. Syukur Ghazali, M.Pd., (II) Musthofa Kamal, S.Pd., M.Sn. Kata kunci: alih kode, komunikasi lisan informal, faktor penyebab alih kode.     Pada masyarakat Pandhalungan di Perumahan Surya Asri Wonorejo terdapat pemakaian dua bahasa atau lebih, yaitu bahasa Jawa (BJ), bahasa Madura (BM), dan bahasa Indonesia (BI) secara bersama-sama atau bergantian. Pemakaian dua bahasa atau lebih berimplikasi terhadap fenomena alih kode. Alih kode pada penelitian masyarakat Pandhalungan di Perumahan Surya Asri Wonorejo dikhususkan kepada alih kode antara bahasa yang satu dengan bahasa yang lain, bukan alih kode antara ragam-ragam atau gaya-gaya yang terdapat dalam satu bahasa. Penelitian ini bertujuan untuk mendeskripsikan faktor-faktor penyebab alih kode yang mencakup partisipan, situasi, topik, dan fungsi interaksi dalam komunikasi lisan masyarakat Pandhalungan.     Penelitian ini menggunakan rancangan penelitian kualitatif sosiologi. Data penelitian berupa alih kode percakapan dalam bentuk audio dan visual yang terjadi dalam interaksi sosial pada situasi nonformal masyarakat Pandhalungan di Perumahan Surya Asri Wonorejo, Lumajang. Pengumpulan data dilakukan dengan alat perekam dan wawancara semistruktural. Instrumen yang digunakan untuk mengumpulkan data berupa alat perekam dan pedoman wawancara.     Berdasarkan hasil analisis data, diperoleh empat simpulan hasil penelitian sebagai berikut. Pertama, peneliti menemukan lima faktor penyebab partisipan beralih kode, yaitu (1) usia yang lebih tua, (2) perbedaan jenis kelamin, (3) perbedaan latar belakang etnis, (4) ada tidaknya relasi kekeluargaan yang dipengaruhi oleh faktor keakraban sebagai penyebab alih kode, dan (5) partisipan kurang akrab sebagai penyebab alih kode. Oleh karena itu, dari kelima faktor partisipan penyebab alih kode, terdapat empat faktor partisipan yang dipengaruhi oleh faktor keakraban sebagai penyebab alih kode.     Kedua, terdapat tiga faktor situasi penyebab alih kode, yaitu (1) latar ang dipengaruhi oleh faktor tingkat formalitas, latar belakang etnis, dan faktor keakraban sebagai penyebab terjadinya alih kode, (2) tingkat formalitas yang dipengaruhi oleh faktor latar dan tingkat keakraban sebagai penyebab terjadinya alih kode, dan (3) tingkat keakraban yang tidak dipengaruhi oleh faktor situasi lain yang menjadi penyebab terjadinya alih kode. Oleh karena itu, dari ketiga faktor situasi penyebab alih kode, terdapat tiga faktor situasi yang dipengaruhi oleh faktor keakraban.     Ketiga, faktor topik penyebab alih kode dalam komunikasi lisan masyarakat Pandhalungan di Perumahan Surya Asri Wonorejo, yaitu perubahan dari topik kekeluargaan ke topik pengetahuan. Keempat, terdapat dua faktor fungsi interaksi, yaitu (1) menaikkan status dan (2) memerintah. Kedua faktor fungsi interaksi penyebab alih kode tidak saling memengaruhi satu sama lain.

Pengaruh tayangan iklan di media televisi terhadap keputusan pembelian honda absolute revo 110CC (studi pada PT. Eka Jaya Motor Batu) / Ronggo Suhandoko

 

Kata Kunci: Iklan, Keputusan Pembelian, Honda Absolute Revo Daya saing yang semakin tajam dalam dunia bisnis menyebabkan para pelaku bisnis ingin mendapatkan tempat yang istimewa dihati konsumen atas produknya. Selain harus mampu menciptakan produk yang unggul, perusahaan juga harus mampu mengkomunikasikan produknya kepada konsumen agar produk mereka lebih dikenal dan diterima, salah satu upaya yang dilakukan adalah dengan strategi promosi. Sebagai salah satu bauran pemasaran, strategi promosi ini diharapkan dapat merebut perhatian calon konsumen. Iklan merupakan salah satu strategi promosi yang dijalankan oleh perusahaan untuk memberikan informasi kepada masyarakat tentang produk dan membujuk pembeli atau target pasar, serta saluran distribusi dan publik untuk membeli produknya. Periklanan digunakan oleh suatu perusahaan untuk menginformasikan (to inform), membujuk (to persuade), serta mengaitkan orang-orang tentang produk yang dihasilkan oleh organisasi maupun individu. Penelitian ini termasuk penelitian deskriptif korelasional dengan menggunakan analisis statistik deskriptif dan analisis statistik inferensial yaitu regresi linier berganda dengan menggunakan SPSS 16.00 for Windows. Populasi dalam penelitian ini adalah seluruh pengunjung dealer Eka Jaya Batu. Dengan menggunakan rumus Infinitife Population dari Daniel & Terrel diperoleh jumlah 84 responden. Untuk mengantisipasi adanya kuesioner yang tidak dikembalikan oleh responden maka peneliti menyebarkan 100 kuesioner kepada 100 responden. Dari 100 kuesioner yang disebar hanya kembali 94 kuesioner, dan yang layak untuk dijadikan responden hanya 84 kuesioner. Penyebaran kuesioner kepada responden dengan menggunakan teknik Accidental Sampling. Data dalam penelitian ini bersifat kuantitatif serta berjenis data ordinal yang mendekati ciri-ciri interval sehingga bisa disebut sebagai data interval. Sumber data yang digunakan adalah sumber data primer dan data sekunder. Pengambilan data primer dalam penelitian ini menggunakan instrumen penelitian berupa angket atau kuesioner, yang sebelumnya telah diuji melalui uji validitas dan uji reliabilitas yang telah diujikan. Instrumen penelitian ini menggunakan Skala Likert 5 opsi, skala pengukuran untuk iklan dan keputusan pembelian meliputi: sangat setuju (5), setuju (4), kurang setuju (3), tidak setuju (2), dan kurang sangat setuju (1). Tujuan penelitian diwujudkan dengan menggunakan analisis statistik deskriptif guna mengetahui gambaran masing-masing subvariabel iklan yang terdiri dari isi pesan, struktur pesan, format pesan, dan sumber pesan serta variabel keputusan pembelian, baik secara parsial maupun simultan. Untuk menguji kelayakan model regresi dilakukan uji asumsi klasik. ii Kesimpulan dari penelitian ini menunjukkan ada pengaruh antara tayangan iklan di media televisi terhadap keputusan pembelian Honda Absolute Revo di dealer Eka Jaya Batu, baik secara parsial maupun simultan. Variabel yang berpengaruh dominan adalah isi pesan. Sehingga berdasarkan hasil tersebut, disarankan: (1) Bagi Perusahaan hasil penelitian ini dapat dijadikan pertimbangan dalam memutuskan pelaksanaan bauran promosinya, khususnya periklanan sehingga produk yang dipasarkan lebih mengena dan mudah diingat oleh konsumen. Hal ini dilakukan untuk melihat situasi dan kondisi konsumen untuk menetapkan iklan yang tepat sehingga mempengaruhi keputusan pembelian guna meningkatkan penjualan Sepeda Motor Honda Absolute Revo. Selain itu, pesan ini juga akan meningkatkan citra Sepeda Motor Honda Absolute Revo. di mata konsumennya. (2) Isi pesan, dan Sumber pesan mempunyai pengaruh terbesar dalam keputusan pembelian Sepeda Motor Honda Absolute Revo. Untuk itu kiranya perusahaan dapat terus mempertahankan kredibilitas isi pesan yang digunakan. Hal ini terkait dengan semakin ketatnya persaingan industri sepeda motor khususnya di Indonesia. Karena pasar sepeda motor di Indonesia dinilai sangat potensial.

Pembentukan civic participation peserta didik dalam pembelajaran PPKn di SMPN 2 Malang / Iin Puji Handayani

 

ABSTRAK Handayani, Iin Puji. 2016. Pembentukan Civic ParticipationPeserta Didik Dalam Pembelajaran PPKn di SMP Negeri 2 Malang. Skripsi. Prodi Pendidikan Pancasila dan Kewarganegaraan. Jurusan Hukum dan Kewarganegaraan. Fakultas Ilmu Sosial Universitas Negeri Malang. Pembimbing: (I) Drs. Suparlan Al Hakim,M.Si, (II) Siti Awaliyah, S.Pd, M.Hum Kata Kunci:Civic Participation, Peserta Didik, Pembelajaran PPKn Civic participation adalah partisipasi kewarganegaraan yang merupakan tujuan dari PPKn dalam mewujudkan generasi yang demokratis. Hakikat dari PPKn adalah memantapkan pengembangan peserta didik dalam dimensi kesadaran sebagai warga negara (civic literacy), komunikasi sosial kultural kewarganegaraan (civic engagement), kemampuan berpartisipasi sebagai warga negara (civic skill and participation), penalaran kewarganegaraan (civic knowledge), dan partisipasi kewarganegaraan secara bertanggung jawab (civic participation and civic responsibility). Secara keseluruhan pembelajaranPPKn di SMP Negeri 2 Malang mulai mengembangkan 3 aspek kompetensi, yaitu kognitif, afektif, dan psikomotorik. Untuk melihat perkembangan aspek kompetensi tersebut terutama dalam aspek psikomotorik guru PPKn berupaya membentuk civic participation dari peserta didikdalam kegiatan pembelajaran. Hal ini ditunjukkan dengan adanya bagaimana partisipasi dari peserta didik dalam pembelajaran PPKn dan diimplementasikan dalam kegiatan sekolah. Penelitian ini bertujuan untukmengetahui(1) rencana program pembentukan civic participation peserta didik dalam pembelajaran PPKn di SMPN 2 Malang, (2) pelaksanaan pembentukan civic participation peserta didik dalam pembelajaran PPKn di SMPN 2 Malang, (3) kendala pembentukan civic participation peserta didik dalam pembelajaran PPKn di SMPN 2 Malang, dan (4) upaya mengatasi kendala pembentukan civic participation peserta didik di SMPN 2 Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Dalam hal ini, peneliti adalah sebagai instrumen utama. Data penelitian ini berupa aktivitas partisipasi peserta didik dalam kegiatan pembelajaran PPKn. Dalam pengumpulan data dilakukan dengan cara observasi melalui pengamatan langsung terhadap kegiatan pembelajaran, wawancara dengan menggunakan pedoman wawancara, dan dokumentasi yang berupa gambaran umum SMPN 2 Malang. Kegiatan analisis data dimulai dengan mereduksi data, penyajian data, dan penarikan kesimpulan. Dalam penelitian ini, triangulasi sumber data diterapkan untuk mengecek keabsahan data. Hasil penelitian ini secara umum menunjukkan bahwa, pertama perencanaan pembentukan civic participation peserta didik adalah melalui penyusunan silabus dan penyusunan RPP, kedua pelaksanaan pembentukan civic participation peserta didik diantaranya(a) menyanyikan lagu-lagu nasional, (b) melaksanakan upacara bendera, (c) melaksanakan kegiatan atau gerakan mentaati tata tertib sekolah, (d) berpartisipasi dalam pentas budaya, (e) berpartisipasi dalam kegiatan sekolah, (f) ikut berpartisipasi dalam kegiatan pemilu,ketiga kendala dalam pelaksanaan program pembentukan civic participation peserta didik dalam pembelajaran PPKn adalah (a) dalam hal mengatur kondisi kelas peserta didik, (b)dalam hal mengatasi peserta didik yang memiliki karakter pendiam, dan keempat upaya mengatasi kendala dalam pelaksanaan program pembentukan civic participation peserta didik dalam pembelajaran PPKn adalah (a) memperingatkan peserta didik yang tidak tertib dan kurang memperhatikan, (b) mencoba berinteraksi dengan peserta didik terhadap permasalahan yang terjadi, (c) menggunakan model pembelajaran yang menarik, dan (d) memberikan pertanyaan atau tugas tambahan bagi peserta didik yang ramai. Saran yang diberikan peneliti oleh guru PPKn dan sekolah sebagai berikut: (a) guru PPKn sebaiknya meningkatkan dan mengembangkan terus program pembentukan civic participation terhadap peserta didik baik dalam pembelajaran maupun dalam kegiatan sekolah, (b) guru PPKn sebaiknya terus menanamkan nilai demokrasi agar civic participation peserta didik dapat terwujud dengan tanggung jawab, (c) sekolah sebaiknya terus meningkatkan kegiatan sekolah yang kreatif dan inovatif untuk mendukung adanya partisipasi dari peserta didik seperti kegiatan pemilihan ketua OSIS ataupun kegiatan partisipasi lain.

Penerapan pembelajaran inkuiri terbimbing dengan model siklus belajar 5-E untuk meningkatkan kemampuan kerja ilmiah dan kognitif siswa kelas VII B MTs. Surya Buana malang / Imroatul Kholishoh

 

Kata kunci : pembelajaran inkuiri terbimbing, model siklus belajar 5-E, kerja ilmiah, kognitif. Berdasarkan observasi awal yang dilakukan di MTs. Surya Buana Malang, ditemukan bahwa guru yang mengajar di kelas VIIB menggunakan metode ceramah dalam pembelajaran fisika dan jarang melakukan kegiatan praktikum sehingga kemampuan kerja ilmiah siswa kurang 70%, ini berarti kemampuan kerja ilmiah siswa masih kurang menurut Modifikasi Nasution (2007). Hasil lain yang ditemukan bahwa kemampuan kognitif siswa kurang dari ketutasan yang belajar klasikal, yaitu hanya 21%. Ketutasan belajar klasikal siswa menurut SKM madrasah adalah 85%. Usaha yang dilakukan untuk memperbaiki permasalahan tersebut yaitu melakukan penerapan pembelajaran inkuiri terbimbing dengan model siklus belajar 5-E. Penelitian ini bertujuan untuk meningkatkan kemampuan kerja ilmiah siswa dan kognitif siswa. Ketercapaian tujuan tersebut dilakukan dengan menerapkan pembelajaran inkuiri terbimbing dengan model siklus belajar 5-E. Pembelajaran terdapat kegiatan demonstrasi dan praktikum yang terdiri dari merumuskan masalah, membuat hipotesis, merencanakan kegiatan, melaksanakan kegiatan, mengumpulkan data, dan mengambil kesimpulan dengan petunjuk-petunjuk seperlunya dari seorang guru. Model siklus belajar 5-E terdiri dari fase pendahuluan, eksplorasi, eksplanasi, elaborasi, dan evaluasi. . Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK), yang terdiri dari dua siklus. Tahapan yang digunakan dalam penelitian adalah perencanaan, tindakan kelas, observasi, dan refleksi. Subjek penelitian ini adalah siswa kelas VII B MTs. Surya Buana Malang dengan jumlah 19 siswa yang terdiri dari 7 laki-laki dan 12 perempuan. Instrumen yang digunakan adalah lembar observasi untuk mencatat data keterlaksanaan pembelajaran dan data kemampuan kerja ilmiah, tes untuk mencatat data kemampuan kognitif siswa, dan catatan lapangan untuk mancatat segala hal yang berhubungan dengan kegiatan pembelajaran yang dilakukan oleh guru maupun siswa yang tidak tercantum dalam lembar observasi. Teknik analisis data dalam penelitian adalah analisis data kualitatif yang menggunakan persentasi. Hasil penelitian menunjukkan bahwa penerapan pembelajaran inkuiri terbimbing dengan model siklus belajar 5-E dapat meningkatkan kemampuan kerja ilmiah siswa yang ditunjukkan oleh peningkatan persentasi seluruh aspek kemampuan kerja ilmiah dan kemampuan kognitif siswa kelas VII B MTs. Surya Buana Malang.. Persentasi kemampuan kerja ilmiah pada siklus I sebesar 74% meningkat menjadi 83,41% pada siklus II dan kemampuan kognitif pada siklus I sebesar 42,10% meningkat menjadi 89,47% pada siklus II.

A Study of the companion's of the prophet geographical dictribution and political alignments / by Fu'ad Jabali

 

Budaya mutu pada sekolah unggulan: studi kasus di SD Islam Sabilillah Malang / Ali Afandi

 

Sebagai salah satu upaya dalam meningkatkan mutu pendidikan dapat diupayakan melalui pengembangan sekolah yang baik atau sekolah yang efektif atau sekolah yang exellent (Sergiovanni, 1987) atau sekolah yang unggul (Newman). Dengan pengembangan sekolah yang baik diharapkan mampu menjadikan pendidikan yang berkualitas. Peningkatan mutu pendidikan di sekolah melalui pengembangan sekolah tidak terlepas dari peranan sekolah dalam mengembangkan budaya mutu sekolah yang dikembangkan. Sekolah yang memiliki karakteristik atau sekolah unggullah yang mampu mencapai keberhasilan pendidikan sebagaimana yang diharapkan, karena sekolah unggul memiliki budaya sekolah (school culture) yang baik. Budaya sekolah merupakan faktor yang paling penting dalam membentuk siswa menjadi manusia yang penuh optimis, berani, tampil, berperilaku kooperatif, dan kecakapan personal dan akademik (Sergiovanni, 1984). Untuk itu perlu diteliti lebih lanjut budaya mutu yang ditampilkan oleh sekolah unggul dalam upaya meningkatkan mutu pendidikan di sekolah. Tujuan penelitian ini adalah (1) untuk mengungkapkan spirit dan nilai-nilai yang dijadikan sumber budaya mutu sekolah; (2) menggambarkan budaya mutu sekolah yang tercermin dalam visi dan misi sekolah, struktur organisasi sekolah, deskripsi tu-gas sekolah, sistem dan prosedur kerja sekolah, kebijakan dan aturan-aturan sekolah, tata tertib sekolah, penampilan fisik sekolah, suasana, dan hubungan formal maupun informal dalam sekolah; (3) menggambarkan budaya mutu sekolah yang nampak dalam sikap dan perilaku kepala sekolah, guru, dan tenaga kependidikan lainnya; dan (4) mendeskripsikan tahap-tahap pengembangan budaya mutu sekolah yang dilakukan kepala sekolah, guru, tenaga kependidikan lainnya, dan stakeholder sekolah. Sedangkan obyek penelitian ini adalah di Sekolah Dasar Islam Sabilillah Malang yang merupakan satuan pendidikan dasar yang bercirikan Islam. Sekolah Dasar Islam Sabililah Malang ini diselenggarakan oleh Lembaga Pendidikan Islam Sabilillah Malang pada Yayasan Sabilillah Malang di bawah pembinaan Dinas Pendidikan Kota Malang. Penelitian ini termasuk penelitian kualitatif dengan rancangan penelitian yang berkategori studi kasus. Adapun teknik pengumpulan datanya dilakukan dengan tiga cara, yaitu: (1) wawancara mendalam, (2) observasi atau pengamatan berperan serta, dan (3) studi dokumentasi. Pemilihan informan penelitian ini menggunakan teknik snowball sampling. Data yang terkumpul dinalisis secara deskriptif dengan alur (a) reduksi data, (b) penyajian data, dan (c) penarikan kesimpulan. Untuk mendapatkan keabsahan data dilakukan uji kredibilitas, transferabilitas, dependebilitas, dan konfir-mabilitas. Dari analisis data diperoleh temuan penelitian, sebagai berikut: (1) spirit dan nilai-nilai budaya mutu yang dijadikan sebagai landasan penyelenggaraan pendidikan adalah (a) spirit dan nilai-nilai perjuangan, (b) spirit dan nilai-nilai ibadah, (c) spirit dan nilai-nilai amanah, (d) spirit dan nilai-nilai kebersamaan, (e) spirit dan nilai-nilai disiplin, (f) spirit dan nilai-nilai profesionalisme, dan (g) spirit dan nilai-nilai menjaga eksistensi sekolah; (2) wujud budaya mutu sekolah nampak pada: (a) visi dan misi sekolah tercermin dalam program atau kegiatan sekolah, dan strategi pembelajaran yang diterapkan, (b) struktur organisasi dan deskripsi tugas sekolah tercermin dengan pembagian tugas yang jelas, garis instruktif dan koordinatif yang fungsional, (c) sistem dan prosedur kerja sekolah tercermin dengan sistem reward bagi siswa dan guru, dan upaya-upaya peningkatan profesional guru, (d) kebijakan dan aturan sekolah tercermin dalam proses pengambilan kebijakan atau keputusan sekolah yang melibatkan warga sekolah, (e) tata tertib sekolah tercermin dalam proses pembuatan tata tertib sekolah melalui team work yang solid, implementasi yang mengedepankan reward, dapat diterima dan dirasakan oleh warga sekolah dengan baik, (f) penampilan fisik (fasilitas) sekolah tercermin dengan usaha-usaha optimalisasi pemanfaatan fasilitas sekolah, perawatan, pemantauan dan evaluasi, (g) suasana dan hubungan formal dan informal tercermin dengan komunikasi melalui kooodinasi yang kontinyu, pengakuan bagi yang berprestasi, suasana saling menghormati, akrab, suasana maju, kreatif, inovatif, hubungan antar individu dan antara bawahan pimpinan yang baik, perhatian secara individu siswa oleh guru, serta pemberian tindakan yang jelas bagi warga sekolah yang melakukan pelanggaran di sekolah; (3) wujud budaya mutu pada sikap dan perilaku tercermin dengan sikap dan perilaku islami, sikap-sikap motivasi dan berprestasi, sikap keteladanan dan berjiwa sosial; dan (4) tahap-tahap pengem-bangan budaya mutu yang dilakukan oleh kepala sekolah, guru, tenaga kependidikan lainnya dan stakeholder sekolah melalui 3 (tiga) tahap, yaitu: (a) tahap perumusan tujuan pengembangan yang dijiwai spirit dan nilai-nilai yang dilanjutkan dengan penetapan kebijakan, (b) tahap sosialisasi dan implementasi, dan (c) tahap evaluasi dan follow up.

Penggunaan analisis camel untuk menilai tingkat kesehatan Bank Syariah (studi kasus: PT. BRI Syariah (Persero) Tbk.) / Vini Annesia Aflaha

 

ABSTRAK Aflaha, Vini, A. 2012. Penggunaan Analisis CAMEL untuk Menilai Tingkat Kesehatan Bank Umum Syariah (Studi kasus pada PT. BRI Syariah (Persero) Tbk.). Pembimbing I : Dr. Sunaryanto, M.Ed, Pembimbing II : Dr. Nurika Restuningdiah, S.E., M.Si.,Ak. Kata Kunci: Analisis CAMEL, Tingkat Kesehatan Bank, Bank Umum Syariah. Bank merupakan suatu lembaga yang berperan sebagai perantara keuangan antara pihak-pihak yang memiliki dana dengan pihak-pihak yang memerlukan dana serta sebagai lembaga yang berfungsi memperlancar aliran lalu lintas pembayaran. Salah satu dari fungsi bank adalah menghimpun dana yang juga merupakan salah satu keunggulan dari bank. Dengan demikian bank wajib memelihara tingkat kesehatan bank dengan prinsip kehati-hatian. Dalam melakukan penilaian tingkat kesehatan bank, umumnya dengan menggunakan metode CAMEL. Karena CAMEL tidak hanya untuk menilai tingkat kesehatan bank tetapi juga dapat memprediksi prospek suatu bank di masa mendatang. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui tingkat kesehatan PT. Bank Rakyat Indonesia Syariah (Persero) Tbk. tahun 2009-2011 dengan menggunakan metode CAMEL. Perhitungan dengan metode CAMEL memperhitungkan mengenai faktor permodalan dengan indikator rasio CAR, faktor kualitas aktiva produktif dengan indikator rasio BDR, faktor manajemen dengan indikator rasio NPM, faktor rentabilitas dengan indikator rasio ROA dan BOPO, serta faktor likuiditas dari suatu bank dengan indikator rasio LDR. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Populasi yang digunakan sebagai sampel penelitian ini adalah lembaga keuangan perbankan umum syariah, dengan alasan bahwa perbankan mempunyai peranan yang penting dalam pertumbuhan dan perkembangan perekonomian karena membantu kegiatan pembangunan yang diatur oleh pemerintah. Penelitian ini menggunakan data sekunder, yang merupakan data jadi yang diterbitkan oleh organisasi yang biasana diperoleh dari dokumen, publikasi dan lainnya. Data yang digunakan adalah laporan keuangan selama tiga tahun berturut-turut, yaitu tahun 2009 sampai tahun 2011 dari PT. Bank Rakyat Indonesia Syariah (Persero) Tbk. Dari hasil perhitungan tingkat kesehatan PT. BRI Syariah dengan menggunakan metode CAMEL dapat diketahui tingkat kesehatan PT. BRI Syariah selama tahun 2009-2011 dapat dikategorikan kurang sehat. Hal ini ditunjukkan dengan nilai skor kumulatif pada kisaran 51-66, yang dapat diketahui dari faktor rentabilitas (Earning) dengan indikator rasio ROA. Yang mana ini dikarenakan adanya rasio ROA yang sangat kecil yang dikeranakan laba bersih yang dihasilkan kurang bisa mengimbangi besarnya beban operasional yang dikeluarkan sehingga berdampak pada faktor manajemen yang mengalami fluktuatif. Akan tetapi meskipun dalam kategori demikian, bank yang baru menjalan usahanya yang berdasarkan prinsip syariah selama tiga tahun ini telah menunjukkan usaha untuk meningkatkan tingkat kesehatannya terus menerus. Hal ini dapat di ketahui dari kenaikan-kenaikan tingkat kesehatan bank dari nilai 60.94 di tahun 2009, nilai 63.36 pada tahun 2010, serta naik menjadi 63.91 di tahun 2011.

Analisis pengaruh financial leverage, net profit margin (NPM), dan return on equity (ROE) terhadap earning per share (EPS) pada perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia tahun 2007-2009 / Nimas Ajeng Pradnya Paramita

 

Fakhs al-Din al-Razi's methodology in interpreting the Qur'an / by Shalahudin Kafrawi

 

Pertanyaan tutor dalam pembelajaran bahasa Indonesia untuk penutur asing di Universitas Negeri Malang
oleh Anik Sholihah

 

Penelitian ini bertujuan untuk mengidentifikasikanp ertranyaantu tor dalam PB I untuk penutur asing di UM Secara khusu bertujuan untuk mendeskripsikan (l) bentuk-bentuk pertanyaan tutor, (2) tungsi pertanyaan tutor, dan (3) strategt tutor dalam bertanya. Penelitian ini rnenggunakan pendekatank ualitatif denganr ancanganp enelitians tudi kasus.D ata penelitian berupa lransknpsi dan catatan lapangan tentang pertanyaan tutor. Instrumen kunci adalah peneliti sendiri dibantu dengan alat-alat perekam berupa caset recorder, dan alat-alat catatan lapangan. Penelrtian ini dilaksanakan di UM, clengans ub.lekp enelitiana dalaht utor untuk Darmasiswad an penga.ladr i CIS tslPA Prograrn CSC (Council Students Center). Data penelitran dikrunpulkan dengant eknik observasni onpartisipanw, awancarad, an angket.L angkahu mum ],ang digunakan dalam rnenganalisis data adalah menyajikan data, rrengklasifikasdi ata,v erifikasi data,d an penarikans impulan.U ntuk mengecek keabsahand ata dan keterpcrcayaanh asil simpuiand ilakukan trianggulasib, aik ronans ejauata. hli,r naupuntc ori. Temuan penelitan menyatakan bahrva bentuk-bentuk pertanyaan yang diajukant utor dalam PBI untuk penutura singb anyakm enggunakank ata tanya ktpu, .\'iapa, hcrupu, tnena, ketnana, kapan, nrcngupu, baguintana tlan l('t'tunvuutt lxtlLtpr iltltutr) discrlai intonasi tanya..Bentuk pertanyaan selanlLrtnyaad alahk alirnat berita disertaid engani ntonasit anya. lJntuk bentuk pertanyaany ang paling sedikit adalahk ata tanyas ulah (kah) dant iduk (kah) disertaii ntonasit anya.T emuan fungsip ertanyaans ebanyak5 fungsi pertanyaan tutor dalaln PBI I'aitu (l) untuk metnintap enjelasan(,2 ) untuk meminta penegasan(,3 ) untLrkn rernerintah(,4 ) untuk keluhan,d an (5) untuk pulian atau cemoohan Strategi tutor dalarn bertanya ada 6 cara yaitu (l) tutor memberikan rvaktr.rb erpikir, (2) mengLrngkapkanp ertanyaans ecaraj elas, (3) pcmbenan acuana taui lustrasi,( 4) petnusatana tau pemtbkusanp ertanyaan(,5 ) pertanyaan dipindahgrlrrkank epadap embelajarl ain, dan (6) Menuntut pembelajard engan rnengungkapkanp crtanyaand enganc ara lain, mengungkapkand enganb ahasa vang lebih sederhanad,a n denganp enjelasan-pen3elasan, tscrtitik tolak dari ternuan-ternuadni atas,d apat disimpulkanb ahwa pe(an)aan-pertartvaatunl or dalam PBI cukup bervariasi,b aik itu benl'uk, fungsi, maupun strategi yang digunakan. Taapi tutor masih jarang menggunakapne rtanyaany ang dibentukd engank ata sudah (kah) dant dak (-kah) diikuti intonasi tanya. Tutor masih menggunakan fungsi pe(anyaan untuk pujian atau cemoohan, dan jarang menggunakan strategr menuntun pertanyaadne nganp enjelasan-penjelasan. Atas dasarp aparand i atas,d iajukan saran-s&rasne bagabi erikut, (1) agar siswa dapat menjawab pertanyaan dengan tepat dan bermakna, tutor hendaknyam enggunakanp ertanyaany ang sesuaid enganb entuk, fungsi, dan strategi, (2) untuk peneliti lanjutan diharapkan meneliti dengan subjek yang lebih luas dengan instrumen yang berbeda dan kajian masalah yang lebih mendalamd, an (3) LembagaB IPA di UM diharapkanm emberikanb ekal dan pengalamayna ngc ukup kepadat utor tentangk eterampilanb ertanya.

Pengembangan CD modul interaktif untuk mata pelajaran ilmu pengetahuan alam pokok bahasan penggolongan hewan berdasarkan jenis makanannya pada kelas IV di SD Tulungrejo I Kecamatan Bumuaji kota Batu / Ardheiles Toto Arima

 

Kata Kunci: Pengembangan, CD Modul Interaktif, Ilmu Pengetahuan Alam CD Modul interaktif merupakan pengembangan dari modul cetak. Modul ini merupakan salah satu media yang dapat digunakan dalam proses pembelajaran. Penggunaan modul dalam proses pembelajaran dapat menimbulkan manfaat atau nilai tertentu dari segi penggunaanya, karena dalam penggunaanya siswa dapat belajar sesuai dengan kemampuan mereka. Berdasarkan observasi awal dilapangan adalah di sekolah tersebut belum menggunakan modul interaktifdan hanya menggunakan media sederhana saja dalam proses pembelajaran meskipun di sana tersedia sarana belajar yang memadahi, luasnya materi Sumber Daya Alam dan terbatasnya waktu yang digunakan dalam penyampaian materi membuat siswa merasa jenuh dalam proses pembelajaran jika hanya menggunakan media sederhana dalam penyampaianya. Oleh karena itu perlu adanya penyediaan sumber belajar yang berupa modul interaktif yang didesain dalam bentuk CD Interaktif. Tujuan dari pengembangan ini adalah untuk menghasilkan suatu produk berupa modul interaktif untuk pembelajaran Ilmu Pengetahuan Alam SD kelas IV yang dapat dijadikan sebagai alternatif dalam pencapaian tujuan pembelajaran yang ditentukan. Subyek penelitian dalam uji coba pengembangan ini adalah siswa SD Negeri Tulungrejo 1 kota Batu kelas 4. jenis data yang digunakan adalah kualitatif dan kuantitatif, data kualitatif diperoleh dari vaidasi ahli media, ahli materi dan siswa. Sedangkan data kuantitatif diperoleh dari hasil pre-test dan post-test. Hasil dari penelitian pengembangan ini berupa CD modul interaktif Mata pelajaran Ilmu Pengetahuan Alam pokok bahasan " Penggolongan Mahluk Hidup Berdasarkan Makanannya". media tersebut divalidasikan pada ahli media, ahli materi dan siswa. Hasil validasi tersebut adalah 1) data ahli media pada kriteria kelayakan modul interaktifdikatakan valid/layak digunakan dengan hasil persentase 93,3%, 2) data ahli materi pada kriteria kelayakan modul interaktifdikatakan valid/layak digunakan dalam pembelajaran dengan hasil persentase 95%, 3) data siswa perseorangan dan kelompok kecil hasil yang diperoleh adalah 87,5% dan 86,9% sehingga pada kriteria kelayakan modul interaktifdikatakan valid/layak digunakan dalam pembelajaran, 4) pada data hasil pre-test dan post-test perseorangan terjadi peningkatan hasil belajar rata-rata dengan nilai 12 dengngan peningkatan nilai terendah 10 dan tertinggi 20. Dengan demikian menurut kriteria kelayakan modul interaktifyang dikembangkan layak digunakan sebagai media pembelajaran. Kesimpulan dari pengembangan ini adalah modul interaktif yang dikembangkan termasuk valid atau layak digunakan sebagai media pembelajaran. Saran pengembangan ini adalah: 1) Bagi Guru, guru mata pelajaran hendaknya mulai menggunakan modul interaktif dan lebih terampil dalam menggunakan dengan cara berlatih. 2) Bagi Siswa, siswa dalam menggunakan media pembelajaran ini harus mempunyai keterampilan dasar dalam pengoperasian komputer, dan beberapa kemampuan dan keterampilan lainnya untuk mendukung penggunaan media ini. 3) Bagi Pengembang selanjutnya, modul interaktif ini hendaknya dikembangkan lebih baik lagi, tepat guna, dan tepat sasaran sehingga dapat dimanfaatkan sesuai dengan kebutuhan dan mencapai tujuan pembelajaran yang diinginkan. dalam Pengembangan modul interaktif untuk mata pelajaran Ilmu Pengetahuan Alam Pokok Penggolongan Mahluk Hidup Berdasarkan Makanannya perlu ada perbaikan dalam gambar,tampilan serta penyempurnaan fitur dalam modul interaktif ini.

Analisis soal ujian nasional (UN) pada mata pelajaran akuntansi tahun pelajran 2008/2009 dan 2009/2010 / Siska Purwanti

 

Kata Kunci: Analisis Kualitas Tes, Ujian Nasional, Mata Pelajaran Akuntansi Ujian nasional merupakan salah satu instrumen evaluasi dalam pendidikan yang terstandarisasi dan digunakan untuk mengukur hasil belajar siswa di akhir pengajaran suatu program pendidikan. Hasil ujian nasional tersebut digunakan untuk mengambil suatu keputusan dalam program pendidikan selanjutnya. Sedemikian pentingnya ujian nasional, sehingga bagi peserta didik, pendidik, dan orang tua benar-benar mempersiapkan diri dengan sebaik-baiknya. Meskipun demikian, kegagalan dalam ujian nasional masih banyak dialami setiap wilayah Indonesia. Hal tersebut menimbulkan pertanyaan apakah soal ujian nasional telah memenuhi kualifikasi sebagai tes standar yang memiliki kualitas instrumen yang andal. Kualifikasi tersebut meliputi tingkat validitas, reliabilitas, taraf kesukaran, daya beda tes. Penelitian ini bertujuan untuk mengetahui tingkat validitas, reliabilitas, taraf kesukaran, dan daya beda pada soal ujian nasional tahun pelajaran 2008/2009 dan 2009/2010. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Pengumpulan data dilakukan dengan teknik dokumen dari soal ujian nasional dua tahun terakhir. Analisis data meliputi analisis tingkat validitas item tes, reliabilitas tes, taraf kesukaran, dan daya beda tes. Berdasarkan hasil penelitian dan pembahasan yang telah dipaparkan, maka dapat disimpulkan bahwa soal-soal ujian nasional ekonomi dengan standar kompetensi dasar akuntansi perusahaan jasa tahun pelajaran 2008/2009 dan tahun pelajaran 2009/2010 kurang sesuai dengan kualifikasi dan keefektifan instrumen evaluasi yang baik terutama pada aspek validitas, taraf kesukaran, dan daya beda soal. Instrumen evaluasi yang baik adalah instrumen yang dapat dipercaya (valid), dapat diandalkan atau ajeg (reliabel), memiliki taraf kesukaran yang tersebar pada butir soal secara proporsional, dan daya beda yang baik pula. Secara umum, jika dibandingkan kualitas soal ujian nasional (UN) tahun pelajaran 2008/2009 dan tahun pelajaran 2009/2010, soal ujian nasional tahun 2008/2009 lebih baik dibandingkan dengan soal ujian nasional tahun pelajaran 2009/2010. Berdasarkan hasil penelitian ini disarankan dalam penelitian selanjutnya untuk menambah sampel penelitian lebih dari dua sekolah, agar hasil yang diperoleh benar-benar obyektif dan menujukkan hasil yang lebih baik, karena setiap sekolah memiliki kemampuan berpikir (input) siswa yang berbeda-beda.

Hubungan antara disiplin kerja guru dan iklim sekolah di SMK negeri se-kota Malang / Juwita Muktisari

 

Kata kunci: disiplin kerja, iklim sekolah, guru atau tenaga pendidik Kehidupan pada saat ini dirasakan berjalan semakin cepat. Di mana saja dapat dijumpai suatu keadaan yang terasa sibuk dan terburu-buru sehingga waktu juga terasa demikian sempit dan sangat berharga. Keadaan ini dengan sendirinya menuntut pula perubahan sikap dan perubahan perilaku manusia, khususnya di dalam terwujudnya disiplin kerja di mana saja dan kapan saja. Disiplin kerja adalah sikap mental yang menunjukkan kesungguhan hati untuk menaati segala hal secara cermat dan tertib, sehingga mancapai kondisi yang baik dalam memenuhi fungsi pendidikan. Kurangnya kedisiplinan akan menghambat penyelenggaraan pendidikan yang secara tidak langsung akan mempengaruhi proses pengembangan pendidikan secara keseluruhan. Tenaga pendidik khususnya guru sebagai pelaksana yang langsung berhubungan dengan anak didik mempunyai peranan yang sangat besar dalam meningkatkan mutu pendidikan, dengan lingkungan sekolah berada dalam keadaan yang nyaman, aman, harmonis, dan menyenangkan untuk melakukan kegiatan proses belajar mengajar dan kegiatan lainnya sesuai dengan tugas dan tanggung jawab masing-masing staf sekolah. Rumusan masalah yang diteliti adalah: (1) bagaimana tingkat disiplin kerja di SMK Negeri se-Kota Malang; (2) bagaimana tingkat kondisi iklim sekolah di SMK Negeri se-Kota Malang; dan (3) bagaimana hubungan antara disiplin kerja dan iklim sekolah di SMK Negeri se-Kota Malang. Sedangkan tujuan penelitiannya yaitu (1) untuk mengetahui tingkat disiplin kerja di SMK Negeri se-Kota Malang; (2) untuk mengetahui tingkat kondisi iklim sekolah di SMK Negeri se-Kota Malang; dan (3) untuk mengetahui hubungan antara disiplin kerja dan iklim sekolah di SMK Negeri se-Kota Malang. Penelitian ini menggunakan analisis statistik deskriptif. Statistik deskriptif adalah statistik yang digunakan untuk menganalisis data dengan cara mendeskripsikan atau menggambarkan data yang telah terkumpul. Adapun langkah-langkah perhitungan yang dilakukan dalam analisis deskriptif yaitu menentukan persentase dan menentukan kualifikasi dari variabel disiplin kerja (x) dan variabel iklim sekolah (y). Jumlah populasi guru yang ada di SMK Negeri Se-Kota Malang sebanyak 944 orang guru dari 12 SMK Negeri, didapatkan 33 orang guru yang mewakili sebagai sampel penelitian, dari jumlah populasi guru yang ada di SMK Negeri Se-Kota Malang. Jumlah sampel yang digunakan pada penelitian ini ditentukan berdasarkan rumus pengambilan jumlah sampel dari Taro dan Yamane atau disebut Rumus Slovin. Dalam pengambilan sampel ini peneliti menggunakan teknik Purposive Sampling, karena keterbatansan waktu, tenaga, dan dana sehingga tidak dapat mengambil sampel besar dan jauh. Hasil penelitian menunjukkan bahwa disiplin kerja guru berada pada kualifikasi sangat tinggi dengan persentase sebesar 30,3% dan diwakili oleh10 responden, kualifikasi tinggi dengan persentase sebesar 60,6% dan diwakili oleh 20 responden,dan kualifikasi cukup dengan persentase sebesar 9,1% dan diwakili 3 responden dengan jumlah keseluruhan sebanyak 33 responden. Sedangkan iklim sekolah berada pada kualifikasi sangat tinggi sebesar 27,3% dan diwakili oleh 9 orang responden, kualifikasi tinggi berada pada persentase sebesar 54,5% dan diwakili oleh 18 responden dan kualifikasi cukup berada pada persentase sebesar 18,2% dan diwakili oleh 6 responden dengan jumlah keseluruhan 33 responden. Untuk pengujian hipotesis menggunakan rumus kolerasi Product Moment, dan didapatkan hasil perhitungan analisis data mendapatkan nilai sebesar 0,344 lebih besar dari pada nilai harga kritik r Product Moment sebesar 0,560 untuk taraf signifikan 5%. Yang berarti ada hubungan antara disiplin kerja guru dan iklim sekolah di SMK Negeri se-Kota Malang. Berdasarkan hasil penelitian dapat disimpulkan sebagai berikut: (1) tingkat disiplin kerja guru di SMK Negeri se-Kota Malang dikategorikan tinggi, (2) tingkat kondisi iklim sekolah di SMK Negeri se-Kota Malang dikategorikan tinggi dan, (3) terdapat hubungan antara disiplin kerja guru dan iklim sekolah di SMK Negeri se-Kota Malang. Saran ditujukan untuk : (1) Kepala sekolah; kepala sekolah supaya mempertahankan disiplin kerja yang sudah berada pada kategori tinggi, kepala sekolah juga perlu membekali guru dalam pelatihan dan pendidikan yang diperlukan untuk meningkatkan kemampuan mengajarnya, kepala sekolah tetap mempertahankan iklim sekolah yang sudah berada pada kategori tinggi, kepala sekolah bersikap terbuka, saling mendukung terhadap para guru dan warga sekolah, dalam meningkatkan kualitas sumberdaya manusia, sebagai bahan acuan kepala sekolah dalam membina disiplin kerja dan iklim sekolah agar lebih baik dari sebelumnya. Dan menambah wawasan bagi kepala sekolah tentang disiplin kerja para guru dan staf sekolah; (2) Guru; para guru diharapkan mampu bekerja secara professional sesuai dengan tugas dan tanggung jawabnya sebagi seorang pengajar, guru diharapkan mampu bekerja sama secara profesional dengan rekan kerjanya tanpa membanding hasil kerjanya dengan orang lain,guru mampu berkomunikasi secara terbuka dengan rekan kerja lainya, guru diharapkan mampu menciptakan lingkungan kerja yang aman, nyaman, tenang, harmonis, dengan semua rekan guru dan warga sekolah lainnya, guru diharapkan mampu mempertahankan displin kerja dan iklim kerja yang sudah berada pada tingkat tinggi; (3) Peneliti; Peneliti diharapkan mampu mencontoh disiplin kerja dan iklim kerja yang ada di SMK Negeri se-kota Malang. Bagi peneliti berikutnya diharapkan dapat menyempurnakan penelitian dan menembah variabel serta metode penelitiannya agar lebih menarik.

Peningkatan berpikir kreatif siswa kelas X IPS 4 dengan model pembelajaran investigasi kelompok di SMA Negeri 2 Malang / Suci Romadani

 

ABSTRAK Romadani, Suci. 2016. Peningkatan Kemampuan Berpikir Kreatif Siswa Kelas X IPS 4 dengan Model Pembelajaran Investigasi Kelompok di SMA Negeri 2 Malang. Skripsi, Jurusan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. Djoko Soelistijo, M.Si, (II) Dr. Budi Handoyo, M.Si. Kata Kunci: berpikir kreatif, investigasi kelompok Penelitian ini dilatar belakangi oleh pentingnya kemampuan berpikir kreatif siswa yang merupakan salah satu tujuan dari pendidikan nasional. Semua mata pelajaran harus mengembangkan kemampuan berpikir kreatif siswa, termasuk geografi. Kenyataan di lapangan, pembelajaran geografi yang dilakukan di SMA Negeri 2 Malang, terutama kelas X IPS 4 masih belum mengoptimalkan kemampuan berpikir kreatif siswa. Berbagai permasalahan pembelajaran geografi masih dijumpai di kelas tersebut, mulai dari rendahnya ketuntasan belajar siswa, hingga penerapan model pembelajaran yang kurang variatif. Penelitian ini bertujuan untuk meningkatkan kemampuan berpikir kreatif siswa kelas X IPS 4 dengan model pembelajaran Investigasi Kelompok. Penelitian ini menggunakan pendekatan penelitian tindakan kelas (PTK). Teknik pengumpulan data pada penelitian ini menggunakan lembar observasi, tes, dokumentasi, dan catatan lapangan. Kegiatan analisis data dilakukan dengan analisis data deskriptif kuantitatif dari hasil kemampuan berpikir kreatif siswa yang disajikan dalam bentuk tabel dan grafik. Berdasarkan hasil analisis data, diperoleh kesimpulan bahwa model pembelajaran investigasi kelompok dapat meningkatkan kemampuan berpikir kreatif siswa kelas X IPS 4 di SMA Negeri 2 Malang. Model pembelajaran investigasi kelompok juga dapat menambah wawasan siswa melalui kegiatan investigasi di luar kelas. Penerapan model pembelajaran Investigasi Kelompok disarankan tidak terjadi kesalahan sintak atau tahapan pembelajaran serta semua siswa dapat terlibat dalam proses investigasi di lapangan.

Pengaruh pengunaan metode pembelajarn kooperatif group investigation (GI) terhadap prestasi belajar sistem kopling manual siswa kelas x otoronik SMK Negri 1 Singosari Malang / Deny Dwi Arisandi

 

Kata Kunci: Metode Pembelajaran Kooperatif Group Investigation, Prestasi Belajar Siswa Salah satu upaya meningkatkan mutu pendidikan diperlukan adanya pembaharuan dalam bidang pendidikan, terutama dalam peningkatan kualitas pembelajaran dan efektifitas metode pembelajaran. Saat ini, pembelajaran inovatif yang mampu membawa perubahan belajar bagi siswa telah menjadi suatu hal yang wajib bagi guru. Dalam memilih metode pembelajaran yang tepat haruslah memperhatikan kondisi siswa, sifat materi bahan ajar, fasilitas dan media yang tersedia serta kondisi guru itu sendiri. Salah satu model pembelajaran yang mengarahkan siswa untuk mencari tahu dan berbuat sehingga dapat membantu siswa untuk memperoleh pemahaman yang lebih dalam pada mata diklat sistem kopling manual adalah model pembelajaran kooperatif model Group Investigation (GI). Jadi, sesuai dengan pernyataan tersebut, penelitian ini bertujuan untuk mengetahui apakah ada perbedaan prestasi belajar sistem kopling manual siswa kelas X Ototronik SMK Negeri 1 Singosari Malang setelah mendapatkan pengaruh penggunaan metode pembelajaran kooperatif Group Investigation (GI) dan metode konvensional. Penelitian ini menggunakan metode eksperimental semu (quasy eksperiment), sebab penelitian ini menggunakan dua kelompok, satu kelompok eksperimen dan satu kelompok kontrol. Kelompok eksperimen dalam penelitian ini adalah kelompok yang dalam proses pembelajaran menggunakan metode Group Investigation, sedangkan kelompok kontrol adalah kelompok yang dalam proses pembelajaran menggunakan metode konvensional. Dengan satu variabel bebas yaitu metode pembelajaran dan satu variabel terikat yaitu prestasi belajar. Populasi dalam penelitian ini adalah siswa kelas X Ototronik SMK Negeri 1 Singosari Malang tahun ajaran 2010/2011 yang terdiri dari dua kelas, yaitu: kelas X OTR 1 (32 siswa) dan kelas X OTR 2 (31 siswa). Berdasarkan hasil analisis diketahui bahwa metode pembelajaran kooperatif Group Investigation berpengaruh terhadap prestasi belajar siswa. Hal ini ditunjukan dengan nilai rata-rata prestasi belajar kelompok eksperimen setelah diberi perlakuan yaitu 85, sedangkan rata-rata prestasi belajar kelompok kontrol setelah diberi perlakuan yaitu 73,33. Dari tes prestasi belajar tersebut dapat dilihat bahwa nilai rata-rata kelompok eksperimen lebih tinggi dibandingkan dengan nilai rata-rata kelompok kontrol. Jadi, dapat disimpulkan prestasi belajar siswa yang ii diajar dengan menggunakan metode kooperatif Group Investigation lebih tinggi dibandingkan dengan prestasi belajar menggunakan metode konvensional karena adanya perbedaan perlakuan pembelajaran antara siswa kelompok eksperimen dengan kelompok kontrol. Saran yang diajukan dalam penelitian ini yaitu: 1) guru dapat menerapkan metode pembelajaran kooperatif Group Investigation dalam proses pembelajaran untuk meningkatkan prestasi belajar, 2) siswa hendaknya lebih berperan aktif dalam pembelajaran kooperatif Group Investigation sehingga prestasi belajar dapat tercapai, 3) bagi lembaga pendidikan dan instansi yang terkait disarankan untuk mensosialisasikan pembelajaran Group Investigation dalam pelatihan dan penataran untuk meningkatkan prestasi belajar, 4) bagi peneliti lain yang ingin mengembangkan penelitian yang berhubungan dengan metode pembelajaran kooperatif model Group Investigation ini untuk dapat menggunakan populasi dan sampel penelitian yang lebih luas serta dengan materi yang berbeda agar mendapatkan data yang lebih baik.

Studi perbandingan efektifitas pembelajaran dengan pendekatan Savi dan pendekatan Konvensional terhadap prestasi belajar siswa kelas 1 SMK PGRI 2 Malang / oleh Afia Naimah

 

Studi tentang penguasaan konsep laju reaksi dan kaitannya dengan kemampuan berfikir formal siswa kelas II SMU Negeri I Paciran Lamongan / oleh Luluk Masitoh

 

llmu kimia merupakanc abangd ari IPA yangm empelajartie ntangs ifat-sifat zat,s trukturz at,t ransfonnaszi at dane nergiy angm enyertainyaIl.m u kimia r'rerupakansa lahs atud ari bidangs tudiI PA yangd iajarkanp adas iswaS MU. Materi- :nateriy angt erdapadt alami lmu kimia hampirs emuanyam erupakanm ateriy ang abstraky angh anyad apatd ipahamid enganb aik oleh sisway angt elahm encapai k:mampuanb erfikirf ormald itinjaud arit eorip erkembangainnt elekP iagetS. alah s:,tum aterii hnu kimia yangd iberikand i SMU adalahl aju reaksi.D idalamm ateri laju reaksib anyakt erdapakt onsepy anga bstraks epertki onsept entangtu mbukan antaram olekrrl-molekpuel reaksdi ane nergai ktivitasy angh arusd ipelajaroi leh siswa.K arenad alamm ateril aju reaksib anyakt erdapakt onsepy anga bstrakm, aka didugau ntukm emahaminydaip erlukank emampuabne rpikirf ormal. Tujuand ari penelitianin i adalahu ntukm engetahu:i( l) banyaknysai swa SMU kelasI I yangt elahm encapati ngkatb erpikirf ormal,( 2)b esarnypar esentase siswak elasI I yangm emahammi ateril aju reaksid, an (3) hubungana ntarak emampuanb erpikir formal denganp restasib elajars iswaS MU kelasl l untukm ateri laju rcaksi. Penelitianin i menggunakadne saine xp ostfacto. Sampepl enelitiana dalahs iswak elasI 13d an1 16S MLJN egerPi aciranL amongan sebanya7k 6 siswa. Untukm emperoledha tap enelitiand igunakatne sB urneyd ant esp restasi belajarT. esB urneyd igunakanu ntukm engukukr etnatnpuabne rpikirf ormals iswa. Tesp restasbi elaiars iswad isusuno lehp enelitid engank oefisienre liabilitas ebesar 0,8.T esi ni digunakanu ntukm engukupr restasbi elajars iswad alamm empelajari materi laju reaksi. Dari penelitianin i diperolehh asils ebagabi erikut:( l) banyaknysai swak elas II SMU NegeriP aciranL, amongany angt elahm encapatii ngkatb erpikir formal sebesa4r3 o/o(;2 ) prcsentasseis wak elasI I SMU NegeriP aciranL amongayna ng memahammi ateriala ju reakssi ebesa4r lo/o,d an( 3) terdapaht ubungapno sitify ang signifikan antara kemampuan berpikir formal dengan prestasi belajar siswa untuk materil aju reaksdi engank oefisienk orelassi ebesa0r, 81.

Penerapan strategi Taba dalam pengajaran apresiasi puisi di SMA
Ali Murtadlo

 

Pengembangan instrumen identifikasi kesulitas belajar pada siswa sekolah dasar di Kabupaten Bojonegoro / Wahyu Ratna Leila

 

Leila, Wahyu Ratna. 2014. Pengembangan Instrumen Identifikasi Kesulitan Belajar pada Siswa Sekolah Dasar di Kabupaten Bojonegoro. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang. Pembimbing: (1) Dra. Sri Weni Utami, M.Si. (2) Ike Dwiastuti, S.Psi., M.Psi. Kata kunci: instrumen, kesulitan belajar.     Penelitian ini bertujuan untuk menghasilkan Instrumen Identifikasi Kesulitan Belajar (IIKB) yang valid dan reliabel dalam mengidentifikasi adanya kesulitan belajar pada siswa Sekolah Dasar Kelas 4 sampai Kelas 6 di Bojonegoro. Hasil penelitian diharapkan memudahkan guru kelas dalam mengidentifikasi adanya kesulitan belajar pada siswa Sekolah Dasar.      Langkah-langkah penelitian ini meliputi: (1) identifikasi tujuan dan kawasan ukur, (2) penguraian komponen isi serta batasan perilaku dan kompetensi, (3) spesifikasi tes (blue print), (4) penulisan item, (5) uji-coba awal, (6) field test dan analisis item, (7) perakitan tes dan penyusunan instrumen, (8) pengujian reliabilitas, (9) tes siap pakai.    Hasil dari validasi isi oleh ahli lapangan, IIKB perlu direvisi pada 34 item. Setelah dilakukan revisi, IIKB diuji cobakan secara perseorangan untuk mengetahui lamanya pengerjaan soal serta kepraktisan media-media yang digunakan dalam IIKB. Setelah IIKB yang diujicobakan secara perseorangan telah direvisi, maka dilakukan uji lapangan terbatas dengan total subjek berjumlah 51 siswa. Selanjutnya dilakukan perhitungan reliabilitas dengan menggunakan pendekatan konsistensi antar rater dan diperoleh rentangan reliabilitas pada IIKB antara 0,510 sampai 0,904.     Pada IIKB ini, selain menggunakan analisis uji validasi isi dan uji reliabilitas ini, hasil IIKB juga dikorelasikan dengan nilai rapot pada sampel penelitian. Selanjutnya diperoleh hasil bahwa nilai rapot Semester Gasal Tahun Pelajaran 2013/2014 siswa yang mengalami kesulitan belajar sedang ataupun ringan adalah rendah dan berada di bawah nilai rata-rata kelas. Hal ini sesuai dengan pendapat menurut Irham & Wiyana (2013) bahwa adanya kesulitan belajar yang dialami siswa akan berdampak pada prestasi belajar yang dicapai oleh siswa yang bersangkutan.     Jadi, berdasarkan dari hasil uji validasi isi, uji reliabilitas, dan dari korelasi positif antara hasil IIKB dengan nilai rapot siswa, maka dapat disimpulkan bahwa IIKB telah valid dan reliabel sebagai instrumen untuk mengidentifikasi kesulitan belajar pada siswa Sekolah Dasar.

Pengembangan bahan ajar IPS kontekstual untuk siswa kelas IV SD Negeri Citapen 1 Kabupaten Bandung Barat / Budi Abriansyah

 

ABSTRAK Abriansyah, Budi. 2016. Pengembangan Bahan Ajar IPS Kontekstual untuk Siswa Kelas IV SD Negeri Citapen 1 Kabupaten Bandung Barat. Tesis. Program Studi Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Dra. Hj. Siti Malikhah Towaf, M.A., Ph.D., Pembimbing (II) Dr. Ach. Amirudin, M.Pd. Kata Kunci: pengembangan bahan ajar, IPS Kontekstual Permasalahan penting dalam pembelajaran IPS di SD adalah dalam menentukan bahan ajar atau materi pembelajaran yang tepat. Karena, kualitas pembelajaran IPS tidak dapat tercapai dengan baik jika bahan ajar yang digunakan tidak berbasis kontekstual. Materi dalam bahan ajar IPS di SD harus sesuai dengan karakteristik siswanya yang berada dalam tahap perkembangan operasional konkret yang masih berpikir dari apa yang dilihat, didengar, atau dirasakan. Oleh karena itu, dikembangkanlah bahan ajar IPS Kontekstual ini yang materinya sesuai dengan situasi dunia nyata sekitar siswa, sehingga siswa mudah memahami materi pembelajaran agar mencapai kompetensi yang diharapkan. Tujuan penelitian dan pengembangan ini adalah untuk menghasilkan bahan ajar IPS Kontekstual yang valid, menarik, praktis, dan efektif digunakan pada pembelajaran IPS di Kelas IV SD. Model penelitian dan pengembangan yang digunakan adalah model 4D (Thiagarajan, dkk., 1974). Model ini dipilih karena tahapannya sistematis dan sesuai untuk mengembangkan bahan ajar cetak. Model 4D ini terdiri dari tahap define (pendefinisian), design (perancangan), develop (pengembangan), dan disseminate (penyebaran). Jenis data yang digunakan yaitu data kualitatif dan kuantitatif. Data dianalisis dengan menggunakan analisis statistik deskriptif yang dikonversi ke dalam persen, kemudian hasilnya dicocokkan dengan kriteria kevalidan, kemenarikan, kepraktisan, dan keefektifan bahan ajar IPS Kontekstual. Hasil uji kevalidan produk dari penilaian ahli media, ahli materi, dan ahli bahasa diperoleh skor rata-rata 90,09% yang menunjukkan kriteria sangat valid. Hasil uji kemenarikan produk dari angket respon siswa diperoleh skor rata-rata 95% yang menunjukkan kriteria sangat menarik. Hasil uji kepraktisan produk diperoleh dari hasil observasi kegiatan guru (92,1%), aktivitas belajar siswa (91,41%), dan dari angket respon guru (87,50%) dan respon siswa (92,25%) yang menunjukkan kriteria sangat praktis. Hasil uji keefektifan produk dilihat dari peningkatan hasil belajar pretest diperoleh skor rata-rata 66, menjadi 82 pada hasil belajar posttest. Berdasarkan hasil tersebut, bahan ajar IPS Kontekstual untuk Kelas IV sekolah dasar ini telah memenuhi persyaratan untuk digunakan dalam pembelajaran karena telah memenuhi kriteria valid, menarik, efektif, dan praktis menurut penilaian para ahli materi, ahli media, ahli bahasa, guru, dan siswa. Bahan ajar IPS Kontekstual ini disarankan untuk dipelajari dan dimanfaatkan oleh semua siswa kelas IV SD yang ada di wilayah Kabupaten Bandung Barat, karena materinya diorientasikan sesuai dengan karakteristik dan kondisi lingkungan wilayah tersebut. Sebagai tindak lanjut, dapat dikembangkan bahan ajar serupa dengan orientasi berbeda disesuaikan dengan perkembangan IPTEK, karakteristik siswa, dan keadaan lingkungan yang lebih mendunia.

Implementasi pembelajaran model latihan inkuiri (inquiry training model) untuk meningkatkan kerja ilmiah dan prestasi belajar fisika siswa kelas VIIIE SMPN 18 Malang / Moh. Rosid Syarifudin

 

Kata Kunci: Latihan Inkuiri, Kerja Ilmiah dan Prestasi Belajar Berdasarkan observasi di kelas VIIIE SMPN 18 Malang, pembelajaran fisika di kelas tersebut masih belum sesuai dengan yang diharapkan. Ketika pembelajaran di kelas berlangsung siswa belum dapat mengoperasikan alat-alat praktikum, diskusi kelas masih diwarnai keramaian atau kegaduhan, dan didapatkan bahwa prestasi siswa rendah. Siswa yang mendapat nilai ujian 70 hanya 20 siswa atau 50% dari jumlah siswa. Pada penelitian ini rumusan masalah dirumuskan: (1) Bagaimana implementasi pembelajaran dengan menggunakan model latihan inkuiri dalam upaya meningkatkan kerja ilmiah dan prestasi belajar siswa kelas VIIIE SMPN 18 Malang? (2) Apakah implementasi pembelajaran dengan menggunakan model latihan inkuiri dapat meningkatkan kerja ilmiah pada siswa kelas VIIIE SMPN 18 Malang? (3) Apakah implementasi pembelajaran dengan menggunakan model latihan inkuiri dapat meningkatkan prestasi belajar siswa kelas VIIIE SMPN 18 Malang? Sedangkan penelitian ini bertujuan untuk: (1) mengetahui proses pembelajaran model latihan inkuiri yang dilaksanakan pada kelas VIIIE SMPN 18 Malang, (2) Mengetahui dampak pembelajaran model latihan inkuiri bagi siswa kelas VIIIE SMPN 18 Malang, dan (3) Mengetahui dampak pembelajaran model latihan inkuiri terhadap peningkatan prestasi belajar fisika bagi siswa kelas VIIIE SMPN 18 Malang. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif, dengan jenis penelitian tindakan kelas (PTK). Tindakan yang diberikan pada penelitian ini berupa Implementasi Pembelajaran model latihan inkuiri yang terdiri dari lima tahapan, yaitu menghadapkan pada masalah, pengumpulan data-verifikasi, pengumpulan data-eksperimentasi, mengorganisasi, merumuskan penjelasan dan menganalisis proses inkuiri. Subyek penelitian ini adalah siswa kelas VIIIE SMPN 18 Malang dengan jumlah 41 siswa, yang terdiri dari 20 orang putri dan 21 orang putra. Pokok bahasan yang digunakan adalah cahaya meliputi: pemantulan cahaya, pembentukan bayangan pada cermin datar, dan pembentukan bayangan pada cermin cekung. Instrumen penelitian yang digunakan berupa rubrik penilaian kerja ilmiah siswa, tes setiap siklus, rekaman data, dan catatan lapangan. Instrumen tindakan yang digunakan meliputi LKS dan RPP. Hasil penelitian menunjukkan bahwa penerapan pembelajaran model latihan inkuiri dapat meningkatkan kerja ilmiah siswa dan prestasi belajar siswa. Peningkatan kerja ilmiah siswa pada merumuskan masalah adalah 50 %, untuk membuat hipotesis -25 %, melakukan praktikum 20 %, mengumpulkan data 5 %, membuat kesimpulan 45,5 %, dan 10 % menjelaskan berdasarkan fakta.

Pengaruh kredibilitas celebrity endorser Sule pada iklan kartu as terhadap keputusan pembelian konsumen ( setudi pada mahasiswa angkatan 2010 pengguna kartu as di Fakultas Ekonomi Universitas Negeri Malang) / Dita Riskasari

 

Kata kunci ; Kredibilitas Celebrity Endorser, Keputusan Pembelian Konsumen Keberadaan selebriti atau orang-orang yang terkenal memberikan dampak dalam berbagai segi kehidupan manusia dari waktu ke waktu. Popularitas selebriti merupakan suatu fenomena tersendiri karena menjadi salah satu fokus perhatian di media cetak maupun di media elektronik. Saat ini dalam berbagai iklan khususnya untuk produk baru, sering menggunakan celebrity endorser dengan tujuan untuk meraih perhatian konsumen terhadap produk. “Celebrity endorser adalah tokoh yang dikenal oleh masyarakat karena potensinya dalam bidang-bidang yang berbeda dari golongan produk yang didukungnya”. Pesan iklan yang disampaikan oleh selebriti yang menarik dan terkenal akan lebih mudah diingat. Tetapi yang lebih penting dalam penggunaan selebriti pada iklan adalah kredibilitas seorang selebriti itu sendiri. Selebriti yang digunakan sebagai model iklan harus mempunyai kredibilitas sehingga konsumen akan percaya pada merek suatu produk. Tujuan dari penelitian ini adalah ingin mengetahui variabel-variabel kredibilitas celebrity endorser yang mempengaruhi keputusan pembelian konsumen. Penelitian ini mempunyai dua variabel , yaitu variabel bebas adalah kredibilitas celebrity endorser (X) dan variabel terikat (Y) adalah keputusan pembelian. Variabel bebas (X) terdiri dari daya tarik (X1), keahlian (X2), kepercayaan (X3), sedangkan variabel terikatnya (Y) adalah keputusan pembelian. Jenis penelitian yang digunakan adalah kausal (sebab-akibat). Populasi yang dipilih adalah mahasiswa S1 Manajemen Angkatan 2010 yang menggunakan kartu seluler AS dengan sampel sebanyak 48 mahasiswa. Pengambilan sampel penelitian ini dilakukan dengan menggunakan teknik sampel jenuh dan metode analisis yang digunakan adalah analisis regresi berganda (multiple regression). Hasil dari analisis yang didapat melalui penyebaran kuesioner menunjukkan bahwa: (1) terdapat pengaruh yang signifikan antara daya tarik, keahlian, kepercayaan secara parsial dan simultan terhadap keputusan pembelian produk kartu AS, (2) Variabel yang paling dominan mempengaruhi keputusan pembelian adalah daya tarik Saran yang dapat direkomendasikan terkait dengan hasil penelitian yang didapatkan adalah: (1) Melihat tanggapan responden yang positif terhadap variable daya tarik Sule sebagai Celebrity Endorser pada iklan Kartu AS, maka PT Telkomsel tetap mempertahankan penggunaan Sule sebagai endorser, karena akan menjadi penyokong kesuksesan produk Kartu AS pada iklan berikutnya. (2), untuk penelitian lanjutan sebaiknya dilakukan dengan memperluas variabel maupun pengembangan indikator serta item lain.

Hubungan kecerdasan interpersonal dan tingkat melek ekonomi (Ekonomic Literacy) dengan kecerendungan nkarir siswa kelas X di SMA laboratorium Universitas Negri Malang / Mufidatul Husnawati

 

Kata Kunci: Kecerdasan Interpersonal, Tingkat Melek Ekonomi (Economic literacy), Kecenderungan Karier. Sikap adalah kecenderungan ke arah suatu obyek, yang meliputi keyakinan-keyakinan seseorang, perasaan-perasaan, dan kecenderungan-kecenderungan tingkah laku seseorang mengenai obyek. Sikap pilihan karier diartikan sebagai pernyataan-pernyataan pikiran, perasaan, dan kecenderungan keterarahan perilaku siswa terhadap karier di masa akan datang. Kecerdasan interpersonal adalah kemampuan untuk menciptakan, membangun, dan mempertahankan suatu hubungan antar pribadi (sosial) yang sehat dan saling menguntungkan. Melek ekonomi (economic literacy) merupakan kemampuan untuk mengerti makna dan arti tentang ilmu ekonomi, yaitu tentang tindakan manusia untuk memenuhi kebutuhan hidupnnya yang banyak bervariasi dan berkembang dengan sumber daya yang ada melalui pilihan-pilihan kegiatan produksi, konsumsi dan distribusi. Penelitian ini bertujuan untuk mengetahui adanya hubungan dan seberapa kuat hubungan yang ada antara kecerdasan interpersonal dan tingkat melek ekonomi (economic literacy) dengan kecenderungan karier siswa kelas X SMA Laboraturium Universitas Negeri Malang. Rancangan penelitian yang digunakan adalah penelitian deskriptif korelasional. Populasinya adalah siswa kelas X reguler yang terdiri dari 8 kelas yang berjumlah 318 siswa. Sampel diambil dengan teknik pengambilan sampel porportional random sampling dimana masing-masing kelas diambil sebanyak 25% yaitu berjumlah 80 siswa. Teknik pengumpulan data menggunakan observasi, angket, dokumentasi dan wawancara. Teknik analisis yang digunakan adalah analisis chi kuadrat (chi square) dan koefisisen kontigensi dengan bantuan program SPSS 16.0 for windows. Berdasarkan hasil penelitian diketahui bahwa: (1) terdapat hubungan yang positif signifikan antara kecerdasan interpersonal dengan kecenderungan karier, (2) terdapat hubungan yang positif signifikan antara tingkat melek ekonomi (economic literacy) dengan kecenderungan karier, (3) terdapat hubugan yang positif signifikan antara kecerdasan interpersonal dan tingkat melek ekonomi (economic literacy) dengan kecenderungan karier. Hal ini dibuktikan dengan hasil uji chi square (chi kuadrat) Asimp.sig 0,000<0,05 pada taraf signifikasi 5 %. Dari hasil analisis diketahui pula bahwa variabel (1) kecerdasan interpersonal dengan kecenderungan karier mempunyai hubungan cukup kuat dengan nilai prosentase koefisien kontigensi 29 %, (2) tingkat melek ekonomi (economic literacy) dengan kecenderungan karier mempunyai hubungan cukup kuat dengan nilai prosentase koefisien kontigensi 28,1 %.

Pengembangan pembelajaran ekonomi berkarakter eco-culture dalam perspektif ekonomi Pancasila / Rahmatullah

 

ABSTRAK Rahmatullah. 2016.PengembanganPembelajaranEkonomiBerkarakterEco-cultureDalamPerspektifEkonomiPancasila.Disertasi. Program StudiPendidikanEkonomi,Pascasarjana,UniversitasNegeriMalang.Pembimbing: (1) Prof. Dr.Wahjoedi, M.E., M.Pd.; (2) Prof. Dr.AgusSuman, S.E., DEA.; (3) Dr.HariWahyono, M.Pd. Kata Kunci: Pembelajaranekonomi, Karaktereco-culture, Nilai-nilaiPancasila. Karaktereco-cultureataubudayapedulilingkunganberdasarkannilai-nilaiPancasila,pentinguntukdiinteralisasikansebagaisalahsatuinovasidalampembelajaranekonomi, khususnyapadasekolahmenengahatas.Hal inimerupakansalahsatuupayauntukmengatasikekuranganliteraturpembelajaranekonomi yang berwawasanlingkungandansesuaidenganjatidiribangsa. selainitu, munculnyaparadigmaeco-cultureinididasariolehperilakuataukebiasaanekonomimanusia yang cenderungmenimbulkankerusakanataupencemaranlingkungansehinggaberakibatpadamunculnyaberbagaipermasalahanlingkungan, sepertipemanasan global, kepunahanberbagaispesiesdariekosistem, pencemaranataupolusilingkungan, dankerusakanlingkunganakibateksploitasi yang berlebihandariperilakuekonomimanusia.Perilakuataukebiasantersebutmerupakanwujuddaripengetahuandancaraberpikirdaripengalamanpendidikanmasalalu, yang cenderungmengabaikankeberlanjutanekologi, sosial, maupunekonomi Penelitianinibertujuanuntukmenghasilkanperangkatpembelajaranekonomiberkaraktereco-culturedalamperspektifekonomiPancasila, yang meliputisilabus, rencanapelaksanaanpembelajaran(RPP), materipembelajaran, LKS, danpenilaianhasilbelajar.ProsedurPengembangandilakukandenganmengacupadamodel pendekatansistemmenurut Dick & Carey.Produk yang dikembangkandivalidasiolehahlidisain, ahlimateri, danpraktisikemudiandilakukanujicobapadasiswadenganmenggunakandesainPenelitianTindakanKelas (PTK). Nilai-nilaieco-culturedalamperspektifekonomiPancasilayang dikembangkandalampenelitianinimeliputi; rasa syukur, rasa memiliki, jujur, saling menghormati, kasih sayang, kepedulian sosial, kebersamaan, cintatanah air, gotongroyong, bertanggungjawab, tidakmemaksakankehendak, makmurberkeadilan, kekeluargaan, dankemandirian. Setelahprodukdikembangkanmakadilakukanujicobaataupenilaianoleh;(1) Ahlidesainpembelajarandengankriteriapenilaiancukupbaik; (2) Ahlimateripembelajarandengankriteriapenilaianbaik; (3) Praktisi/Guru ekonomidengankriteriapenilaiansangatbaik; (4) Tanggapandanhasilbelajarsiswadengankriteriapenilaiansangatbaik.Dengandemikian, dapatdisimpulkanbahwaperangkatpembelajaranekonomiberkaraktereco-culturedalamperspektifekonomiPancasilalayakdanefektifuntukdiimplementasikansebagaisalahsatualternatifdalampembelajaranekonomi, khususnya di sekolahmenengahatas. Berdasarkanhasilpenelitiandanpengembanganini, makaperludisarankanhal-halsebagaiberikut: (1) Siswadiharapkandapatmengaplikasikannilai-nilaipedulilingkungan yang sesuaidenganbudayabangsa, melaluiperilakuekonomidalamkehidupansehari-hari; (2) Guru dapatmenggunakanpaketpembelajaranekonomiberkaraktereco-culturedalamperspektifekonomipancasila, sebagaisalahsatu alternative literature dalampembelajaranekonomi, dandisesuaikandenganmateriekonomi yang diajarkandalam proses belajarmengajar. Hal terpentingadalahterbentuknyaketeladanansikapdanperilakuekonomi guru sehingadapat di tularkankhususnyakepadasiswadanmasyarakatpadaumumnya; (3) Perludilakukansosialisasikepada guru ekonomi, denganmelibatkanorganisasi guru sepertiAsosiasi Guru Ekonomi Indonesia (AGEI) danMusyawarah Guru Mata Pelajaran (MGMP) ekonomi, sertamelibatkanperguruantinggi yang memilikijurusanatau program studipendidikanekonomi. Sosialisasidapatdilakukandalambentukkegiatan seminar, diskusiilmiah, maupunpemutaran film tentangperlunyakelestarianlingkungan; (4) Perlumengimplementasikankaraktereco-culturepadaanaksejakdinibaikmelaluipendidikan formal maupunpendidikan informal dengankonsepfamilyeco-culture.

Hubungan antara disiplin kerja dengan produktivitas kerja karyawan bagian produksi di Perusahaan Rokok Lembang Jaya Malang
oleh Amik Kusminingsih

 

Peningkatan prestasi belajar matematika melalui pembelajarn kontekstual pada siswa kelas V SDN BAMBANG 01 KECAMATAN WAJAK KABUPATEN MALANG./Estu Wahyuning Suprapti

 

Pembelajaran matematika Di SDN BAMBANG 01 KECAMATAN WAJAK pada umumnya masih menggunakan metode konvensional. Apabila ada kesulitan siswa terlihat diam saja dan tidak mempunyai keinginan untuk bertanya dengan gurunya maupun ber-tukar pendapat dengan temannya. Selain itu media yang digunakan tidak menarik dan sulit dipahami oleh siswa. Akibatnya hasil belajar matematika pada pra tinda-kan sangat rendah yaitu dari 20 siswa hanya ada 1 siswa yang memperoleh skor 70 atau 5% dari jumlah siswa dan 19 siswa lain memperoleh skor antara 20 - 60. Berbagai kekurangan dan kelemahan tersebut perlu diadakan upaya per-baikan untuk pembelajaran selanjutnya dengan menerapkan model pembelajaran yang bisa meningkatkan hasil belajar siswa yaitu model pembelajaran kooperatif tipe STAD (Student Teams Achievement Divisions). Model ini dipilih karena sesuai dengan keadaan siswa di SDN BAMBANG 01 KECAMATAN WAJAK yang pada umumnya hete-rogen baik kemampuan individunya maupun jenis kelaminnya, selain itu dengan menerapkan model pembelajaran kooperatif tipe STAD dapat memotivasi siswa khususnya dalam hal bertanya dan mengeluarkan pendapat sehingga siswa dapat memahami materi dengan mudah dan hasil belajar dapat meningkat. Rumusan masalah dalam penelitian ini adalah sebagai berikut. (1) bagai-manakah pelaksanaan pembelajaran matematika di kelas IV SDN BAMBANG 01 KECAMATAN WAJAK pada pra tindakan? (2) bagaimanakah pelaksanaan pembelajaran matematika di kelas IV SDN BAMBANG 01 KECAMATAN WAJAK dengan menerapkan model pembelajaran kooperatif tipe STAD pada tiap siklus? (3) bagaimanakah peningkataan hasil belajar matematika di kelas IV SDN BAMBANG 01 KECAMATAN WAJAK dari pra tindakan, siklus I dan siklus II dengan menerapkan model pembelajaran kooperatif tipe STAD?. Tujuan dari penelitian ini adalah sebagai berikut. (1) mendeskripsikan pelaksanaan pembelajaran matematika di kelas IV SDN BAMBANG 01 KECAMATAN WAJAK pada tahap pra tindakan, (2) mendeskripsikan pelaksanaan pembelajaran dan hasil belajar matematika dengan menerapkan model pembelajaran kooperatif tipe STAD pada siklus I dan siklus II, (3) mendeskripsikan peningkatan hasil belajar matematika dengan menerapkan model pembelajaran kooperatif tipe STAD dari pra tindakan, siklus I dan silklus II. Metode yang digunakan dalam penelitian ini adalah deskriptif kualititatif. Rancangan yang digunakan adalah Penelitian Tindakan Kelas (PTK) yang terdiri dari tiga tahap yaitu pra tindakan, siklus I dan siklus II. Masing-masing tahap terdiri dari (1) perencanaan, (2) pelaksanaan, (3) observasi dan (4) refleksi. Data dan sumber yang dibutuhakan dalam penelitian ini adalah data hasil belajar siswa yang meliputi produk dan keterlaksanaan pembelajaran kooperatif tipe STAD. Teknik pengumpulan data dilakukan dengan cara (1) teknik observasi, (2) teknik kuis, (3) teknik kuisioner/angket. Instrumen yang digunakan berupa (1) lembar observasi, (2) kuisioner/angket, (3) kuis/tes, (4) catatan lapangan (field note). Teknik analisa data dipilah menjadi 4 kelompok data, (1) data hasil belajar siswa, (2) data pengamatan pembelajaran kooperatif tipe STAD, (3) data kegiatan mengajar guru, dan (4) data yang diperoleh dari angket siswa. Hasil belajar siswa yang diperoleh pada saat pos tes pra tindakan adalah 49 kualifikasi nilai kurang, pada siklus I adalah 71,65 kualifikasi nilai baik, sedang-kan pada siklus II adalah 85,5 kualifikasi nilai sangat baik. Dari hasil belajar ter-sebut dapat diketahui peningkatan dari pra tindakan ke siklus I sebesar 22,65%, sedangkan dari siklus I ke siklus II terjadi peningkatan sebesar 13,85%. Aktivitas siswa pada pra tindakan memperoleh skor 9,42 atau kualifikasi nilai sangat kurang, aktivitas siswa pada siklus I memperoleh skor 76,42 atau kualifikasi nilai baik, dan aktivitas siswa pada siklus II memperoleh skor 95,28 atau kualifikasi nilai sangat baik. Sedangkan aktivitas guru pada pra tindakan memperoleh skor 19,1 atau kualifikasi nilai sangat kurang, aktivitas guru pada siklus I memper-oleh skor 83,50 atau kualfikasi nilai baik, dan aktivitas guru pada siklus II memperoleh skor 94,50 atau kualifikasi nilai sangat baik. Kesimpulan berdasarkan temuan dari peneliatian ini, diketahui bahwa kegiatan pembelajaran selama pra tindakan, siklus I dan siklus II dengan mene-rapkan model pembelajaran kooperatif tipe STAD dapat meningkatkan hasil belajar siswa pada mata pelajaran matematika, serta dapat meningkatkan aktivitas siswa dan aktivitas guru dalam mengembangkan keterampilan kooperatif dalam hal (1) menghargai pendapat orang lain, (2) mengambil giliran dan berbagi tugas, (3) mengundang orang lain untuk bicara, (4) bertanya, (5) mendengarkan dengan aktif, (6) tidak berbeda dalam tugas, (7) bersama-sama memeriksa jawaban. Saran yang diberikan berdasarkan kesimpulan diatas adalah (1) bagi siswa, setelah menerapkan model pembelajaran kooperatif tipe STAD dapat mengapli-kasikan pembelajaran kooperatif tipe STAD dengan kehidupan sehari-hari khususnya dalam hal bekerjasama dan mengeluarkan pendapat, (2) bagi guru, dapat mengembangkan pembelajaran kooperatif tipe STAD pada mata pelajaran lainnya berdasarkan hasil peningkatan yang telah dicapai pada mata pelajaran matematika, (3) bagi peneliti lain, penerapan pembelajaran kooperatif tipe STAD perlu dikembangkan lebih lanjut dan lebih bervariasi untuk memperbaiki keku-rangan dan memperoleh hasil yang memuaskan, (4) bagi peneliti, penerapan model pembelajaran kooperatif tipe STAD perlu dikembangkan lebih lanjut dan lebih bervariasi untuk memperbaiki kekurangan dan memperoleh hasil yang memuaskan.

Struktur tema-tema dalam teks abstrak skripsi mahasiswa Jurusan Sastra Indonesia Universitas Negeri Malang / Danang Satria Nugraha

 

Nugraha, Danang Satria. 2014. Struktur Tema-Rema dalam Teks Abstrak Skripsi Mahasiswa Jurusan Sastra Indonesia Universitas Negeri Malang, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Abdul Syukur Ibrahim, (II) Dr. Mudjianto, M.Pd. Kata kunci: struktur tema-rema, teks abstrak skripsi.     Teks abstrak skripsi merupakan manifestasi pesan-pesan yang disampai-kan penulis kepada pembaca dalam peristiwa komunikasi. Pengaturan pesan-pesan dalam teks terumuskan dalam konsep yang dikenal dengan istilah struktur tema-rema. Penelitian ini meneliti struktur tema-rema dalam teks abstrak skripsi.     Tujuan penelitian ini adalah mendeskripsikan struktur tema-rema dalam teks abstrak skripsi. Secara khusus, terdapat empat subtujuan yang menyertainya, yaitu mendeskripsikan (1) tema tunggal, (2) tema ganda, (3) rema tidak berekor, dan (4) rema berekor.     Penelitian ini menggunakan rancangan deskriptif kualitatif. Instrumen yang digunakan untuk mengumpulkan dan menganalisis data adalah panduan pengum-pul data dan panduan analisis data. Data penelitian berwujud kalimat deklaratif yang mengandung tema tunggal, tema ganda, rema tidak berekor, dan rema ber-ekor. Pengumpulan data dilakukan dengan teknik dokumentasi. Untuk mempe-roleh keabsahan data dilakukan kegiatan triangulasi data. Kegiatan analisis data dimulai sejak tahap pengumpulan data, tahap kodifikasi data, tahap reduksi data, hingga tahap penyajian hasil analisis.     Hasil penelitian ini adalah struktur tema-rema dalam teks abstrak skripsi dapat dideskripsikan melalui empat klasifikasinya, yaitu tema tunggal, tema ganda, rema tidak berekor, dan rema berekor. Pertama, tema tunggal. Tema tung-gal terdiri atas dua subklasifikasi, yaitu (a) tema tunggal berupa frasa dan (b) tema tunggal berupa klausa. Tema tunggal yang berupa frasa terdiri atas lima jenis, yaitu tema tunggal yang berupa frasa nominal, frasa verbal, frasa numeralia, preposisional, atau frasa konjungsional. Tema tunggal yang berupa klausa terdiri atas dua jenis, yaitu tema tunggal berupa klausa yang tidak berkonjungsi atau klausa yang berkonjungsi.     Kedua, tema ganda. Tema ganda terdiri atas dua subklasifikasi, yaitu (a) te-ma ganda yang salah satu konstituennya berupa frasa dan (b) tema ganda yang salah satu konstituennya berupa klausa. Tema ganda yang salah satu konstitu-ennya berupa frasa terdiri atas lima jenis, yaitu tema ganda yang salah satu konsti-tuennya berupa frasa nominal, frasa verbal, frasa numeralia, frasa preposisional, atau frasa konjungsional. Tema ganda yang salah satu konstituennya berupa klausa terdiri atas dua jenis, yaitu tema ganda yang salah satu konstituennya berupa klausa tidak berkonjungsi atau klausa berkon-jungsi.     Ketiga, rema tidak berekor. Rema yang tidak berekor dalam teks abstrak skripsi terdiri atas dua subklasifikasi, yaitu (a) rema yang tidak berekor yang salah satu konstituennya berupa frasa dan (b) rema yang tidak berekor yang salah satu konstituennya berupa klausa. Rema yang tidak berekor yang salah satu konstitu-ennya berupa frasa terdiri atas lima jenis, yaitu rema yang tidak berekor yang sa-lah satu konstituennya berupa frasa nominal, frasa verbal, frasa ajektival, frasa numeralia, atau frasa preposisional. Rema yang tidak berekor yang salah satu konstituennya berupa klausa terdiri atas dua jenis, yaitu rema tidak berekor yang salah satu konstituennya berupa klausa yang tidak berkonjungsi atau klausa yang berkonjungsi.     Keempat, rema berekor. Rema yang berekor terdiri atas dua subklasifikasi, yaitu (a) rema berekor yang ekornya berupa frasa dan (b) rema berekor yang ekornya berupa klausa. Rema berekor yang ekornya berupa frasa terdiri atas tujuh jenis, yaitu rema berekor yang ekornya berupa frasa agentif, pasientif, lokatif, frasa temporal, frasa instrumental, frasa komitatif, atau frasa benefaktif. Rema berekor yang ekornya berupa klausa terdiri atas dua jenis, yaitu rema berekor yang ekornya berupa klausa tidak berkonjungsi atau klausa berkonjungsi. Saran penelitian untuk tiga pihak sebagai berikut. Peneliti selanjutnya dapat meneliti struktur tema-rema pada konstruksi kalimat interogatif dan imperatif. Mahasiswa dapat memanfaatkan adanya contoh-contoh analisis kalimat sebagai panduan praktis menyusun prioritas pesan dalam teks abstrak skripsi mereka. Tim Penyusun Pedoman Penyusunan Karya Ilmiah (PPKI) Universitas Negeri Malang hendaknya memerikan petunjuk yang lebih detail tentang prosedur penyusunan teks abstrak skripsi seperti spesifikasi jenis kalimatdan ketentuan jumlah kalimat dalam satu paragraf.

Hubungan penggunaan fasilitas perpustakaan dengan prestasi belajar siswa SLTP Negeri I Tirtoyudo Kabupaten Malang / oleh Gatot Suprapto

 

Analisis penerapan pendidikan karakter dalam pembelajaran ekonomi pada kurikulum 2013 SMAN 9 malang tahun ajaran 2015/2016 / Ayuna Astintami

 

ABSTRAK Astintami, Ayuna.2016. Analisis Penerapan Pendidikan Karakter Dalam Pembelajaran Ekonomi Pada Kurikulum 2013 SMAN 9 Malang Tahun Ajaran 2015/2016. Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang: Pembimbing: (1) Dr. Hari Wahyono, M.Pd (2) Dr. Hj. Lisa Rokhmani, M.Si. Kata Kunci: Penerapan, Pendidikan Karakter, Pembelajaran Ekonomi, pada Kurikulum 2013 Proses pembelajaran dapat dibentuk karakter manusia baik dengan penanaman karakter yang kuat dan positif. Munculnya masalah pendidikan merupakan salah satu bukti melemahnya pendidikan karakter. Pendidikan karakter merupakan salah satu cara untuk mengatasi masalah pendidikan yang timbul. Kurikulum 2013 yang berbasis karakter dapat diartikan kurikulum ini berorientasi pada karkter dan di wujudkan dalam 18 karakter. Fokus penelitian dalam penelitian ini ada tiga pertama, penerapan pendidikan karakter dalam pembelajaran ekonomi pada kurikulum 2013 kelas XI IIS 1 dan XI IA 3. Kedua, faktor pendukung dan penghambat dalam penerapan pendidikan karakter. Ketiga, Evaluasi penerapan pendidikan karakter di SMAN 9 Malang tahun ajaran 2015/2016. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal yang mencangkup penerapan pendidikan karakter, faktor pendukung dan penghambat, dan hasil dalam penerapan pendidikan karakter dalam pembelajran ekonomi di SMAN 9 Malang. Penelitian menggunakan pendekatan kualitatif jenis penelitian fenomenologi pada situasi yang alami dan nyata. Terwujud dalam kutipan hasil wawancara oleh guru ekonomi kelas XI, wakil kepala sekolah bidang kurikulum, siswa kelas XI IIS 1 dan XI IA 3 (lintas minat), dan hasil observasi kelas. Analisis data menggunakan trianggulasi sumber dan teknik untuk menjaga keabsahan data. Hasil analisis data yang diperoleh ketika penelitian, diperoleh kesimpulan sebagai berikut. Pertama, penerapan pendidikan karakter dalam pembelajaran ekonomi baik dalam penerapannya dan dapat dilihat dari RPP dan proses pembelajaran di dalam kelas. Guru selalu memperbarui perangkat pembelajaran sesuai dengan kurikulum 2013. Guru menyesuaikan 18 karakter yang akan diterapkan disesuaikan ke dalam RPP yang tentunya disesuaikan materi yang akan diajarkan di kelas dan guru juga membuat daftar penilaian yang jelas untuk setiap siswa. Siswa menunjukan karakter positif yang dapat menunjukan keberhasilan penerapan pendidikan karakter dalam pembelajaran ekonomi. Kedua,Faktor pendukung penerapan pendidikan karakter adalah fasilitas yang dapat digunakan dan mendukung dalam kegiatan pembelajaran agar tercapai penerapan nilai karakter. Pihak sekolah melalu komite sebagai pihak pendanaan menyediakan fasilitas yang dapat dinikmati seluruh warga sekolah. Faktor penghambat yang dirasakan guru di kelas adalah mengalami kendala berupa waktu yang terkadang terpotong, pemahaman siswa ketika guru mengadakan kegiatan diskusi, dan kesadaran siswa. Faktor penghambat ini membuat pendidikan karakter kurang maksimal penerapannya. i Ketiga, penilaian yang dilakukan guru pada kurikulum 2013 penyesuaian dalam penilaian yang dilakukan guru pada penilaian sekolah sudah merancang dengan kotak diskripsi pada rapot, juga dapat diakses melalui website yang diperoleh dari jurnal mengajar guru yang diolah oleh wali kelas. Saran bagi pihak sekolah diharapkan diharapkan dapat mengembangkan dalam instrumen penilaian karakter yang sudah ada agar penilaian pendidikan karakter dapat di pahami oleh guru dalam penilaiannya. Saran untuk Guru ekonomi diharapakan selalu melakukan penerapan pendidikan karakter dengan 18 karakter dari pemerintah yang disesuikan dengan materi secara terus menerus agar peserta didik memiliki karakter positif. Saran bagi peneliti lain diharapkan apabila mengambil tema penelitian ini tidak anya pada satu guru ekonomi saja agar penelitian lebih luas dan fokus kepada pembelajaran ekonomi dan bagi peneliti dapat mengetahu penerapan pendidikan karakter yang ternyata dapat dilaksanakan dengan baik di SMAN 9 Malang.

Implementing team-pair-solo strategy using narrative video to improve the writing ability of the eight grade students at SMP Negeri 1 Bandar Lampung / Susi Kurniati

 

ABSTRAK Susi Kurniati, 2016. Menerapkan Strategi Team-Pair-Solo (Berkelompok-Berpasangan-Individu) dengan menggunakan Video Narrative untuk meningkatkan kemampuan menulis siswa Kelas Delapan pada SMP Negeri 1 Bandar Lampung. Thesis, Jurusan Pendidikan Bahasa Inggris, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Bambang Yudi Cahyono, Ph.D., (2) Prof. Dr. Yazid Basthomi, M.A. Kata Kunci: Strategi Team-Pair-Solo, video narrative, kemampuan menulis Penelitian ini mengimplementasikan penggunaan Strategi Team-Pair-Solo dengan penggunaan video narratif untuk meningkatkan kemampuan menulis siswa. Observasi awal terhadap siswa menunjukkan bahwa siswa mengalami kesulitan dalam proses menulis cerita dalam bahasa Inggris. Selain mengalami kesulitan dalam menentukan ide cerita dan mengembangkan isi cerita, siswa juga memiliki motivasi yang rendah dalam menulis. Hal ini disebabkan karena aktivitas pelajaran menulis dilakukan dengan metode yang kurang tepat dan media yang kurang menarik. Oleh karena itu, peneliti menerapkan strategi dengan mengimplementasikan pembelajaran Team-Pair-Solo atau kerja Berkelompok-Berpasangan-Individu dengan menggunakan video narrative sebagai media pembelajaran yang menarik dan memotivasi. Penelitian ini melibatkan siswa Kelas VIII 9 yang merupakan kelas dengan perolehan nilai menulis paling rendah, yaitu dua puluh enam siswa dari tig puluh satu siswa tidak memenuhi KKM dalam test awal menulis. Sehingga, Peneliti menerapkan strategi Team-Pair-Solo dengan menggunakan media video narrative untuk meningkatkan kemampuan menulis siswa serta meningkatkan motivasi belajar menulis siswa. Sehingga, pertanyaan dalam penelitian ini adalah, “Bagaimana strategy Team-Pair-Solo dengan menggunakan video narrative mampu meningkatkan kemampuan menulis siswa kelas delapan SMP Negeri 1 Bandar Lampung?”. Desain penelitian ini adalah Penelitian Tindakan Kelas dengan menggunakan strategi belajar berkelompok, berpasangan dan individu. Data dan sumber data dalam penelitian ini diperoleh melalui lembar observasi, rubrik penilaian, dan catatan lapangan. Dalam implementasinya, penelitian ini dilakukan selama satu siklus, yang masing-masing siklus terdiri dari empat pertemuan penerapan strategi dan satu pertemuan tes kemampuan menulis. Hasil penelitian menunjukkan bahwa pada aktifitas pembelajaran, siswa mengalami peningkatan score secara signifikan. Terdapat dua puluh enam siswa (84%) mencapai level menulis “Very Good” dengan nilai diatas 79 dan lulus nilai KKM, sementara terdapat lima siswa (16%) meraih nilai di bawah KKM; dua diantaranya (6%) meraih nilai 70 dan 75 dengan berada pada level menulis “Good” dan tiga siswa lainnya meraih nilai 60 dan 65 berada pada level menulis “Fair”. Keseluruhan siswa (100%) mengalami peningkatan nilai antara 10 hingga 65 poin dengan sembilan variasi rentang nilai. Peneliti menitik beratkan pada memotivasi siswa, kemampuan siswa dalam menulis mengembangkan ide cerita, memperkaya vocabulary dan bekerja sama, kesediaan untuk membantu dan meminta bantuan dari teman. Yang bertujuan untuk meningkatkan motivasi siswa dalam belajar menulis, meningkatkan kemampuan menulis siswa, keakuratan penulisan dan kecerdasan interaksi sosial. Karena alasan tersebut, dengan tercapainya kriteria keberhasilan, maka strategi Team-Pair-Solo dengan menggunakan media video narrative dikatakan mampu meningkatkan kemampuan menulis siswa serta mampu meningkatkan motivasi belajar siswa. Prosedur pelaksanaan strategi Team-Pair-Solo tersebut adalah sebagai berikut: (1) membagi siswa dalam kelompok, menuntun siswa untuk memahami unsur sebuah cerita, (2) menunjukan video narrative pada siswa dan bertanya tentang video tersebut, (3) siswa diminta bekerja didalam kelompok menemukan kosa kata baru, ide cerita dan unsur cerita, (4) siswa diminta bekerja berpasangan, mengedit kalimat, merevisi kalimat dan membangun sebuah paragraph sederhana, (5) dan siswa diminta bekerja individu membangun dan mengembangkan cerita secara lengkap. Kesimpulan dari penelitian ini adalah strategi ini sangat bermanfaat untuk memotivasi siswa dalam belajar menulis, serta khususnya guru yang ingin meningkatkan kemampuan menulis siswa dan aktifitas pembelajaran mereka dengan menghadirkan pembelajaran yang menarik, kreatif dan motivatif. Strategi ini bisa digunakan disatuan pendidikan manapun dengan terlebih dahulu disesuaikan dengankondisi siswa masing-masing.

Pengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis teks berita siswa kelas VIII SMP Negeri 2 Malang / Lailinda Nur Jannah

 

Jannah, Lailinda Nur. 2014. Pengaruh Penggunaan Teknik Peta Pikiran terhadap Kemampuan Menulis Teks Berita Siswa Kelas VIII SMP Negeri 2 Malang. Skripsi, Jurusan Sastra Indonesia, FS, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. H. Dawud, M.Pd., (2) Dewi Pusposari, S.Pd., M.Pd. Kata kunci:teknik peta pikiran, kemampuan menulis, teks berita     Di dalam Kurikulum Tingkat Satuan Pendidikan (KTSP) terdapat kompetensi dasar (KD) menulis teks berita siswa kelas VIII SMP. Untuk mencapai KD tersebut, ada tiga aspek kemampuan menulis berita yang harus dikuasai oleh siswa, yakni judul, teras, dan tubuh berita. Ketiga aspek tersebut dianggap masih sulit dicapai oleh siswa.Salah satu penyebab kesulitan tersebut adalah teknik pembelajaran yang digunakan kurang mendukung. Dengan demikian, dibutuhkan sebuah teknik yang dapat mengoptimalkan kemampuan menulis teks berita. Pada penelitian ini diujicobakan teknik peta pikiran untuk membantu siswa dalam memetakkan berita yang diperoleh, sehingga mereka mampu menulis teks berita dengan benar.     Secara umum penelitian ini bertujuan untuk mengetahui pengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis teks berita siswa kelas VIII. Secara khusus penelitian ini bertujuan untuk mengetahui pengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis judul, teras, dan tubuh berita siswa kelas VIII SMP Negeri 2 Malang.     Penelitian ini menggunakan rancangan kuasi eksperimen. Populasi penelitian ini adalah siswa kelas VIII SMP Negeri 2 Malang, sedangkan sampel penelitian ini adalah siswa kelas VIII-A sebagai kelas kontrol dan kelas VIII-I sebagai kelas eksperimen.Kelas eksperimen diberikan perlakuan dengan menggunakan teknik peta pikiran, sedangkan kelas kontrol menggunakan teknik konvensional. Instrumenkelas eksperimen berupa Lembar Kerja Siswa(LKS) yang di dalamnya terdapat langkah-langkah menulis teks berita dengan teknik peta pikiran. Intrumen kelas kontrol berupa LKS yang di dalamnya terdapat perintah menulis teks berita.Dengan instrumen tersebut diperoleh data penelitian nilai kemampuan menulis judul, teras, dan tubuh teks berita dari kelas eksperimen dan kelas kontrol.     Hasil penelitianpengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis judul, teras, dan tubuh berita menunjukkan bahwa nilai kelas eksperimen lebih tinggi dibandingkan dengan kelas kontrol, kecuali aspek kelogisan kalimat teras berita dan ejaan serta tanda baca. Berdasarkan hasil analisis statistik uji beda tes akhirkemampuan menulis judul berita diketahui t hitung adalah 3,620, p = 0,001 (p < 0,05).Hasil tersebut menunjukkan bahwa terdapat perbedaan skor menulis judul berita kelas eksperimen dengan kelas kontrol. Dengan demikian dapat disimpulkan bahwa ada pengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis judul berita. Jadi, penggunaan teknik peta pikiran dapat meningkatkan kemampuan menulis judul teks berita.     Hasil analisisuji beda tes akhirkemampuan menulis teras berita diketahui t hitung adalah 4,313, p = 0,000 (p < 0,05). Hasil tersebut menunjukkan bahwa terdapat perbedaan skor menulis teras berita kelas eksperimen dengan kelas kontrol. Dengan demikian dapat disimpulkan bahwa ada pengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis teras berita.Jadi, penggunaan teknik peta pikiran dapat meningkatkan kemampuan menulis teras teks berita.     Hasil analisis uji beda tes akhirkemampuan menulis tubuh berita diketahui t hitung adalah 8,105, p = 0,000 (p < 0,05). Hasil tersebut menunjukkan bahwa terdapat perbedaan skor menulis tubuh berita kelas eksperimen dengan kelas kontrol. Dengan demikian dapat disimpulkan bahwa ada pengaruh penggunaan teknik peta pikiran terhadap kemampuan menulis tubuh berita.Jadi, penggunaan teknik peta pikiran dapat meningkatkan kemampuan menulis tubuh teks berita. Saran yang diajukan peneliti berdasarkan hasil penelitian adalah (1) bagi guru mata pelajaran Bahasa Indonesia teknik peta pikiran digunakan untuk keterampilan bahasa Indonesia yang lain,(2) bagi peneliti lain dapat menerapkan teknik pembelajaran yang tepat untukmeningkatkan aspek ejaan dan tanda baca, dan (3) bagi penelitia lain juga dapat mengembangkan teknik peta pikiran yang dapat mendorong siswa secara mandiri membuat peta pikiranpada pembelajaran menulis teks berita.

An analysis of instructional materials for integrated language lessons in English for the senior high school for the second year students of SMU based on the 1994 curriculum / by Helmi MK

 

Dilema etis staf auditor: independensi, profesionalisme, dan kualitas audit (studi kasus pada Kantor Akuntan Publik X Malang) / Ika Kustikasari

 

ABSTRAK Kustikasari, Ika. 2016. DilemaEtisStaf Auditor: Independensi, Profesionalisme, danKualitas Audit. Skripsi, JurusanAkuntansi, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (1) Dr. Sri Pujiningsih, S.E, M.Si, Ak, (II) Dr. Suparti, M.P. Kata Kunci: DilemaEtis, Independensi, ProfesionalismedanKualitas Audit Kualitaslaporanhasil audit danopini audit yang telahdikeluarkanolehsuatu KAP merupakanjaminandarikepercayaanpublik. Laporanhasil audit dapatdinalaiberkualitasapabilaseluruhprosedur audit dijalankandenganbaikolehstaf auditor. Tetapiadanyadilemaetismenimbulkanperilakutawarmenawaropiniantarastaf auditor danklien, halinimenyebabkanburuknyakualitaslaporanhasil audit yang dikeluarkanolehsuatu KAP.Penelitianinibertujuanuntukmemahamiperilakustafauditor yangdihadapkanpadadilemaetisatasindependensi, profesionalismedankualitas audit. Penelitianinimenggunakanpendekatankualitatifdenganmetodestudikasusdenganinformanseluruhstaf auditor, baik junior maupun senior yang ada di KAP X Malang.Teknikanalisis data dilakukandenganreduksi data, penyajian data danpenarikankesimpulan.Sedangkanpengecekankeabsahanpenelitiandilakukandengantekniktrianggulasisumberdantekniktrianggulasimetode. Berdasarkanpaparan data danpembahasan, diperolehtigasimpulanhasilpenelitiansebagaiberikut.Pertama, dilemaetis yang dihadapiolehstaf auditor di KAP X Malang telahberdampakpadaburuknyaindependensistaf auditor, yang terlihatdariindikatorlamanyahubungandengankliendantekanandariklien.Namundariindikatorpeer review danjasa non audit tidakditemukanadanyapenyimpangan. Hal inidikarenakandilemaetislebihmudahdialamistaf auditor ketikamenjalankantugasutamanyayaitu audit daripadamenjalankanjasa non audit. Kedua, dilemaetis yang terjadi di KAP X Malang telahmempengaruhiprofesionalismenyatanpamelihatlatarbelakangpendidikandanupdateperaturanbaru yang dilakukan.Buruknyaprofesionalismestaf auditor di KAP X Malang ditunjukkandariketidaktegasanstaf auditor untukmenolakajakanklien yang dapatmempengaruhi proses audit. Selainitukeinginanuntukberkarirdibidanglainjugamempengaruhiprofesionalismestaf auditor di KAP X Malang. Ketiga, dilemaetis yang dialamiolehstaf auditor telahberdampakpadakualitashasil audit. Hal initerlihatdariadanyatawarmenawar di opini audit, yang mencerminkanbahwalaporan audit yang dikeluarkanoleh KAP X Malang kurangberkualitas. Secaralogika, jikaindependensidanprofesionalisme yang dimilikistaf auditor terganggumakalaporanhasil audit yang dikeluarkanmenjaditidakberkualitas. Disarankanuntukpenelitianselanjutnyahendaknyamelibatkan partner sebagaiinforman, sertapenelitiandilakukanpadasaat volume kegiatan di KAP rendah agar data yang didapatmaksimaldanetikaprofesi yang ditelititidakterbataspadaindependensidanprofessionalisme.

Peningkatkan minat belajar Bahasa Arab Siswa Madrasah Ibtidaiyah Islamiyah Kebonsari Malang melalui teknik bermain / Dewi Aizaun Anisa

 

ABSTRAK Anisa, Dewi, Aizaun. 2009. Peningkatan Minat Belajar Bahasa Arab Siswa Madrasah Ibtidaiyah Islamiyah Kebonsari Malang Melalui Teknik Bermain. Skripsi, Jurusan Sastra Arab, Program Studi Pendidikan Bahasa Arab, Fakultas Sastra Universitas Negeri Malang. Pembimbing: (I) Drs. M. Syatibi Nawawi, (II) Prof. Drs. H. Muhaiban. Kata kunci: minat belajar, bahasa Arab, teknik bermain. Bahasa Arab merupakan salah satu bahasa asing yang ada di Indonesia yang berfungsi sebagai bahasa agama, ilmu pengetahuan dan alat komunikasi. Beberapa sekolah telah mengembangkan permainan sebagai bagian dari proses pembelajaran bahasa Arab. Dilihat dari segi usia, siswa yang masih dini maka pembelajaran bahasa Arab dengan teknik bermain sangat sesuai untuk diterapkan dengan tujuan agar siswa dapat memahami dan mempelajari bahasa Arab dengan mudah dan seoptimal mungkin tanpa rasa terpaksa atau dipaksa untuk mempelajarinya. Lokasi penelitian yang dipilih sebagai ajang penelitian tindakan kelas ini, adalah MII Kebonsari Malang yang berlokasi di Jalan S. Supriadi 172 L Kebonsari Malang. Adapun jumlah siswa di kelas V sebanyak 38 orang. Dalam pengajaran bahasa Arab di MII Kebonsari Malang dengan menggunakan teknik bermain, salah satu kegiatannya tidak bisa terlepas dari kehidupan anak-anak. Segala aktifitas yang ditujukan untuk anak-anak diikuti dengan permainan, baik di dalam lingkungan sekolah, maupun ketika berada di lingkungan keluarga dan masyarakat. Tujuan diadakan penelitian ini adalah: (1) mendeskripsikan teknik bermain yang digunakan dalam peningkatan minat belajar bahasa Arab siswa MII Kebonsari Malang; (2) mendeskripsikan penerapan teknik bermain dalam peningkatan minat belajar bahasa Arab siswa MII Kebonsari Malang; (3) mendeskripsikan tentang minat belajar bahasa Arab siswa MII Kebonsari Malang dengan teknik bermain. Jenis penelitian yang dilaksanakan adalah penelitian tindakan kelas dengan beberapa siklus. Setiap siklus terdiri atas empat tahapan yaitu: (1) penyusunan rencana tindakan, (2) pelaksanaan tindakan, (3) observasi, (4) refleksi. Subjek penelitian ini adalah siswa kelas V Madrasah Ibtidaiyah Islamiyah Kebonsari Malang. Data dalam penelitian ini yaitu data kualitatif berupa rekaman pelaksanaan pembelajaran dengan teknik bermain. Adapun teknik pengumpulan data yang digunakan yaitu (1) wawancara, (2) observasi. Dalam penelitian ini peneliti bertindak sebagai instrumen utama. Keabsahan data dalam penelitian ini diperiksa melalui trianggulasi, yaitu membandingkan hasil wawancara, angket dan observasi. Hasil dari penelitian ini adalah: (1) teknik bermain di MII Kebonsari Malang menggunakan tiga permainan yaitu: permainan bisik berantai, bermain peran; dan permainan berhitung; (2) penerapan teknik bermain di MII Kebonsari Malang sesuai dengan karakteristik anak dengan cara memasukkan unsur permainan dalam kegiatan pembelajaran (3) minat dan motivasi siswa dalam pembelajaran bahasa Arab dengan teknik bermain sangat meningkat. Berdasarkan hasil penelitian ini, dapat disarankan agar dilakukan penelitian lebih lanjut misalnya dalam teknik bermain peran sebagian siswa kurang menguasai kosakata/mufradat, hal ini dapat diantisipasi dengan cara siswa diberi tugas untuk menghafal kosakata/mufradat. Kurangnya waktu yang disediakan dalam penerapan teknik bermain dapat diatasi dengan cara menyampaikan sebagian teori bahasa Arab disela-sela pelaksanaan teknik bermain.

Diagnosis kesulitan siswa memecahkan masalah matematika pokok bahasan persamaan kuadrat di kelas X SMAN 8 Malang / Fuad Rifai

 

ABSTRAK Rifai, Fuad. 2008. Diagnosis Kesulitan Siswa Memecahkan Masalah Matematika Pokok Bahasan Persamaan Kuadrat di Kelas X SMAN 8 Malang. Skripsi, Program Studi Pendidikan Matematika FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M.Pd, (II) Drs. Rustanto Rahardi, M.Si. Kata kunci: diagnosis, kesulitan siswa, memecahkan masalah Pemecahan masalah merupakan bagian dari kurikulum matematika yang sangat penting karena dalam proses pembelajaran maupun penyelesaian masalah tersebut, siswa dimungkinkan memperoleh pengalaman menggunakan pengetahuan serta keterampilan yang sudah dimiliki untuk diterapkan pada pemecahan masalah yang tidak rutin. Rutin atau tidak suatu soal merupakan hal yang sangat relatif. Suatu soal yang dianggap sebagai masalah bagi seseorang, bagi orang lain mungkin hanya merupakan hal yang rutin belaka. Perbedaan soal rutin dan soal tidak rutin adalah bahwa soal rutin biasanya mencakup aplikasi suatu prosedur matematika yang sama atau mirip dengan hal yang baru dipelajari. Sedangkan dalam soal tidak rutin, untuk sampai pada prosedur yang benar diperlukan pemikiran yang mendalam. Melalui kegiatan ini aspek-aspek kemampuan matematika penting seperti penerapan aturan pada masalah tidak rutin, penemuan pola, penggeneralisasian, komunikasi matematika, dan lain-lain dapat dikembangkan secara lebih baik. Pemecahan masalah merupakan sesuatu yang harus dipelajari oleh siswa. Di dalam pemecahan masalah, siswa diharapkan memahami proses penyelesaian masalah tersebut dan menjadi terampil dalam memilih dan mengidentifikasikan kondisi dan konsep yang relevan, mencari generalisasi, merumuskan rencana penyelesaian, dan mengorganisasikan keterampilan yang telah dimiliki sebelumnya. Prosedur pengembangan soal yang digunakan meliputi dua tahapan, yaitu tahap studi pendahuluan dan tahap pengembangan. Tahap studi pendahuluan meliputi dua bagian, yaitu survey pendahuluan dan studi kepustakaan. Sedangkan tahap pengembangan terdiri dari kegiatan penyusunan instrumen dan validasi. Hasil penelitian adalah bentuk-bentuk kesulitan yang dihadapi siswa dalam memecahkan masalah matematika.Bentuk-bentuk tersebut antara lain adalah : Kesulitan siswa dalam menyelesaikan masalah matematika dikategorikan dalam tiga bagian sebagai berikut. Pertama adalah kesulitan dalam menerapkan konsep. Kesulitan ini meliputi dua hal yaitu kesulitan atau kesalahan dalam mamaknai suatu istilah atau definisi dalam suatu soal dan kesulitan atau kesalahan siswa dalam menuliskan bentuk matematika dari suatu istilah atau definisi matematik. Kedua adalah kesulitan dalam menerapkan prinsip. Kesulitan ini meliputi dua hal yaitu kesulitan atau kesalahan prinsip yang melibatkan konsep atau menyangkut konsep tertentu dan Kesulitan atau kesalahan prinsip yang merupakan kesalahan perhitungan aljabar. Ketiga adalah kesulitan dalam memecahkan masalah verbal. Kesulitan ini meliputi tiga hal yaitu kesulitan yang pertama muncul dari ketidak tahuan siswa mengenai persamaan yang dibentuk dari permasalahan yang diberikan, kesulitan atau kesalahan siswa dalam membuat sketsa permasalahan yang diberikan dan Kesalahan dalam menentukan model matematika dikarenakan tidak menggunakan sketsa model.

Upaya pemerintah daerah dalam menanggulangi illegal logging di Desa Ngrejo Kecamatan Tanggunggunung Kabupaten Tulungagung / Mitra Ari Kiswanto

 

ABSTRAK Kiswanto, Mitra Ari. 2016. Upaya Pemerintah Daerah Dalam Menanggulangi Illegal Logging di Desa Ngrejo Kecamatan Tanggunggunung Kabupaten Tulungagung. Skripsi, Program Studi S1 Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Moch. Yuhdi Batubara, SH., M.H., (II) Drs. H. Petir Pudjantoro, M.Si. Kata Kunci: Illegal Logging, Pemerintah Daerah Illegal Logging sebagai praktek eksploitasi hasil hutan berupa kayu secara tidak sah dari kawasan hutan negara melalui aktifitas penebangan pohon dan atau pemanfaatan serta peredaran kayu atau olahannya yang berasal dari hasil tebangan secara tidak sah. Penelitian ini bertujuan untuk mendeskripsikan: (1) Kondisi Illegal Logging yang terjadi di Desa Ngrejo Kecamatan Tanggunggunung Kabupaten Tulungagung, (2) Program atau kegiatan yang di kembangkan sebagai upaya pemerintah daerah dalam menanggulangi Illegal Logging di Desa Ngrejo Kecamatan Tanggunggunung Kabupaten Tulungagung, (3) Efektifitas program atau kegiatan yang dikembangkan pemerintah daerah dalam menanggulangi Illegal Logging di Desa Ngrejo Kecamatan Tanggunggunung Kabupaten Tulungagung. Penelitian ini menggunakan pendekatan kualitatif, dengan jenis penelitian deskriptif. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, dan dokumentasi. Data penelitian yang berupa dokumentasi dan hasil wawancara dengan beberapa informan yaitu Kepala Dinas Kehutanan, Asisten Perhutani Campurdarat, Kapolsek Tanggunggunung, Kepala Desa Ngrejo, dan Masyarakat. Kegiatan analisis data dengan menggunakan model analisis secara induktif yaitu penulis mengelompokkan data yang sejenis atau merupakan bagian dari masalah yang sama akan dibahas dan kemudian menarik kesimpulan. Berdasarkan hasil analisis data tersebut, diperoleh tiga hasil penelitian sebagai berikut. Pertama kondisi Illegal Logging di Desa Ngrejo, yaitu kerusakan lingkungan seperti (1) mengeringnya sebagian sumber air; (2) tanah longsor; (3) erosi; dan (4) meningkatnya suhu udara di wilayah Desa Ngrejo. Kedua, program atau kegiatan yang dikembangkan sebagai upaya pemerintah daerah dalam menanggulangi Illegal Logging di Desa Ngrejo, yaitu (1) PHBM merupakan program pengelolaan hutan yang dilakukn oleh pihak Perhutani dengan masyarakat sekitar kawasan hutan; (2) operasi gabungan merupakan operasi yang dilakukan oleh pihak Perhutani yang diadakan dua kali dalam satu bulan; (3) reboisasi merupakan pemulihan hutan yang dilakukan Dinas Kehutanan maupun Perhutani dikawasan hutan yang gundul dan gersang; (4) LMDH merupakan lembaga yang dibentuk masyarakat sekitar kawasan hutan yang bertujuan untuk pengelolaan hutan. Ketiga, upaya pemerintah yaitu dengan PHBM dan operasi gabungan, serta reboisasi untuk menanggulangi hutan yang gundul dan gersang. Namun efektivitas program yang dikembangkan oleh pemerintah daerah, yaitu belum efektif karena kurangnya kesadaran dari masyarakat sekitar hutan. Beberapa saran dari peneliti diajukan kepada beberapa pihak, yakni (1) Bagi Dinas Kehutanan Kabupaten Tulungagung seharusnya sosialisasi akan pentingnya hutan terhadap masyarakat kawasan hutan ditingkatkan lagi; (2) Bagi Perum Perhutani sebaiknya perlu adanya upaya yang lebih untuk melakukan patroli atau operasi gabungan di kawasan hutan; (3) Bagi Kapolsek Tanggunggunung sebaiknya lebih tegas lagi dalam memberikan sanksi kepada pelaku pencurian kayu atau Illegal Logging; (4) Bagi Kepala Desa Ngrejo sebaiknya meningkatkan kerja sama antar masyarakat dengan pihak perhutani dalam mengelola kawasan hutan; (5) Bagi Masyarakat Desa Ngrejo seharusnya masyarakat mematuhi peraturan untuk menjaga kelestarian hutan.

Nilai-nilai akhlak muslim dalam novel Tahun-tahun yang Hilang Berdiri Tegar di Bawah Bayang-bayang Syekh Yusuf karya Rully Ferdiansyah / Musa Abadi

 

ABSTRAK Abadi, Musa. 2014. Nilai-Nilai Akhlak Muslim dalam Novel Tahun-Tahun Yang Hilang Berdiri Tegar Di Bawah Bayang-Bayang Syekh Yusuf. Skripsi, Jurusan Pendidikan Sastra Indonesia dan Daerah, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (1) Prof. Dr. Wahyudi Siswanto, M.Pd, (II) Dwi Sulistyorini, S.S., M. Hum. Kata Kunci: nilai, akhlak muslim, novel Novel merupakan salah satu bentuk karya sastra berjenis prosa rekaan modern dalam wujud ungkapan-ungkapan tertulis yang di dalamnya mengandung unsur estetis dan manfaat. Unsur estetis berkaitan dengan kreativitas pengarang dalam menyajikan cerita, sedangkan unsur manfaat dimaknai sebagai unsur yang memberikan keuntungan secara nyata bagi pembaca. Hiburan dan nilai-nilai berupa ajaran moral atau akhlak yang diilustrasikan melalui kisah, sikap, dan tingkah laku tokoh yang disinergikan oleh pengarang dengan situasi, kondisi, dan jalinan peristiwa dalam novel adalah representasi bentuk unsur manfaat. Nilai-nilai akhlak muslim berisikan pemaknaan berharga dari ajaran akhlak atau moral dalam agama Islam yang idealnya dipelajari, dipahami, dan diimplementasikan seorang muslim dalam kehidupan sehari-hari. Nilai-nilai akhlak muslim sejatinya bertendensi pada nilai-nilai akhlak mulia yang dicontohkan oleh nabi besar Muhammad SAW. Pada novel religi berjudul Tahun-Tahun yang Hilang Berdiri Tegar di Bawah Bayang-Bayang Syekh Yusuf penulis banyak menampakkan nilai-nilai akhlak muslim dalam penceritaanya. Hal tersebut dikarenakan penulis sangat terinspirasi sosok ulama besar bernama Syekh Yusuf Al-Makasari Al-Bantani. Berdasarkan pertimbangan adanya nilai-nilai akhlak muslim dalam novel, peneliti memutuskan untuk memilih novel tersebut sebagai objek penelitian. Tujuan diadakan penelitian ini untuk mendeskripsikan tiga nilai akhlak muslim dalam novel Tahun-Tahun yang Hilang Berdiri Tegar di Bawah Bayang-Bayang Syekh Yusuf, yaitu (1) nilai-nilai akhlak muslim kepada Allah SWT, (2) nilai-nilai akhlak muslim kepada sesama, dan (3) nilai-nilai akhlak muslim terhadap lingkungan.     Penelitian ini menggunakan pendekatan kualitatif dengan desain deskriptif. Sumber data penelitian diperoleh dari novel berjudul Tahun-Tahun yang Hilang Berdiri Tegar di Bawah Bayang-Bayang Syekh Yusuf karya Rully Ferdiansyah cetakan pertama yang diterbitkan oleh DIVA PRESS pada tahun 2012 dengan tebal 407 halaman. Wujud data penelitian ini berupa kutipan-kutipan berbentuk unit-unit kalimat, paragraf, atau dialog yang terdapat pada teks novel. Kutipan-kutipan yang diambil merepresentasikan nilai-nilai akhlak muslim kepada Allah SWT, sesama, dan terhadap lingkungan. Instrumen yang digunakan pada penelitian ini adalah peneliti sendiri dilengkapi dengan tabel data.     Teknik yang digunakan peneliti dalam proses pengumpulan data meliputi empat tahap. Pertama, peneliti membaca secara intensif dan komprehensif yang dilanjutkan dengan observasi terhadap novel untuk memperoleh gambaran umum mengenai isi cerita. Kedua, peneliti mengidentifikasi isi novel untuk menjaring data sesuai dengan konsep penelitian. Kegiatan identifikasi dilakukan dengan menelusuri paparan bahasa yang terdapat dalam pikiran, perasaan, perilaku, sikap, tokoh-tokoh dalam bentuk dialog dan monolog dalam cerita. Ketiga, peneliti mengambil kutipan berbentuk unit-unit kalimat, paragraf, atau dialog yang menunjukkan wujud nilai-nilai akhlak muslim kepada Allah SWT, sesama dan terhadap lingkungan. Setelah itu, peneliti mengelompokkan kutipan ke dalam pembahasan sesuai sub bab yang dibahas sesuai dengan tabel pengumpulan data. Keempat, peneliti mengkaji tabel pengumpulan data yang diperoleh dan mengaitkannya dengan landasan teori dan fokus utama masalah-masalah yang diteliti sehingga menghasilkan hasil analisis yang akurat.      Berdasarkan analisis data, temuan penelitian, dan pembahasan pada bab IV dan V, dapat disimpulkan bahwa di dalam novel terdapat empat nilai-nilai akhlak muslim kepada Allah SWT, lima nilai-nilai akhlak muslim kepada sesama, dan dua nila-nilai akhlak muslim terhadap lingkungan. Keseluruhan nilai-nilai akhlak muslim tersebut diuraikan sebagai berikut. Pertama, nilai-nilai akhlak muslim kepada Allah SWT yang terkandung dalam novel, yaitu (1) keimanan, (2) penghayatan atas nikmat-Nya, (3) berserah diri kepada Allah SWT, dan (4) mempercayai adanya kuasa dan pertolongan Allah SWT. Kedua, nilai-nilai akhlak muslim kepada sesama yang terkandung dalam novel dikelompokkan ke dalam nilai-nilai akhlak muslim dalam keluarga dan masyarakat. Nilai-nilai akhlak muslim dalam keluarga, yaitu menyayangi dan bersikap sopan santun kepada orang tua dan berempati terhadap kerabat. Nilai-nilai akhlak muslim dalam masyarakat, yaitu (1) bermurah hati, (2) berjiwa besar, dan (3) perkataan selaras dengan perbuatan. Ketiga, nilai-nilai akhlak muslim terhadap lingkungan yang terkandung dalam novel, yaitu pemanfaatan alam secara optimal dan bijaksana serta menyayangi sesama makhluk (hewan atau tumbuhan).     Berdasarkan pada simpulan yang dikemukakan di atas, ada sejumlah saran yang perlu disampaikan kepada peneliti lanjutan, penulis karya sastra, dan pembaca. Bagi peneliti selanjutnya, disarankan agar mengembangkan penelitian tentang nilai-nilai akhlak muslim pada sebuah karya sastra lain dengan menggunakan landasan teori dan perspektif yang berbeda sehingga hasil penelitian tentang nilai-nilai akhlak muslim dalam karya sastra akan lebih beragam dan bervariatif. Selain itu, penelitian ini juga dapat dijadikan sebagai bahan acuan bagi peneliti lain yang melakukan penelitan sejenis. Bagi penulis karya sastra, disarankan agar dapat membuat karya sastra yang berkualitas, yang tidak hanya bersifat hiburan semata tetapi juga memberikan hikmah kepada pembaca. Hikmah yang terkandung dalam karya sastra dapat disampaikan melalui tokoh-tokoh dalam cerita maupun tema cerita. Bagi pembaca, disarankan agar dapat menambah pengetahuan dan pemahaman tentang nilai-nilai akhlak muslim dengan membaca karya sastra religi Islami. Selain itu, hendaknya pembaca dapat memilih karya sastra yang kaya akan ajaran-ajaran kebaikan sehingga pembaca dapat memanfaatkan karya sastra sebagai salah satu rujukan membentuk sikap dan perilaku yang arif dan bijaksana dalam menjalani kehidupan.

Motivasi dan partisipasi siswa dalam kegiatan koperasi sekolah di SMU Negeri 2 Tulungagung / oleh Datim Siswanto

 

Peran Pusat Pelayanan Terpadu Korban kekerasan Terhadap Perempuan dan Anak (PPT-K2TPA) dalam menanggulangi korban kekerasan di Kabupaten Situbondo / Anindita Nareswari

 

ABSTRAK Nareswari, Anindita. 2016. Peran Pusat Pelayanan Terpadu Korban Kekerasan Terhadap Perempuan dan Anak (PPT-K2TPA) Dalam Menanggulangi Korban Kekerasan Di Kabupaten Situbondo. Skripsi. Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Suko Wiyono, S.H, M. Hum (II) Dr. Nurrudin Hady, S.H, M.H Kata Kunci: PPT-K2TPA, Kekerasan Perempuan dan Anak Anak merupakan mahkluk Tuhan yang mulia dimana keberadaannya adalah kewenangan Allah melalui proses penciptaan, Allah menitipkan anak tersebut kepada orang tua, dan tugas orang tua wajib menjaga anak tersebut. Selain itu perempuan pada umumnya dianggap sebagai makhluk yang lemah, sehingga kadang-kadang mengalami penghinaan, penindasan atau pelecahan, dengan kata lain tidak dibenarkan untuk menyia-nyiakan kehidupannya atau menganggap rendah kedudukannya. Banyak perempuan dan anak yang hingga saat ini mengalami kekerasan yang berupa kekerasan fisik, psikis, maupun seksual, yang otomatis akan mengakibatkan penderitaan dan traumatis pada si korban kekerasan. Tujuan dari penelitian ini adalah: (1) Untuk mengetahui program PPT-K2TPA dalam menanggulangi korban kekerasan di Kabupaten Situbondo. (2) Untuk mengetahui pelaksanaan program yang ditetapkan oleh PPT-K2TPA dalam menanggulangi korban kekerasan di Kabupaten Situbondo. (3) Untuk mengetahui kendala yang dihadapi PPT-K2TPA dalam pelaksanakan program menaggulangi korban kekerasan di Kabupaten Situbondo. (4) Untuk mengetahui upaya PPT-K2TPA dalam mengatasi kendala pelaksanaan program menaggulangi korban kekerasan di Kabupaten Situbondo. Penelitian ini menggunakan pendekatan kualitatif. Lokasi penelitian di jalan Anggrek 68 Situbondo Kompleks RSUD Abdoer Rahem Situbondo dan kantor Badan Permberdayaan Masyarakat dan Perempuan yang berada di jalan PB. Dudirman 45 Situbondo. Sumber data dalam penelitian ini adalah manusia dan dokumentasi. Informan dari penelitian ini adalah Kepala Bidang Keadilan dan Kesetaraan Gender di Badan Pemberdayaan Masyarakat dan Perempuan (BPMP), dan Pengurus/Admin PPT-K2TPA Kabupaten Situbondo. Prosedur analisis data dengan prosedur reduksi data, kategorisasi data, sintesisasi, dan diakhiri dengan menyusun hipotesis kerja. Berdasarkan hasil analisis tersebut, diperoleh empat kesimpualan hasil penelitian sebagai berikut. Pertama, PPT-K2TPA adalah bentuk penyelenggaraan layanan terpadu berbasis rumah sakit menangani korban kekerasan terhadap perempuan dan anak, meliputi pelayanan medis, medikolegal, psikososial dan bantuan hukum, secara lintas fungsi dan lintas sektoral. PPT-K2TPA mempunyai beberapa program kegiatan antara lain: (a) Kegiatan Fasilitasi Pengembangan PPT-K2TPA, (b) Kegiatan Sosialisasi Terkait Kesetaraan dan Keadilan Gender, (c) Kegiatan Sosialisasi Pemahaman Trafficking Pornografi, (d) Kegiatan Sosialisasi Cegah Kekerasan. Kedua, dalam pelaksanaan program, PPT-K2TPA bekerjasama dengan berbagai pihak, antara lain Pemerintahan Kabupaten Situbondo, kecamatan dan sekolah, Rumah Sakit Umum Daerah dr. Abdoer Rahem Situbondo, Kepolisian, advokat Kabupaten Situbondo, dan unsur dari LPBH NU Kabupaten Situbondo, LSM SAR Situbondo dan unsur Organisasi Kemasyarakatan Bela Negara Situbondo, Masyarakat dan unsur Penyuluh Agama Seksi Bimas Islam dari Kantor Kementrian Agama Kabupaten Situbondo, Masyarakat dan pihak Rumah Sakit Umum Daerah dr. Abdoer Rahem Kabupaten Situbondo. Ketiga, kendala yang dialami PPT-K2TPA yaitu: (1) kurangnya anggaran dana, (2) kurangnya antusias anak pada saat sosialisasi, (3) kurangnya Sumber Daya Manusia (SDM) yang memadai, (4) kurangnya pemahaman masyarakat tentang PPT-K2TPA. (5) korban atau keluarga korban tidak mendukung Keempat, upaya PPT-K2TPA dalam mengatasi kendala yaitu: (1) upaya mengatasi kendala terkait kurangnya dana, (2) upaya mengatasi kendala terkait kurangnya antusian anak, (3) upaya mengatasi kendala terkait kurangnya sumber daya manusia (SDM), (4) upaya mengatasi kendala kurangnya pemahaman masyarakat tentang PPT-K2TPA, (5) upaya mengatasi kendala korban atau keluarga korban tidak mendukung. Berdasarkan hasil penelitian saran yang diajukan adalah agar menambah pengurus lembaga atau konselor sehingga dapat memberikan pelayanan dengan maksimal. Dengan bertambahnya pengurus lembaga PPT-K2TPA, program yang direncakan dapat berjalan dengan lancar dan dapat menanggulangi korban kekerasan yang ada di Kabupaten Situbondo.

Kemampuan menuliskan kembali dongeng yang sudah dibaca siswa kelas VII SMP Negeri I Watulimo tahun pelajaran 2013/2014 / Dieseta Silvi Palupi

 

Palupi, Dieseta Silvi. 2014. Kemampuan Menuliskan Kembali Dongeng yang sudah Dibaca Siswa Kelas VII SMP Negeri I Watulimo. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Imam Agus Basuki, M. Pd (II) Dr. Sunoto, M. Pd. Kata kunci: pembelajaran menulis, menulis dongeng. Menulis adalah kemampuan menuangkan gagasan dalam bentuk bahasa tulis untuk disampaikan kepada pembaca. Salah satu kompetensi dasar aspek menulis dalam standar isi bahasa Indonesia kelas VII SMP pada Kurikulum Tingkat Satuan Pendidikan adalah menulis kembali dengan bahasa sendiri dongeng yang pernah dibaca atau didengar. Tujuan penelitian ini untuk mengukur kemampuan menuliskan kembali dongeng yang sudah dibaca siswa kelas VII SMP Negeri I Watulimo. Kemampuan menulis ini dilihat dari aspek ejaan, pilihan kata, keefektifan kalimat, dan kelengkapan isi yang kemudian akan dinilai secara keseluruhan untuk ditentukan kemampuannya. Penelitian ini menggunakan desain penelitian deskriptif dan menggunakan jenis penelitian kuantitatif. Data penelitian ini berupa skor untuk setiap karangan berdasarkan aspek-aspek penilaian yang sudah ditentukan dalam pedoman penilaian kemudian dari hasil penyekoran tersebut dideskripsikan kemampuan siswa dalam menuliskan kembali dongeng yang sudah dibaca. Karangan siswa dari kegiatan menuliskan kembali dongeng, dianalisis dan dinilai berdasarkan pedoman penilaian. Penilaian dilakukan dengan memberikan skor pada setiap aspek yang diteliti. Setelah semua data terkumpul dilakukan analisis data. Analisis data meliputi (1) persiapan, (2) tabulasi, (3) penilaian, dan (4) deskripsi hasil penelitian.     Hasil penelitian kemampuan menuliskan kembali dongeng yang sudah dibaca siswa kelas VII SMP Negeri I Watulimo, menunjukkan siswa yang mampu menuliskan kembali dengan ejaan yang kurang dari 4 kesalahan sebanyak 10 dari 50 siswa atau sebesar 20%, sedangkan sebanyak 40 siswa atau sebesar 80% belum mampu menuliskan kembali dongeng dengan ejaan yang tepat. Dari segi pilihan kata, siswa yang mampu menuliskan kembali dongeng dengan pilihan kata yang tepat sebanyak 47 dari 50 siswa atau sebesar 94% sedangkan siswa yang belum mampu sebanyak 3 siswa atau sebesar 6%. Dari segi keefektifan kalimat siswa yang mampu menuliskan kembali dongeng yang sudah dibaca sebanyak 43 dari 50 siswa atau sebesar 86% dan sebanyak 7 siswa atau sebesar 14% belum mampu menuliskan kembali dongeng dengan kelimat yang efektif. Dari segi kelengkapan isi siswa yang mampu menuliskan kembali dongeng dengan isi yang lengkap sebanyak 44 siswa atau sebesar 88% dan sebanyak 6 siswa atau 12% belum mampu. Dari rata-rata keseluruhan aspek penilaian siswa, kemampuan siswa dalam menuliskan kembali dongeng yang sudah dibaca siswa kelas VII SMP Negeri I Watulimo tahun pelajran 2013/2014 menunjukkan nilai rata-rata 79,8. Dengan demikian siswa kelas VII SMP Negeri I Watulimo tahun pelajaran 2013/2014 dapat dikatakan mampu dalam menuliskan kembali dongeng yang sudah dibaca.      Berdasarkan hasil penelitian dan pembahasan dapat diberikan saran kepada tiga pihak yaitu guru bahasa Indonesia, siswa, dan peneliti lain. Pertama, kepada guru bahasa Indonesia SMP Negeri I Watulimo, dari hasil temuan ini, guru disarankan untuk membiasakan siswa menggunakan bahasa Indonesia yang baik dalam kegiatan pembelajaran bahasa Indonesia, dalam arti tidak mencampuradukkan dengan dialek. Saran selanjutnya untuk guru, dalam pembelajaran menulis, siswa lebih ditekankan kembali dalam penggunaan ejaan. Selain itu disarankan kepada guru untuk lebih meningkatkan kualitas menulis siswa. Kedua, kepada siswa disarankan untuk membiasakan diri menggunakan bahasa Indonesia yang baik dalam berkomunikasi. Selain itu disarankan untuk siswa agar lebih memperhatikan penggunakan tata bahasa dan ejaan yang baik dalam pelajaran bahasa Indonesia khususnya dalam pembelajaran menulis. Ketiga, kepada peneliti lain, dari hasil temuan ini disarankan untuk menjadikan penelitian ini sebagai batu loncatan untuk mengembangkan bahan ajar, media pembelajaran, atau melakukan penelitian tindakan kelas untuk meningkatkan hasil kegiatan menulis siswa SMP Negeri I Watulimo.

Pengaruh konsentrasi herbisida terhadap pertumbuhan Azolla pinnata" / oleh Agus Supriadi"

 

Implementasi makna semboyan Untung Suropati dalam strategi perencanaan pembangunan Kabupaten Pasuruan / Bagus Wicaksono

 

ABSTRAK Wicaksono, Bagus. 2016. Implementasi Makna Semboyan Untung Surapati dalam Strategi Perencanaan Pembangunan Kabupaten Pasuruan. Skripsi, Jurusan Hukum dan Kewaganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr.H A Rosyid Al Atok M.Pd M.H, (II) Dr. Didik Sukriyono S.H M.Hum. Kata Kunci: Semboyan, Perencanaan, Strategi Pembangunan Kab.Pasuruan Pembangunan nasional sebagai usaha dalam meningkatkan kesejahteraan bangsa Indonesia. Berkaitan dengan itu, maka diperlukan perencanaan pembangunan untuk terwujudnya masyarakat adil dan makmur sebagaimana diamanatkan oleh Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 dan berdasarkan Pancasila. Berdasarkan hasil studi pendahuluan, pembangunan daerah merupakan bagian dari pembangunan nasional. Setiap daerah penting menyusun startegi pembangunan. Kabupaten Pasuruan menetapkan semboyan Untung Surapati sebagai strategi perencaan pembangunan. Penelitian ini dilaksanakan dengan tujuan mengetahui sejarah perumusan dan makna semboyan Untung Surapati sebagai strategi perencanaan pembangunan Kabupaten Pasuruan. Serta mengetahui implementasi, kendala, dan upaya dalam pelaksanaan perencanaan pembangunan melalui semboyan Untung Surapati. Penelitian ini menggunakan model penelitian kualitatif deskriptif. Kehadiran peneliti sebagai human instrument. Sumber data diperoleh dari data primer (subjek penelitian) dan data sekunder (dokumen hard file dan soft file). Pengumpulan data dilakukan dengan menggunakan teknik wawancara dan dokumentasi. Tahap-tahap analisis data menggunakan 3 langkah yaitu reduksi data (data reduction), penyajian data (display data) dan penarikan kesimpulan atau verifikasi (conclusion drawing verification). Pengecekan keabsahan temuan yaitu melalui ketekunan pengamat melakukan pengamatan secara rinci dan teliti. Tahap-tahap penelitian yaitu tahap persiapan, tahap pelaksanaan dan tahap penyelesaian. Berdasarkan hasil penelitian, diperoleh 5 kesimpulan sebagai berikut. Pertama, Semboyan ini di tetapkan pada tanggal 25 juni 1988 dengan di keluarkannya SK No. 147 Tahun 1988 tentang penetapan semboyan Untung Surapati sebagai semboyan penggerak pembangunan Kabupaten Pasuruan. Kedua, makna semboyan Untung Surapati pada setiap kata dan kalimat mengandung makna dan maksud tersendiri. Makna kata Untung memiliki arti yaitu “Seluruh Potensi Masyarakat” dan selanjutnya makna kata Surapati memiliki arti yaitu “arah motivasi”. Ketiga, implementasinya semboyan Untung Surapati sebagai strategi perencanaan pembangunan Kabupaten Pasuruan yaitu melalui langkah-langka yang harus di tempuh potensi Untung dalam membangun Pasuruan yang aman, tertib dan indah (Surapati) berwawasan lingkungan. Keempat, kendala dalam pelaksanaan perencanaan pembangunan Kabupaten Pasuruan melalui semboyan Untung Surapati yaitu: Keterbatasan anggaran, kemampuan SDM dalam perencanaan belum optimal, belum optimalnya perencanaan pembangunan yang akurat sesuai kebutuhan dan waktu, keterbatasan daerah dalam mengakomodir aspirasi kebutuhan masyarakat dan adanya ego atau kepentingan antar sektor. Kelima, Upaya- upaya dalam mengatasi kendala pelaksanaan perencanaan pembangunan Kabupaten Pasuruan melalui semboyan Untung Surapati yaitu meningkatkan kecermatan tindakan (mana yang lebih penting harus dilakukan), peningkatan daya saing Sumberdaya Manusia melalui pendidikan yang berkwalitas, pengembangan kegiatan penelitian di lapangan, peningkatan pelayanan publik, menjalin komunikasi yang baik antar lini sektor.

Pengaruh citra perusahaan, nilai, pesaing dan faktor ekonomi terhadap keputusan pengguna jasa telekomunikasi pada PT.TELKOM (Studi kasus pada konsumen pengguna jasa telkom kandatel di kota malang kecamatan Blimbing) / Robertha pandu wijaya

 

ABSTRAK Pandu, Robertha. 2009. Pengaruh Citra Perusahaan, Nilai, Pesaing, dan Faktor Ekonomi Terhadap Keputusan Penggunaan Jasa Telekomunikasi pada PT. TELKOM (Studi Kasus pada Konsumen Pengguna Jasa Telkom Kandatel di Kota Malang Kecamatan Blimbing). Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (1): Drs. Agus Hermawan, M. Bus, M.Si, Pembimbing (II): Titis Shinta Dhewi, S. P, M.M. Kata Kunci: Citra Perusahaan, Nilai, Pesaing, Faktor Ekonomi, Keputusan Konsumen. Kota Malang merupakan salah satu bagian dari DIVRE V PT. TELKOM yaitu Divisi Regional yang terletak di Provinsi Jawa Timur. Kota Malang pada umumnya adalah kota penyangga dari Kota Surabaya, sekaligus sebagai kota terbesar kedua di Jawa Timur menjadikan kota pilihan utama dan pertama untuk ekspansi bisnis Telekomunikasi, hal tersebut ditunjang karena Kota Malang memiliki banyak potensi seperti Kota Pelajar, Kota Industri, Kota Perdaganagan, dan Kota Pariwisata dan dari sisi ekonomi memberikan peluang pertumbuhan cukup tinggi bagi berbagai operator Telekomunikasi. TELKOM merupakan salah satu BUMN yang sahamnya saat ini dimiliki oleh Pemerintah Indonesia (51,19%) dan oleh publik sebesar (48,81%). Sebagian besar kepemilikan saham publik (45,58%) dimiliki oleh investor asing, dan sisanya (3,32%) dimiliki oleh investor dalam negeri. Perusahaan ini bergerak di bidang jasa telekomunikasi dan wilayah daerah usahanya tersebar di seluruh Indonesia. TELKOM juga menjadi pemegang saham mayoritas di 9 anak perusahaan, termasuk PT. Telekomunikasi Seluler (Telkomsel). Usaha bisnis yang dilakukan oleh TELKOM diantaranya adalah Fixed Wireline (layanan telepon dengan jaringan kabel/POTS); Fixed Wireless (Flexi); Jasa Sambungan Langsung Internasional (SLI 007); serta Data dan Internet (Speedy). Untuk bisnis Fixed Wireline atau telepon rumah, sampai dengan saat ini TELKOM Malang masih menjadi pemain utama dalam layanan telepon tetap bebasis kabel. Kondisi ini bukan berarti TELKOM tidak punya pesaing, namun dengan semakin kreatifnya operator selular memainkan tarifnya, maka akan semakin dirasakan murah oleh pelanggan dan akibatnya akan semakin mudah pelanggan Fixed Phone pindah ke selular. Hal ini merupakan ancaman yang sangat potensial bagi PT. TELKOM. Sedangkan kebutuhan dan keinginan para konsumen terus berubah. Agar berhasil, para pemasar perlu bersungguh-sungguh berupaya untuk menentukan kebutuhan konsumen mereka sekarang. Perilaku konsumen menjadi dasar yang amat penting dalam pemasaran dan periklanan. Riset konstan terhadap Citra perusahaan, Nilai, Pesaing, dan Faktor Ekonomi akan faktor-faktor yang mempengaruhi perilaku pembelian sangatlah penting. Berdasarkan penjelasan diatas maka peneliti tertarik melakukan penelitian tentang Citra Perusahaan, Nilai, Pesaing, dan Faktor Ekonomi pada PT. TELKOM. Penelitian ini bertujuan untuk mengetahui pengaruh Citra Perusahaan (X1), Nilai (X2), Pesaing (X3), dan Faktor Ekonomi (X4) secara parsial maupun simultan terhadap Keputusan Konsumen. Dalam penelitian ini teknik pengambilan sampel peneliti menggunakan Rumus Slovin yang memasukkan unsur kelonggaran ketidaktelitian karena kesalahan pengambilan sampel yang masih dapat ditolerir. Yang dimana jumlah sampel yang diambil sebanyak 100 orang konsumen pengguna jasa telekomunikasi pada PT. TELKOM Kandatel Malang. Skala yang digunakan adalah Skala Likert dengan 5 (lima) opsi pilihan jawaban. Untuk menguji kelayakan instrumen digunakan uji validitas dan reliabilitas. Teknik pengumpulan data dalam penelitian ini menggunakan kuesioner, wawancara, dan observasi langsung. Penelitian ini menggunakan teknik analisis deskriptif dan analisis regresi linear berganda dengan menggunakan SPSS Versi 12.00. Berdasarkan hasil penelitian diketahui bahwa variabel Citra Perusahaan (X1), Nilai (X2), Pesaing (X3), dan Faktor Ekonomi(X4) secara parsial mempunyai pengaruh positif signifikan terhadap Keputusan Konsumen pengguna jasa telekomunikasi pada PT. TELKOM. Adanya pengaruh tersebut ditunjukkan dengan nilai signifikansi dari uji t dari masing-masing variabel < 0,05. Dimana nilai tersebut berturut-turut sebagai berikut: untuk Citra Perusahaan (X1) mempunyai nilai signifikansi 0,016, Nilai (X2) mempunyai nilai signifikansi 0,001, Pesaing (X3) mempunyai nilai signifikansi 0,508, dan Faktor Ekonomi (X4) mempunyai nilai signifikansi 0,009. Selain itu juga ditunjukkan dengan nilai t hitung untuk Citra Perusahaan = 2,457 > nilai t tabel = 1,67, nilai t hitung untuk Nilai = 3,344 > nilai t tabel = 1,67, nilai t hitung untuk Pesaing = 0,664 < nilai t tabel = 1,67 dan nilai t hitung untuk Faktor Ekonomi = 2,662 > nilai t tabel = 1,67. Secara simultan Citra Perusahaan (X1), Nilai (X2), Pesaing (X3), dan Faktor Ekonomi (X4) juga mempunyai pengaruh positif yang signifikan terhadap Keputusan Konsumen pengguna jasa telekomunikasi pada PT. TELKOM Kandatel Malang. Pengaruh tersebut ditunjukkan dengan nilai signifikansi F sebesar 0,000 ≤ 0,05 dan ditunjukkan oleh nilai F hitung = 16,255 > f tabel = 2,72. Selain itu diketahui pula bahwa nilai Adjusted R Square sebesar 0,381. Dapat diinterpretasikan bahwa variabel Citra Perusahaan, Nilai, Pesaing dan Faktor Ekonomi dalam mempengaruhi keputusan konsumen dalam menggunakan jasa telekomunikasi pada PT. TELKOM Kandatel Malang sebesar 38,1 % dan sisanya sebesar 61,9 % dipengaruhi oleh variabel-variabel lain di luar penelitian. Berdasarkan hasil penelitian ini, dapat disarankan kepada PT. TELKOM Kandatel Malang sebaiknya selalu meningkatkan atau mempertahankan Citra Perusahaan, Nilai, Pesaing, dan Faktor Ekonomi guna menarik konsumen, selain itu hendaknya PT. TELKOM Kandatel Malang juga memperhatikan pula faktor lain yang tidak dijelaskan dalam penelitian ini guna menarik konsumen. Selain itu juga disarankan kepada peneliti berikutnya Peneliti menyarankan dalam penelitian selanjutnya agar menggunakan variabel tanggapan emosional sebagai variabel bebasnya dan kepuasan atau keputusan konsumen sebagai variabel terikat.

Pemanfaatan Museum Sunan Drajat sebagai sumber belajar sejarah pada kelas XI IPS semester gasal di MA Ma'arif 7 Banjarwati Lamongan / Sri Lestari

 

Lestari, Sri. 2014. Pemanfaatan Museum Sunan Drajat sebagai Sumber Belajar Sejarah pada Kelas XI IPS Semester Gasal di MA Ma’arif 7 Banjarwati Lamongan. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing I: Drs. H. Kasimanuddin Ismain, M.Pd., Pembimbing II: Drs. Slamet Sujud Purnawan Jati, M.Hum Kata Kunci: pemanfaatan, Museum Sunan Drajat, sumber belajar     Museum Sunan Drajat merupakan tempat yang menyimpan benda-benda peninggalan Sunan Drajat. Melalui benda-benda koleksinya, Museum Sunan Drajat dapat memberikan informasi mengenai penyebaran Islam yang dilakukan oleh Sunan Drajat, pada saat ini kurangnya pemanfaatan terhadap situs sejarah khususnya Museum Sunan Drajat sebagai sumber belajar sejarah serta kajiannya. Selain itu Letak Museum Sunan Drajat yang dekat dengan MA Ma’arif 7 Banjarwati, membuat sekolah tersebut lebih efektif jika memanfaatkan Museum Sunan Drajat sebagai sumber belajar.     Penelitian ini dilaksanakan dengan tujuan untuk mengetahui potensi Museum Sunan Drajat sebagai sumber belajar sejarah kelas XI IPS 1 di MA Ma’arif 7 Banjarwati. Mengetahui pemanfaatan Museum Sunan Drajat sebagai sumber belajar sejarah kelas XI IPS J di MA Ma’arif 7 Banjarwati.     Penelitian ini menggunakan rancangan penelitian deskriptif, dengan menggunakan pendekatan kualitatif. Data penelitian berupa paparan dari pemandu Museum Sunan Drajat terkait dengan sejarah museum dan potensinya, dan paparan dari guru dan siswa kelas XI IPS J terkait dengan potensi dan pemanfaatan Museum Sunan Drajat. Teknik pengumpulan data menggunakan wawancara, observasi, dan dokumentasi. Instrumen yang digunakan dalam penelitian ini adalah peneliti (human instrument) serta instrumen penunjang yakni pedoman observasi, pedoman wawancara, dan lembar soal. Untuk menjaga keabsaan data, dilakukan dengan triangulasi data. Tahap penelitian dimulai dari persiapan penelitian, eksplorasi, dan penulisan.     Berdasarkan hasil analisis data tersebut, diperoleh dua simpulan hasil penelitian sebagai berikut. Pertama, potensi Museum Sunan Drajat sebagai sumber belajar sejarah. Potensi yang dimiliki Museum Sunan Drajat adalah benda-benda koleksi Museum Sunan Drajat yaitu koleksi geologika, biologika, etnografika, arkeologika, historika, numismatika, filologika, keramologika, dan seni rupa. Keadaan benda-benda koleksi yang masih baik sehingga masih layak digunakan sebagai sumber belajar. Selain itu, potensi lain yang dimiliki adalah ketersedian pemandu Museum Sunan Drajat sehingga sedikit banyak dapat memberikan informasi mengenai benda-benda koleksi Museum Sunan Drajat. Selain itu adanya keterkaitan atau relevansi mengenai materi kelas XI IPS dengan benda-benda koleksi Museum Sunan Drajat.     Kedua, proses pemanfaatan Museum Sunan Drajat sebagai sumber belajar sejarah yakni dengan mengajak siswa ke Museum Sunan Drajat, di sana guru memberikan penjelasan kemudian siswa mencari informasi untuk mengisi lembar soal yang diberikan. Metode pembelajaran yang diberikan adalah resource based learning. Hasil penelitian yang kedua yakni mengenai pemanfataan Museum Sunan Drajat sebagai sumber belajar sejarah kelas XI IPS J MA Ma’arif 7 menunjukkan hasil yang baik, dengan perolehan tingkat keberhasilan nilai aktivitas sebesar 79,6% dari tiga aspek yang diamati yakni kesiapan, perhatian, dan ketepatan. Sedangkan pada nilai kognitif yang diperoleh siswa dengan tingkat keberhasilan 79,50%. Hal ini menunjukkan bahwa pemanfaatan Museum Sunan Drajat berjalan dengan baik.     Faktor pendukung pembelajaran di Museum Sunan Drajat adalah kedekatan jarak antara Museum Sunan Drajat dengan MA Ma’arif 7 Banjarwati, serta koleksi benda-benda Museum Sunan Drajat yang relevan dengan materi kelas XI IPS. Faktor penghambat pembelajaran di Museum Sunan Drajat adalah kurangnya fokus dari siswa pada materi yang diberikan atau pengkondisian siswa. Kurangnya keterangan pada setiap benda, serta tidak tersedia buku-buku bacaan yang dapat menunjang pemahaman pengunjung dan tidak adanya promosi.

Penerapan model pembelajaran aktif tipe kartu arisan untuk meningkatkan minat dan hasil belajar siswa kelas XI IPS SMA Negeri 3 Malang / Fahreza Agustina Zuhri

 

Zuhri, Fahreza Agustina. 2014. Penerapan Model Pembelajaran Aktif Tipe Kartu Arisan untuk Meningkatkan Minat dan Hasil Belajar Sejarah Siswa Kelas XI IPS 1 SMAN 3 Malang. Skripsi. Jurusan Sejarah. Fakultas Ilmu Sosial. Universitas Negeri Malang. Pembimbing (I) Drs. Kasimanuddin Ismain M.Pd. Pembimbing., (II) Aditya Nugroho Widiadi S.Pd, M.Pd Kata Kunci: Model Kartu Arisan, Minat, Hasil Belajar, Sejarah SMA Negeri 3 Malang merupakan salah satu lembaga pendidikan menengah atas yang favorit di kota Malang, dimana sekolah ini dalam proses pembelajarannya telah menggunakan alat-alat teknologi canggih seperti Liquid Crystal Display (LCD) yang dapat membantu meningkatkan proses pembelajaran. Namun, proses pembelajaran sejarah yang ada di kelas XI IPS 1 SMAN 3 Malang masih kurang maksimal. Dari hasil observasi dan wawancara kepada guru dan siswa menunjukan permasalahan pembelajaran sejarah yang ada di kelas XI IPS 1 terletak pada minat belajar dan hasil belajar yang masih rendah. Untuk mengatasi permasalahan tersebut digunakan pembelajaran aktif tipe kartu arisan. Penelitian ini bertujuan untuk mengetahui seberapa besar pembelajaran aktif tipe kartu arisan dapat meningkatkan minat dan hasil belajar sejarah siswa kelas XI IPS 1 SMAN 3 Malang Tahun Pelajaran 2013/2014. Penelitian ini menggunakan metode Penelitian Tindakan Kelas kolaboratif dengan guru kelas yang dilakukan melalui dua siklus. Pada siklus I dilaksanakan 2 kali pertemuan dan siklus II 2 dilaksanakan 2 kali pertemuan. Teknik pengumpulan data yang digunakan adalah observasi, wawancara, dokumentasi, dan tes. Observasi dilakukan dengan tujuan mengamati aktivitas siswa sebelum dan sesudah penerapan model pembelajaran aktif tipe kartu arisan. Wawancara untuk memperoleh data mengenai segala permasalahan yang sedang diteliti oleh peneliti. Dokumentasi untuk mendokumentasikan data yang diperoleh oleh peneliti dan pendukung hasil penelitian. Sedangkan tes untuk menilai dan mengukur hasil belajar peserta didik setelah diterapkannya model pembelajaran kartu arisan. Hasil penelitian ini menunjukkan dengan diterapkannya model pembelajaran aktif kartu arisan di kelas XI IPS 1, minat dan hasil belajar siswa mengalami peningkatan. Terbukti dari hasil observasi minat siswa menunjukkan angka 77, 27 % pada siklus I, sedangkan pada siklus II mengalami kenaikan hingga 82%. Hasil belajar siswa juga mengalami kenaikan dibandingkan dibandingkan hasil nilai pra siklus yang hanya menunjukkan nilai 76,23 tentu saja nilai itu masih dibawah KKM SMAN 3 Malang yang mencapai nilai diatas 80. Namun, setelah adanya tindakan dengan penerapan kartu arisan ini, rata-rata hasil belajar siswa pada siklus I sebesar 81,41 dan mengalami peningkatan pada siklus II dengan nilai rata-rata sebesar 87. Saran peneliti setelah diterapkannya model pembelajaran aktif tipe kartu arisan ini bagi guru bidang studi sejarah SMAN 3 Malang agar dapat mempertimbangkan model kartu arisan ini sebagai suatu alternatif dalam memberikan variasi penyampaian materi di kelas.

Kinerja campuran aspal dengan bahan tambah styrofoam ditinjau dari parameter Marshall / Dita Yanuar Adi Nugroho

 

ABSTRAK Nugroho, Dita, YanuarAdi. 2016. KinerjaCampuranAspaldenganBahanTambah Styrofoam Ditinjau dari Parameter Marshall. Proyek Akhir,Jurusan Teknik Sipil, Fakultas Teknik, Program Studi D3 Teknik Sipil dan Bangunan,Universitas Negeri Malang. Pembimbing: Drs. Boedi Rahardjo, M.Pd., M.T Kata kunci:campuranaspal,bahan tambah, styrofoam, parameter Marshall Seiringberkembangnyajaman, semakinbanyakupaya yang dilakukanpadacampuranaspaldengantujuanmeningkatkankualitasaspalsebagaibahanpengikatuntuklapisanperkerasanlentur. Upaya-upaya yang dilakukandiantaranyadenganmenambahkanbahantambahkedalamcampuranaspal yang digunakan.Dalamtugasakhirinimenggunakanbahantambahdengancampuranstyrofoam. Tujuan dari penulisan laporantugasakhirini adalahuntukmengetahuikinerjacampuranaspaldenganbahantambahstyrofoamditinjaudari parameter Marshall. Dalampengujianiniperencanaancampuran yang digunakanadalahperencanaancampurannomor V. Benda uji dengan kadar aspal 4,5%;5%;5,5%;6%;6,5%;7% denganperbandinganterhadap berat total agregat sebanyak 3 buah untuk masing-masing kadar, kemudian didapatkan hasil Kadar Aspal Optimum (KAO). Kemudian dibuat buah benda uji dengan bahan tambah styrofoamdengankadarsebesar 1%;2%;3%;4%;5%; dan 6% terhadap berat aspalsebanyak 3 buah untuk masing-masing kadarpadakondisi KAO.Dalam proses pencampuranya, styrofoamdicampurkandiatasaspal yang dipanaskankemudiandiadukhinggatercampursecarakeseluruhan. Suhupemadatan yang digunakandalampengujianiniadalah 125°C. Hasil yang didapatdenganmenambahkanstyrofoammenunjukkan bahwa:penambahanstyrofoammeningkatkannilaistabilitas;penambahanstyrofoammenurunkannilaiflow;penambahanstyrofoammeningkatkannilaiMQ; nilaiVIM mengalamipeningkatandarikadar 1-4% kemudian di atas 4%mengalamipenurunan, nilai VIM belummemenuhispesifikasi; nilaiVMA mengalamipeningkatandarikadar 1-4% kemudian di atas 4%mengalamipenurunan; nilaiVFA mengalamipenurunandarikadar 1-4% kemudian di atas 4%mengalamipeningkatan.

Pengaruh pemanfaatan Situs Kendeng Lembu sebagai sumber belajar sejarah terhadap hasil belajar siswa kelas X SMA Negeri 1 Glenmore Kabupaten Banyuwangi / Agung Kurniawan

 

Kurniawan, Agung. 2014. Pengaruh Pemanfaatan Situs Kendeng Lembu sebagai Sumber Belajar Sejarah terhadap Hasil Belajar Siswa di Kelas X SMA Negeri 1 Glenmore Kabupaten Banyuwangi. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. Slamet Sujud Purnawan Jati, M.Hum., (II) Deny Yudo Wahyudi, S.Pd. M.Hum. Kata Kunci: sumber belajar, situs Kendeng Lembu, hasil belajar.     Sumber belajar merupakan salah satu komponen dalam sistem pembelajaran. Di Kecamatan Glenmore Kabupaten Banyuwangi terdapat Situs Kendeng Lembu yang perlu dilestarikan dan dikenalkan pada masyarakat. Situs Kendeng Lembu dapat dimanfaatkan sebagai sumber belajar. Situs Kendeng Lembu ini akan dimanfaatkan sebagai sumber belajar pada kelas X SMA Negeri 1 Glenmore. Pemanfaatan situs sebagai sumber belajar di kelas X SMA Negeri 1 Glenmore karena dekatnya situs dengan sekolah selain itu pemanfaatan Situs Kendeng Lembu ini relevan dengan materi dan tujuan pembelajaran.     Penelitian dilakukan dengan tujuan untuk mengetahui pembelajaran sejarah di kelas X SMA Negeri 1 Glenmore, mendeskripsikan pemanfaatan Situs Kendeng Lembu sebagai sumber belajar sejarah di kelas X SMA Negeri 1 Glenmore, serta menjelaskan pengaruh pemanfaatan Situs Kendeng Lembu sebagai sumber belajar sejarah terhadap hasil belajar siswa kelas X SMA Negeri 1 Glenmore.     Pada penelitian ini penulis menggunakan pendekatan kuantitatif dengan menggunakan metode eksperimen. Rancangan penelitian menggunakan desain group kontrol pretest posttest. Sampel dari penelitian ini adalah kelas X-8 sebagai kelas eksperimen dan kelas X-4 sebagai kelas kontrol. Kelas eksperimen memanfaatkan Situs Kendeng Lembu sebagai sumber belajar sedangkan kelas kontrol menggunakan LKS sebagai sumber belajar. Instrumen yang digunakan adalah pretest dan posttest. Sebelum instrumen diujikan terlebih dahulu dilakukan validitas, reliabilitas, tingkat kesukaran, dan daya pembeda. Sumber data dari penelitian ini adalah hasil dari pretest dan posttest. Setelah diperoleh data kemudian dilakukan analisis data menggunakan uji independent sample t-test.     Berdasarkan hasil analisis dapat diperoleh tiga kesimpulan yaitu sebagai berikut. Pertama, pembelajaran sejarah di kelas X SMA Negeri 1 Glenmore kurang variatif. Metode yang digunakan guru hanya terpaku pada ceramah dan tanya jawab saja. Sedangkan sumber belajar yang digunakan masih sebatas Lembar Kerja Siswa (LKS) dan jarang menggunakan buku sebagai sumber belajar. Media yang digunakan guru adalah peta konsep.     Kedua, bentuk pemanfaatan Situs Kendeng Lembu sebagai sumber belajar adalah dengan melakukan kunjungan situs. Siswa diajak langsung melihat benda-benda peninggalan zaman neolitik yang ada di Situs Kendeng Lembu dan tugas siswa selama di situs adalah menganalisis dan mengamati situs tersebut. Dekatnya situs dengan sekolah dapat menghemat biaya selain itu Situs Kendeng Lembu relevan dengan materi dan tujuan pembelajaran. Tetapi, kunjungan situs sebaiknya dilakukan di luar jam sekolah agar tidak terbentur waktu dan siswa akan mendapatkan informasi lebih banyak.     Ketiga, Pemanfaatan Situs Kendeng Lembu sebagai sumber belajar berpengaruh terhadap hasil belajar siswa kelas X SMA Negeri 1 Glenmore. Hal ini terbukti dari perbedaan rata-rata gainscore kelas eksperimen dan kelas kontrol yang cukup signifikan yaitu rata-rata gainscore kelas eksperimen adalah 38,00 dan gainscore kelas kontrol 31,67. Terjadi peningkatan yang signifikan pada hasil belajar kelas eksperimen sebesar 80.85%.     

Pertidaksamaan kuadrat di sekolah lanjutan tingkat pertama / oleh Wiwik Suciati

 

Motif arsitektur candi Jabung di desa Jabung kecamatan Paiton Kabupaten Probolinggo / oleh Eny Suprapti

 

Hubungan antara gaya kepemimpinan kepala sekolah, kecerdasan emosional guru dan motivasi kerja guru dengan profesionalisme guru sekolah dasar negeri se Kecamatan Purwakarta Kota Cilegon / Nur Cahyani

 

ABSTRAK Cahyani, Nur. 2016. Hubungan antara Gaya Kepemimpinan Kepala Sekolah, Kecerdasan Emosional Guru dan Motivasi Kerja Guru dengan Profesionalisme Guru SD Negeri Se Kecamatan Purwakarta Kota Cilegon. Tesis. Program Studi Manajemen Pendidikan, Pascasarjana Universitas Negeri Malang.Pembimbing : (I) Prof.H.A.Sonhadji K.H. , M.A., Ph.D ; (II) Dr. H. ImronArifin, M.Pd Kata kunci :gaya kepemimpinan kepala sekolah, kecerdasan emosional guru, motivasi kerja guru, profesionalisme guru. Profesi atau profesionalisme juga dapat kita artikan sebagai pandangan yang menganggap bidang pekerjaan sebagai suatu pengabdian melalui keahlian khusus yang diperoleh melaui pendidikan tertentu dan menganggap keahlian itu sebagai suatu yang harus diperbaharui dan dikembangkan secara kontinyu dengan memanfaatkan kemajuan-kemajuan yang ada. Guru dalam konteks pendidik dalam pencerdasan kehidupan bangsa, harus memiliki semangat profesionalisme dan kepribadian yang utuh. Kepribadian guru yang utuh dan berkualitas sangat penting, karena dari sini muncul tanggungjawab professional sekaligus menjadi inti kekuatan professional dan kesiapan untuk selalu mengembangkan diri. Seorang guru juga harus jeli melihat peluang untuk mengembangkan potensi anak didik, karena kejelian itu merupakan ciri kepribadian yang profesional. Penelitian ini bertujuan untuk (1) mengetahui gambaran umum: (a) gaya kepemimpinan kepala sekolah, (b) kecerdasan emosional guru, (c) motivasi kerja guru dan (d) profesionalisme guru (2) mengetahui hubungan (a) gaya kepemimpinan kepala sekolah dan kecerdasan emosional guru dengan motivasi kerja guru, (b) gaya kepemimpinan kepala sekolah dengan motivasi kerja, (c) kecerdasan emosional guru dengan motivasi kerja guru, (d) gaya kepemimpinan kepala sekolah, kecerdasan emosional guru dan motivasi kerja guru dengan profesionalisme,(e)gaya kepemimpinan kepala sekolah dengan profesionalisme guru,(f)kecerdasan emosional guru dengan profesionalisme guru, dan(g)motivasi kerja guru dengan profesionalisme guru SD Negeri se Kecamatan Purwakarta Kota Cilegon. Penelitian ini didasarkan pada model desain survey deskriptif yang bersifat korelasional, menggunakan pendekatan kuantitatif dengan menggunakan analisis jalur (path analysis). Subyek yang dijadikan populasi adalah para guru SD Negeri Se Kecamatan Purwakarta Kota Cilegon yang berjumlah 152 orang. Dari populasi tersebut kemudian ditentukan sampel sebanyak 80 orang dengan cara cluster proporsional random sampling. Pengumpulan data dilakukan dengan menggunakan angket, selanjutnya data yang terkumpul dianalisis dengan teknik analisis deskriptif dan teknik analisis jalur. Hasil analisis juga menunjukkan bahwa : (1) Gaya kepemimpinan kepala sekolah termasuk dalam kategori tinggi dan berorientasi kepada hubungan manusia (2) Kecerdasan emosional guru termasuk dalam kategori tinggi (3) Motivasi kerja guru termasuk dalam kategori tinggi (4) Profesionalisme guru termasuk dalam kategori tinggi (5) Gaya kepemimpinan kepala sekolah dan kecerdasan emosional guru secara simultan berhubungan signifikan terhadap motivasi kerja (6) Gaya kepemimpinan kepala sekolah berhubungan signifikan terhadap motivasi kerja guru (7) Kecerdasan emosional guru berhubungan signifikan terhadap motivasi kerja guru (8) Gaya kepemimpinan kepala sekolah, kecerdasan emosional guru dan motivasi kerja guru secara simultan berhubungan signifikan terhadap profesionalisme guru (9) Gaya kepemimpinan kepala sekolah tidak berhubungan signifikan terhadap profesionalisme guru (10) Kecerdasan emosional guru berhubungan signifikan terhadap profesionalisme guru (11) Motivasikerja guru berpengaruh signifikan terhadap profesionalisme guru. Berdasarkan temuan dan pembahasan hasil penelitian dikemukakan beberapa saran : (1) Pemerintah Kota Cilegon melalui dinas pendidikan dan sumberdaya manusia yang relevan dapat melakukan kegiatan penelitian mengenai hal-hal yang dapat memicu motivasi dan juga demotivasi PNS guru SD Negeri di kecamatan Purwakarta Kota Cilegon (secara sempit) ataupun keseluruhan PNS guru di Kota Cilegon (secara luas) dalam rangka untuk meningkatkan motivasi kerja mereka sehingga dimungkinkan dapat berkontribusi pada meningkatnya profesionalisme mereka (2) Bagi kepala sekolah, hasil penelitian ini hendaknya dijadikan bahan informasi yang berguna terkait dengan profesionalisme guru dengan menciptakan peran kepemimpinan kepala sekolah yang menyenangkan agar guru termotivasi dan berdampak pada meningkatnya profesionalisme yang dimilikinya (3) Bagi guru perlu diperhatikan hal-hal yang memberikan kontribusi terhadap peningkatan kinerja guru dalam hal ini profesionalisme guru dan kepala sekolah harus dapat menentukan strategi yang efektif dan apabila terjadi penurunan kualitas profesionalisme guru dapat mengidentifikasi penyebabnya. (4) Bagi peneliti sebagai pertimbangan rujukan penelitian yang relevan dan supaya selanjutnya penelitian ini dapat dikembangkan lebih dalam lagi.

Analisis kandungan protein pada biji mete (Anacardium occidentale L.) / oleh Norma Gardini

 

Pohonja rnbu mete( Anacardiumo ccidentaleL .) tinggi 7-12 m danb ercabang, buahnytae rdiri dari buahs emud anb uahs ejati.B uahs ejatij ambu metem engandung proteind an lemak. Penelitiani ni bertujuanu ntuk mengetahuki adark andunganp rotein buahm etek ultivar Lokal danS rilangkay angb erumur2 ,5 buland an 1,5b ulan. Buah mete yang digunakan dalam penelitian ini diperoleh dari perkebunan NgadirejoW, onogiri,J awaT engahp adab ulanA gustus-September. Penelitian dilakukan di laboratorium Biologi dan laboratorium Kimia FMIPA universitasN egeriM alang,p adab ulanA pril-Mei 2000d enganp erlakuanu murd an kultivar.U mur yangd igunakan2 ,5 buland anu mur 1,5b ulanm eliputik ultivarL okal danS rilangkas etiapk ombinaspi erlakuand iulang4 kali. Jenisp enelitiany ang dilakukana dalahe ksperimenD. ata kandungann itrogen( %) diperolehd enganc ara metodeM ikrokjeldahl.A nalisisd atam enggunakaann alisisv ariang andad uad engan tarafs ignifikans5i % danb ila sigrrifikand ilanjutkand enganU ji BNT. Hasil penelitianm enunjukkank andunganp rotein buah metek ultivar Lokal diperolehn ilai rerata5 ,02%S ritangkad iperolehn ilai rerata3 ,86o/o,umu2r, 5b ulan diperolehn ilai rerata4 ,77Vod, anu mur 1,5b uland iperolehn ilai rerata4 '11%. Sedangkakno rnbinasai ntarau murd ank ultivar diperolehn ilai rerata4 ,44%.Dari seluruhk andunganp roteint ersebudt iperolehn ilai reratal ebih rendahd ari yang seharusnyyaa itu antara1 9%s ampadi engan2 1o/oo, lehk arenait u kandunganp rotein ini tidakm emenuhDi aftarK omposisiB ahanM akanan

Aplikasi teorema Hamilton Caeley terhadap matriks dan invers matriks yang dipangkatkan
oleh Siti Ambarwati

 

dasarnyaS kipsi ini membahaste ntangp erhitunganm atiks dan lly:t:-1gi:_ITq $p*++an.denganm enggunaTkeaonr emHaa miltoCna eley. pMpeelsrrkpaaa.rn kliaagrnkmM aytaaatannm d kaaslt alr itkrbp seey rraokiartudli oa: 4A n.a 5I+n : atAaur2qa. Am d ziata.tArni: ky sAa dk.Aaenn.,A g4.arA mnm. Aaak,d atril k ts si.nd sia teepdaraltid hniagcktab arain dkh aewlnaagu baencn aturak menggunakanT eoremaH amilton caeley untuk mlncari ,et diperolei'benruk prkaltannya berubah menjadi perkalian skalar dengan matriki, yaitu : Al: (a1A3+ ar42* a3A+- a1!) .. : f lj-a* klmudiank eduar uasp ersamaan(l) dPieksaalimkaana dn(le ) ndgiapneAros,l eehhd inagrig A.pal.idkaiprsoeil eThe: o 4r5e m: a-H (oaAmuil to* no CrAaet l,e v;V. .- iA I "_-,,._- -^,1_"_.ara DuJursangtamr ereukpsapklaisnai tTk aero draermi paHo lainmoimlto knaC raalCeelenyms tieknnyyaat.akabna hwat iap matriks Teorema ini memuat hubungan antara matriks dengan polinom karakteristik, bentuk umump olinomk arakteristika dalah: p(1) = b, ff + b,_,if -r + ....+ b/ , + bo . Ilka P(2) adalah polinom karakteristik dalam ), dan jika ,t bisa diganti dengan r maka polinom P(2) rnenjadip (l). Bila p(A) :0 , makaI adalaha karO ari. p(,a)u ntut 1= A. Iadi terbuktiT eoremaH amiltonC aelev. I1l

Pengaruh penerapan model pembelajaran snowball throwing terhadap motivasi belajar geografi siswa kelas XI SMA Negeri 2 Batu / Fiqih Ainal Farah

 

ABSTRAK Farah, Fiqih Ainal. 2016. Pengaruh Penerapan Model Pembelajaran Snowball Throwing Terhadap Motivasi Belajar Geografi Siswa Kelas XI SMA Negeri 2 Batu. Skripsi, Program Studi Pendidikan Geografi, Jurusan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) Drs. Yusuf Suharto, M.Pd, (II) Drs. Mustofa, M.Pd. Kata kunci:PembelajaranSnowball Throwing, Motivasi Belajar Salah satu model pembelajaran kooperatif yang dapat meningkatkan motivasi belajar siswa yaitu model pembelajaran Snowball Throwing. Kelebihan model pembelajaran Snowball Throwing yakni dapat melatih kesiapan dalam merumuskan pertanyaan, membuat siswa lebih tertarik dengan adanya permainan, dapat melatih menyampaikan gagasan, mengajari makna kerjasama dan tanggungjawab, serta siswa akan termotivasi meningkatkan kemampuannya. Model pembelajaran Snowball Throwing dieksperimenkan kepada siswa diharapkan dapat meningkatkan motivasi belajar geografi siswa, dilihat dari aspek motivasi yaitu aspek perhatian, relevansi, percaya diri, dan kepuasan. Tujuan penelitian ini untuk mengetahui adanya pengaruh penerapan model pembelajaran Snowball Throwing terhadap motivasi belajar geografi siswa kelas XI SMA Negeri 2 Batu, pada kompetensi dasar Kearifan dalam Pemanfaatan Sumber Daya Alam Berkelanjutan. Penelitian ini merupakan penelitian eksperimen semu (quasi experiment) dengan menggunakan desain non equivalent (pretest dan post test)control-gorup. Subjek yang diteliti adalah kelas XI IIS 2 sebagai kelas eksperimen dan kelas XI IIS 3 sebagai kelas kontrol. Data motivasi diperoleh dari angket yang diberikan kepada siswa sebelum dan sesudah perlakuan. Data yang diuji dalam penelitian ini yaitu gain score motivasi belajar siswa dan dianalisis menggunakan independent sample t-test dengan bantuan SPSS 16.0 for Windows. Hasil penelitian menunjukkan bahwa model pembelajaran Snowball Throwing berpengaruh signifikan terhadap motivasi belajar geografi siswa kelas XI SMA Negeri 2 Batu. Hal tersebut dapat dibuktikan darihasil uji hipotesis penelitian, dengan nilai rata-rata kelas eksperimen lebih tinggi sebesar 81,5 dibanding kelas kontrol yakni 77, maka H0 ditolak.

Using comic strips to improve the VII grade students' skill of writing a descriptive paragraph in SMP Negeri 10 Malang / Khoharudin Nugroho Aji

 

Kata Kunci: comic strips, kemampuan menulis siswa, paragraf descriptif Menulis adalah sebuah kemampuan yang harus dikuasai siswa. Paragraf deskriptif adalah salah satu dari lima gaya penulisan yang diajarkan dalam proses pengajaran dan pembelajaran menulis bagi siswa kelas VII Sekolah Menengah Pertama (SMP). Penelitian ini telah dilaksanakan di SMP Negeri 10 Malang. Di sekolah tersebut, banyak siswa kelas VII yang memiliki masalah dalam menulis sebuah paragraf terutama deskriptif. Ketika mereka diminta untuk menyusun sebuah paragraf deskriptif tentang satu tempat umum, nilai hasil tulisan mereka di bawah KKM (Kriteria Ketuntasan Minimal) berdasarkan isi, penggunaan bahasa, dan pengaturan. Berdasarkan daftar pertanyaan dan diskusi dengan guru kelas, hal tersebut terjadi dikarenakan kegiatan pengajaran dan pembelajaran yang dilaksanakan kurang begitu menarik bagi siswa dan kurang berfariasi. Peneliti bermaksud untuk menemukan solusi masalah tersebut dengan menggunakan Comic Strips dalam proses pengajaran dan pembelajaran. Peneliti yakin bahwa Comic Strips dapat efektif karena dapat membuat siswa menikmati proses pengajaran dan pembelajaran. Comic Strips juga memiliki beberapa kegunaan lain untuk membantu siswa meningkatkan kemampuannya dalam menulis sebuah paragraf deskriptif dan membantu guru dalam mengajar supaya efektif. Comic Strips ini terdiri dari beberapa gambar yang menarik dan lucu yang dapat membantu siswa menemukan ide dalam proses menulis khususnya paragraf deskriptif. Bagian-bagian dari Comic Strips telah disusun sesuai urutan untuk membantu siswa dalam mengatur paragraf mereka. Setiap bagian dari Comik Strips memberi informasi yang rinci tentang gambaran sebuah tempat dan situasinya. Terdapat beberapa kata kunci dalam kalimat yang belum lengkap pada Comic Strips tersebut yang dapat membantu siswa memfariasi kata-kata yang digunakan dalam menulis sebuah paragraf deskriptif. Comic Strips tersebut juga dapat digunakan oleh guru untuk mengarahkan siswa selama proses pengajaran dan pembelajaran menulis. Comic Strips memiliki beberapa ciri khas yang hamper sama dengan picture sequence. Menurut Brown (2004:226) “picture sequence dapat memberikan sebuah rangsangan yang pas untuk menghasilkan tulisan”. Model penelitian yang digunakan dalam penelitian ini adalah PTK (Penelitian Tindakan Kelas) Kolaborasi. Penelitian ini dilaksanakan dalam dua kali putaran. Setiap putaran terdiri dari empat tahap, yaitu, perencanaan, pelaksanaan, pengamatan, dan pencerminan. Hasil pengamatan dalam penelitian ini dianalisa berdasarkan proses dan hasil karya. Berdasarkan proses, hasil pengamatan diperoleh dari menganalisa daftar pengamatan kegiatan siswa dan guru, catatan lapangan, daftar pertanyaan untuk siswa, dan wawancara dengan guru kelas dan siswa. Berdasarkan proses, hasil pengamatan diperoleh dari menganalisa nilai hasil tulisan siswa. Dilihat dari prosesnya, hasil pengamatan menunjukkan bahwa Comic Strips dapat membantu siswa dalam menemukan ide menulis. Beberapa kata kunci pada kalimat-kalimat yang belum lengkap membantu siswa dalam memfariasi kata-kata yang digunakan dan menyusun tata bahasa kalimat. Comic Strips juga memiliki gambar-gambar berwarna-warni yang dapat membuat siswa menikmati proses pengajaran dan pembelajaran. Gambar-gambar bentuk nyata yang ditunjukkan tersebut memberi siswa inspirasi untuk menemukan dan menyusun ide mereka. Berdasarkan bagian-bagian dari Comic Strips, siswa dapat memetak-metakkan apa yang ingin ditulis dalam susunan sebuah paragraf. Guru juga dapat menggunakan Comic Strips tersebut untuk membimbing siswa mengembangkan ide dalam tulisannya dengan cara memberi beberapa pertanyaan. Comic Strips tersebut berguna sekali untuk membuat siswa aktif dan kreatif dalam belajar menulis. Dalam hasil karya, peneliti menemukan bahwa jumlah keseluruhan hasil karya siswa yang mendapatkan nilai di atas 75 (KKM) dihitung dalam bentuk persentase meningkat pada setiap putaran penelitian. Lebih dari 50% siswa memperoleh nilai lebih tinggi dari KKM (75). Nilai rata-rata hasil karya siswa pada putaran ke 2 adalah 79,55. Itu berarti nilai kemampuan keseluruhan siswa telah lebih dari KKM. Dapat disimpulkan bahwa Comic Strips dapat meningkatkan kemampuan siswa dalam menulis sebuah paragraf deskriptif. Berdasarkan hasil penelitian ini, peneliti merekomendasikan kegunaan Comic Strips dalam proses pengajaran dan pembelajaran menulis sebuah paragraf deskriptif. Para peneliti selanjutnya disarankan untuk meneliti lebih lanjut kegunaan Comic Strips pada kelas yang berbeda, tingkat pendidikan yang berbeda, dan/atau jenis paragraf yang berbeda

Penerapan pembelajaran tematik untuk meningkatkan hasil belajar Calistung kelas 2 SD Negeri Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro / Hevyana Dewi

 

Kata Kunci: Pembelajaran tematik, hasil belajar membaca, menulis, menghitung (calistung) siswa. Hasil wawancara dan observasi di kelas 2 SDN Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro menunjukkan bahwa hasil belajar calistung siswa masih rendah. Hal ini terlihat dari hasil belajar siswa Pra Tindakan, dari 35 siswa yaitu terdapat 18 siswa atau sebesar 51% yang sudah mencapai ketuntasan belajar, dan terdapat 17 siswa atau sebesar 49% yang belum mencapai ketuntasan belajar dan rata-rata hasil belajar siswa 65. Kurangnya kemampuan membaca menulis dan berhitung pada siswa sehingga hasil belajar siswa rendah.Tujuan penelitian ini mendeskripsikan penerapan pembelajaran tematik dalam meningkatkan hasil belajar calistung siswa kelas 2 SDN Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam dua siklus. Satu siklus terdiri dari dua kali pertemuan. Masing-masing pertemuan terdiri dari pertemuan pertama 2 jam pelajaran, pertemuan kedua 2 jam pelajaran dengan alokasi waktu 1 jam pelajaran selama 35 menit. Teknik pengumpulan data yang digunakan dalam penelitian adalah: (1) Observasi (2) Tes (3) Format catatan lapangan (4) Dokumentasi. Subyek penelitian adalah siswa kelas 2 SDN Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro sejumlah 35 siswa. Materi yang diajarkan adalah materi semester 2 dengan tema ” Lingkungan” yang dibuat dari berbagai perpaduan mata pelajaran diantaranya B. Indonesia, IPA, Matematika, IPS, dan SBK. Hasil dari penelitian ini menunjukkan bahwa penerapan pembelajaran tematik dapat meningkatkan hasil belajar calistung siswa. Dibuktikan dengan peningkatan rata-rata nilai hasil belajar siswa pada Siklus 1 sebesar 70 dan meningkat pada Siklus 2 menjadi 77. Persentase pelaksanaan pembelajaran calistung di dalam kelas juga mengalami peningkatan, persentase aktivitas membaca siswa pada siklus 1 sebesar 72%, sedangkan pada siklus 2 meningkat menjadi 78%. Persentase aktivitas menulis pada siklus 1 sebesar 65%, sedangkan pada siklus 2 meningkat menjadi 82%.. Sedangkan aktivitas berhitung pada siklus 1 sebesar 68%, sedangkan pada siklus 2 meningkat menjadi 81%. Adapun saran yang dapat diberikan yaitu Bagi guru yang akan menerapkan pembelajaran pembelajaran tematik sebaiknya mempersiapkan hal-hal yang dibutuhkan secara matang sebelum memulai pelaksanaan pembelajaran seperti menyiapkan RPP dan media pembelajaran yang akan digunakan, guru sebaiknya juga lebih komunikatif dengan siswa dan menggunakan metode yang lebih bervariasi agar siswa tidak bosan

Program Siswa Asuh Sebaya (SAS) sebagai penunjang wsajib belajar 12 tahun di SMP Negeri 2 Srono Kabupaten Banyuwangi / Dyah Retno Galuh Syafitri

 

ABSTRAK Syafitri, Dyah Retno Galuh. 2015. Program Siswa Asuh Sebaya Sebagai Penunjang Wajib Belajar 12 Tahun di SMPN 2 Srono Kabupaten Banyuwangi. Skripsi, Jurusan Hukum dan Kewaganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. M. Yudhi Batubara, SH, MH, (II) Dra. Arbaiyah Prantiasih, M.Si. Kata Kunci: pendidikan Indonesia, wajib belajar 12 tahun, pendidikan di Banyuwangi, siswa asuh sebaya, Pendidikan merupakan hal mendasar yang saat ini menjadi permasalahan yang sangat kompleks. Jika kita melihat di sekeliling kita, masih banyak terlihat anak-anak yang tidak dapat menikmati sekolah, bahkan menghabiskan waktunya dijalanan. Seharusnya anak-anak itu dapat menikmati masa kecilnya untuk bermain bersama teman-teman sebayanya. Terkadang miris melihat pembangunan Indonesia yang cukup pesat, namun masih banyak pula penduduknya yang tidak dapat mengenyam pendidikan yang layak. Indonesia tidak akan maju jika anak-anak Indonesia tidak memperoleh haknya untuk mendapatkan pendidikan yang layak. Masalah pendidikan di Indonesia ini jika dilihat lebih jauh lagi merupakan masalah yang sangat rumit. Faktor kemiskinan menjadi salah satu penyebab tingginya anak putus sekolah di Indonesia. Keadaan ekonomi Indonesia yang semakin terpuruk berdampak pula pada pendidikan di Indonesia. Banyak sekali anak yang tidak dapat mengenyam pendidikan karena biaya pendidikan yang mahal. Kurang meratanya pendidikan juga di rasakan masyarakat Banyuwangi. Banyaknya angka putus sekolah terjadi di berbagai daerah di kabupaten Banyuwangi melatar belakangi munculnya program Siswa Asuh Sebaya (SAS). Program ini merupakan program yang bertujuan untuk membantu anak-anak Kabupaten Banyuwangi yang kurang mampu dengan cara para siswa menggalang dana secara sukarela untuk membantu biaya pendidikan temannya yang kurang mampu. Dana tersebut di kelola oleh sekolah masing masing dengan memberikan laporan kepada dinas pendidikan setiap tiga bulan sekali, hal ini merupakan upaya pemerintah untuk merealisasikan program wajib belajar 12 tahun di Kabupaten Banyuwangi. Penelitian ini bertujuan untuk mendiskripsikan (1) program Siswa Asuh Sebaya sebagai penunjang wajib belajar 12 tahun yang di terapkan di SMP Negeri 2 Srono Kabupaten Banyuwangi; (2) pelaksanaan program Siswa Asuh Sebaya sebagai penunjang wajib belajar 12 tahun di SMP Negeri 2 Srono; (3) kendala yang dihadapi pada pelaksanaan program Siswa Asuh Sebaya yang di terapkan di SMP Negeri 2 Srono; (4) upaya yang dilakukan pihak sekolah untuk mengatasi kendala yang dihadapi pada pelaksanaan program Siswa Asuh Sebaya di SMP Negeri 2 Srono. Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian yang digunakan adala deskriptif. Sumber data penelitian yaitu orang, peristiwa, dan dokumen. Penelitian dilakukan di SMP Negeri 2 Srono Kabupaten Banyuwangi yang berlokasi di Jalan Raya Sumbersari No 23 Kecamatan Srono Kabupaten Banyuwangi. Teknik pengumpulan data yang digunakan adalah observasi, wawancara, dan dokumentasi. Teknik analisis data yang digunakan adalah reduksi data, penyajian data, penarikan kesimpulan, verifikasi. Dari penelitian tersebut dapat disimpulkan sebagai berikut: pertama, program yang dapat menunjang wajib belajar 12 tahun di SMP Negeri 2 Srono antara lain, (a) Program Siswa Asuh Sebaya, (b) Program Bantuan Beasiswa Siswa Miskin, (c) Program Orang Tua Asuh. Kedua, pelaksanaan program penunjang wajib belajar 12 tahun di SMP Negeri 2 Srono, (a) program SAS dilaksanakan dan dikelola oleh masing-masing sekolah penerima ditentukan dari pihak sekolah dengan mensurvey langsung ke rumah siswa, (b) program Bantuan Beasiswa Siswa Miskin (BSM) merupakan program bantuan dari pemerintah pusat yang diberikan kepada keluarga miskin, penerima ditentukan dari desa, sekolah langsung menerima nama-nama siswa yang terdaftar sebagai penerima bantuan BSM, (c) program Orang Tua Asuh dilaksanakan oleh guru-guru SMP Negeri 2 Srono sebagai rasa empati kepada siswa miskin, bantuan ini bersifat suka rela tanpa paksaan dari pihak sekolah. Ketiga, kendala-kendala yang ditemui saat pelaksanaan program adalah (a) pencapaian dana SAS tidak selalu mencapai target, (b) kurangnya sosialisasi program SAS, (c) kurang tepatnya sasaran penerima bantuan, (d) jumlah besaran dana yang kurang memadahi, (e) penyalahgunaan penggunaan dana, (f) dana yang turun tidak tepat waktu, (g) kurangnya rasa kepedulian. Keempat, upaya yang dilakukan pihak SMP Negeri 2 Srono dalam mengatasi kendala adalah (a) penggalangan dana dilakukan sebelum waktu istirahat, (b) melakukan sosialisasi kepada seluruh siswa SMP Negeri 2 Srono, (c) melakukan survey langsung kepada keluarga siswa, (d) memfasilitasi siswa dengan memberikan buku tabungan dan menyimpankan uang siswa, (e) memberikan pemahaman kepada walimurid agar dana digunakan dengan semestinya, (f) memaksimalkan peran orang tua untuk ikut berpartisipasi dalam pendanaan siswa. Berdasarkan hasil penelitian tersebut disarankan (1) Masyarakat Banyuwangi seharusnya lebih mendukung program wajib belajar 12 tahun di Kabupaten Banyuwangi dengan menyekolahkan anak-anaknya hingga jenjang yang lebih tinggi karena pemerintah telah melakukan berbagai upaya demi kesejahteraan masyarakat di bidang pendidikan, seperti memberikan berbagai bantuan untuk biaya pendidikan keluarga yang kurang mampu, (2) Pemerintah pusat maupun Pemerintah Kabupaten Banyuwangi sebaiknya tidak hanya berhenti sampai disini saja, masih banyak yang harus di perbaiki terkait dengan pendidikan di Indonesia, (3) Seluruh warga SMP Negeri 2 Srono sebaiknya lebih meningkatkan kesadaran untuk membantu sesamanya, dan lebih antusias lagi untuk melaksanakan program penunjang wajib belajar 12 tahun demi kesejahteraan bersama.

Hubungan antara karakteristik keluarga dan status gizi batita di Dusun Landangan Kabupaten Probolinggo / Furqoni Syahfitri

 

Syahfitri, Furqoni. 2014. Hubungan Antara Karakteristik Keluarga dan Status Gizi Batita di Dusun Landangan Kabupaten Probolinggo. Skripsi. Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Dra. Mazarina Devi, M.Si. (II) Aisyah Larasati, ST., MT., MIM., Ph. D. Kata Kunci: Karakteristik Keluarga, Status Gizi, Batita     Masalah stunting (status gizi pendek berdasarkan indeks panjang badan menurut umur atau tinggi badan menurut umur) masih menjadi masalah nasional. Hasil Riset Kesehatan Dasar (Riskesdas) menunjukkan bahwa prevalensi balita menurut indeks TB/U (Tinggi Badan menurut Usia) mencapai 35,6%. Hal ini menunjukan masalah prevalensi balita pendek di Indonesia cukup serius.     Tujuan penelitian ini yaitu mengidentifikasi karakteristik keluarga batita Dusun Landangan Kabupaten Probolinggo, mempelajari status gizi batita Dusun Landangan Kabupaten Probolinggo, dan mengkaji hubungan antara karakteristik keluarga batita dan status gizi batita Dusun Landangan Kabupaten Probolinggo. Penelitian ini menggunakan survey analitik dengan rancangan penelitian cross sectional. Populasi dalam penelitian ini adalah 102 batita. Sampel penelitian adalah sampel jenuh, yaitu 102 batita di Dusun Landangan Kabupaten Probolinggo. Pengumpulan data dilakukan dengan menggunakan kuesioner dan observasi. Uji yang digunakan untuk menguji hipotesis hubungan antara variabel penelitian adalah uji crosstabs dengan derajat kepercayaan 95%.     Hasil penelitian menunjukkan bahwa status gizi batita di Dusun Landangan beragam. Status gizi berdasarkan tinggi badan menurut usia dengan kategori sangat pendek sejumlah 7 batita (6,86%). Status gizi berdasarkan tinggi badan menurut usia dengan kategori pendek sejumlah 20 batita (19,61%). Status gizi berdasarkan tinggi badan menurut usia dengan kategori normal sejumlah 69 batita (67,65%). Status gizi berdasarkan tinggi badan menurut usia dengan kategori tinggi sejumlah 6 batita (5,88%). Sesuai dengan analisis data, dapat diketahui bahwa pendidikan ayah batita, pekerjaan keluarga dan pendapatan keluarga batita mempunyai hubungan yang signifikan terhadap status gizi batita. Karakteristik keluarga batita yang meliputi usia orang tua batita, besar keluarga batita dan pendidikan ibu batita tidak memiliki hubungan yang signifikan terhadap status gizi batita.

Perspektif proses internal bisnis sebagai alternatif pengukuran kinerja pada perusahaan industri Sandang Nusantara Unit Lawang
oleh Novi Kurniawati

 

Padap ersaingana bad rnibrmasr ini perusahaanm enghadapil ingkungan bisnrs yang kompetitif dan turbulen, sehingga menjadikan masa depan sangat kompleks dan sulituntukd iprediksid engant epat.U ntuk mengantisipaskie adaanli ngkunganb isnis yangd emikian,p erusahaanm embutuhkans uatu alat pengukuranb aru yang sifatnya nonk euangany ang dapatm enunjangk eberhasilanp erusahaand i masay ang akan datangm, isalnyam elalui pendekatanh alanceds corecard yang di dalamnyam eliputt perspektifprosesin ternal bisnis, perspeklif customcr sertap erspektifpembelajaran danp ertumbuhanP.e nelitiani ni difokuskanp adap erspektifprosesin ternalb isnis. Dalamp erspektifi ni manajerb erusaham engidentifikasi proses-prosesp enting untuk mencapatiu juan perusahaany ang ada dalam perspektifczst()mermaupunk euangan. Tujuand arip enelitianin i adalah:( 1) untuk mengetahubi agaimanakaphe ngukuran dan tolok ukur kinerla yang digunakan proses intemal bisnis, (2) untuk mengetahui tingkatk eberhasiland an kinerja perusahaand alam mengelola sumberd aya yang dimiliki ditinjaud ari perspektifp rosesi nternalb i snis. Metode penelitian yang digunakan adalah metode deskriptif analisis yaitu metode penelitian dengan cara menggambarkan dan menguraikan data relevan yang adad alamp erusahaans, ertam elakukan suatua nalisist erhadapd atat ersebutd an menelaahte ori yang melandasinya.A nalisis dan evaluasid ilakukan melalui suatu prosesp engukurany ang tepat berdasarkant olok ukur kinerja yang relevan dengan membandingkand ua penode tahun yang berbeda. Berdasarkanp erspektifprosesi nternal bisnis, perbaikany ang dilakukan dalam prosesin ternalp erusahaana kan ditujukan pada peningkatank ualitas, penekanan biayad anp engurangans iklus waktu produksi. Melalui pengukurant erhadaps emua asp€kp entingd alam prosesi nternal perusahaana, kan dapat diketahui kine{a dan pemicu kine4a dari proses peningkatan kualitas, penekanan biaya dan pengurangan siklus waktu produksi tersebut secaratepat dan komprehensif. Dari hasil pengukuran yang dilakukan dapat disimpulkan bahwa secara umum kinerja proses internal bisnis perusahaaunn tuk periodet ahun 1999 dan 2000 cukup baik, dan secarak hususk ineria prosesin ternalb isnis perusahaanp ada tahun 2000 mengalami peningkatand ari tahun 1999. Untuk menghindari adanya penyimpangan dalam proses produksi, sebaiknya perusahaamn engurangia ktivitas-aktivitasy ang tidak bernilai tambah( non vulue added activtttes) dan meningkatkan kualitas bahan baku dalam proses produksi agar menghasilkparno dukb erkualitasb ark.S elaini tu, perusahaanjugase baiknyas egera melakukainno vasi-inovasbia ru agard apatm emenuhip ermintaand an rnemberikan kepuasakne padap elanggan.

Pengaruh pelatihan mencegah kekerasan lunak terhadap pengendalian diri / Fardika Sihiyantoro

 

2010 ABSTRAK Sihiyantoro, Fardika. 2009. Pengaruh Pelatihan Mencegah Kekerasan Lunak Terhadap Pengendalian Diri. Skripsi, Program Studi Bimbingan dan Konseling, Jurusan Bimbingan Konseling dan Psikologi. Pembimbing (I) Dr. Triyono, M.Pd (II) Drs. Moh. Bisri, M.Si Kata Kunci: pengaruh, pelatihan mencegah kekerasan lunak, pengendalian diri Masa kanak-kanak masih pada tataran perkembangan pembentukan identitas diri dan pengendalian diri, sehingga masalah yang banyak muncul pada anak adalah masalah yang berhubungan dengan pengendalian diri. Kurangnya pengendalian diri berdampak pada munculnya gangguan perilaku. Salah satu bentuk gangguan perilaku yang khas pada masa kanak-kanak adalah kekerasan lunak (perilaku pasif destruktif dalam tingkat terendah). Pelatihan mencegah kekerasan lunak telah dikembangkan dan memiliki kriteria ketepatan, kelayakan, kegunaan, dan akseptabilitas. Orientasi pelatihan ini adalah membantu dan memudahkan guru dalam memberikan layanan bimbingan pribadi-sosial melalui model role-playing dan pendekatan cerita bergambar, khususnya untuk mencegah terjadinya perilaku kekerasan lunak. Penelitian ini difokuskan untuk mengetahui keefektifan pelatihan mencegah kekerasan lunak terhadap pengendalian diri. Desain penelitian ini adalah one group pretest and posttest design. Karakteristik subyek dalam penelitian ini adalah: siswa yang masih terdaftar di suatu sekolah dasar, berusia antara 7-11 tahun, berjenis kelamin laki-laki atau perempuan, dan memiliki tingkah laku kekerasan lunak. Pengumpulan data pretest dan posttest menggunakan inventori. Teknik analisis statistik yang digunakan adalah uji beda wilcoxon dengan program SPSS 13.0 for Windows. Hasil analisis statistik menunjukkan terdapat pengaruh yang signifikan dari pelatihan mencegah kekerasan lunak terhadap pengendalian diri siswa SD Islam Mohammad Hatta Malang. Dari hasil penelitian, peneliti mengemukakan saran kepada: pihak SD Islam Mohammad Hatta Malang, kepala sekolah, konselor, orang tua siswa dan peneliti selanjutnya. Kepada guru SD Islam Mohammad Hatta disarankan untuk menindaklanjuti pelatihan ini dengan bimbingan individu dan kepala SD Islam Mohammad Hatta disarankan untuk memfasilitasi penyediaan tenaga konselor di SD tersebut. Kepala sekolah disarankan untuk terbuka tehadap perkembangan di dunia pendidikan, memberikan motivasi dan teladan kepada guru/konselor untuk terus mengembangkan kompetensi profesional. Bagi konselor/guru SD, disarankan untuk menguasai kompetensi dalam menggunakan media bimbingan dan menggunakan pelatihan meencegah kekerasan lunak. Bagi para orang tua, peneliti menyarankan untuk selektif memilih tayangan media yang ditonton anak, melakukan pendampingan kepada anak, dan memusatkan perhatian pada usaha mengubah reinforcement dan model yang diikuti. Kepada peneliti selanjutnya, disarankan untuk menguji keefektifan pelatihan ini terhadap variabel lain, menggunakan desain penelitian yang melibatkan kelompok kontrol, mengontrol variabel-variabel bebas di luar penelitian, dan menggunakan instrumen lain yang digunakan pada jangka waktu yang lebih lama setelah treatment.

Pengaruh persepsi siswa tentang perpustakaan sekolah dan profesionalisme guru terhadap prestasi belajar akuntansi siswa SMA Negeri 1 Singosari Malang / Erma Damayanti

 

Kata Kunci: Perpustakaan Sekolah, Profesionalisme Guru, Prestasi Belajar Akuntansi. Perpustakaan sekolah adalah sebuah ruangan atau gedung yang digunakan untuk menyimpan buku dan terbitan lainnya yang biasanya disimpan menurut tata susunan tertentu yang digunakan pembaca bukan untuk dijual. Tujuan perpstakaan sekolah salah satunya adalah harus digunakan oleh pemakainya. Pemakai tersebut antarqa lain guru dan siswa. Profesionalisme guru adalah pekerjaan atau kegiatan yang dilakukan oleh seseorang dan menjadi sumber penghasilan kehidupan yang memerlukan keahlian, kemahiran, atau kecakapan yang memenuhi standar mutu atau norma tertentu serta memerlukan pendidikan profesi sehingga dapat meningkatkan prestasi belajar siswa. Tujuan Penelitian adalah untuk mengetahui pengaruh: (1) untuk mengetahui pengaruh perpustakaan sekolah terhadap prestasi belajar akuntansi siswa, (2) untuk mengetahui pengaruh profesionalisme guru terhadap prestasi belajar akuntansi siswa. Populasi penelitian ini adalah siswa kelas XII IPS SMA Negeri 1 Singosari yaitu sebanyak 76 siswa. Teknik pengambilan sampel adalah teknik (random sampling) sehingga diperoleh sampel berjumlah 39 siswa. Variabel bebas dalam penelitian ini adalah perpustakaan sekolah(X1), profesionalisme guru (X2), dan variabel terikatnya prestasi belajar akuntansi (Y). Teknik pengumpulan data yang digunakan dalam penelitian ini adalah kuesioner dan dokumentasi. Metode analisis data menggunakan analisis regresi linier berganda. Hasil penelitian yang diperoleh: (1) tidak terdapat pengaruh perputakaan sekolah terhadap prestasi belajar akuntansi siswa SMA Negeri 1 Singosari sebesar 2,002, (2) tidak terdapat pengaruh profesonalisme guru terhadap prestasi belajar akuntansi siswa SMA Negeri 1 Singosari sebesar 2,002, (3) tidak terdapat pengaruh perpustakaan sekolah dan profesionalisme guru terhadap prestasi belajar akuntansi siswa SMA Negeri 1 Singosari sebesar 0,833. Disarankan: (1) Bagi kepala sekolah hendaknya menunjuk salah satu guru atau pegawai sebagai penanggung jawab perpustakaan, serta melakukan pembenahan perpustakaan sekolah, (2) Bagi guru diharapkan dapat melakukan komunikasi secara efektif dengan siswa sehingga dapat meningkatkan prestasi siswa, (3) Bagi siswa yang prestasi belajar tidak baik diharapkan berusaha meningkatkan prestasi belajar dengan memanfaatkan fasilitas sekolah terutama perpustakaan sekolah dan mengikuti kegitan belajar mengajar dengan baik, (4) penelitian selanjutnya hendaknya jumlah sampel dan populasi dikembangkan, selain itu pengumpulan data hanya berupa angket dan dokumentasi sebaiknya dikembangkan berupa observasi dan wawancara dengan siswa.

Pengaruh atmosfir toko (Store atmosphere) terhadap keputusan pembelian buku text book (Studi pada konsumen toko buku Toga Mas Malang) / Ferry Indra L.

 

Kata Kunci: Atmosfir Toko, Keputusan Pembelian Konsumen. Kota Malang merupakan kota yang mendapat julukan sebagai kota pendidikan atau kota pelajar. Kota ini mendapat julukan tersebut, karena terdapat banyak perguruan tinggi baik perguruan tinggi negeri maupun swasta, selain itu banyak mahasiswa yang berasal dari luar kota Malang. Keberadaan kota Malang sebagai kota pendidikan didukung oleh beberapa fasilitas pendidikan salah satunya adalah toko buku. Berbicara masalah toko buku, perkembangan toko buku di Indonesia cukup menggembirakan, tampak disetiap sudut kota banyak kita temukan toko buku khususnya di kota Malang. Keberadaan toko buku di kota Malang sangat disambut baik oleh pelajar, sehingga peritel harus mampu bersaing di pasar mereka untuk merebut hati konsumennya. Untuk dapat bertahan dan memenangkan persaingan, setiap retailer dituntut untuk mengembangkan usaha pemasaran yang inovatif pada bisnis ecerannya guna menarik para konsumen untuk mengunjungi tokonya, setelah itu konsumen diharapkan melakukan pembelian, sehinggga omset penjualan akan naik, dengan omset penjualan naik maka pendapatan akan naik dan berakibat aliran laba (profit flow) akan lancar. Untuk dapat menarik konsumen agar melakukan pembelian, salah satunya dapat dilakukan dengan kreatifitas penciptaan suasana (Atmosphere) yang menyenangkan dan menarik di dalam toko, karena dewasa ini ada kecenderungan berubahnya motif seseorang untuk berbelanja, dimana kegiatan berbelanja tidak hanya sebagai kegiatan fungsional untuk membeli barang kebutuhan saja, tetapi juga kegiatan untuk rekreasi, hiburan atau hanya untuk pelepas stress. Artinya, saat konsumen masuk ke sebuah toko, mereka tidak hanya memberikan penilaian terhadap produk yang ditawarkan retailer tetapi juga akan memberikan penilaian terhadap kreatifitas penciptaan suasana pada toko tersebut. Berdasarkan penjelasan diatas maka peneliti tertarik melakukan penelitian tentang Atmosfir Toko. Penelitian ini bertujuan untuk pengaruh Atmosfir Toko (yang terdiri atas faktor desain toko, faktor sosial dan faktor ambien toko) secara parsial terhadap keputusan pembelian konsumen Toko Buku Toga Mas Malang. Dalam penelitian ini teknik pengambilan sampel yang digunakan Accidental Sampling yaitu menentukan sampel berdasarkan kebetulan, dimana jumlah sampel yang diambil sebanyak 138 orang konsumen Toko Buku Toga Mas Malang dengan menggunakan rumus Umar. Skala yang digunakan adalah Skala Likert dengan 5 (lima) opsi pilihan jawaban. Untuk menguji kelayakan instrumen digunakan uji validitas dan reliabilitas. Teknik pengumpulan data dalam penelitian ini menggunakan kuesioner, dokumentasi, observasi dan wawancara. Penelitian ini menggunakan teknik analisis deskriptif dan analisis regresi linear berganda dengan menggunakan SPSS Versi 12.00. Berdasarkan hasil penelitian diketahui bahwa variabel Terdapat pengaruh positif yang signifikan Atmosfir Toko (yang terdiri atas Faktor Desain Toko, Faktor Sosial dan Faktor Ambien Toko) secara parsial terhadap Keputusan Pembelian Konsumen. Hal ini ditunjukkan dengan nilai signifikansi t = 3,294 < 0,05 untuk Faktor Desain Toko, nilai signifikansi t = 0,006 < 0,05 untuk Faktor Sosial, dan Signifikansi t = 0,001 < 0,05 untuk faktor Ambien Toko. Terdapat pengaruh positif yang signifikan Atmosfir Toko (yang terdiri atas Faktor Desain Toko, Faktor Sosial dan Faktor Ambien Toko) secara simultan terhadap Keputusan Pembelian Konsumen. Hal ini ditunjukkan dengan nilai signifikansi sebesar F = 0,000 lebih kecil dari nilai  = 0,05. Dari hasil penelitian diketahui faktor ambien merupakan faktor dominan dari atmosfir toko yang mempengaruhi keputusan pembelian konsumen di Toko Buku Toga Mas Malang.

Pelaksanaan strategi promosi pada industri Jamu Toga Medica dalam memperkenalkan produk-produknya / oleh Hendro Zuniyanto

 

Penerapan strategi pemecahan masalah heuristik II untuk meningkatkan balajar hitung penjumlahan di kelas I SD / Neni Lita Herminati

 

ABSTRAK Herminati, L. N. Penerapan Strategi Pemecahan Masalah Heuristik II untuk Meningkatkan Belajar Hitung Penjumlahan di Kelas I SD Fakultas Ilmu Pendidikan Jurusan KSDP Program PJJ S1 PGSD. Pembimbing : Dra. Sri Harmini, S.Pd, M.Pd. Kata Kunci : Pembelajaran Berbasis Masalah (PBL), Strategi Pemecahan Heuristik II, Penjumlahan, Matematika, SD. Guru sebagai pelaksana dan pengembang pembelajaran harus mampu memilih dan menerapkan berbgai pendekatan dan metode untuk meningkatkan hasil belajar siswa. Hasil observasi awal diketemukan bahwa hasil belajar siswa di SDN Ngemplakrejo dari 30(100%) siswa sebanyak 23 (76.6%) siswa belum mencapai kriteria ketentuan kelas yang diharapkan minimal 80%. Berdasarkan hal itu, pendekatan pembelajaran berbasis masalah dengan menggunakan strategi pemecahan masalah heuristik dalam pembelajaran matematika sangat tepat sebagai alternatif dalam proses pembelajaran, karena siswa dilibatkan secara aktif, efektif dan menyenangkan dalam pembelajaran. Tujuan yang ingin dicapai dalam penelitian ini adalah: (1) mendeskripsikan pelaksanaan pembelajaran matematika melalui penerapan strategi pemecahan masalah heuristik II; (2) Meningkatkan aktivitas siswa dalam pembelajaran matematikan melalui penerapan strategi pemecahan masalah heuristik II; (3) Meningkatkan kemampuan belajar hitung penjumlahan pada siswa kelas I SDN Ngemplakrejo. Penelitian ini menggunakan desain penelitian tindakan kelas dengan metode Kemmis dan Taggart yang terdiri dari empat fase, yaitu perencanaan, pelaksanaan, tindakan, observasi, dan refleksi. Metode pengumpulan data dalam penelitian ini dengan teknik tes dan non tes (observasi dan wawancara), sedangkan instrumen pengumpulan data berupa: pedoman observasi untuk menilai aktivitas, kreativitas, efektivitas, dan pembelajaran menyenangkan bagi siswa, soal pre test dan post test untuk menilai hasil belajar siswa dalam pembelajaran matematika dengan menerapkan strategi pemecahan masalah heuristik II. Dari hasil analisis data penelitian ini menunjukkan bahwa dalam pembelajaran matematika dengan menerapkan strategi pemecahan masalah heuristik II terjadi beberapa peningkatan yaitu: (1) untuk aktivitas, kreativitas, efektivitas, dan rasa senang siswa terhadap pembelajaran yang diperoleh mulai siklus I sampai siklus II mengalami peningkatkan yang signifikan. Yaitu dari 30 (100%) siswa seluruhnya sudah mencapai kriteria aktif, kreatif, efektif dan rasa senang dalam pembelajaran; (2) hasil belajar pada waktu pre test adalah 46,7 dengan kriteria sangat rendah mengalami peningkat pada siklus I yaitu 74,6 dengan kriteria cukup tinggi dan mengalami peningkatan yang signifikan lagi pada siklus II 87,6 dengan kriteria tinggi. Meskipun ada 3 (10%) yang tidak mencapai kriteria ketuntasan individu namun ketuntasan belajar kelas sudah tercapai yaitu minimal 80%. Namun demikian, nampaknya masi sangat di perlukan upaya-upaya lebih lanjut dalam usaha memperbaiki dan menngkatkan hasil belajar siswa di sekolah tersebut.

Aspek kelucuhan dan nilai-nilai edukatif cerita lucu Nusantara
oleh Mohamad Choliq

 

Studi tentang ragam hias bordir dan proses pembuatan kerajinan bordir di rumah busana "Faiza Bordir" di Desa Kalirejo, Kecamatan Bangil, Kabupaten Pasuruan / Sonie Maulana

 

Kata Kunci: Identifikasi ragam hias, motif, seni kerajinan, bordir Seni kerajinan Bordir sudah membudaya di Indonesia. Seni Bordir selalu hidup dan berkembang, disukai masyarakat dan dapat diaplikasikan dalam berbagai karya. Keindahan sebuah karya bordir mempunyai daya tarik dan nilai tambah tersendiri. Hampir semua seni kerajinan perlu didukung oleh motif ragam hias seperti batik, keramik, porselen dll. Begitu pula seni kerajinan bordir, ragam hias memegang peran utama. Karena ragam hias sangat menentukan dalam membuat karya bordir yang indah, variatif dan penuh warna. Bordir merupakan salah satu warisan seni/budaya Indonesia yang mempunyai nilai seni tinggi. Guna melestarikan warisan budaya tersebut "Faiza Bordir" terus berupaya mengembangkan seni bordir dengan produk-produk yang digali dari khazanah budaya dan seni Indonesia. Tujuan dari penelitian ini adalah (1) mengidentifikasi macam ragam hias kerajinan bordir yang terdapat pada rumah busana "Faiza Bordir" (2) proses pembuatan kerajinan bordir pada rumah busana "Faiza Bordir". Untuk mencapai tujuan tersebut, pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif, karena pada penelitian ini berusaha mengungkapkan gejala secara menyeluruh dan sesuai dengan konteks melalui pengumpulan data dari latar alami dengan memanfaatkan diri peneliti sebagai instrumen kunci. Alternatif metode yang diambil ini adalah metode deskriptif. Hal-hal yang berkaitan dengan ragam hias desain kerajinan bordir pada rumah busana "Faiza Bordir" di dusun Kalirejo, Kecamatan Bangil, Kabupaten Pasuruan akan dideskripsikan dalam penelitin ini. Hasil dari penelitian ini adalah (1) jenis produk yang dihasilkan dibedakan menjadi dua, yaitu produk busana dan produk non-busana. Pada produk busana antara lain, blus, kebaya, mukena, baju gamis, gaun, kemeja, baju anak, kerudung dan busana muslim. Sedangkan pada produk non-busana antara lain, taplak meja, tempat tisu, sampul buku/sampul Al-Qur'an, tas jinjing/tas wanita, penutup dan tatakan gelas, sarung bantal, kipas, sepatu dan kotak seserahan. (2) ragam hias untuk menghias produknya, yaitu motif geometris dan motif non-geometris. (3) Alat untuk membuat kerajinan bordir yaitu mesin bordir, pemidangan, kertas minyak/kertas roti, kertas karbon, gunting, solder dan setrika. Bahan untuk membuat kerajinan bordir yaitu kain dan benang. (4) terdapat tiga proses utama pembuatan kerajinan bordir pada Rumah Busana "Faiza Bordir" yang meliputi tahap persiapan, tahap inti dan tahap akhir.

Musykilah adl-dlomir fi lughoti al-arabiyyah / Junaidi Qomaruddin Adi Purnomo

 

Keterampilan tema terhadap unsur pendidikan novel LHO karya Putu Wijaya sebuah analisis struktural
oleh Andri Pitoyo

 

Analisis nilai novel dalam kumpulan cerpen anak-anak berjudul Lebih menarik dari kuda lumping" karya Toha Mohtar
oleh Sri wulandari"

 

Perang Jepang - Tiongkok 1937 / oleh Sukarni

 

Pembelajaran pemecahan masalah untuk meningkatkan hasil belajar matematika tentang luas bangun datar siswa kelas V SDN Karanganyar Pasuruan / Tutik Suharti

 

Penelitian ini bertujuan untuk meningkatkan kemampuan pemecahan masalah siswa dengan menggunakan pembelajaran pemecahan masalah. Dalam penelitian ini dapat dirumuskan masalah sebagai berikut: 1) Bagaimanakah Pembelajaran Pemecahan Masalah dapat meningkatkan aktivitas siswa kelas V SDN Karanganyar Pasuruan dalam pembelajaran matematika? 2) Bagaimanakah Pembelajaran Pemecahan Masalah dapat meningkatkan hasil belajar matematika tentang luas bangun datar siswa kelas V SDN Karanganyar Pasuruan? 3) Apakah Pembelajaran Pemecahan Masalah dapat meningkatkan kemampuan siswa kelas V SDN Karanganyar Pasuruan dalam pembelajaran matematika materi luas bangun datar? Hasil pembelajaran menunjukkan bahwa menggunakan pembelajaran pemecahan masalah pada luas bangun datar (persegi, persegi panjang, trapesium, dan layang-layang) dapat meningkatkan pemahaman siswa. Disamping itu siswa masih memerlukan latihan-latihan sebagai penguatan. Sebagai saran agar hasil pembelajaran menjadi maksimal dan menarik maka guru hendaknya perlu menyeimbangkan antara waktu untuk drill, penggunaan media dan diskusi.

Usaha-usaha pengendalian banjir di Kabupaten Tulungagung / oleh Djoko Santoso

 

Vaidasi Media pebelajaran "papan geometri" di RA Al-Hikmah Lekok Pasuruan/Lailatul Izzah

 

Penerapan metode belajar learning cycle-5E pada mata pelajaran akuntansi terhadap siswa kelas XII IPS 1 untuk meningkatkan aktivitas dan hasil belajar di SMA Negeri 6 Malang / Dyah Titin Kurniatin

 

Kata Kunci: learning cycle-5 fase, aktivitas, hasil belajar. Berdasarkan hasil observasi awal dan wawancara dengan siswa maupun guru yang bersangkutan, mengindikasikan bahwa guru langsung pemberian tugas-tugas. Selanjutnya guru tidak memberikan eksplanasi dan evaluasi terhadap tugas yang diberikan. Dalam hal ini siswa belajar sendiri sehingga mereka belum menemukan jawaban mana yang benar yang harus dipergunakan. Tujuan penelitian adalah: (1) Untuk mendeskripsikan bagaimana meningkatkan aktivitas belajar siswa kelas XII-IPS1 dengan model Pembelajaran Learning cycle 5E di SMA Negeri 6 Malang. (2)Untuk mendeskripsikan bagaimana meningkatkan hasil belajar siswa kelas XII-IPS1 dengan menggunakan model Pembelajaran Learning Cycle 5E di SMA Negeri 6 Malang. Jenis penelitian yang digunakan adalah penelitian tindakan kelas (classroom action research) dengan pendekatan kualitatif. Alat pengumpulan data menggunakan, tes, lembar observasi, lembar catatan lapangan, dan pedoman wawancara. Sumber data yang digunakan dalam penelitian ini adalah siswa kelas XII-IPS1 SMA Negeri 6 Malang tahun ajaran 2009/2010. Hasil penelitian menunjukkan: model pembelajaran Learning Cycle 5E dapat meningkatkan aktivitas dan hasil belajar siswa. Pada siklus I berdasarkan lembar observasi aktivitas siswa dalam penerapan model pembelajaran learning cycle 5E memperoleh skor kurang dari kriteria ketuntasan belajar yaitu mendapat skor 56,66%. Pada siklus II nilai aktivitas siswa penilaian dengan lembar observasi aktivitas siswa skor rata-rata kelas meningkat menjadi 76,66% berarti dalam hal ini meningkat sebesar 20%. Peningkatan skor ini mengalami kenaikan secara signifikan. Hasil belajar yang diperoleh dari tiga aspek yaitu aspek kognitif siklus I sebesar 73,8% dan siklus II naik menjadi 77,1%. Sedangkan ditinjau dari segi afektif dapat diketahui persentase sebesar 56,7% dan untuk siklus II dengan persentase (65,8%). Untuk aspek psikomotorik pada siklus I hasil yang diperoleh sebesar 24,3% dan pada siklus II meningkat menjadi 65,8%. Dengan demikian penelitian ini dapat disimpulkan bahwa penerapan metode pembelajaran learning cycle 5E dapat meningkatkan aktivitas dan hasil belajar siswa kelas XII-IPS1 SMA Negeri 6 Malang. Beberapa saran dari peneliti diharapakan bisa meningkatkan aktivitas siswa dalam belajar untuk belajar secara mandiri seperti pada fase eksplorasi dan siswa tetap dapat mengingat dari kegiatan tersebut dikarenakan hasil dari menemukan dan mengetahui letak kesalahan diharapakan dari proses itu siswa tetap dapat mengingat materi yang telah dipelajari. Serta dapat dijadikan sebagai bahan dalam mengembangkan variasi-variasi metode untuk meminimalisasikan kejenuhan dalam proses belajar mengajar di dalam kelas

Teori ferroelektrik elektronik oleh Sri Yuana Partiwi

 

Dalamtu lisani ni. dipaparkatne orid arif erroelektrisitaysa ngd iawalid ari sebuahfa set ransisei lektronik.Untumk engetahuhia l-hayl angb erkaitand engan ferroelektrike lektronik.m akap erlu dilakukank ajiant entangte ori ferrnelekfrik elekfonik. Kajiani ni mempunyatiu jrtan( a) unhrkm emahamsi olusiS CMF( self consistenmt eanf ield) uuhrkk eadaand asard ari modelF alicov-Kimball(; b) untuk meng;etahpuei rhitungans useptibilitaslin ier dari modelF alicov-Kimballd; an( c) unRrkm engetahupie rhitrurgansu septibilitash armonikk eduad ari modelF alicov- Kimball. Metodek ajiany angd igunakadna lamk ajiani ni adalahm etodek ajianp ustaka hasilp enelitiany angt elahd ilakukano lehp arai lmuwan,y angd ikemasd alamb entuk jumal penelitianK. ajianp ustakain i berusaharm urkm emberikang ambarante ntang pembahasatne ori ferroelektrike lektonik. Adapunl angkah-langkayha ngd itah*an olehp enelitia ntaral ain: (a) mengumpulkadna udata yangb erasadl ari semuaju rnal danj uga yangb erasadl an buku-bukuy angt erkaitd enganft rroelekfrik elektonik; (b) mengambhil al-haly angt €rkait denganb ahanf erroelekrik elekfioniku ntukd ijadikan pemrlisanin i; (c) menyusund atay angt elahd iperolehs ehinggam enjadis ebuah tulisany angm emilikib ahasayna ngb erurutand anj ugaj elas. Hasilk ajian ini, menginvestigaksai rakteristiko ptik linier dann on linier dari modelF alicov-KisrballS. olusiS CtvIFm erupakans uatup enyelesaiatne oritisd ari suatuk eadaand asard ari modelF alicov-Kimbalyl angm empunyaki oherensdi iantara electrond padam omantumk danh olef padam omentum-k . sifat-sifatf erroelektrik elektroniky angb erhubungadne ngang ejalae lecnond apatd iselesaikand engans olusi SCMF. Transisi temperahr pada fenoelekfiik elellronik dapat mengakibatkan perubahasni metrii nversiy angd apatd ilihat dari perubatranfr ekuensyi angd ihasilkan rnenjaddi uak ali dari frekuensis emulad anp urjangg elombangy angm enjadi setengadha ri keadaans emulaO. lehk arenai tu perhihmgany angb erkaitand engan fenoelekrik elekronik dapat dilala*anmelatui solusi SCMFBahan ferroelekrik elelctroniky angd alamt ulisani ni disebutd enganp erpaduanb abanc ampurand apat diaplikasikanp adas uku-sukup adaH amiltonianS. ukup ertamad ari l{amiltonian adalahk eseimbangayna ngt eratury aitu optik non linier. Sukuk eduad ari Flamiltoniana dnlahk eseimbanga)na og tidak t€rahr )ang dapatd iaplikasikenp ada optik non linier yangd alama rlisani ni adalahp embangkitahna rmonikk edua.

Analisis pelaksanaan asas praduga tak bersalah di Pengadilan Negeri Kraksaan Kabupaten Probolinggo / oleh Samsudin Husaini

 

Evaluasi kesesuaian lahan untuk pengembangan kawasan permukiman di Kecamatan Mojoroto Kota Kediri / Habibarani Khoirun Nisa'

 

ABSTRAK Nisa’, Habibarani K. 2015. Evaluasi Kesesuaian Lahan untuk Pengembangan Kawasan Permukiman di Kecamatan Mojoroto Kota Kediri. Skripsi, Jurusan Pendidikan Geografi FIS Universitas Negeri Malang. Pembimbing: (I) Drs. Rudi Hartono, M.Si (II) Drs. Sudarno Herlambang, M. Si. Kata kunci: evaluasi kesesuaian lahan, permukiman Permukiman merupakan daerah di luar kawasan lindung yang digunakan sebagai lingkungan tempat tinggal atau hunian masyarakat berada di wilayah perkotaan dan perdesaan. Kecamatan Mojoroto memiliki luas wilayah 24,601 km2. Pertambahan penduduk sebesar 3.912 jiwa/tahun menyebabkan kebutuhan akan permukiman juga meningkat. Apabila diproyeksikan hingga tahun 2018 dengan laju pertumbuhan penduduk rata-rata sebesar 3,00%, jumlah penduduk Kecamatan Mojoroto adalah 116.530 jiwa dengan kebutuhan rumah mencapai 23.306 unit. Untuk itu perlu dilakukan adanya evaluasi lahan untuk mengetahui tingkat kesesuaian lahan yang dapat dikembangkan sebagai kawasan permukiman. Penelitian ini bertujuan mengevaluasi kesesuaian lahan untuk pengembangan kawasan permukiman dan menganalisis sebaran kesesuaian lahan untuk pengembangan kawasan permukiman di Kecamatan Mojoroto berdasarkan kelas kesesuaian lahan untuk pemukiman. Metode yang digunakan dalam penelitian ini adalah survey dengan pendekatan deskriptif. Data yang digunakan dalam penelitian ini meliputi data primer dan data sekunder. Pengolahan data spasial menggunakan software ArcView 3.3. yaitu dengan cara menumpangsusunkan tiga peta yaitu peta jenis tanah, peta kemiringan lereng, dan peta penggunaan lahan. Populasi yang diperoleh dari tumpag susun (overlay) peta sebanyak 16 satuan lahan, sampel penelitian yang diambil sebanyak 5 unit lahan. Teknik pengambilan sampel menggunakan teknik purposive sampling. Penentuan kelas kesesuaian lahan untuk permukiman ditetapkan berdasarkan jumlah hasil pengharkatan (scoring) terhadap parameter-parameter kesesuaian lahan pada satuan lahan. Hasil penelitian menunjukkan bahwa kelas sesuai untuk pengembangan kawasan permukiman 15.933,3 m2 dari luas seluruh unit lahan, terletak di seluruh kelurahan di Kecamatan Mojoroto yaitu Kelurahan Sukorame, Kelurahan Bandar Lor, Kelurahan Mojoroto, Kelurahan Pojok, dan Kelurahan Lirboyo. Jadi, seluruh unit lahan sesuai untuk dikembangkan menjadi kawasan permukiman.

Pengembangan modul keterkaitan struktur, fungsi, dan proses serta kelainan/penyakit pada sistem saraf untuk mencapai SKL-SP dan tujuan mata pelajaran biologi pada siswa kelas XI di SMA Negeri I Grati Pasuruan / Dia Faroka

 

Kata kunci : Modul keterkaitan struktur, fungsi dan proses serta kelainan/penyakit pada sistem saraf, SKL-SP, Tujuan Mata Pelajaran Biologi. Berdasarkan hasil Observasi, diketahui bahwa pembelajaran Biolodi di SMA Negeri I Grati menggunakan Lesson Study dan Non Lesson Study. Proses Lesson Study dilaksanakan sekali setiap semester untuk mata pelajaran biologi begitu juga dengan mata pelajaran yang lain. Sehingga pelaksanaan lesson study belum dapat mencapai visi dan misi sekolah. Permasalahan yang terjadi pada Lesson Study maupun Non Lesson Study yaitu, a) Siswa kurang dilibatkan secara aktif dikelas, b) Kemampuan berfikir belum dipertimbangkan sebagai bagian integral dari pembelajaran, c) Siswa yang cerdas dan cepat belajarnya terhambat dengan adanya siswa yang lamban dan siswa yang lamban akan semakin kesulitan, LKS yang digunakan kurang efektif, efisien dan fleksibel, d) LKS belum dapat mencapai tujuan Biologi dan SKL-SP. Alternatif solusi permasalahan yang tejadi adalah a) menggunakan Bahan ajar berupa modul yang menerapkan informasi, dan pengetahuan, secara logis, kritis, kreatif dan inovatif. Sehingga siswa dapat membangun pengetahuannya sendiri dan tidak hanya menerima informasi saja, b) menggunakan Bahan ajar yaitu modul karena bersifat Self intructional, Self Containned, Adaptif, Stand alone,dan user friendly. Model Pengembangan modul yang digunakan penulis mengikuti langkahlangkah sebagai berikut : 1)Potensi dan Masalah, 2) Pengumpulan Informasi, 3) Desain Modul, 4) Validasi Modul pembelajaran dan uji coba kelompok kecil, 5) Revisi Modul pembelajaran I, 6) Uji Coba langsung Modul pembelajaran, 7) Revisi Modul pembelajaran II, 8) Penyempurnaan Modul. Hasil validasi yang dilakukan oleh ahli media, ahli materi, guru dalam tampilan modul yaitu SKL-SP dan Tujuan Biologi adalah 80,21%, 91,73%, 90,73%, sedangkan hasil validasi modul berdasarkan gagasan modul berupa visual,gambar dan video yaitu 79.58%, 96,87%, 93,75%.Hasil uji coba kelompok kecil dan besar yaitu 84.64% dan 89.58%. Data hasil validasi dari ahli media, ahli materi dan guru serta uji coba kelompok kecil dan besar bahwa modul tidak perlu direvisi. Meskipun berdasarkan data kuantitatif modul telah telah dinyatakan valid dan layak tetapi perlu ditindak lanjuti mengenai komentar dan saran ahli media, ahli materi, guru dan kelompok kecil serta besar. Produk yang dihasilkan adalah modul Keterkaitan Struktur, Fungsi, Dan Proses Serta Kelainan/Penyakit Pada Sistem Saraf untuk mencapai Kompetensi Dasar. “Keterkaitan antara Struktur, Fungsi, dan Proses Serta Kelainan/Penyakit yang terjadi pada Sistem Regulasi”. Modul ini mempunyai 5 kegiatan belajar dengan alokasi waktu 8 x 45 menit. Saran pemanfaatan dan pengembangan lebih lanjut dari hasil pengembangan ini dapat dikembangkan sebagai berikut 1) Modul yang dikembangkan dapat dimanfaatkan lebih lanjut dengan diproduksi oleh sekolah yang bersangkutan dengan seijin peniliti. Hal ini bertujuan untuk memenuhi kebutuhan sekolah dan membelajarkan siswa secara mandiri dan sebagai contoh modul yang memiliki komponen lengkap, memenuhi standart lulusan mata pelajaran dan tujuan mata pelajaran Biologi, 2) Diperlukan ketelitian dalam membuat modul yang mencapai SKL-SP dan Tujuan mata pelajaran Biologi

Enhancing content-area reading skills of the English Department students of STAIN Malang through summary writing / by Rohmani Nur Indah

 

Alat penetas telur bebek otomatis berbasis arduino mega / Andi Alfian

 

ABSTRAK Alfian, Andi. 2016. Alat Penetas Telur Bebek Otomatis Berbasis Arduino Mega. TugasAkhir, JurusanTeknikElektro. Program Studi D3 TeknikElektro, FakultasTeknik. UniversitasNegeri Malang.Pembimbing: Arif Nur Afandi, S.T., M.T., MIAEng, MIEEE, Ph.D. Kata Kunci: Prototype, SistemOtomasi, DHT11, ArduinoMega. Mesin tetas adalah sebuah alat yang menggantikan proses pengeraman yang dilakukan oleh indukan. Dengan menggunakan mesin tetas, maka keuntungan yang akan didapat adalah kapasitas penetasan yang lebih besar. Selama ini kebanyakan mesin tetas di industri peternakan masih menggunakan sistem konvesional, dimana alat penetasan telur tersebut masih dilakukan secara manual, yaitu pemutaran telur untuk mendapatkan distribusi temperatur yang merata pada permukaan telur, pada saat inilah menyebabkan penurunan suhu dan mengurangi kebersihan.Alat penetas inimenggunakanmikrokontrolerAtmega2560 (sebuahkeping yang secarafungsionalbertindaksepertisebuahkomputer) yang dimanfaatkanuntukmewujudkanrangkaianelektronikdari yang sederhanahingga yang kompleks. Yangbertujuanuntukmempermudahdalam proses penetasan telur bebek. Tahapandalampeerancanganiniterdiridari: (1) blok diagram, (2) proses perancangan, (3) hardware,(4) software, dan (5) hasilpengujian. Pengujianprototype dilakukandengancaramengujitiapblokkomponendanpengujiansistemkeseluruhan. Hasilpengujianmemperlihatkan pada saat tombol start ditekan, maka secara otomatis sistem akan aktif selama 28 hari dan sensor suhu diatur dengan rentang maksimal 39°C dan kelembaban rentang maksimal 75%.Berdasarkan hasil pengujian menunjukkan bahwa, alat penetas inidapatbekerjasesuaidenganprinsipkerja yang dirancang. Dengandemikianprototype yang dibuatdapatberfungsidenganbaikdansesuaidenganperancangan.

Penerapan model pembelajaran laboratori untuk meningkatkan hasil belajar menjahit pengembvangan diri SMP Islam 02 Pujon / Yuliani

 

Kata Kunci : Laboratori, Sistem kelompok, Hasil belajar menjahit Pendidikan adalah usaha sadar dan terencana untuk mewujutkan suasana belajar dan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan spiritual, keagamaan, pengendalian diri, kepribadian, kecerdasan, akhlak mulia, serta keterampilan yang diperlukan dirinya, masyarakat, bangsa dan Negara. Untuk mencapai itu semua, guru mempunyai peran yang sangat penting terhadap keberhasilan peserta didiknya. Berdasarkan observasi yang dilakukan peneliti dengan guru pembimbing ekstrakurikuler menjahit di SMP Islam 02 Pujon, diperoleh informasi bahwa pembelajaran yang dilaksanakan di kelas pengembangan diri menjahit masih belum maksimal. Hal ini dapat dilihat dari hasil menjahit siswa pengembangan diri menjahit pada semester pertama yang rata-rata masih dibawah SKBM (Standar Ketuntasan Belajar Minimum). Melihat kondisi ini, maka diperlukan suatu metode pembelajaran yang tepat, sehingga dapat meningkatkan hasil belajar siswa. Metode pembelajaran laboratori sistem kelompok dapat dijadikan sebagai salah satu alternatif pembelajaran yang dapat digunakan untuk meningkatkan hasil menjahit siswa. Model pembelajaran ini mengajak siswa untuk berhadapan langsung dengan material bahan dan praktik. Kegiatan ini juga menuntut siswa untuk melakukan latihan dan bekerja sama dengan sistem kelompok. Penelitian ini bertujuan untuk mendiskripsikan penerapan metode pembelajaran laboratori sistem kelompok dalam upaya untuk meningkatkan hasil belajar menjahit siswa pengembangan diri menjahit SMP Islan 02 Pujon tahun pelajaran 2010-2011 Penelitian ini menggunakan pendekatan deskriptif, karena peneliti lebih banyak mengumpulkan data baik dalam bentuk data kualitatif maupun data kuantitatif. Jenis penelitian yang peneliti lakukan adalah penelitian tindakan kelas, dengan subyek siswa kelas pengembangan diri menjahit SMP Islam 02 Pujon. Teknik pengumpulan data yang dilakukan peneliti adalah: (1). Observasi, digunakan untuk mengamati aktivitas guru dan siswa selam proses pembelajaran berlangsung, (2). Catatan lapangan, digunakan untuk melengkapi data yang tidak tercantum dalam lembar observasi, (3). Hasil tes praktik, untuk mengetahui tes siklus akhir siswa. Data dalam penelitian ini terbagi menjadi dua jenis, yaitu data kualitatif dan data kuantitatif. Data kuantitatif dianalisis dengan mencari nilai rata- rata dan presentasinya. Data kualitatif dianalisis menggunakan teknik analisis data yang terdiri dari mereduksi data, menyajikan data dan penarikan kesimpulan. Hasil penelitian pada siklus I, antara lain adalah : (1). Presentase keberhasilan aktivitas kegiatan kelompok pertemuan pertama mencapai 73,2 %, sedangkan pada pertemuan kedua 79,7 %. (2). Presentase keberhasilan Pengelolaan pembelajaran guru pada pertemuan pertama 83,3% sedangkan pada pertemuan kedua 89%. (3). Nilai rata-rata kelas 73,39. Hasil analisis data pada siklus I ini menunjukkan bahwa hasil pelaksanaan siklus I masih banyak kekurangan. Adapun hasil penelitian pada siklus II, antara lain adalah (1). Presentase keberhasilan aktivitas kegiatan kelompok mencapai 89.28 %, (2). Presentase keberhasilan pengelolaan pembelajaran guru 96,87% . (3). Nilai rata- rata kelas 80,17. Hasil analisis data pada siklus II sudah mencapai SKBM (standar Ketuntasan Belajar Minimum) ini berarti pelaksanaan pada tindakan II telah cukup baik. Hasil analisis siklus III memperoleh jasil antara lain adalah, (1). Presentase keberhasilan aktivitas kegiatan kelompok 91,66 %, (2). Presentase keberhasilan pengelolaan pembelajaran guru 98,95%.(3). Nilai rata-rata kelas 90.28. Hal ini berarti pelaksanaan pada tindakan III telah sangat baik. Berdasarkan hasil analisis data ketiga siklus tersebut, terlihat bahwa hasil pelaksanaan tindakan pada siklus II dan III mengalami peningkatan biladibandingkan pada siklus I. Hal ini menunjukkan bahwa penerapan motode laboratori sistim kelompok dapat meningkatkan hasil belajar menjahit siswa pengembangan diri menjahit SMP Islam 02 Pujon Tahun ajaran 2010-2011.

Hubungan antara bimbingan oleh orang tua dan motivasi belajar dengan prestasi belajar siswa kelas II SLTP Negeri 7 Pasuruan tahun ajaran 1999/2000
oleh Evi Kristiana

 

Lembagas ekolahb ertanggungJ awab aLasp endidikan p€serlad idiknya, agar memilikip restasdi i bidangk ognitif, afektif, dan psikornotor.U ntuk mencapaik etiga aspekte rsebudt ipengaruhoi leh bchrapa lhktor anlaral ain dari dalam dirr sisrva maupun dari luar diri siswa seperti bimbingan oleh orang tua dan nrotivasi belajar sjswa. Bimbingan orang tua dan moljvasi bclalar menrpakan salah satu faktor penunjankge trerhasilanp restasbi clajar pescrtad rdik. Tu3uanp enelirianin i adalahu ntuk menjaw6bm asalahp okok yang rnenjadi perhatiadna larnS rnelitianin i, yaitu( l) apakaha dah ubungana ntara.bimhingaonle h orangtw r denganm otivasib elajars iswa,( 2) apakaha da hubungana ntarab inrbingan oleh orang tua dengan prestasi belajar siswa, (3) apakah ada hubungan anrara motivasbi elajard enganp restasib elajar sisrva,d an (4) apakaha da hubungana nlara bimbingano leh orangt ua dan motivasib ela-iasr rswad enganp restasbi elajars isrva. Rancangan penelitian ini adalah dcsknptif korelasional. populasi

Kemandirian belajar kelompok dalam meningkatkan pendapatan keluarga (studi kasus pada kelompok pengrajin anyaman bambu Makaaruyen di Desa Kinilow Kecamatan Tomohon Kabupaten Dati II Minahasa) / oleh Marien Pinontoan

 

Penerapan model pembelajaran Project Based Learning (PjBL) untuk meningkatkan keterampilan metakognitif dan hasil belajar biologi siswa kelas X4 SMAI Ma'arif Singosari-Malang-Jawa Timur / Humila Ainun Nadhiroh

 

ABSTRAK Nadhiroh, Humila Ainun. 2016. Penerapan Model Pembelajaran Project Based Learning (PjBL) untuk Meningkatkan Keterampilan Metakognitif dan Hasil Belajar Biologi Siswa Kelas X4 SMAI Ma’arif Singosari. Skripsi, Program Studi Pendidikan Biologi,Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (1) Dr. Murni Saptasari, M.Si., (2) Dra. Sunarmi, M.Pd. Kata Kunci: Model Pembelajaran PjBL, Keterampilan Metakognitif, Hasil Belajar. Proses pembelajaran Biologi di kelas X4 SMAI Al Ma’arif Singosari masih cenderung menggunakan metode ceramah yang berpusat pada guru. Model pembelajaran yang diterapkan belum melatih siswa untuk memecahkan suatu permasalahan sesuai dengan langkah kerja ilmiah. Hal ini menyebabkan pemberdayaan proses berpikir siswa masih lemah dan hasil belajar siswa kurang memuaskan.Pemberdayaan proses berpikir berkaitan erat dengan keterampilan metakognitif yang akan membantu siswa menjadi pebelajar mandiri. Keterampilan metakognitif akan berdampak pada ketercapaian hasil belajar yang memuaskan. Berdasarkan uraian tersebut, dilakukan penelitian yang bertujuan untuk meningkatkan keterampilan metakognitif dan hasil belajar siswa kelas X4 SMAI Al Ma’arif Singosari. Jenis penelitian ini yaitu penelitian tindakan kelas yang terdiri dari 2 siklus. Tahap penelitian tindakan kelas yaitu perencanaan, pelaksanaan, observasi, dan refleksi. Teknik pengumpulan data yang digunakan berupa tes dan non tes. Teknis tes dengan pemberian soal tes akhir silklus, sedangkan teknik non tes dengan lembar observasi, catatan lapangan, wawancara, dan dokumentasi. Keterlaksanaan pembelajaran PjBL diukur dengan lembar observasi keterlaksanaan pembelajaran. Keterampilan metakognitif diukur dengan lembar kuesioner metakognitif O’Neil & Abedi, serta tes Essay menggunakan rubrik metakognitif oleh Corebima. Hasil belajar diukur dengan soal tes akhir siklus, lembar penilaian proyek, lembar penilaian sikap, dan lembar asesmen kinerja. Hasil penelitian menunjukkan bahwa keterampilan metakognitif dan hasil belajar siswa meningkat melalui model pembelajaran PjBL. Peningkatan tersebut dapat dilihat dari kenaikan persentase keterampilan metakognitif dan hasil belajar dari siklus I ke siklus II. Keterampilan metakognitif siswa berdasarkan hasil kuesioner sebesar 65,04% meningkat sebanyak 4,14% menjadi 69,18% pada siklus II. Keterampilan metakognitif yang diukur melalui tes Essay menggunakan rubrik metakognitif sebesar 56,68% meningkat sebanyak 3,74%menjadi 60,42%.pada siklus II. Peningkatan hasil belajar siswa klasikal ranah pengetahuan dari 56,25% meningkat sebesar 18,75% menjadi 75,00%, ranah sikap yaitu 75,00% meningkat sebesar 6,25% menjadi 81,25%, ranah keterampilan yaitu 75,00% meningkat sebesar 9,37% menjadi 84,37%. Kesimpulan yaitu penerapan model pembelajaran PjBL dapat menngkatkan keterampilan metakognitif dan hasil belajar siswa kelas X4 SMAI Al Ma’arif Singosari. Berdasarkan hasil penelitian dapat diberikan saran bahwa penerapan model PjBL membutuhkan persiapan yang matang dan kemampuan pengelolaan kelas dengan baik.

Studi pemahaman tata nama hidrokarbon siswa kelas I SMUN 1 Kotatif Batu / oleh Puji Mulyani

 

BerdasarkanG BPP1 994M ata PelajaranK imia, tata namaI UpAC untuk iridrokarbon alifatik (alkana, alkena, dan alkuna) disajikan di kelas I cawu 3, yaitu padap okok bahasanh idrokarbond an minyak bumi. Bagi siswaS MU kelasI pelajarank imia merupal-anm atap elajaranb aru sehinggas iswad imungkinkan nengalami kesulitan dalam memahami konsepkonsep yang ada termasuk dalam penerapanta ta namah idrokarbon.B eberapah asil penelitianm enunjukkanb ahwa siswam engalamik esulitand alam mempelajaris enyawak arbon.o leh karenai tu penulisi ngin mengetahubi agaimanap emahamans iswak elasI SMUN 1 Kotatif Batu tentang tata nama IUPAC untuk senyawa hidrokarbon. Penelitiani ni menggunakanm etoded eskriptif denganp opulasip enelitian seluruh siswa kelas I SMUN I Batu tahun pelajaran l99gl20oo yang terdiri dari tujuh kelas.B erdasarkanni lai nta-ratakimia cawu2 ,anggotapopulasdi ianggaph omogen sehinggas etiapk elasm empunyaip eluangy ang samas ebagasi ampel.S ampeld ipilih secaraa cakd an sebagasi ampelp enelitiana dalahk elas l-l,l-2, dan I-5. Untuk mengetahutii ngkat pemahamans iswat entangt ata namah idrokarbond igunakan instrumenb erupat es pilihan gandas ebanyak4 0 butir soal. Sebelumd igunakanu ntuk pengambilan data instrumen ini diujicobakan kepada 42 siswa kelas I SMUN I Batu yangt idak dijadikans ampeyl aitu kelasI -3 untukm engetahuvia liditas,r eliabilitas, dayab edad an tingkat kesukaranb utir soal.u ntuk pengambiland atad igunakans oal sebanyak3 0 butir yang memenuhik eempatk riteria uji cobad an datay angd iperoleh dianalisisd enganm enggunakante knik persentase. . Hasil penelitiany angd iperolehd apatd isimpulkans ebagabi erikut: pemahamans iswak elasI SMUN I Kotatif Batu tentang:( l) penamaanh idrokarbon yangt idak bercabangte rgolongb aik (73to/o),c ukup( 13,7%),t idak baik (12,9%), (2) Penamaahni drokarbony angm empunyasi atuc abangte rgolongb aik {37, l%), cukup (28,27o),t idak baik (34,7yo), (3) Penamaanh idrokarbony ang mempunyar lebih dari satuc abangte rgolongb aik (30,6%),c ukup( 28,2%),k urangb atk( 23,4o/o), tidak baik (17,7%),( 4) Penerapaant urant atan amaT UPACte rgolongb aik (23,4%), cukup (46,8%),t idak baik (29,8o/o)(,5 ) Penulisanr umuss tnrkturh idrokarbony ang tidak bercabangte rgolongb aik (79%),c ukup( 17,7%%)t,i dak baik (3,2%), (6) Penulisan rumus struktur hidrokarbon yang mempunyai satu cabang tergolong baik(69,a%)c, ukup(19,4%)k,u rangbaik( 9,7o/o),tidakba(i1k, 6%),(7)penulisan rumus struktur hidrokarbon yang mempunyai lebih dari satu cabang tergolong baik (48,4%), cukup (34,1%), kurang baik (8,1%), dan tidak baik(12,1

Pelaksanaan pembelajaran di Pondok Pesantren Salafiyah Bahrul Muhtadin Kota Batu dalam membentuk kepribadian santri / Zefri Prasetyo

 

Kata Kunci: Pembelajaran Pesantren, Kepribadian Pesantren merupakan lembaga non formal yang tumbuh dari dan dalam masyarakat untuk melayani berbagai kebutuhan masyarakat. Pesantren tidak hanya dijadikan sebagai lembaga ilmu keagamaan belaka, akan tetapi pesantren adalah satu kesatuan integral yang tidak dapat lepas dari realitas obyektif agar mampu menjawab tantangan zaman. Kepribadian santri merupakan tujuan utama dari pesantren. Para ulama’ sepakat bahwa moralitas seorang santri menduduki ranking teratas mengungguli kompetensi keilmuannya. Dalam hal ini kepribadian/akhlak dikedepankan sampai-sampai mengalahkan kedalaman ilmu. Tujuan dilaksanakan penelitian ini adalah untuk medeskripsikan bentuk-bentuk pembelajaran pondok pesantren salafiyah Bahrul Muhtadin, pelaksanaan pembelajaran pondok pesantren salafiyah Bahrul Muhtadin, serta mendeskripsikan pelaksanaan pembelajaran pondok pesantren salafiyah Bahrul Muhtadin dalam membentuk kepribadian santri. Rancangan penelitian ini menggunakan metode penelitian deskriptif kualitatif. Pengumpulan data dilakukan melalui teknik wawancara, observasi, dan studi dokumen. Penelitian pelaksanaan pembelajaran di pondok pesantren salafiyah bahrul muhtadin kota batu dalam membentuk kepribadian santri. Penelitian dilakukan di pondok pesantren salafiyah Bahrul Muhtadin Kota Batu. Sumber data dalam penelitian ini adalah masyarakat pesantren Bahrul Muhtadin Kota Batu. Analisis data hasil penelitian dilakukan dengan reduksi data, penyajian data dan penarikan kesimpulan (verivikasi). Hasil Penelitian menunjukkan: (1) Bentuk-bentuk pembelajaran di Pondok Pesantren Salafiyah Bahrul Muhtadin dibagi menjadi beberapa macam diantaranya Madrasah Diniyah, Pengkajian kitab kuning, dan Toriqoh Qodiriyah wanaqsyabandiyah. Pembelajaran Pondok Pesantren Bahrul Muhtadin menggunakan sistem belajar mengajar tradisional dengan pengajian kitab secara bandongan atau sorogan kepada bapak Kyai dan ustadz dan menggunakan paduan kitab-kitab kuning salaf karya para ulama' terdahulu, baik dalam bidang tauhid, fiqih, bahasa, maupun tasawuf. (2). Pelaksanaan pembelajaran di pondok pesantren Bahrul Muhtadin dimulai sejak subuh hingga malam hari. secara garis besar Kegiatan tersebut dilaksanakan berdasarkan programnya. Unsur-unsur Pelaksanaan Pembelajaran Pondok Pesantren Salafiyah Bahrul Muhtadin meliputi beberapa aspek antara lain : waktu pelaksanaan, kurikulum pembelajaran, metode pembelajaran, dan evaluasi. (3).Dalam rangka membentuk kepribadian santri Pesantren Bahrul Muhtadin menerapkan beberapa hal antara lain pemahaman santri terhadap materi yang diajarkan, pembiasaan hidup bermoral, dan penerapan disiplin melalui tata tertib. Berdasarkan hasil penelitian di atas maka saran yang dapat disampaikan adalah: (1) Pengasuh Pesantren hendaknya memberikan program ketrampilan agar santri mempunyai bekal lebih. (2) Dalam kurikulum pembelajaran sebaiknya dimasukkan pengetahuan umum. (3) Dalam pelaksanaan pembelajaran hendaknya ustadz lebih variatif lagi dalam menggunakan metode pembelajaran. (4)Hendaknya dalam proses pembelajaran ustadz menambah media pembelajaran. (5)Hendaknya santri selalu fokus dalam menempuh pembelajaran dan selalu menaati tata tertib pesantren.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |