Pengaruh kupon, maturitas, yield to maturity obligasi, dan suku bunga SBI terhadap harga pasar obligasi perusahaan manufaktur yang listing di BEI periode 2007-2009 / Dhana Teguh Arfianto

 

Kata kunci: kupon, maturitas, yield to maturity, suku bunga SBIdan harga pasar dan harga pasar obligasi Obligasi merupakan instrumen keuangan jangka yang diperdagangkan di pasar sekunder, jika obligasi diperdagangkan maka tingkat imbal hasil (yield) investor akan terus berubah seiring berjalannya waktu dan mengikuti pergerakan bunga pasar. Perubahan ini terjadi karena obligasi memiliki karakteristik pendapatan berupa bunga. Berdasarkan karakteristik obligasi tersebut maka penelitian ini bertujuan untuk menguji seberapa besar pengaruh kupon, maturitas, yield to maturity obligasi dan suku bunga SBI terhadap harga pasar obligasi perusahaan manufaktur serta mendeskripsikan masing-masing variabel yakni kupon, maturitas, yield to maturity obligasi dan suku bunga SBI terhadap harga pasar obligasi perusahaan periode 2007-2009. Kupon obligasi adalah tingkat bunga yang dibayarkan oleh penerbit obligasi yang umumnya setiap 1, 3, 6 atau tahunan sampai obligasi tersebut jatuh tempo. Maturitas obligasi adalah jangka waktu obligasi. Suku bunga SBI adalah harga atau balas jasa dari peminjam kepada pemberi pinjaman atas pinjaman dalam waktu tertentu. Yield to Maturity adalah hasil yang diperoleh investor sampai dengan jatuh tempo. Harga pasar obligasi adalah nilai arus kas sekarang yang ditawarkan dalam nominal presentase yaitu at par, at premium, dan at discount. Rancangan penelitian ini adalah penelitian asosiatif yang bertujuan untuk mengetahui pengaruh variabel kupon, maturitas, yield to maturity obligasi dan suku bunga SBI terhadap harga pasar obligasi perusahaan manufaktur. Populasi dalam penelitian ini adalah obligasi perusahaan manufaktur yang beredar pada periode 2007-2009. Dengan teknik purposive sampling diperoleh sampel sejumlah 12 obligasi. Data yang digunakan adalah data sekunder, yang dipublikasikan oleh Harian Bisnis Indonesia 2007-2009, Indonesian Bond Market Directory (IBMD) 2008-2009, Bank Indonesia, dan Bursa Efek Indonesia. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi berganda. Hasil penelitian menunjukkan bahwa kupon obligasi memiliki tingkat bunga yang tetap dan fluktuatif, maturitas memiliki waktu jatuh tempo yang bervariasi jangka pendek, menengah dan panjang, juga suku bunga SBI cenderung mengalami penurunan, yield to maturity yang searah dengan pergerakan suku bunga serta harga pasar obligasi bervariasi at par, at premium dan at dicount. Pengaruh secara parsial menunjukan adanya pengaruh positif pada kupon obligasi perusahaan manufaktur sedangkan maturitas, yield to maturity dan suku bunga SBI memiliki pengaruh yang negatif terhadap harga pasar obligasi. Pengaruh negatif yang ditunjukkan oleh variabel yield to maturity dikarenakan harga pasar obligasi merupakan nilai sekarang arus kas. Seiring dengan meningkatnya hasil diinginkan, nilai sekarang dari arus kas akan menurun sehingga harga juga akan turun. Secara simultan variabel kupon, maturitas, yield to maturity obligasi dan suku bunga SBI berpengaruh hterhadap harga pasar obligasi perusahaan manufaktur.

Keanekaragaman arthropoda permukaan tanah pada pertanaman jarak pagar (Jatropha curcas L.) di kebun percobaan Karangploso dan Asembagus / Irma Nurita Rahmawati

 

KataKunci: keanekaragaman, arthropoda permukaan tanah, jarak pagar. Jarakpagar(JatrophacurcasL.)merupakansalahsatutumbuhanpotensialyangsaatinitelahdikembangbiakkankarenabijinyamenghasilkanminyakyangdapatdimanfaatkanuntukbahanbakaralternatifyangbernilaiekonomi.PertumbuhantanamanjarakpagartidaklepasdariperananArthropodapermukaantanahyangbersifatmenguntungkandanmerugikan.HinggasaatiniinformasikeanekaragamanArthropodapermukaantanahyangadapadapertanamanjarakpagarmasihsangatterbatas.AdapuntujuandaripenelitianiniadalahuntukmengetahuikeanekaragamanArthropodapermukaantanahpadapertanamanjarakpagardiKP.KarangplosodanKP.AsembagussertamengetahuiperbedaankeanekaragamanantaraArthropodapermukaantanahpadapertanamanjarakpagardikedualokasi. Jenispenelitianyangdigunakandalampenelitianiniadalahdeskriptif–komparatifdenganpendekatankuantitatif.PenelitiandilakukanpadabulanFebruari-April2010diKebunPercobaanBalittasdiKarangploso¬MalangdanAsembagus-Situbondo.Pengambilandatamenggunakanteknikpitfalltrap.PopulasidalampenelitianadalahArthropodapermukaantanahpadapertanamanjarakpagarsedangkansampelnyaadalahArthropodapermukaantanahyangterjebakpadapitfalltrap.TingkatkeanekaragamanArthropodapermukaantanahdihitungdenganindekskeanekaragamanShanon-WienerdanuntukmembandingkankeanekaragamanArthropodatanahantaraKP.KarangplosodanKP.Asembagusdengananalisisstatistikvariandanujittarafsignifikan5%. KeanekaragamanArthropodapermukaantanahpadapertanamanjarakpagarKP.Karangplosodiperoleh28familidenganfamiliyangmemilikijumlahpopulasitertinggiadalahFormicidae,Isotomidae,Hypogastruraidae,Oncopoduridae,danGryllidae,sedangkandiKP.Asembagusadalah31familidenganfamiliyangmemilikijumlahpopulasitertinggiadalahHypogastruraidaedanFormicidae.KeanekaragamanArthropodapermukaantanahdiKP.Karangplosoadalah2,1danKP.Asembagussebesar2,5keduanyatergolongsedang.BerdasarkanujivariankeanekaragamanArthropodapermukaantanahdikedualokasiP>0,05.KeanekaragamanArthropodapermukantanahKP.KarangplosodanKP.Asembagusmemilikivarianyangsama,sedangkananalisisujitdiperolehhasilP>0,05yangberartitidakterdapatperbedaankeanekaragamanantaraArthropodapermukaantanahpadapertanamanjarakpagardikedualokasi.KeanekaragamanArthropodapermukaantanahdikedualokasiyangtidaklepasdaripengaruhlingkungan,sepertisuhu,kelembaban,curahhujan,ketersediaanmakanan(nutrisi)danpredasi.

Upaya meningkatkan pembelajaran IPA siswa kelas IV MI Darul Ulum Gondangwetan dengan pendekatan kooperatif model STAD / Hidayati

 

Kata Kunci: Student Team Achievement Division (STAD), Hasil Belajar dan IPA Ilmu pengetahuan alam (IPA) merupakan ilmu pengetahuan yamg berkaitan erat dengan cara mencari tahu tentang alam secara sistematis. IPA bukan hanya penguasaan kumpulan pengetahuan saja yang berupa fakta-fakta, konsep-konsep atau prinsip-prinsip saja tetapi juga merupakan suatu proses penemuan. Penggunaan metode ceramah dalam pembelajaran IPA kurang efektif karena pembelajaran masih terpusat pada guru dan siswa cenderung pasif sehingga hasil belajar siswa masih rendah. Untuk meningkatkan hasil belajar siswa dalam pembelajaran IPA pada siswa kelas IV di MI Darul Ulum adalah melalui pembelajaran koopertif (Cooperative Learning) karena penerapan pembelajaran kooperatif ini dalam pembelajaran IPA merupakan satu bentuk perubahan pola pikir dalam kegiatan belajar mengajar IPA di sekolah. Dalam pembelajaran kooperatif terdapat beberapa variasi model yang dapat diterapkan, yaitu diantaranya: Student Team Achievement Division (STAD). Skripsi ini mempelajari tentang: (1) penerapan pendekatan kooperatif model STAD pada mata Pelajaran IPA siswa kelas IV di MI Darul Ulum Gondangwetan; (2) aktivitas siswa kelas IV MI Darul Ulum Gondangwetan dalam pembelajaran IPA dengan menggunakan pendekatan kooperatif model STAD; (3) hasil belajar pada mata pelajaran IPA siswa kelas IV MI Darul Ulum Gondangwetan setelah menggunakan pendekatan kooperatif model STAD Tujuan penelitian ini adalah (1) mendiskripsikan penerapan pendekatan kooperatif model STAD pada mata pelajaran IPA siswa kelas IV MI Darul Ulum Gondang wetan; (2) mendiskripsikan aktivitas siswa MI Darul Ulum Gondangwetan dalam pembelajaran IPA dengan menggunakan pendekatan kooperatif model STAD; (3) mendiskripsikan hasil belajar pada mata pelajaran IPA siswa kelas IV MI Darul UlumGondangwetan setelah menggunakan pendekatan kooperatif model STAD. Penelitian ini menggunakan metode analisis deskriptis kualitatif, yaitu suatu metode penelitian yang bersifat menggambarkan kenyataan atau fakta dengan data yang diperoleh saat penelitian. Secara umum proses analisis data dimulai dengan menelaah seluruh data yang tersedia dari observasi awal, perencanaan, pelaksanaan tindakan, observasi, dan refleksi pada siklus I. Kemudian ditarik kesimpulan untuk selanjutnya dilakukan tindakan pada silkus II, pada siklus II juga diperoleh data dari perencanaan, pelaksanaan, observasi, dan refleksi. Dari hasil penelitian diperoleh data skor hasil observasi aktivitas guru siklus I pertemuan I skor yang diperoleh sebesar 54,6%, pertemuan II sebesar 68%. Sedangkan pada siklus II pertemuan I sebesar 93%, dan pertemuan II 98%. Peningkatan aktivitas siswa dapat dilihat pada prosentase aktivitas siswa yang semakin meningkat.Hasil belajar siswa pada siklus I nilai rata-rata yang diperoleh 62,5 dan pada tahap pelaksanaan siklus II nilai rata-rata mencapai 76,35%. Hal ini menunjukkan adanya peningkatan hasil belajar IPA siswa dengan menggunakan model STAD Dari hasil penelitian dan pembahasan, diperoleh kesimpulan bahwa penerapan model STAD dalam pembelajaran IPA dapat meningkatkan aktivitas dan hasil belajar siswa kelas IV MI Darul Ulum Gondang Wetan Berdasarkan penelitian ini maka disarankan kepada guru untuk selalu menerapkan model-model pembelajaran yang bervariasi dan bagi kepada sekolah hendaknya membantu menyediakan sarana pembelajaran yang tidak memungkinkan siswa untuk membawanya.

Penerapan metode eksperimen untuk meningkatkan kemampuan sains permulaan pada anak didik kelompok A TK Negeri Pembina Kota Blitar / Anis Masriyah

 

Kata kunci : Sains Permulaan, Metode Eksperimen, Anak TK Pemilihan judul tersebut dengan latar belakang adanya penerapan metode yang kurang tepat, yaitu metode pemberian tugas yang tidak melibatkan anak secara langsung, sehingga penguasaan anak tentang sains sangat rendah, untuk itu peneliti mencoba menggunakan metode eksperimen dalam pembelajaran sains permulaan. Tujuan dari penelitian ini adalah untuk meningkatkan kemampuan sains permulaan anak melalui penerapan metode pembelajaran eksperimen. Penelitian yang dilakukankan peneliti hanya meneliti kegiatan sains permulaan pada pembelajaran kognitif di area sains untuk Kelompok A yang dilakukandi TK Negeri Pembina Kota Blitar. Peneliti menggunakan pedoman penilaian Unjuk kerja yang dilakukan anak dan observasi. Penelitian ini dirancang dengan penelitian tindakan kelas (PTK) pada setiap siklusnya terdiri dari planing (perencanaan), acting & observasing (tindakan & pengamatan), reflecting (refleksi) dan revise plan (revisi rencana). Berdasarkan hasil penelitian tindakan yang menunjukkan bahwa terjadi peningkatan kemampuan sains permulaan dengan penerapan metode pembelajaran eksperimen. Pada siklus I peningkatan mencapai 22,342% dan diperoleh rata-rata penilaian anak dalam sains permulaan sebesar 70,353%. Pada siklus II peningkatan mencapai 17,202% dan diperoleh rata-rata penilaian sebesar 87,555%. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa dengan menerapkan metode pembelajaran eksperimen, kemampuan sains anak meningkat. Pembelajaran dari berpusat pada guru menjadi berpusat pada anak, perubahan penilaian ke arah yang komprehensif yang tidak hanya dengan hasil kerja anak, dan pengembangan situasi pembelajaran ke arah yang lebih kondusif, maka disarankan untuk menggunakan metode eksperimen dalam kegiatan pembelajaran sains permulaan pada bidang pengembangan Kognitif.

Peningkatan keterampilan berbicara dengan pendekatan pragmatik pada siswa kelas V MI Miftahul Ulum Bajangan Gondangwetan Pasuruan / Lilis Suryani

 

Kata kunci: Pendekatan pragmatik, keterampilan berbicara, Sekolah Dasar. Bahasa Indonesia berperan sebagai alat untuk mempersatukan keberagaman bahasa, adat istiadat, suku, dan budaya. Bertolak dari hal tersebut, siswa diharapkan memiliki kemampuan berkomunikasi dengan bahasa Indonesia yang baik dan benar. Permasalahan yang terjadi di kelas adalah siswa belum mampu berbicara dengan bahasa Indonesia yang baik dan benar serta tidak sesuai dengan situasi dan konteks, sehingga perlu adanya inovasi dalam pembelajaran yang bertujuan untuk mencapai tujuan pembelajaran, yaitu meningkatkan hasil belajar keterampilan berbicara siswa kelas V MI Miftahul Ulum Bajangan yang mencakup, kelancaran berbicara, intonasi, ketetapan dan ketepatan ucapan, pilihan kata yang tepat, kontak mata yang sesuai dengan situasi dan konteks saat berbicara. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan pragmatik. Rancangan penelitian ini menggunakan jenis penelitian tindakan kelas (PTK) melalui tahap perencanaan, tindakan, pengamatan, dan refleksi. Subjek penelitian berjumlah 16 orang siswa di MI Miftahul Ulum Bajangan kecamatan Gondangwetan kabupaten Pasuruan. Teknik pengumpulan data dengan menggunakan tes, observasi dan wawancara selama proses pembelajaran. Dalam penelitian ini, pendekatan pragmatik diterapkan dalam matapelajaran Bahasa Indonesia di kelas V MI Miftahul Ulum Bajangan. Hasil penelitian yang diperoleh adalah sebagai berikut; hasil belajar siswa berupa pemahaman konsep tentang situasi dan konteks saat berbicara secara klasikal mengalami peningkatan dari 45,4% pada pra tindakan menjadi 58,18% pada siklus I. Selanjutnya menjadi 80,6% pada siklus II. Hasil belajar yang berupa tes secara lisan pada siklus I meningkat dari 46,62% menjadi 76,85% pada siklus II. Secara keseluruhan hasil belajar siswa pada pra tindakan masih dibawah nilai standar minimum yaitu 60% mengalami peningkatan sehingga mencapai di atas standar minimum dan mencapai target yang telah ditetapkan setelah pembelajaran dengan menggunakan pendekatan pragmatik pada siklus I dan II. Hal ini disimpulkan bahwa pendekatan pragmatik telah berhasil meningkatkan keterampilan berbicara siswa. Dari hasil penelitian ini diharapkan agar guru menerapkan pembelajaran dengan pendekatan pragmatik dalam mengajarkan matapelajaran Bahasa Indonesia khususnya keterampilan berbicara.Bagi peneliti lain diharapkan dapat meneliti dengan menggunakan metode atau pendekatan lain dalam rangka meningkatkan mutu pembelajaran di sekolah.

Perbedaan perilaku agresi pada siswa SMA Laboratorium Universitas Negeri Malang yang berasal dari keluarga TNI dan keluarga non-TNI / Ainun Jariyah

 

Kata kunci: perilaku agresi, remaja Agresi merupakan bentuk pencurahan energi yang berlebih pada diri seseorang yang tampak dalam tindakan secara fisik ataupun verbal dan bertujuan untuk menekan, mengalahkan orang lain atau mengalahkan masalah yang sangat sulit. Para pelaku agresi bermacam-macam dari anak kecil hingga orang dewasa dengan latar belakang permasalahan yang beraneka ragam pula. Remaja sebagai salah satu pelaku agresi seringkali membuat resah lingkungan disekitarnya. Itu semua dikarenakan adanya persaingan atau tuntutan untuk memenuhi kebutuhan akan pengetahuan yang semakin bertambah pada remaja. Remaja yang sedang mencari identitas diri cenderung melakukan hal-hal yang menurut orang tua mereka bertentangan dengan apa yang dianggap sesuai. Kondisi semacam ini mengundang perhatian orang tua untuk mengendalikan anak dengan segera. Apabila upaya tidak dapat dilaksanakan, ada kecenderungan orang tua bertindak tidak sabar, melakukan tindakan kekerasan dan menyakiti anak. Bahkan ada pula orang tua yang malu mengakui kesalahan kemudian akan membentuk sistem pertahanan diri dan berusaha lebih keras lagi, akibat bagi anak apabila mendapat perlakuan yang keras dari orang tua dan sering menyaksikan perilaku agresif orang tua maka anak akan berperilaku agresif pula. Penelitian ini adalah penelitian deskriptif dan komparatif. Penelitian ini menggunakan uji terpakai. Penelitian dilakukan di SMA Laboratorium Universitas Negeri Malang dengan subjek penelitian berjumlah 64 remaja sesuai dengan karakteristik yang telah ditentukan dengan reliabitas 0,940. Instrumen yang digunakan dalam penelitian ini berupa skala perilaku agresi yang disusun berdasarkan metode Rating yang Dijumlahkan (Methods of Summated Ratings) dari Likert. Data yang diperoleh dianalisis menggunakan teknik analisis deskriptif dan analisis Uji-t, yaitu Uji Independent Sample Test dengan taraf signifikansi 0,05. Hasil penelitian menunjukkan t hitung sebesar 2, 937 dengan taraf signifikansi Sig.(2-tailed) sebesar 0,005 < 0,05 sehingga dapat disimpulkan bahwa H_0 ditolak, artinya ada perbedaan perilaku agresi pada remaja yang berasal dari keluarga TNI dengan remaja yang berasal dari keluarga non-TNI. Nilai mean-1 lebih besar dari nilai mean-2 atau 118,78 > 101,81 menunjukkan bahwa perilaku agresi remaja yang berasal dari keluarga TNI lebih tinggi dari pada remaja yang berasal dari keluarga non-TNI. Berdasarkan hasil penelitian, disarankan bagi remaja sendiri bersikap lebih terbuka kepada orang tua maupun dari pihak sekolah, sehingga dapat menemukan penyelesaian atau solusi yang terbaik atas masalah yang dihadapi dan menumbuhkan rasa tanggung jawab atas segala resiko yang harus ditanggung karena perilaku agresi yang dilakukan.

Pengaruh karakteristik perusahaan terhadap kelengkapan social disclosure pada laporan tahunan perusahaan high profile yang terdaftar di BEI periode 2006-2008 / Sri Utami

 

Pengaruh relationship marketing terhadap loyalitas nasabah (studi pada nasabah tabungan Britama PT. Bank Rakyat Indonesia Tbk. Cabang Malang Martadinata) / Irul Kurniawan

 

Kata Kunci: Relationship Marketing (Trust, Commitment, Communication, Conflict Handling), Loyalitas Nasabah. Perkembangan dunia bisnis yang pesat dewasa ini, telah mendorong semakin tingginya tingkat persaingan terutama pada sektor jasa. Bisnis jasa sangat berpengaruh dalam dunia modern, hal ini bisa dilihat dalam kehidupan sehari-hari yang tidak bisa terlepas dari berbagai sektor jasa, seperti jasa kesehatan, jasa transportasi, jasa perbankan, jasa asuransi dan lain-lain. Tingginya persaingan antar bank saat ini, memacu bank-bank untuk berlomba menarik nasabah dengan memberikan layanan perbankan yang beraneka ragam. Benteng utama agar nasabah tidak lari kepada pesaing adalah bank harus membuat nasabah menjadi loyal. Oleh sebab itu, kegiatan utama perusahaan pada saat ini adalah menciptakan loyalty, tidak cukup hanya satisfaction. Bank berusaha mendesain relationship marketing yang dimiliki sebaik mungkin untuk menciptakan dan meningkatkan loyalitas nasabah.BRI sebagai Bank Pemerintah pertama di Republik Indonesia yang didirikan sejak tahun 1895 dan mendedikasikan pelayanan pada masyarakat kecil sebagai hal yang utama dianggap sebagai salah satu lembaga keuangan yang memiliki nasabah-nasabah yang loyal. Tujuan penelitian ini adalah untuk mengetahui: pengaruh secara parsial Relationship Marketing (Trust (X1), Commitment (X2), Communication (X3), dan Conflict Handling (X4)), terhadap Loyalitas Nasabah (Y), pengaruh secara simultan Relationship Marketing (Trust (X1), Commitment (X2), Communication (X3), dan Conflict Handling (X4)), terhadap Loyalitas Nasabah (Y), dan variabel yang dominan berpengaruh terhadap Loyalitas Nasabah. Penelitian ini termasuk dalam penelitian deskriptif korelasional. Populasi yang diambil dalam penelitian ini adalah nasabah tabungan Britama PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata per Agustus 2009. Penentuan sampel menggunakan rumus Slovin dengan persen kelonggaran ketidaktelitian yang digunakan adalah 5% sehingga diperoleh sampel sebanyak 330 orang. Teknik penentuan sampel yang digunakan adalah Proportional Random Sampling dengan teknik pengambilan sampel menggunakan Accidental Sampling dengan menggunakan kuesioner sebagai instrumen penelitian. Kuesioner dalam penelitian ini termasuk dalam kuesioner tertutup menggunakan skala Likert dengan 5 alternatif pilihan jawaban. Untuk menguji kelayakan instrumen dilakukan uji validitas dan reliabilitas dengan sampel uji coba berjumlah 40 orang responden. Proses pengolahan data menggunakan software SPSS 16 for Windows. Selain itu diketahui pula Adjusted R Square sebesar 0,505. Artinya bahwa 50,5% loyalitas nasabah pada nasabah tabungan Britama PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata dipengaruhi oleh Relationship Marketing (Trust, Commitment, Communication, dan Conflict Handling), Sedangkan sisanya sebesar 49,5% dipengaruhi oleh faktor-faktor lain yang tidak diteliti dalam penelitian ini. Berdasarkan penelitian ini hasil yang diperoleh adalah: (1) secara parsial ada pengaruh positif yang signifikan Relationship Marketing (Trust, Commitment, Communication, dan Conflict Handling) terhadap loyalitas nasabah, (2) secara simultan terdapat pengaruh positif yang signfikan antara Relationship Marketing (Trust, Commitment, Communication, dan Conflict Handling) terhadap loyalitas nasabah, (3) variabel yang dominan pengaruhnya terhadap loyalitas nasabah dalam penelitian ini adalah variabel commitment. Saran yang dapat diberikan dalam penellitian ini adalah: (1) hendaknya PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata terus memperhatikan dan mempertahankan relationship marketing sebagai salah satu keunggulan kompetitifnya. (2) perusahaan harus lebih inovatif dalam strategi memperoleh nasabah. Salah satu cara yang terbaik adalah dengan menerapkan program member get member yaitu nasabah mengajak orang lain untuk menjadi nasabah PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata. (3) hendaknya mahasiswa lain yang ingin menulis masalah tersebut lebih lanjut juga menggunakan nasabah lain diluar nasabah tabungan Britama sebagai obyek penelitian, atau mengkaji aspek lain diluar relationship marketing sebagai variabel penelitian. (4) diharapkan pada peneliti selanjutnya untuk mengambil obyek atau tempat penelitian yang berbeda dari penelitian ini untuk lebih mengembangkan penelitian yang sejenis.

Penerapan metode pembelajaran proyek memasak untuk mengembangkan kemampuan kognitif pada kelompok A di TK. Arjuno 2 Kota Batu / Elni Disna Windri

 

Kata kunci: kemampuan kognitif, metode proyek. Kemampuan kognitif setiap anak berbeda, ada anak yang sudah mampu dan ada anak yang belum mampu. Namun pada kenyataannya di TK Arjuno 02 Batu banyak anak yang kurang dalam bidang kognitif, terutama dalam mengenal ukuran berat atau ringan. Seorang anak akan mengalami kesulitan membaca angka pada timbangan yang jarumnya bergoyang-goyang oleh karena itu timbangan yang paling baik untuk anak adalah timbangan tua yang sederhana atau timbangan neraca.Dengan pembelajaran melalui metode proyek memasak bertujuan mengembangkan kemampuan kognitif dalam mengenal ukuran berat. Penelitian ini di lakukan di TK Arjuno 02 Batu, tanggal 21 September 2010 sampai dengan 14 Oktober 2010. Metode penelitian yang di gunakan adalah Penelitian Tindakan Kelas (PTK). Penilaian yang di gunakan adalah lembar observasi. Dengan di terapkannya metode pembelajaran proyek masak ini, terbukti anak lebih mengenal mana yang berat dan yang ringan, anak apat menimbang secara seimbang dengan timbangan neraca, anak tahu satuan, gelas, sendok. Berasar hasil penelitian ini di sarankan agar guru dapat menerapkan metode ini guna meningkatkan kemampuan kognitif anak dalam mengenal ukuran berat ringan, banyak sedikit, menimbang benda dan mengenal satuan wadah. Selain itu juga dapat meningkatkan mutu pembelajaran di sekolah.

Pemanfaatan lingkungan sekolah untuk meningkatkan kemampuan menulis kalimat sederhana kelas II MI Darussalam Rembang Pasuruan / Erna Irawati

 

Kata kunci : Lingkungan Sekolah, Kemampuan Menulis, Kalimat Sederhana, SD. Salah satu keterampilan berbahasa yang cukup komplek adalah menulis, keterampilan menulis di sekolah dasar merupakan sesuatu yang perlu dikuasai oleh setiap siswa sekolah dasar, karena keterampilan ini menjadi sarana untuk mempelajari seluruh mata pelajaran di sekolah. Namun tidak sedikit siswa yang belum menguasai cara-cara menulis, terutama menulis kaliat sederhana khususnya bagi siswa kelas II MI Darussalam Rembang Pasuruan. Hal ini kemungkinan disebabkan oleh teknik meupun metode yang kurang tepat dalam penyampaian materi, sehingga peneliti ingin menciptakan suasana yang baru dalam kegiatan belajar mengajar dengan memanfaatkan lingkungan sekolah sebagai sarana dalam penyampaian materi atau sebagai media dalam pembelajaran menulis kalimat sederhana di kelas II MI Darussalam Rembang Pasuruan. Tujuan dari penelitian ini yaitu: a) mendeskripsikan penerapan pembelajaran dengan memanfaatkan lingkungan sekolah untuk meningkatkan kemampuan menulis kalimat sederhana, dan b) mendeskripsikan pemanfaatan lingkungan dalam pembelajaran dapat meningkatkan kemampuan menulis kalimat sederhana. Obyek sasaran penelitian ini adalah siswa kelas II MI Darussalam Rembang Pasuruan. Adapun metode yang digunakan oleh peneliti dalam pengumpulan data adalah wawancara, observasi , dan tes. Dengan menggunakan instrumen yang berupa pedoman wawancara, pedoman observasi, dan pedoman penilaian. Penelitian ini dilakukan dalam tiga tahap yaitu tahap pra siklus, siklus 1 dan siklus 2. Pada tahap pra siklus dari 11 siswa 3 diantaranya tuntas dalam belajar dengan nilai 80, 75, dan 70. Pada siklus 1 dari 11 siswa 7 diantaranya yang tuntas dalam belajar dengan nilai 90, 75, 70 80,85. Pada siklus 2 dari 11 siswa 9 diantaranya yang tuntas dalam belajar dengan nilai 95, 70, 75, 85. Dari hasil atau data diatas menunjukkan bahwa pemanfaatan lingkungnan sekolah dapat meningkatkan kemampuan menulis kalimat sederhana siswa kelas II MI Darussalam Rembang Pasuruan. Dengan demikian peneliti menyarankan kepada guru-guru yang lain hendaknya menggunakan lingkungan sekolah sebagai sarana dalampenyampaian materi agar kemampuan siswa dapat meningkat khususnya pada pembelajaran menulis kalimat sederhana.

Developing the honey comb challenge multimedia game courseware to improve the fourth graders' speaking skill at SDN Purwantoro II Malang / Ridhia Rizki Anugraini

 

Keywords: speaking, EYL, multimedia/media, courseware. This study focused on developing The Honey Comb Challenge multimedia game courseware to improve the fourth graders’ speaking skill especially in answering the teacher’s questions dealing with location (preposition of place) at SDN Purwantoro II Malang. Multimedia game courseware that is used for foreign language teaching and learning will make young learners actively participate to speak, in addition, the children would learn to communicate and express their creativity by using multimedia (Lee, 2009). This research and development (R&D) adopts the framework of Taba cited in Dubin and Olhstain (1986: 2). The materials were developed based on the basic competence of teaching speaking for the fourth graders in the syllabus used at SDN Purwantoro II Malang. The courseware consists of two themes which contains pictures dealing with location (preposition of place), music, and a music video. The courseware was assembled in the form of CD-ROM which was completed with autorun CD-ROM. The researcher also developed a guidance book of the courseware which covers the ways to navigate the courseware, the rules of the game, questions and answers for each theme in the game, and speaking scoring rubric to assess the students’ speaking skill. In courseware try-out, the students liked and enjoyed the activities in the courseware. They were really attracted and interested in the multimedia application which consists of animation and audio so that they could perform their ability in speaking skill well. Therefore the use of The Honey Comb Challenge multimedia game courseware is expected to meet the needs of media in teaching and learning speaking skill for the fourth graders at SDN Purwantoro II Malang, with the hope that it can improve their speaking skill.

Pengembangan paket bimbingan pengendalian emosi bagi siswa sekolah menengah pertama / Elok Nur Khoirisami

 

Katakunci:paketbimbingan,pengendalianemosi,siswaSMP. SiswaSMPsebagaikelompokusiaremaja,tidaklepasdarifenomenayangterjadipadasetiapremaja.SiswaSMPtermasukdalamkategoriremajaawalataumasatransisi,yangterkadangintensitasmunculnyaproblememosiseringdibandingkandenganremajaakhir.Selamamasatransisiini,remajamengalamikrisisidentitas.Krisisidentitaspadasaat-saattertentuseringkalimenimbulkanketidakstabilanemosicemas,bingung,danmerasatidakbahagia.Problememosiyangdialamiremaja,bilatidaksegeradipecahkanakanmenghambatremajadalammelakukanpenyesuaiandenganlingkungansosialdanjugadengandirinyasendiri.Konselorperlumemberikanbimbingankarenapengendalianemosibukanlahsesuatuyangdimilikisecaraalamiolehindividu,melainkanmerupakansesuatuyangdipelajari. TujuanseperangkatpengembanganpaketbimbinganpengendalianemosiadalahuntukmenghasilkanPaketBimbinganPengendalianEmosibagiSiswaSMPyanglayak,tepat,berguna,danmenarikbagisiswaSMP.ProdukyangdihasilkandaripengembanganiniadalahPaketBimbinganPengendalianEmosiyangterdiriatas(1)panduanPaketBimbinganPengendalianEmosiuntukkonselor,(2)materiPaketBimbinganPengendalianEmosiuntuksiswa,dan(3)bukukerjapengendalianemosiuntuksiswa;yangterdiriatastigapenggalan,yaitu:(I)HakikatEmosi,yangterdiriatas(a)PengertiandanJenis-jenisEmosidan (b) PerkembanganEmosipadaRemaja,(II)PengaruhEmosi,dan(III)CaraPengendalianEmosi,yangterdiriatas(a)PengaturanDiri(selfregulation)dan(b)PengaturanEmosi(emotionalregulation).Paketinidisusundenganmenggunakanmodelpembelajaranexperientiallearning. Penelitianinimerupakanpenelitianpengembanganyangmenggunakanlangkah-langkahpengembangandariBorg&Gall(1983)yangterdiriatastahapperencanaan,tahappengembanganproduk,dantahapujicoba.Subyekujicobaadalahahli,yaituahlibimbingandankonselingdanahlibahasa;ujicalonpenggunaproduk,yaitukonselor;danujikelompokkecil,yaitusatukelassiswaSMP.Datadikumpulkanmelaluiformatujiahlidanujicalonpenggunaberupaskalapenilaian,datayangdiperolehadalahdatakuantitatifdankualitatif.Sedangkanujikelompokkecilberupadatakualitatif.Datakuantitatifdianalisisdenganmenggunakananalisisreratadandatakualitatifdianalisisdenganmenggunakananalisisdeskriptif. BerdasarkanpenilaianahliBK,PaketBimbinganPengendalianEmosibagiSiswaSMPinisangatbergunauntuksiswadankonselordalammemberikanbimbingantentangpengendalianemosidenganrerata3,9.Dilihatdariaspekkelayakan,paketinisangatlayakdiberikankepadasiswadenganrerata3,56.Dariaspekketepatan,paketinitepatuntukdigunakanolehsiswadankonselordalam i memberianbimbinganpengendalianemosidenganrerata3.Adapunaspekkemenarikan,paketinimenarikdenganrerata3,sedangkanmenurutahliBahasa,PaketBimbinganPengendalianEmosibagiSiswaSMPsangattepat,dilihatdarikejelasan,kesesuaian,hubungankalimatsatudenganyanglain,danbahasayangdigunakanuntuksiswadenganrerata3,8.Berdasarkanujicalonpengguna(konselor);dilihatdariaspekkegunaan,paketinisangatbergunadenganrerata3,67;aspekkelayakan,paketinisangatlayakdenganrerata3,63;aspekketepatan,paketinisangattepatdenganreratata3,52;danaspekkemenarikan,paketinisangatmenarikdenganrerata3,75.Berdasarkanujikelompokkecil(siswa),PaketBimbinganPengendalianEmosimenarikdanpenjelasannyacukupjelas. Berdasarkanhasilpenelitiantersebut,saranyangdiberikanadalah:(1)konselorharusmemahamiprosedurbimbingandanmateribimbinganagarsiswadapatmencapaitujuanbimbinganyangdikehendaki,(2)konselorharuskreatifdalammengaturwaktukarenamengingatminimnyajamtatapmuka,(3)bagipenelitiselanjutnya,dapatmelakukanujiefektivitaspaketbimbinganpengendalianemosiuntukmengetahuikeefektivitasandankelayakanpenerapanpaketpengendalianemosidenganmenggunakanekperimensemu,dan(4)paketpengendalianemosiinidikembangkandenganmelakukanpenelitihandiSMPNegeri1PucukLamongan,sehinggaapabiladilakukanuntukSMPlain,makaperludilakukanpenyesuaian-penyesuaiandenganmenganalisiskembalikebutuhansiswaterhadappaketpengendalianemosi.

Prediksi kebangkrutan industri rokok di Indonesia yang listing di BEI periode 2005-2008 dengan menggunakan metode Z-score / Agus Subagiyo

 

Kata Kunci: Kebangkrutan, Industri Rokok, Analisis Altman (Z-Score) Kebangkrutan dapat diartikan sebagai kegagalan perusahaan dalam menjalankan kegiatan usahanya untuk menghasilkan laba. Kegagalan dapat dilihat dari dua segi, yaitu segi ekonomi dan segi keuangan. Dari segi ekonomi, perusahaan dianggap gagal apabila mempunyai return yang negative. Sedangkan dari segi keuangan, perusahaan dianggap gagal atau tidak mampu membayar utangnya pada tanggal jatuh tempo. Penelitian ini menggunakan metode Altman (Z-Score) untuk memprediksi kebangkrutan industri rokok. Rasio yang digunakan dalam metode ini terdiri dari modal kerja (X1), laba ditahan (X2), EBIT (X3), nilai pasar dari modal (X4), dan penjualan (X5). Dari hasil Z-Score kemudian perusahaan dapat dikategorikan apakah perusahaan tersebut berada pada kondisi sehat, rawan bangkrut, dan bangkrut berdasarkan titik cut off. Tujuan penelitian ini untuk menggambarkan kinerja keuangan, memprediksikan kebangkrutan dan melihat potensi kebangkrutan pada industri rokok yang dijadikan sampel penelitian dengan menggunakan metode Z-Score. Penelitian ini merupakan penelitian deskriptif yaitu penelitian yang tidak terdapat variabel bebas maupun terikat. Akan tetapi ada satu variabel utama yang menjadi fokus penelitian adalah tingkat kebangkrutan perusahaan yang diukur dengan indikator rasio-rasio Z-Score. Hasil penelitian menunjukkan bahwa perkembangan rasio pada PT BAT Indonesia Tbk mengalami penurunan dibandingkan dengan tiga perusahaan sampel yang lain. Selain itu PT BAT Indonesia Tbk pada tahun 2005 samapai dengan tahun 2008 dalam kondisi bangkrut, dan berdasarkan trend Z-Score tahun 2009 dua perusahaan dalam kondisi sehat, satu perusahaan dalam kondisi rawan bangkrut, dan satu perusahaan dalam kondisi bangkrut. Berdasarkan hasil penelitian tersebut, peneliti dapat menyarankan bagi perusahaan memperbaiki manajemen dan memperbaiki kinerja keuangannya masing-masing supaya perusahaan tetap berada dalam kondisi sehat dan tidak berada dalam kondisi rawan bangkrut maupun kondisi bangkrut.

Persepsi siswa kelas VI SD Negeri se Kecamatan Klojen Malang terhadap seks / Mila Husnatin Nihaya

 

Kata Kunci: Persepsi, Siswa kelas VI SD, Seks. Saat ini banyak dijumpai siswa kelas VI SD yang sudah mulai datang bulan (bagi anak perempuan) dan mengalami mimpi basah (bagi anak laki-laki). Hal ini tidak terlepas dari semakin berkembangannya teknologi informasi misalnya banyaknya acara TV yang memperlihatkan pergaulan bebas dan banyaknya situs porno atau majalah porno yang mudah didapat oleh anak. Perkembangan teknologi itulah yang menyebabkan banyak anak cepat matang. Anak yang mengalami cepat matang, kematangan seksualnya berkembang lebih cepat dari pada rata-rata anak yang lain. Perubahan yang begitu cepat ini menimbulkan anak penasaran atas apa yang terjadi pada dirinya. Mereka akan mencari informasi tentang seks dari mana saja, misal dari guru, teman, orangtua, media masa, dll. Informasi yang tepat akan memberikan dampak yang baik bagi anak sedangkan informasi yang tidak tepat akan memberikan dampak yang buruk bagi anak. Untuk mengetahui bagaimana pengetahuan siswa tentang seks, dilaksanakan penelitian mengenai persepsi siswa kelas VI SD Negeri Se Kecamatan Klojen Malang terhadap seks. Tujuan penelitian ini adalah untuk mengetahui persepsi siswa kelas VI SD Negeri Se Kecamatan Klojen Malang terhadap seks. Tujuan persepsi siswa kelas VI terhadap seks dapat dijabarkan sebagai berikut: (1) mengetahui persepsi siswa tentang pengertian seks, (2) mengetahui persepsi siswa tentang perkembangan seksual, (3) mengetahui persepsi siswa tentang sumber belajar seks, (4) mengetahui persepsi siswa tentang etika bergaul. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif kuantitatif. Populasi penelitian adalah siswa kelas VI SD Negeri Se Kecamatan Klojen Malang. Sampel penelitian sebanyak 117 orang siswa kelas VI SD Negeri Se Kecamatan Klojen Malang. Teknik pengambilan sampel yang digunakan adalah multiple stage sample yaitu dengan menggunakan area probability sampel dan simple random sampling. Data dikumpulkan dengan angket yang dianalisis dengan teknik persentase. Hasil penelitian mengenai persepsi siswa kelas VI SD Negeri Se Kecamatan Klojen Malang Terhadap Seks, menunjukkan bahwa banyak siswa cukup paham tentang pengertian seks. Banyak siswa yang sangat paham tentang perkembangan seksual. Cukup banyak siswa yang sangat paham tentang sumber belajar seks. Cukup banyak siswa yang cukup paham tentang etika bergaul. Secara umum dapat disimpulkan bahwa banyak siswa yang sangat paham tentang seks, sedikit siswa yang cukup paham tentang seks, dan tidak ada siswa yang tidak paham tentang seks. Penelitian ini hendaknya dapat digunakan oleh guru kelas sebagai acuan dalam menyusun program bimbingan dan konseling. Penelitian ini hendaknya juga dapat dijadikan masukan peneliti lanjut untuk lebih memperluas populasinya dan mengembangkan instrumentnya sehingga diketahui hasil penelitian di lain populasi yang lebih dalam.

Penggunaan media domino bilangan untuk meningkatkan kemampuan berhitung perkalian dengan teknik permainan pada siswa kelas III SDN Percobaan 2 Malang / Titik Wijiastutik

 

Kata Kunci: domino bilangan, berhitung perkalian, permainan. Bermain merupakan kebutuhan yang utama bagi siswa pada usia SD. Untuk itu guru perlu memfasilitasi pembelajaran matematika yang sesuai dengan karakteristik siswa SD. Salah satu strategi yang digunakan dalam pembelajaran matematika adalah belajar melalui permainan. Dengan permainan diharapkan siswa tidak jenuh dan termotivasi untuk menyelesaikan masalah matematika khususnya perkalian. Penelitian ini bertujuan untuk mendeskripsikan: (1) proses pembelajaran matematika siswa kelas III SDN Percobaan 2 Malang dengan menggunakan domino bilangan, (2) kemampuan berhitung perkalian siswa kelas III SDN Percobaan 2 Malang setelah menggunakan media domino bilangan. Penelitian ini menggunakan pendekatan kualitatif. Jenis penelitiannya menggunakan PTK dengan model siklus yang dikembangkan oleh Kemmis dan Mc Taggart. Penelitian ini dilaksanakan dalam 2 siklus. Subjek penelitiannya adalah siswa kelas III SDN percobaan 2 Malang yang berjumlah 27 siswa. Adapun instrumen yang digunakan dalam penelitian ini adalah observasi, wawancara dan tes. Penelitian ini menggunakan standar ketuntasan belajar untuk individu yang ditetapkan 65 dan untuk ketuntasan klasikal 80%. Hasil penelitian menunjukkan bahwa aktivitas siswa pada saat proses pembelajaran matematika meningkat, ditandai dengan siswa yang aktif berdiskusi dengan kelompoknya, banyak siswa yang ingin maju menyampaikan hasil diskusinya. Kemampuan siswa memahami konsep perkalian setelah menggunakan media kartu bilangan juga mengalami peningkatan. Hal ini dapat dilihat dari nilai rata-rata siswa sebelum menggunakan kartu bilangan hanya mencapai 61,3. Setelah menerapkan permainan dengan kartu bilangan, nilai rata-rata siswa pada siklus I mencapai 72,4. Pada siklus II mengalami peningkatan lagi yaitu nilai rata-rata mencapai 84,6. Kesimpulan dari penelitian ini adalah (a) Penggunaan media kartu bilangan perkalian dalam proses pembelajaran matematika di SDN Percobaan 2 Malang telah memberikan kesempatan pada siswa untuk menemukan sendiri sebuah konsep perkalian, bekerja kelompok sehingga melatih sikap saling bekerjasama dengan teman, melatih keberanian siswa untuk mengungkapkan pendapatnya; (b) pembelajaran dengan menerapkan media kartu bilangan perkalian pada siswa SDN Percobaan 2 Malang dapat meningkatkan kemampuan siswa dalam berhitung perkalian. Saran yang dapat disampaikan antara lain: (a) guru hendaknya memberi pengarahan pada siswa agar dalam membuat kelompok tidak memilih-milih teman; (b) memberi penjelasan sampai siswa paham sebelum permainan dilaksanakan; (c) guru hendaknya selalu memberi motivasi (d) Guru hendaknya selalu mengingatkan siswa yang tidak mau bekerja dengan kelompok.

Penggunaan media kartu gambar untuk meningkatkan kemampuan berbahasa pada anak kelompok B di RA Miftahul Khoir / Indrarti Yhuaningsih

 

Kata kunci: media kartu gambar, kemampuan berbahasa, Roudhatul Athfal. Kemampuan bahasa sangat penting bagi anak usia dini, karena merupakan kemampuan dasar yang harus dimiliki anak sebagai persiapan membaca dan menulis untuk memasuki jenjang Sekolah Dasar. Untuk meningkatkan kemampuan bahasa anak, perlu adanya media pembelajaran yang dapat menarik dan menyenangkan pada saat pelaksanaan pelajaran membaca. Hasil observasi awal ditemukan bahwa anak RA Miftahul Khoir Grati Pasuruan masih rendah sebelum menggunakan kartu gambar. Sebagian anak belum mampu mencapai kriteria ketuntasan yang ditentukan oleh sekolah yaitu 60% dari ketuntasan individu. Berdasarkan hal ini, penggunaan media kartu gambar sangat tepat digunakan sebagai alternatif dalam proses pembelajaran. Tujuan penelitian ini adalah: 1) mendeskripsikan penggunaan media kartu gambar yang dapat meningkatkan kemampuan membaca anak kelompok B di RA Miftahul Khoir, 2) mendeskripsikan peningkatan kemampuan membaca anak kelompok B di RA Miftahul Khoir setelah diterapkan atau dibelajarkan dengan media kartu gambar. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan 2(dua) siklus. Masing-masing siklus terdiri atas 4 tahapan: perencanaan, pelaksanaan , observasi, dan refleksi. Subyek penelitian ini adalah anak kelompok B di RA Miftahul Khoir sebanyak 20 anak. Teknik pengumpulan data yang digunakan adalah observasi secara langsung terhadap kegiatan anak. Hasil penelitian ini menunjukkan menggunaan media kartu gambar dapat meningkatkan kemampuan berbahasa anak kelompok B di RA Miftahul Khoir, terbukti dari hasil yang diperoleh anak dapat dilihat dari rata-rata hasil observasi anak mulai dari pratindakan (46) dengan prosentase (10%), meningkat pada siklus I (66) dengan prosentase (45%), dan meningkat lagi pada siklus II (84,15) dengan prosentase (90%) yang terus mengalami peningkatan. Dari penggunaan media kartu gambar ini dapat meningkatkan kemampuan berbahasa pada kegiatan membaca dan nilai ketuntasan belajar anak. Saran yang disampaikan yaitu penggunaan media kartu gambar dengan cara menunjukkan obyek/bendanya akan memudahkan, memotivasi dan menarik minat anak dalam pelaksanaan kegiatan membaca, sehingga dapat meningkatkan kemampuan berbahasa pada saat pembelajaran.

Penerapan pendekatan kooperatif model jigsaw untuk meningkatkan hasil belajar IPA siswa kelas V di SDN Pakisaji 02 Kabupaten Malang / Zainal Abdi

 

Kata Kunci: Model Jigsaw, Hasil Belajar, IPA Pengamatan yang telah dilaksanakan di SDN Pakisaji 02 Kabupaten Malang dapat diketahui beberapa permasalahan yang timbul pada mata pelajaran IPA. Adapun rincian dari permasalahan yang timbul: (1) nilai rata-rata siswa berdasarkan ulangan harian dan formatif mencapai 35%. Nilai rata-rata tersebut masih di bawah Standar Ketuntasan Minimal yang ditentukan oleh sekolah tersebut, yaitu 75%; (2) guru cenderung masih mendominasi dalam proses pembelajaran; (3) siswa kurang diberi kesempatan untuk memperoleh sendiri pengetahuan yang didapat, sehingga siswa cenderung pasif dalam proses belajar mengajar. Adapun penelitian ini bertujuan untuk meningkatkan kompetensi yang dimiliki siswa dengan jalan meningkatkan hasil belajar siswa dengan menerapkan model Jigsaw Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) dengan model Kemmis Taggart yang terdiri dari 2 siklus dan 4 tahapan, yaitu: tahap perencanaan, tahap pelaksanaan tindakan, tahap observasi, dan tahap refleksi. Subyek penelitian ini adalah siswa kelas V SDNPakisaji 02 Kabupaten Malang yang terdiri dari 31 siswa dengan rincian 14 siswa laki-laki dan 17 siswa perempuan. Penelitian ini menunjukkan adanya peningkatan hasil belajar siswa. Indikasi adanya dampak yang baik terhadap hasil belajar adalah adanya kenaikan rata-rata skor dari nilai siswa yang sebelumnya mencapai 66,6 dan terus meningkat menjadi 80,3. selain itu dampak tersebut dapat dilihat dari hasil nilai tes evaluasi pada siklus I pertemuan I mencapai 58%, meningkat pada pertemuan II menjadi 68%, meningkat pada siklus II pertemuan 1 menjadi 77%, dan pada pertemuan II meningkat menjadi 84%.Serta semakin berkurangnya domiasi guru dalam proses relajar mengajar, hal tersebut dapat dibuktikan dari pencapaian guru dalam menerapkan model Jigsaw, yaitu pada siklus I pertemuan I mencapai 64% meningkat pada pertemuan II menjadi 73%, meningkat pada siklus II pertemuan I menjadi 82%, dan meningkat pada pertemuan II menjadi 96%. Berdasarkan hasil penelitian di atas disarankan agar guru senantiasa dapat menerapkan model Jigsaw yang terbukti dapat meningkatkan hasil belajar IPA siswa kelas V di SDN Pakisaji 02 Kabupaten Malang.

Pemahaman mahasiswa Fakultas Ilmu Pendidikan Universitas Negeri Malang tentang kehidupan berkeluarga / Deka Wahyu K.

 

Key Word: Comprehension, student, family life. Family life is a fact which is very complex, where the family life starts by way a marriage. Marriage is a formal bound between women and men as a husband or wife spouse, which can unite both of personal adult in a comprehensive manner. Family life is something which bound state, in the bound state consists in responsible and commitment toward the couple, which if it collide, the consequences family will not harmonious. The Student’s comprehend about family life is a think how the student understand, know, conmprehend and recognize a family life. The purpose of this research to know the level of student’s comprehend Faculty Of Training Education University Of Malang About Family Life. The design of this research uses descriptive quantitative method. The population of the reasearch is the students of Faculty Training Education University Of Malang, The sample of research is 10% from totality the students of Faculty of Training Education with the total 410 people. Technique which get the sample use Stratified Random Sampling. The collect data uses measurer inventory the sudent’s comprehend about family life with very appropriate, appropriate, less appropriate, and not appropriate classify. Technique of analysis which used descriptive percentage. The result of research shows that the student’s comprehend Faculty Training Education University Of Malang about family life had known from the percentage result and description as from BKP,TEP,AP,PLS,PAUD, and PGSD 2007 forces ascertainable that the student’s Faculty of training education more comprehend about family life is in PGSD department, but to 2008 forces from Faculty of training education the student’s comprehend about family life more in the student’s PGSD department. To 2009 forces the comprehension about family life more understand by the student BK department and PLS. And to 2010 forces which most comprehend about family life is in BKP department and Education Technology Department. According the result of this research, so the researcher advised to various party :1) BK UPT party to give guidance about readiness in choose endure family life. This case need given either in information form either guidance directly to the students. 2) For the students ought to more prepare their self to endure family life will their endure in the next future. So it need get information about family life to personal ripeness will determine the selection to marriage early or delay their want to marriage, 3) For the researcher to further researcher hopeable continue this research becomes a research which more deep again.

Peningkatan kemampuan membaca pemahaman isi teks bacaan melalui metode pembelajaran penemuan (discovery) siswa kelas IV SDN Ngadirejo 2 Kota Blitar / Heri Wijayanto

 

Kata kunci: membaca pemahaman, metode penemuan (discovery). Pada kenyataan di lapangan, siswa kelas IV SDN Ngadirejo 2 Kecamatan Kepanjenkidul Kota Blitar memiliki kemampuan membaca pemahaman yang rendah. Maka, perlu diadakan penelitian untuk mengatasi masalah tersebut. Rumusan masalah penelitian ini adalah 1) Bagaimanakah penerapan metode pembelajaran penemuan (discovery) untuk meningkatkan kemampuan membaca pemahaman isi teks bacaan siswa kelas IV SDN Ngadirejo 2 Kota Blitar, 2) Bagaimanakah hasil peningkatan kemampuan membaca pemahaman isi teks bacaan melalui metode pembelajaran penemuan (discovery) siswa kelas IV SDN Ngadirejo 2 Kota Blitar. Penelitian ini bertujuan (1) mendeskripsikan penerapan metode pembelajaran penemuan (discovery) dalam pembelajaran Bahasa Indonesia untuk meningkatkan kemampuan membaca pemahaman isi teks bacaan siswa kelas IV SDN Ngadirejo 2 Kota Blitar, dan (2) mendeskripsikan hasil peningkatan kemampuan membaca pemahaman isi teks bacaan melalui metode pembelajaran penemuan (discovery) siswa kelas IV SDN Ngadirejo 2 Kota Blitar. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Jenis penelitian yang dipergunakan dalam penulisan skripsi ini adalah Penelitian Tindakan Kelas (PTK). Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Sedangkan teknik pengumpulan data yang digunakan adalah observasi dan tes. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan metode discovery dapat meningkatkan aktivitas siswa dalam pembelajaran kemampuan membaca pemahaman siswa antara lain, pemahaman harfiah yaitu, prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 69,7 dan pada pertemuan kedua yaitu 78,8. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 77,3 dan pada pertemuan kedua yaitu 81,8. Pemahaman inferensial yaitu prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 69,7 dan pada pertemuan kedua yaitu 72,7. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 71,2 dan pada pertemuan kedua yaitu 77,3. Pemahaman evaluasi yaitu prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 69,7 dan pada pertemuan kedua yaitu 71,2. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 80,3 dan pada pertemuan kedua yaitu 80,3. Pemahaman apresiasi yaitu prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 72,7 dan pada pertemuan kedua yaitu 69,7. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 72,7 dan pada pertemuan kedua yaitu 80,3. Ketuntasan klasikal pada akhir siklus II yaitu 91% lebih besar dari standar ketuntasan kalsikal yang ditentukan 80%. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa penerapan metode penemuan (discovery) dapat meningkatkan kemampuan membaca pemahaman siswa kelas IV SDN Ngadirejo 2 Kota Blitar, oleh karena itu guru disarankan untuk menerapkan metode penemuan (discovery) pada mata pelajaran bahasa Indonesia khususnya membaca pemahaman.

Strategi pembelajaran agama Islam di Pondok Pesantren Syaikhona Mohammad Kholil I Bangkalan Jawa Timur / Suhudi

 

Kata Kunci: Islam, bandongan, sorogan, pondok pesantren, instructional, kiyai, ustadz, students and tabarruk. Teknologi pembelajaran adalah studi dan praktek secara etis untuk memfasilitasi pembelajaran dan meningkatkan kinerja dengan cara menciptakan, menggunakan, dan mengelola proses dan sumberdaya teknologi yang sesuai. Ada sebuah tradisi pembelajaran yang sudah sejak lama dilaksanakan di pondok pesantren salafiyah yaitu pembelajaran dengan metode bandongan dan sorogan yang dilakukan dengan prinsip tabarruk. Dimana strategi pembelajaran tersebut secara empirik terbukti sangat efektif untuk mencapai tujuan pembelajaran. Fokus penelitian ini adalah tentang bagaimana strategi pembelajaran yang digunakan di pondok pesantren syaikhona Mohammad Kholil I Bangkalan, bagaimana prilaku kiyai, ustadz dan santri, dan apakah dampaknya terhadap santri/pebelajar. Tujuan penelitian ini adalah mendeskripsikan secara komprehensif tentang proses pembelajaran dengan prinsip tabarruk melalui strategi Bandongan dan Sorogan di Pondok Pesantren Syaikhona Mohammad Kholil I Bangkalan. Metode penelitian pondok pesantren salafiyah Syaikhona Mohammad Kholil I Bangkalan ini menggunakan pendekatan fenomenologi yang di dalam pandangan sosiologi Ritzer masuk pada kuadran keempat yaitu mikro-subyektif. Dan oleh karena itu maka menggunakan analisa data kualitatif dengan menggunakan data primer dan sekunder yang didapatkan melalui wawancara dengan informan inti dan informan biasa serta pengamatan berkali-kali tentang kehidupan di pondok pesantren. Berdasarkan data penelitian yang ditemukan, pesantren ini menyelenggarakan pendidikan agama Islam ke dalam dua program pendidikan dengan tujuan untuk membentuk santri yang beriman, bertaqwa dan berakhlaq al-karimah. Kedua program tersebut ialah ma’hadiyah dan madrasiyah. Dalam kedua program pendidikan ini buku rujukan pembelajaran hampir semuanya menggunakan kitab kuning, kecuali mata pelajaran Aswaja (Ahlussunnah Wal Jamaah), yang dapat dikelompokkan ke dalam mata pelajaran al-Qur’an dan al-Hadist, fiqh, tauhid, akhlaq, bahasa Arab dan sejarah Islam. Strategi pembelajaran yang digunakan adalah strategi konvensional dan modern, yaitu strategi kooperatif, inkuiri dan strategi pembelajaran langsung dengan metode sorogan dan bandongan, dimana kemudian strategi ini berkembang menjadi strategi muhawarah, majlis ta’lim dan mudzakkarah. Pada semua strategi pembelajaran tersebut di atas ada prinsip yang melekat yaitu prinsip tabarruk. Prinsip tabarruk yang selalu melekat pada setiap strategi dan metode pembelajaran adalah karena didasarkan pada keyakinan yang mendalam bahwa pelajaran agama Islam bisa masuk pada kognisi si belajar, lalu menimbulkan penghayatan dalam hati sehingga menjadi sikap dan terejawantahkan ke dalam bentuk prilaku si belajar hanya dengan barokah dari Allah. Untuk memperoleh barokah ini santri harus patuh kepada ajaran agama Islam yang diwujudkan menjadi ketaatan kepada nabi Muhammad, sebagai pesuruh Allah, kemudian, kepada sahabat dan para pengikutnya, yaitu ulama (orang ahli agama; bisa disebut kiyai, tuan guru dan sebagainya). Ketundukan pada ulama ditunjukkan dengan ketundukan pada peraturan pesantren dan cinta kepada kyai (ulama) yang dipercaya memiliki karomah. Wujud daripada cinta dan tunduk kepada ulama juga diwujudkan si belajar (santri) dalam kehidupan keseharian di pesantren dengan tirakat yaitu menahan lapar dan amarah serta hidup prihatin selama berada di pesantren. Dalam pelakasanaan pembelajaran agama Islam, di pesantren ini tidak dikenal dengan adanya dokumen kurikulum sebagaimana pendidikan formal lainnya di Indonesia, juga tidak dikenal adanya sistem evaluasi belajar dan kenaikan kelas oleh guru atau pengasuh. Penilaian hasil belajar dan kenaikan kelas ditentukan sendiri oleh santri dengan melakukan evaluasi sendiri apakah dia mampu membaca dan memahami kitab-kitab yang dipelajari atau tidak. Pelaksanaan stategi bandongan dan sorogan dilakukan dengan kiyai atau ustadz sebagai pemberi informasi utama dan tanpa adanya tanya jawab dan interaktif. Sedangkan pembahasan hasil pembelajaran dari sorogan dan bandongan di lakukan santri dengan strategi lain yaitu musyawarah, muhawarah dan muhadloroh. Dimana kegiatan tersebut dilakukan sesama santri dengan dipandu oleh ustadz atau santri senior, yang diadakan di musholla atau seramb-serambi pondok. Fakta tersebut memperlihatkan bahwa pesantren ini merupakan lembaga pendidikan yang berorientasi pada pembentukan santri yang memiliki kemampuan ilmu agama dan mampu mengejawantahkan ilmunya ke dalam bentuk perbuatan sehingga dapat menjadi Muslim yang beriman, bertaqwa dan berakhlaq al-karimah (bermoral baik).

Penelitian motif pada industri kerajinan batik ayu gestar Kelurahan Gedog Kecamatan Senanwetan Kota Blitar / Cindy Lovina

 

ABSTRAK Lovina, Cindy. 2015. Penelitian MotifpadaIndustriKerajinan Batik AyuGestarKelurahanGedogKecamatanSananwetanKota Blitar.Skripsi, JurusanSenidanDesain, FakultasSastra, UnivesitasNegeri Malang.Pembimbing: (I) Drs. Sumarwahyudi, M.Sn, (II) Ike Ratnawati, S.Pd, M.Pd. Kata Kunci:motif batik, AyuGestar, kotaBlitar Di kotaBlitarindustrikreatifdipandangsemakinpentingdalammendukungkesejahteraandalamperekonomian. Sebagaiwujudpandangantersebut, sebagianbesarmasyarakatsetempatmenggelutiaktivitasindustrikecildankerajinanrumahtangga, mulaidarianak-anak di luarkegiatanmengikuti proses belajarmengajar, remajahingga orang tua, baikwanitamaupunpria,salahsatunyaadalahindustrikerajinan batik. Selamaobservasi, penelitimenemukanberbagaimacamindustrikerajinan batik baikbesarmaupunkecil yangadadalamwilayahkotaBlitar. Secaraumumpenelitianinidilaksanakanuntukmendeskripsikandesain motif batik yang dibuatolehAyuGestar di kelurahanGedogkecamatanSananwetankotaBlitar.Alasanpenelitiankualitatifinidilakukan di industrikerajinan batik AyuGestaradalahindustrikerajinaninimengangkattemaunggulankotaBlitarsebagaisumberinspirasidalammembuatdesain motif, misalnya 1) ikan koi, 2) kendangjimbe, 3) belimbingKarangsari, dan lain-lain.Data yang diperolehdengancarawawancaradanobservasidariberbagaimacamsumber, denganmanusia yangdigunakansebagaiinstrumendalampengumpulan data. Kemudianpenelitimenelaah data, mengidentifikasi data sertamengklasifikasikannyasebelummelakukanevaluasiterhadap data tersebut. Batik-batik hasilkaryaAyuGestertergolongdalamjenis batik kreasi, yaknipengembangan ide-ide baru yang sebagianbesarberasaldarilingkungansekitar.Berdasarkanhasilpenelitian yang telahdiperoleh, data yang didapatpenelitiadalahdesainkain batik AyuGestarterdiridariberbagaimacam motif, misalnya motif binatang, tumbuhan, makhlukhidup, imajinatif, dangabungan, sehinggapenelitimembatasiruanglingkupbahasanyaitu motif 1) binatang air, 2) alambenda yang berupakendangjimbe,dan 3)gabungan yang merupakan motif JagadBlitar. Motifbinatang yang penelitimaksudadalahjenisbinatang air, yakniikan koi yang merupakanprodukunggulankotaBlitar.Jenis motif ikan koi adalah motif yang selaludiusahakanuntuktampilpadasetiapkaryaperajin batik AyuGestar, sehinggamasyarakatakanlebihmengenalkotaBlitarlewat motif-motif ikan koi. Motif alambendalebihcenderungpadadesain yang menggunakangambarkendangjimbesebagai motif utamanya.Kendangjimbeadalahjenisalatmusiktradisionalkhaskotaini yang banyakditemukan di daerahpasarmakam Bung Karno, bahkanada yang dibuatsebagaiminiaturuntuksekedarhiasanatauaksesoris.Sedangkanpada motif gabungan, penelitimaksudkanpadadesain batik dengan motif JagadBlitar.Motif JagadBlitaradalah motif originalmilikAyuGestar yang barudikembangkanpadatahun 2011, bersamadenganberdirinyakelompokini.Kemudianpada motif tumbuhanterdapatberbagaimacamjenisdesain, karena motif tumbuhanlah yang banyakpenelititemukandalamsebagaianbesardesain-desain batik AyuGestar.

Peningkatan hasil belajar IPA melalui connected model berbasis pakem siswa kelas V SDN Penaggungan Malang / Imam Hambali

 

Kata Kunci: Hasil Belajar, IPA, Pembelajaran Terpadu Connected Model. Pembelajaran terpadu connected model merupakan model integrasi inter bidang studi. Penelitian ini bertujuan untuk mengetahui penerapan Pembelajaran terpadu connected model, peningkatan aktivitas dan hasil belajar siswa.Hasil observasi awal telah ditemukan: (a) nilai ulangan tengah semester kurang dari standar ketuntasan secara klasikal.(b) pembelajaran cendrung tex book.(c) pembelajaran masih bersifat informatif. Penelitian ini dilaksanakan di kelas V-B SDN Penanggungan Malang.waktu pelaksanaan mulai tanggal 18 Agustus sampai 22 November 2010. Pendekatan dalam penelitian ini adalah pendekatan kualitatif jenis penelitian tindakan kelas (PTK) collaborative. Dengan tujuan 1)Bagaimanakah penerapan connected model berbasis PAKEM siswa kelas V SDN Penanggungan Malang pada pembelajaran IPA konsep sistem peredaran darah manusia? 2)Apakah penerapan connected model berbasis PAKEM dapat meningkatkan keaktifan siswa kelas V SDN Penanggungan Malang? 3)Apakah penerapan connected model berbasis PAKEM dapat meningkatkan hasil belajar siswa kelas V SDN Penanggungan Malang? Penerapan pembelajaran terpadu connected model adalah pembelajara yang yang mengintegrasikan satu konsep, keterampilan yang dikaitkan dengan konsep, keterampilan lain dalam satu bidang studi. Aktivitas belajar berpusat pada siswa sehingga pembelajaran lebih bermakna dan efektif. Hasil yang diperoleh dari pelaksanaan siklus I dan siklus II, menunjukkan adanya peningkatan hasil belajar siswa. Dilihat dari proses pembelajaran pada pra tindakan, tindakan siklus I dan tindakan pada siklus II dengan skor rata-rata kelas sebagai berikut: (1) pra tindakan 68,4% dengan 14 orang siswa yang tuntas dan 21 siswa tidak tuntas, dengan skor tertinggi 99 dan skor terendah 32; (2) tindakan siklus I 71,4% dengan siswa yang tuntas dan 17 orang dan yang tidak tuntas 18 orang dengan skor tertinggi 100 dan skor terendah 60; (3) tindakan siklus II 79,1% dengan siswa yang tuntas 24 dan yang tidak tuntas 11 dengan skor tertinggi 100 dan skor terendah 60. Kesimpulan: (1) penerapan pembelajaran terpadu connected model adalah pembelajaran yang dilakukan dengan mengaitkan satu konsep dengan konsep berikutnya dalam satu bidang studi; (2) aktivitas belajar siswa meningkat melalui pembelajaran terpadu connected model; (3) hasil belajar siswa pada pembelajaran IPA juga mengalami peningkatan.

Meningkatkan ketrampilan berhitung melalui bermain bilangan dengan menggunakan media gambar untuk kelompok A TK Katholik Indriyasana VIIIB Mojorejo Kecamatan Wates Kabupaten Blitar / Diyah Candra Mayang Wulan

 

Keywords: playing numbers and media images. This research background at low numeracy skills of children in the count, classifying objects, the symbol pair numbers, showing two sets of objects. This is because the learning activities do not involve children and the use of media that is still less so the child is less interested in learning activities. Based on observations made in group A Catholic kindergarten Indriyasana Mojorejo VIIIB contained formulation of the problem: (1) How is the application of play numbers by using media images can improve the numeracy skills of children in group A Catholic kindergarten Indriyasana VIII B Mojorejo? (2) Is the application of playing numbers by using media images can improve the numeracy skills of children in group A Catholic kindergarten Indriyasana VIII B Mojorejo. The research design used in this research is the study design and class actions are designed in two cycles. Each - each consisting of 4 phases, (1) planning, (2) Implementation, (3) Observations, (4) Reflection. The subject of this research is the son of group A Catholic kindergarten Indriyasana VIII B Mojorejo as many as 27 children. Methods of data collection obtained through observation sheet child's activity during the learning process and documentation in the form of photographs during the learning. The results showed that play using media images to improve numeracy skills of children. In the first cycle counting capabilities of children reached 72.3%, while in the second cycle increased to 89.8%. Improving numeracy skills of children characterized by increasing the skill to count, classify objects, pair the symbol number, appointed two sets of objects. Based on the results of these studies concluded that the application of playing numbers by using media images to improve numeracy skills for children in group A Catholic kindergarten Indriyasana VIII B Mojorejo. Based on research results and conclusions in this class action can be suggested: for schools to disseminate the results of this research is to improve the quality of learning, especially numeracy skills. For teachers to implement play numbers by using media images in learning activities in the field of numeracy skills

Penerapan model mind mapping untuk meningkatkan hasil belajar PKn siswa kelas IV SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang / Tri Indah Mariana

 

Kata kunci : Mind mapping, hasil belajar, PKn SD Penggunaan model pembelajaran berpengaruh terhadap hasil belajar siswa.Terbukti dari hasil observasi yang dilakukan menunjukkan bahwa pembelajaran dengan model konvensional mengakibatkan hasil dan ketuntasan belajar siswa menjadi rendah. Sebagai upaya untuk meningkatkan hasil belajar siswa tersebut, diperlukan adanya penerapan pembelajaran model mind mapping. Dengan model mind mapping ini siswa dapat melakukan belajar bermakna. Penelitian ini bertujuan untuk (1) mendeskripsikan penerapan model mind mapping untuk meningkatkan hasil belajar siswa dalam pembelajaran PKn. (2) Mendeskripsikan hasil belajar dengan menggunakan model mind mapping dalam pembelajaran PKn. Jenis penelitian ini adalah penelitian tindakan kelas yang dilaksanakan pada semester genaptahun ajaran 2010/2011,. Subjek penelitian ini adalah siswa kelas IV SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang dengan jumlah siswa 24. Rancangan penelitian ini mengacu pada model Kemmis dan Taggart. Dilaksanakan dalam 2 siklus. Di setiap siklus terdapat 4 tahap yaitu perencanaan, pelaksanaan, observasi, refleksi. Teknik pengumpulan data menggunakan tes dan observasi, dokumentasi,wawancara. Analisis data secara deskriptif. Hasil penelitian dan pembahasan yang diperoleh adalah sebagai berikut: (1) penerapan model mind map dilaksanakan 2 siklus. Kegiatan inti meliputi pemberian rangkuman materi, Tanya jawab tentang materi yang telah dibaca, siswa dibagi menjadi beberapa kelompok dan diberikan LKK, siswa memperhatikan contoh mind map yang dibuat guru seperti contoh tapi lebih dikembangkan lagi, pembahasan hasil kerja kelompok. Kegiatan akhir meliputi menyimpulkan materi dan mengerjakan soal evaluasi. (2) Hasil belajar siklus I dan II menunjukkan bahwa pembelajaran dengan menggunakan model mind mapping mampu meningkatan hasil belajar siswa. Pada siklus I Ketuntasan hasil belajar mencapai 50% dengan rata-rata kelas 61,62. Hasil belajar meningkat lagi pada siklus II menjadi 80,3 % dengan rata-rata kelas 76,79. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa penerapan pembelajaran model mind mapping dalam pembelajaran PKn materi pemerintahan desa dapat meningkatkan hasil belajar, khususnya di SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang. Dari hasil penelitian ini disarankan bahwa guru PKn hendaknya menerapkan model mind mapping dalam pembelajaran PKn khususnya materi pemerintahan desa sebagai salah satu alternatif pembelajaran untuk meningkatkan aktivitas dan hasil belajar siswa di kelas.

Penggunaan media buku cerita bergambar untuk mengembangkan kemampuan bahasa anak kelompok B di TK Al Hidayah Gedog I Kota Blitar / Septarini Dwi Lestari

 

Keywords: language skills, media picture-books, TK This research background at the lack of language skills of children. This is because in learning activities using the media picture books children often joking and not paying attention when the teacher explained in front of the class. This study aimed to describe the media use picture books that can develop language skills and describe the results of the use of picture-book media in TK Al Hidayah Gedog I Blitar city. This study used descriptive qualitative research design. class action with 2 cycles. In each cycle consists of several stages, namely planning, execution, observation, and reflection, also using data analysis. The results showed that media use picture books in learning activities proved to be utilized in the learning activities to develop children's language skills Ability TK.Pada first cycle average child reaches the 73.95% increase to 88.54% in cycle II. Marked improvement with increased language ability through the use of reading picture books to answer the question the content of picture books, fluency in reading picture books, fluency in telling the content of picture books. It is suggested that in learning to develop children's language use picture books for the media to conduct further research with other problems that can be utilized in the field of development in addition to the field of learning language skills, namely art, cognitive and physical motor.

Penerapan teknik dictogloss dalam meningkatkan menyimak pada siswa kelas V SDN Blabak 1 Kota Kediri / Andi Rubiyantoro

 

Kata Kunci: Teknik dictogloss, meningkatkan, menyimak. Kemampuan menyimak siswa kelas V SDN Blabak 1 Kota Kediri masih rendah. Maka teknik dictogloss dipilih sebagai jalan keluar permasalahan tersebut. Teknik ini dipilih karena menonjolkan kerjasama dalam merekonstruksi bahan simakan sehingga siswa yang mempunyai kemampuan lebih bisa membantu siswa yang kemampuannya kurang. Selain alasan itu, juga didasarkan atas keunggulan yang dimiliki teknik dictogloss. Skripsi ini didasarkan atas pemasalahan: a) Bagaimana penerapan teknik dictogloss dalam meningkatkan kemampuan menyimak pelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri? Dan b) Apakah ada peningkatan kemampuan siswa menyimak pelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri setelah menggunakan teknik dictogloss? Berdasarkan permasalahan yang telah ada, Skripsi ini memiliki tujuan: a) Mendiskripsikan penerapan teknik dictogloss dalam meningkatkan kemampuan menyimak pembelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri. Dan b) Mendiskripsikan peningkatan kemampuan siswa menyimak pembelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri setelah menggunakan teknik dictogloss. Penelitian ini menggunakan penelitian tindakan kelas model Kemmis dan Tagart yang terdiri dari empat tahap yaitu perencanaan, pelaksanaan, obsertavasi, serta reflkesi. Sasaran penelitian ini adalah siswa kelas V SDN Blabak 1 Kota Kediri semester ganjil tahun pelajaran 2010/2011. Dari data hasil penelitian yang dilaksanakan, diperoleh data tentang penerapan teknik dictogloss dan kemampuan menyimak siswa setelah menggunakan teknik dictogloss. Pembelajaran menyimak dengan teknik dictogloss dilaksanakan dengan empat tahap yaitu persiapan, dikte, rekonstruksi, serta analisis dan koreksi. Penerapan teknik dictogloss diterapkan dengan baik oleh guru. Ini didasarkan pada APKG I, APKG II, dan lembar observasi. APKG I siklus I sebesar 79,3 dan siklus II 90,3. APKG II siklus I 91,7 dan siklus II 91,1. Lembar observasi kemampuan guru mempersiapkan pembelajaran dictogloss siklus I 85 dan siklus II 89. Lembar observasi melaksanakan pembelajaran dictogloss siklus I 82 dan siklus II 92,5. Kemampuan menyimak siswa didasarkan pada nilai akhir dan ketuntasan secara klasikal. Rata-rata nilai akhir pada pratindakan sebesar 60,9 siklus I sebesar 69 dan siklus II sebesar 78. Ketuntasan secara klasikal pra tindakan 22%, siklus I 65%, dan siklus II 91%. Berdasarkan hasil penelitian di atas diperoleh kesimpulan bahwa penerapan pembelajaran menyimak menggunakan teknik dictogloss yang benar, bisa membantu meningkatkan kemampuan menyimak siswa.

Penerapan metode role playing untuk meningkatkan hasil belajar siswa pada matapelajaran PKn kelas III SDN Kersikan I Bangil Kabupaten Pasuruan / Zurinal Qurana Firdaus

 

Keyword: Application, Role- Playing method, Learning achievement, PKn, SD. PKn is a very important lesson because it is related with students mental outlook in the future time learning method used in learning of PKn must be able to include cognitive, affective, and pshycomotor aspects. The firt observation result is found that the students of SDN Kersikan I at Bangil Pasuruan regence found the problem faced to PKn learning in the third year, such as : 1) There is not communication double ways between teachers and students, students and students, 2) Learning activity is generally done by traditional learning group, 3) The students leanrning is very low. Learning activity must be improved immediatelly by the teachers by choosing learning method that can make the students more actively, creatively and happily in learning process. The aim, we want to get in this research is : 1) To describe application of Role-Playing learning method in PKn learning for the students in the third class III SDN Kersikan I, 2) Describing the students learning activity in PKn learning in application Role-Playing method for PKn to the student class III SDN Kersikan I, 3) describe the increasing of students learning achievement via Role-Playing learning method in class III SDN Kersikan I. This research used Class Action Research (CAR) with 2 (two) siclus. Every siclus consist of phases : Planning, observation and reflection action implementation. The minimal completeness value standart is 75 % by learning achievement class 80 % from the number of research subject. This research subject is teacher and 26 students class III SDN Kersikan I. The data collection technique in yhis research is observation, interview, and test. Instrument of data collection used such as interview pattern, APKG II, the students learning activity assesment equipment and post test. This research resuslt shows the implementation of Role-Playing learning method to the students in the class III SDN Kersikan I can increase the students result. This is Proved from the result that is obtained by the students before applicating of Role- Playing learning method from rate score 69,23 become 71,53 at the post test siclus I and post test siclus II becomes 89,92. The advice presented to the teachers that is so that can implement and use Role-Playing leaning method for PKn lesson by other competence or other lesson. Based on the conclusion above can give to: the teacher that conclude in the competence or other themes that appropiate with condition and situation of school environment each. The learning must be done by giving chance for the students involved directly in learning process.

Penerapan metode bercerita dengan menggunakan media boneka tangan untuk mengembangkan kemampuan bahasa anak kelompok BI di TKN Pembina Kecamatan Kepanjenkidul Kota Blitar / Arif Fatkhur Rohman

 

Keywords: language skills, media, hand puppets, story method, TK This research background in the low language ability children in terms of simply telling penglaman in group B in TKN coach Kepanjenkidul Blitar District. Teachers have not used the correct media in developing the ability to tell a simple experience, in addition to telling the courage in front of class, language fluency of children in story telling and imagination of children in story telling is also relatively low. This study aims to describe the application of media to tell by using hand puppets in the development of the ability to tell a simple experience in the BI group of children in TKN coach Kepanjenkidul Blitar district and describe the increasing ability to tell a simple experience in children in the BI group TKN Kepanjenkidul Blitar District Pembina marked with courage in front of the classroom telling kids, language fluency of children in story telling and imagination in children's ability to tell stories. This research was conducted in TKN Kec.Kepanjenkidul coach with the study design used was a class action design (TOD) model cycle. In each cycle consists of several stages, namely planning, execution, observation, and reflection. In this study, researchers collaborate with classroom teachers. The results showed that the application simply share the experience with the media hand puppets to enhance the ability to tell a simple experience in the BI group of children in TKN coach Kepanjenkidul Blitar District. The study lasted two (2) cycles by using the observation. Prosespeningkatan ability to tell a simple experience is said to increase when the percentage reaches 75% or more and the cycle is successful jia two (2) better than the previous cycle. The success of this study are marked demgam: (1) Children dare talk in front of the class, (2) Children fluent in story telling, (3) Children capable of imagination in story telling. Based on this research, listening to stories and retelling stories heard a new, simply share the experience and to tell by using the pronouns I, me you, they, him using hand puppets media can increase children's language ability in story telling. This is evidenced by the average percentage of children in story telling ability in pre-action is still low with a percentage of 38.75% and the average percentage of children in story telling ability at the time the study reach 82.63%

Penerapan metode karya wisata melalui menggambar bebas untuk mengembangkan kemampuan seni anak kelompok B di TK Al Hidayah Dawuhan Kecamatan Kepanjenkidul Kota Blitar / Nurwiyanti

 

Kata kunci : Metode Karya Wisata, Menggambar Bebas, Kemampuan Seni, TK Al-Hidayah Dawuhan Kota Blitar. Anak usia 4-6 tahun merupakan bagian dari anak usia dini yang secara terminologi disebut sebagai anak usia prasekolah atau taman kanak-kanak. Sejumlah riset membuktikan bahwa perkembangan kecerdasan anak pada masa ini mengalami peningkatan dari 50% menjadi 80%. Hal ini menunjukan pentingnya upaya pengembangan seluruh potensi anak diusia pra sekolah karena pada usia tersebut anak mengalami masa peka, yaitu masa terjadinya pematangan fungsi-fungsi fisik dan psikis yang siap merespon stimulus yang diberikan oleh lingkungan. Masa peka merupakan masa untuk meletakan dasar pertama dalam mengembangkan seluruh potensi anak termasuk pula minat dan bakat dalam bidang seni. Dari hasil pengamatan penulis pada kegiatan pembelajaran bidang pengembangan pengembangan seni di TK Al – Hidayah Dawuhan, khususnya kelompok B pada bulan Agustus 2010, penulis menemukan beberapa masalah, diantaranya minat anak terhadap pembelajaran seni, untuk menggambar bebas masih sangat rendah, terbukti dengan hasil yang yang dicapai anak masih belum memenuhi target yang telah ditentukan. Tujuan dari penelitian ini adalah untuk mendeskripsikan penerapan metode karya wisata melalui menggambar bebas dapat meningkatkan kemampuan seni anak kelompok B di TK Al - Hidayah Dawuham Kota Blitar, dan mendeskripsikan peningkatan kemampuan seni anak kelompok B TK Al-Hidayah Dawuhan Kota Blitar, dengan metode karya wisata melalui menggambar bebas. Metode pelaksanaan menggunakan model guru sebagai peneliti , yaitu mulai dari persiapan, pelaksanaan , pelaporan hasil penelitian dilaksanakan oleh guru yang melakukan penelitian. Namun karena pengumpulan data sambil mengajar bukan suatu pekerjaan mudah , maka untuk membantu dalam mengumpulkan data peneliti meminta bantuan pada teman sejawat sebagai co- observer (Sa’dun Akbar, 2009: 22). Dalam pelaksanaan observasi dapat membantu dalam proses pengumpulan daata dan analisis data. Penelitian tindakan kelas ini menggunakan siklus model Kemmis dan Taggart (1988). Dengan menerapkan siklus yang dilakukan secara berulang dan berkelanjutan (siklus spiral) diharapkan dapat meningkatkan kemampuan anak dalam menggambar bebas artinya daslam apbila pada satu siklus ada indek kegagalan dan keberhasilan yang kemudian direfleksikan untuk perencanaan siklus berikutnya yang diharapkan bisa semakin meningkatkan pencapaian hasilnya pada siklus-siklus berikutnya. Dari hasil perolehan nilai anak sebelum tindakan, siklus I dan II diketahui bahwa peningkatan pada setiap tes yang diberikan sangat baik pada pra tes rata-rata nilai siswa dalam menggambar bebas adalah 41,25, rata-rata ini kemudian meningkat menjadi 55 pada tes siklus I yang menggunakan penerapan metode karya wisata, peningkatan yang signifikan kemudian diperoleh pada tes siklus II yaitu dengan rata-rata 78,75. Pada siklus II ini, karena rata-rata nilai siswa dalam menggambar bebas sudah baik sehingga diputuskan untuk mengakhiri penelitian karena kemampuan seni anak kelompok B TK Al-Hidayah Kota Blitar telah terbukti meningkat. Dari hasil yang didapat, penelitian ini diharapkan dapat membantu meningkatkan kualitas proses belajar da mengajar dan memotivasi guru dalam melakukan peningkatan kualitas pembelajaran yang aktif, kreatif, dan menyenangkan.

Peningkatan kemampuan sains melalui permainan warna di TK Dharma Wanita II Srengat / Tina Devi Prihantini

 

Kata kunci: Kemampuan Sains, Permainan Warna, TK Dharma Wanita Usia 4-6 tahun dipahami sebagai masa keemasan dan masa peka bagi anak. Pada masa ini anak sensitive untuk menerima upaya pengembangan terhadap seluruh potensinya. Mengingat dalam kemampuan kognitif juga meliputi kemampuan sains, maka peneliti mencoba meningkatkan kemampuan sains melalui permainan warna. Dalam kegiatan ini peneliti mengharapakan agar anak dapat mengenal konsep sains dan meningkatkan daya pikir anak. Tujuan yang ingin dicapai ialah (1) Mendeskripsikan permainan warna yang dapat meningkatkan kemampuan sains anak (2) Mendeskripsikan peningkatan kemampuan sains anak melalui permainan warna (3) mendeskripsikan kelebihan dan kelemahan permainan warna dalam meningkatkan kemampuan sains anak Penelitian ini menggunakan rancangan penelitian tindakan kelas yang dilaksanakan dalam dua siklus dan metode yang digunakan untuk pengumpulan data dalam penelitian ini adalah observasi, dokumentasi dan tes, sedangkan instrument penilaian ini berupa lembar observasi anak dan format penilaian. Hasil penelitian ini menunjukkan peningkatan kemampuan sains anak melalui permainan warna, permainan warna dapat meningkatkan kemampuan sains anak, terdapat kelebihan dan kelemahan dalam permainan warna yang dapat meningkatkan kemampuan sains anak. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa dengan penerapan permainan warna dapat meningkatkan kemampuan sains anak di TK Dharma wanita II Srengat, peningkatkan kemampuan sains dapat dilakukan melalui permainan warna, terdapat kelebihan dan kelemahan dalam permainan warna untuk meningkatkan kemampuan sains anak kelompok B di TK Dharma wanita II Srengat. Dalam pembelajaran permainan warna ini tampak ada kecenderungan anak untuk bercerita tetapi ini tidak diteliti sehingga disarankan kepada peneliti untuk meneliti kegiatan permainan warna ini untuk mengembangkan kemampuan bahasa anak.

Peningkatan kemampuan membaca melalui membaca pemahaman pada siswa kelas V SDN Gledug 01 Kecamatan Sanankulon Kabupaten Blitar / Zakiyah Rokhmahwati

 

Kata kunci: membaca, membaca pemahaman Pengambilan judul penelitian di atas berdasarkan permasalahan dalam pelaksanaan pembelajaran membaca di SDN Gledug 01 Kecamatan Sanankulon Kabupaten Blitar yang masih menggunakan metode ceramah dan pembelajaran yang monoton. Berdasarkan hasil observasi, guru menyuruh siswa membaca buku paket, kemudian disuruh menjawab pertanyaan tanpa tahapan kegiatan membaca yang runtut. Akibatnya siswa kurang memahami isi bacaan dan siswa mudah bosan sehingga nilai hasil belajar menjadi rendah. Penelitian ini bertujuan untuk: (1) Mendeskripsikan pelaksanaan pembelajaran membaca melalui membaca pemahaman, dan (2) mendeskripsikan peningkatan kemampuan membaca melalui membaca pemahaman. Pendekatan yang digunakan adalah penelitian kualitatif dengan jenis penelitian tindakan kelas (PTK). Lokasi penelitian di SDN Gledug 01, subjek penelitian siswa kelas V dengan jumlah siswa 13 laki-laki dan 10 perempuan. Teknik pengumpulan data adalah observasi, tes, dan angket. Teknik analisis data berupa teknik analisis data kualitatif dan kuantitatif. Hasil penelitian yang telah dilakukan diperoleh data adanya peningkatan pemahaman siswa dari tiap siklusnya. Pelaksanaan pembelajaran membaca melalui membaca pemahaman dilaksanakan dalam 3 siklus. Untuk mengetahui tingkat kemamapuan dasar siswa dalam pembelajaran dilakukan pra tindakan. Pada pra tindakan hasil belajar siswa mencapai 26.08%, hal ini disebabkan guru menggunakan metode ceramah saja, dan kegiatan belajar yang kurang menarik. Pada siklus I perolehan hasil belajar mencapai 30,4%, siklus II mendapat 47.82%. Dan pada siklus III siswa yang mendapat nilai di atas 65 menjadi 95.65%. Berdasarkan pembahasan dapat disimpulkan bahwa pelaksanaan membaca melalui metode membaca pemahaman dapat dilakukan dengan kegiatan membaca bacaan, mengadakan tanya jawab, melanjutkan bacaan atau cerita yang rumpang, memerankan lakon dalam isi bacaan, dan mencari permasalahan dalam bacaan, sehingga hasil belajar siswa dapat meningkat. Semula dari pra tindakan perolehan nilai sebesar 60.43 meningkat menjadi 62.60 pada siklus I. Pada siklus II perolehan nilai meningkat menjadi 64.78, serta pada siklus III nilai meningkat drastis menjadi 81.30. Berdasarkan penelitian ini, guru disarankan untuk memilih dan menerapkan metode yang tepat disesuaikan dengan materi yang diajarkan agar tercapai hasil belajar yang optimal.

Peningkatan kemampuan kognitif melalui bermain puzzle kreatif pada anak kelompok B di RA Mamba'ul Huda Mlaten Nguling Pasuruan / Saudah

 

Kata kunci : peningkatan kemampuan kognitif, bermain Puzzle Kreatif Kemampuan kognitif bertujuan untuk mengembangan kemampuan berfikir anak yang dapat mengolah perolehan belajarnya dengan memecahkan masalah untuk meningkatkan kemampuan kognitif melalui bermain Puzzle Kreatif, perlu adanya kegiatan pembelajaran yang sesuai dengan persiapan bermain Puzzle Kreatif untuk meningkat dan lebih baik. Hasil observasi ditemukan bahwa siswa RA Manba’ul Huda belum menerapkan metode bermain Puzzle Kreatif, sebagaian siswa belum mampu mencapai kriteria ketuntasn belajar siswa yang ditemukan oleh siswa yaitu 75 ketuntasan individu. Berdasarkan hal ini, metode bermain Puzzle Kreatif sangat tepat digunakan sebagai alternative dalam pembelajaran. Tujuan yang ingin dicapai dalam penelitian ini adalah : 1). Mendeskripsikan pelaksanaan metode bermain Puzzle Kreatif yang dapat meningkatkan kemampuan kognitif anak RA Manba’ul Huda Mlaten. 2) Mendeskripsikan peningkatan kemampuan kognitif melalui metode bermain Puzzle Kreatif di RA Manba’ul Huda Mlaten. 3) Mendeskripsikan peningkatan kemampuan kognitif melalui bermain Puzzel Kreatif yang dapat meningkatkan kognitif anak kelompok B RA Mamba’ul Huda Mlaten Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan dalam 2 (dua) siklus, masing-masing siklus terdiri dari 4 tahapan : perencanaan, pelaksanaan, observasi, dan refleksi, subyek penelitian ini adalah siswa kelompok B RA Manba’ul Huda Mlaten sebanyak 20 siswa. Tehnik pengumpulan data yang diggunakan adalah observasi. Hasil analisis data setelah pelaksanaan metode bermain Puzzle Kreatif menunjukkan bahwa : hasil pengamatan observasi siswa dalam melaksanakan kegiatan bermain Puzzle Kreatif mencapai nilai 80,00 dengan kategori A, ketuntasan belajar 100 %. Hasil penelitian ini menunjukkan pelaksanaan metode bermain Puzzle Kreatif kelompok B RA Manba’ul Huda Mlaten dapat meningkatkan kemampuan kognitif siswa, terbukti dari hasil yang diperoleh siswa dapat dilihat dari rata-rata hasil tes mulai dari pra tindakan (53,50) dengan presentase (15 %), meningkat siklus I (65,00) dengan presentase (45 %), dan meningkat lagi siklus ke II (80,00) dengan presentase (100 %) yang terus mengalami peningkatan. Untuk meningkatkan kualitas pembelajaran, kemampuan kognitif melalui bermain puzzel kreatif anak harus bisa mengatasi masalah ketergantungan guru pada buku paket, mengubah pembelajaran dari panduan guru menuju ke permainan, sehingga perubahan penilaian ke arah yang lebih kondusif dan menyenangkan, maka disarankan mensosialisasikan ke guru-guru untuk menggunakan metode bermain sambil belajar.

Meningkatkan kemampuan membacakan dongeng kelas 2 melalui pendekatan komunikatif di MI Roudlotul Hikmah Kecamatan Nguling Kabupaten Pasuruan / Unaizah

 

Kata kunci : Kemampuan membaca, dongeng, pendekatan komunikatif, MI Hasil observasi ditemukan siswa Kelas 2 di MI Roudlotul Hikmah Kecamatan Nguling belum pernah menggunakan pembelajaran dengan menggunakan pendekatan komunikatif. Sebagian besar siswa merasa bosan dan kurang bergairah dalam pembelajaran sehingga siswa belum mampu mencapai kriteria ketuntasan. Masalahnya adalah pembelajaran yang digunakan hanya biasa-biasa saja. Metode yang digunakan adalah ceramah. Tujuan yang ingin di capai dalam penelitian ini adalah : Menerapkan pendekatan komunikatif dapat meningkatkan kemampuan siswa dalam membaca di kelas 2 MI Roudlotul Hikmah Kecamatan Nguling. Penelitian ini terdiri dari 2 (dua) siklus. Subyek penelitian ini adalah siswa kelas II MI Roudloutl Hikmah yang berjumlah 18 orang siswa. Metode pengumpulan data dengan menggunakan observasi, wawancara dan hasil evaluasi / tes serta refleksi. Penelitian ini dilaksanakan selama 2 siklus melalui tahap perencanaan, pelaksanaan tindakan, observasi, evaluasi serta refleksi. Instrumen yang digunakan adalah pedoman observasi, pedoman wawancara dan soal tes. Hasil penelitian yang diperolah adalah sebagai berikut : rata-rata prestasi belajar siswa dalam pembelajaran bahasa mengalami peningkatan dari 62 pada pra tindakan menjadi 72,66 pada siklus I kemudian menjadi 89,11 pada siklus II. Tetapi pembelajaran secara individu terdapat dua anak yang belum tuntas masalahnya adalah anak tersebut belum bisa membaca. Adapun cara penangananya guru memberikan remedial khusus. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa dengan menggunakan pendekatan komunikatif dapat meningkatkan prestasi belajar bahasa, aktivitas siswa MI Roudlotul Hikmah lebih aktif daripada sebelumnya. Berdasarkan penelitian ini hendaknya guru memperhatikan karakteristik siswa serta menerapkan pendekatan komunikatif dalam pembelajaran bahasa. Adapun saran yang dilakukan oleh guru, siswa, maupun peneliti harus memperhatikan karakteristik dan dapat menindaklanjuti pendekatan komunikatif tersebut.

Penerapan metode bermain tebak angka untuk peningkatan kemampuan kognitif kelompok A di RA Mamba'ul Huda Mlaten Nguling Pasuruan / Iin Sulinah

 

Kata kunci: Peningkatan kemampuan kognitif, bermain tebak angka Kemampuan kognitif bertujuan untuk mengembangkan kemampuan berfikir anak melalui bermain tebak angka. Bermain tebak angka dapat meningkatkan kemampuan mengenal konsep bilangan 1 sampai 10. Hasil observasi awal ditemukan bahwa siswa RA Manba’ul Huda belum mampu mencapai kriteria ketuntasan belajar siswa yang ditentukan sekolah yaitu 70 ketuntasan individu. Tujuan yang ingin dicapai dalam penelitian ini adalah: 1) mendeskripsikan penerapan metode bermain tebak angka untuk meningkatkan kemampuan kognitif anak kelompok A RA Manba’ul Huda Mlaten Nguling Pasuruan, 2) mendeskripsikan peningkatan kemampuan kognitif Kelompok A di RA. Manba’ul Huda Mlaten Nguling Pasuruan dengan diterapkan metode bermain tebak angka. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan dalam dua siklus yang masing-masing siklus terdiri atas empat tahapan, yaitu perencanaan, pelaksanaan, pengamatan dan refleksi. Yang menjadi subyek penelitian adalah siswa kelompok A RA Manba’ul Huda Mlaten Nguling Pasuruan sebanyak 20 siswa dengan observasi sebagai tekhnik pengumpulan datanya. Hasil analisis data setelah pelaksanaan metode bermain tebak angka menunjukkan bahwa hasil pengamatan observasi siswa dalam melaksanakan kegiatan mencapai nilai 79,75 dengan kategori A, ketuntasan belajar 100%. Hasil penelitian ini menunjukkan pelaksanaan metode bermain tebak angka kelompok A RA Manba’ul Huda dapat meningkatkan kemampuan kognitif siswa, terbukti dari hasil yang diperoleh siswa dengan rata-rata hasil tes mulai dari pra tindakan (50,75) dengan persentase (15%0) meningkat siklus I (62,25) dengan persentase (45%) dan meningkat lagi siklus II (79,75) dengan persentase 100% yang terus mengalami peningkatan. Saran yang disampaikan kepada guru yaitu agar dapat menerapkan metode bermain tebak angka dalam meningkatkan kemampuan kognitif dengan pengaembangan lain. Metode pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian lain sebagai bahan bandingan sehingga dikemudian hari menjadi lebih baik.

Pengaruh metode pembelajaran kooperatif model STAD vs konvensional dan motivasi berprestasi terhadap hasil belajar bahasa Arab siswa kelas X SMAN I Malang / Umi Machmudah

 

Kata kunci: Metode Pembelajaran Kooperatif, motivasi berprestasi, hasil belajar bahasa Arab Pebelajar bahasa Arab di SMAN 1 kemampuannya sangat beragam. Dalam belajar bahasa asing dibutuhkan suasana belajar atau lingkungan yang dapat mendukung tercapainya hasil belajar yang maksimal. Sementara metode pembelajaran kooperatif model STAD belum banyak diterapkan di SMAN yang mengajarkan bahasa Arab, padahal metode ini dapat meningkatkan hasil belajar bahasa termasuk bahasa arab, karena dengan metode ini siswa yang memiliki kemampuan rendah akan terdorong untuk aktif belajar, dan siswa yang berkemampuan tinggi semakin meningkat kemampuannya. Penelitian ini bertujuan untuk: 1) menguji efektifitas dua metode pembelajaran koperatif model STAD dan pembelajaran konvensional yang berbeda dalam pembelajaran bahasa Arab yang digunakan di SMAN I Malang, 2) menguji perbedaan hasil belajar bahasa Arab siswa SMAN I Malang antara siswa yang memiliki motoivasi berprestasi tinggi dan siswa yang memiliki motivasi berprestasi rendah, 3) menguji pengaruh interaksi antara penerapan metode pembelajaran kooperatif model STAD dengan tingkat motivasi berprestasi terhadap hasil belajar bahasa Arab siswa SMAN I Malang Untuk mencapai tujuan penelitian tersebut, dilakukan penelitian kuasi eksperimen pada pebelajar kelas X SMAN I Malang tahun pelajaran 2009/ 2010. Eksperimen menggunakan rancangan dua faktor dengan versi desain faktorial non-ekuivalen control group. Dengan teknik random, terpilih X2 dan X4 sebagai kelompok eksperimen yang diberi perlakuan metode pembelajaran kooperatif model STAD dan kelas X3 dan X5 sebagai kelompok kontrol yang difasilitasi dengan metode konvensional. Data hasil belajar bahasa Arab dikumpulkan dengan menggunakan tes hasil belajar bahasa Arab dalam berbagai macam tes, yakni bentuk menjodohkan, pilihan ganda, isian, menyusun kalimat yang terdiri dari 40 item. sepuluh item pertama berbentuk tes pilihan asosiatif dengan indeks relabilitas alpha cronbach = 0, 891; lima item kedua berbentuk tes pilihan ganda dengan indeks relabilitas alpha cronbach = 0,773; sepuluh item ketiga berbentuk tes melengkapi dengan indeks relabilitas alpha cronbach = 0,947; lima item keempat berbentuk tes membuat kalimat dengan indeks alpha cronbach = 0,774; lima item kelima berbentuk tes menyusun kata-kata dengan indeks alpha cronbach = 0,775; lima item keenam berbentuk tes isian dengan indeks alpha cronach = 0,819;Data motivasi berprestasi diukur dengan menggunakan kuesioner motivasi berprestasi yang dikembangkan oleh Robinson (1961) yang telah diadaptasi oleh Degeng (1991). Data dianalisis dengan menggunakan statistik deskriptif dan analisis varians faktorial 2 x 2 dengan bantuan program SPSS 13,0 for windows. Pengujian hipotesis dilakukan pada taraf signifikansi 0,05. Berdasarkan analisis data, ditemukan hasil-hasil penelitian sebagai berikut. Pertama, terdapat perbedaan hasil belajar bahasa Arab antara kelompok siswa yang belajar dengan metode pembelajaran kooperatif model STAD (PKs) dengan kelompok siswa yang belajar dengan metode pembelajaran konvensional (PKv) ( F = 76,130; p = 0,000 ). Kedua, terdapat perbedaan hasil belajar bahasa Arab antara kelompok siswa yang memiliki motivasi berprestasi tinggi (MBt) dengan siswa yang memiliki motivasi berprestasi rendah (MBr) ( F = 107,576; p = 0,000 ). Ketiga, terdapat pengaruh interaksi antara metode pembelajaran kooperatif model STAD dan konvensional dan tingkat motivasi berprestasi (tinggi dan rendah) terhadap perolehan hasil belajar bahasa Arab ( F = 10,100; p = 0,002 ) Berdasarkan temuan-temuan penelitian, diajukan saran-saran sebagai berikut: (1) perbaikan mutu pembelajaran bahasa Arab khususnya pada siswa SMAN dengan menerapkan metode pembelajaran kooperatif di kelas, (2) metode pembelajaran yang diteliti dalam penelitian ini hanya terbatas pada keberadaan bahasa Arab yang sifatnya sebagai materi integrated artinya keempat ketrampilan bahasanya diajarkan secara terintegrasi, tidak berdiri sendiri-sendiri sebagai mata pelajaran yang terpisah. Karena itu untuk mendapat hasil penelitian yang akurat disarankan untuk meneliti dan membandingkan beberapa metode yang dikenal selama ini pada masing-masing ketrampilan bahasa, sehingga guru dapat memilih metode pembelajaran yang tepat, yang dapat meningkatkan hasil belajar, (3) variabel-variabel moderator (selain motivasi berprestasi) yang diduga juga berpengaruh terhadap hasil belajar bahasa arab, disarankan untuk diadakan penelitian lebih lanjut dan dikombinasikan dengan metode pembelajaran kooperatif, sehingga akan diperoleh suatu strategi pembelajaran yang tepat dalam meningkatkan mutu pembelajaran bahasa Arab, khususnya untuk siswa SMAN, (4) untuk menguji keefektifan metode pembelajaran kooperatif model STAD dan konvensional, perlu dilakukan penelitian dengan: a) melibatkan variable –variabel kemampuan yang lain, misalnya kemampuan berpikir kritis, kemampuan awal, kemampuan pengambilan keputusan, kemampuan berkolaborasi, kemampuan memecahkan masalah, dan yang lainnya, b) memperpanjang durasi perlakuan untuk melihat lebih cermat proses peningkatan kemampuan dalam rentang waktu yang lebih lama, dan jika mungkin dipertimbangkan untuk dilakukan juga penelitian kualitatif atau penelitian tindakan kelas

Pengaruh aktivitas pengembangan diri Paskibra terhadap prestasi belajar sejarah siswa kelas XII Jurusan IPS SMA Negeri 10 Malang / Nica Meilinda Dwi P.

 

Kata Kunci : pengembangan diri, prestasi belajar Pendidikan merupakan hal penting dalam kemajuan suatu negara dan individu, sudah hampir dipastikan bahwa semakin maju seseorang maka ia akan membutuhkan pendidikan.Di era yang maju seperti sekarang ini dibutuhkan keterampilan yang benar-benar dapat menunjang suatu jenis pekerjaan. Tidak hanya pendidikan akademik saja tetapi pendidikan non-akademik juga diperlukan, sehingga pada saat peserta didik lulus telah memiliki keterampilan atau setidaknya pengetahuan bermasyarakat. Pendidikan non-akademik yang dimaksud adalah melalui kegiatan Pengembangan diri. Dalam pendidikan umum dijelaskan bahwa pengembangan diri bertujuan memberikan kesempatan kepada peserta didik untuk mengembangkan dan mengekspresikan diri sesuai dengan kebutuhan, bakat, dan minat setiap peserta didik sesuai dengan kondisi sekolah. Kegiatan pengembangn diri difasilitasi dan atau dibimbing oleh konselor, guru, atau tenaga kependidikan yang dapat dilakukan dalam bentuk kegiatan ekstrakurikuler. Banyak faktor yang mempengaruhi prestasi belajar yaitu faktor intern adalah faktor dari dalam anak yaitu secara umum dan keseluruhan yang ada pada anak atau bersumber dari dalam diri subjek belajar, sedangkan disini faktor ekstern yaitu keaktifan dalam kegiatan pengembangan diri yang dianggap mempengaruhi prestasi belajar siswa. Untuk itu penelitian ini merumuskan masalah sebagai berikut.(1) Bagaimana tingkat keaktifan siswa kelas XII jurusan IPS di SMA Negeri 10 Malang dalam mengikuti kegiatan pengembangan diri paskibra?;(2) Bagaimana prestasi belajar mata pelajaran sejarah siswa kelas XII jurusan IPS yang mengikuti kegiatan pengembangan diri paskibra di SMA Negeri 10 Malang?;(3) Bagaimana pengaruh aktivitas pengembangan diri paskibra terhadap prestasi belajar mata pelajaran sejarah siswa kelas XII jurusan IPS SMA Negeri 10 Malang? Penelitian ini dilakukan di SMA Negeri 10 Malang. Rancangan penelitian yang digunakan adalah rancangan deskriptif korelasional. Populasi dam penelitian ini adalah seluruh siswa kelas XII jurusan IPS yang mengikuti kegiatan pengembangan diri paskibra. Sampel penelitian ini diambil melalui purposive sampling. Teknik pengumpulan data dengan menggunakan angket dan dokumentasi, penelitian ini menggunakan analisis deskriptif untuk menggambarkan tentang kondisi keaktifan kegiatan pengembangan diri dan prestasi belajar siswa pada mata pelajaran sejarah. Hasil penelitian menunjukan bahwa aktivitas pengembangan diri paskibra (X) memiliki nilai signifikansi sebesar 0.000 lebih kecil dari alpha : 0.05 dan nilai Thitung 6.708 lebih besar dari Ttabel sebesar 1.310 yang berarti bahwa Ho ditolak dan Ha diterima. Sehingga dapat disimpulkan bahwa aktivitas pengembangan diri paskibra (X) memberikan hasil sumbangan efektif (SE) terhadap prestasi belajar mata pelajaran sejarah (Y) sebesar 4,8% sedangkan 95,2% dipengaruhi oleh variable lain diluar penelitian yang dilakukan oleh peneliti. Kegiatan pengembangan diri paskibra merupakan faktor lingkungan (ekstern) dan kegiatan diluar proses kegiatan belajar mengajar dikelas yang tidak mempengaruhi pencapaian prestasi belajar siswa. Untuk penelitian selanjutnya, jika menggunakan variabel yang sama seperti dalam penelitian ini. Diharapkan dapat mengambil sampel yang lebih luas dan banyak sehingga hasilnya dapat bermanfaat bagi banyak pihak

Penerapan model pembelajaran talking stick untuk meningkatkan hasil belajar IPS pada siswa kelas V SDN Blitar Kecamatan Sukorejo Kota Blitar / Tatik Darlia

 

Kata kunci: IPS, hasil belajar, model talking stick. Selama ini pelajaran IPS dianggap sebagai pelajaran yang kurang penting, membosankan dan kurang menarik. Hal ini disebabkan karena mata pelajaran IPS tidak termasuk pelajaran UAN dan sebagian besar materi IPS menuntut siswa untuk menghafal. Selain berasal dari faktor siswa, peran guru juga mendukung ketidak menarikan pembelajaran IPS. Guru lebih banyak mendominasi kegiatan pembelajaran di kelas, dengan kata lain guru sebagai pusat pembelajaran. Guru cenderung hanya menyampaikan materi apa adanya tanpa berusaha bagaimana agar siswanya tidak pasif dalam pembelajaran. Kadang guru tidak menyadari bahwa hal ini akan berdampak pada hasil belajar siswa yang kurang memuaskan. Penelitian ini bertujuan (1) Mendeskripsikan tentang pelaksanaan pembelajaran IPS Kelas V di SDN Blitar Kecamatan Sukorejo Kota Blitar dengan model pembelajaran talking stick. (2) Mendeskripsikan peningkatan hasil belajar siswa pada mata pelajaran IPS Kelas V dengan penggunaan model pembelajaran talking stick di SDN Blitar Kecamatan Sukorejo Kota Blitar. Tujuan penelitian pelaksanaan pembelajaran mata pelajaran IPS di kelas V SDN Blitar Kecamatan Sukorejo Kota Blitar adalah mendeskripsikan tentang pelaksanaan pembelajaran IPS Kelas V di SDN Blitar Kecamatan Sukorejo Kota Blitar dengan model pembelajaran talking stick dan mendeskripsikan peningkatan hasil belajar siswa pada mata pelajaran IPS Kelas V dengan penggunaan model pembelajaran talking stick di SDN Blitar Kecamatan Sukorejo Kota Blitar. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan model talking stick dapat meningkatkan hasil belajar IPS siswa. Dalam setiap siklus ketuntasan hasil belajar pada proses belajar siswa mengalami peningkatan yaitu pra siklus (27,7%), siklus I (50%) dan siklus II (100%). Dalam setiap siklus ketuntasan hasil belajar pada tes akhir siswa mengalami peningkatan yaitu pra siklus (30,6%), siklus I (63,9%) dan siklus II (100%). Kesimpulan yang dapat diambil dari penelitian ini yaitu dengan menggunaan model talking stick dalam pembelajaran terbukti dapat meningkatkan hasil belajar IPS siswa. Maka disarankan menggunakan model talking stick dalam pembelajaran untuk meningkatkan hasil belajar IPS siswa.

Penerapan pembelajaran inkuiri terbimbing untuk meningkatkan keterampilan proses dan prestasi belajar materi sistem indera siswa kelas XI IPA SMA Negeri 11 Malang / Yohana Hariyono

 

Kata kunci: keterampilan proses, pembelajaran inkuiri terbimbing, prestasi belajar Observasi awal yang dilakukan di kelas XI-IPA SMA Negeri 11 Malang pada saat pembelajaran Biologi, peneliti menemukan beberapa fakta antara lain: (a) pengajaran berbasis keterampilan proses belum pernah dilakukan, (b) prestasi siswa belum mencapai target yang diinginkan berdasarkan Standar Ketuntasan Belajar Mengajar (SKBM) dengan nilai 70. Masalah yang dapat diidentifikasi berdasarkan fakta dan permasalahan tersebut adalah rendahnya keterampilan proses dan prestasi belajar siswa, sehubungan dengan hal tersebut maka tujuan penelitian ini adalah untuk: 1) meningkatkan keterampilan proses siswa, 2) meningkatkan prestasi belajar siswa. Jenis penelitian yang dilakukan adalah penelitian tindakan kelas yang dirancang dalam 2 siklus pembelajaran inkuiri terbimbing. Dalam setiap siklus terdiri dari 4 tahap yaitu: perencanaan, pelaksanaan, observasi dan refleksi. Setiap siklus melibatkan tahapan inkuiri terbimbing yang meliputi observasi, bertanya, perumusan masalah, pengamatan dan pengumpulan data, kesimpulan, dan refleksi. Sedangkan untuk keterampilan proses meliputi: 1) melakukan observasi, 2) mengajukan hipotesis atau dugaan sementara, 3) memprediksi, 4) menemukan pola atau hubungan, 5) melakukan komunikasi secara efektif, 6) merencanakan investigasi, dan 7) melakukan pengukuran dan penghitungan. Subjek penelitian tindakan ini adalah siswa kelas XI-IPA SMA Negeri 11 Malang yang berjumlah 40 siswa. Penelitian ini dilaksanakan pada bulan April-Mei 2008. Jenis data dalam penelitian ini berupa data 1) keterampilan proses siswa dan 2) prestasi belajar siswa Hasil dari penelitian ini adalah (1) Penerapan pembelajaran inkuiri terbimbing meliputi beberapa tahapan yaitu kegiatan awal, kegiatan inti, dan kegiatan akhir. Pada kegiatan awal diberikan pengajaran berupa pemberian pertanyaan pengarah agar siswa mampu menemukan sendiri arah dan tindakan yang harus dilakukan untuk memecahkan permasalahan yang disodorkan oleh guru. Penerapan inkuiri terbimbing yang benar dapat digunakan dalam meningkatkan keterampilan proses siswa untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera siswa kelas XI IPA SMA Negeri 11 Malang, (2) Penerapan pembelajaran inkuiri terbimbing meliputi beberapa tahapan yaitu kegiatan awal, kegiatan inti, dan kegiatan akhir. Pada kegiatan awal diberikan pengajaran berupa pemberian pertanyaan pengarah agar siswa mampu menemukan sendiri arah dan tindakan yang harus dilakukan untuk memecahkan permasalahan yang disodorkan oleh guru. Penerapan inkuiri terbimbing yang bebar dapat digunakan dalam meningkatkan prestasi belajar siswa untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera siswa kelas XI IPA SMA Negeri 11 Malang, (3) Penerapan pembelajaran inkuiri terbimbing untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera sehubungan dengan keterampilan proses siswa kelas XI IPA SMA Negeri 11 Malang mengalami peningkatan dari 54.62% pada siklus I menjadi 71.43% pada siklus II, (4) penerapan pembelajaran inkuiri terbimbing untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera sehubungan dengan prestasi belajar siswa kelas XI IPA SMA Negeri 11 Malang mengalami peningkatan dari nilai rata-rata 73 pada siklus I menjadi 89 pada siklus II, (5) Penerapan pembelajaran inkuiri terbimbing pada pokok bahasan sistem indera dapat digunakan untuk meningkatan keterampilan proses dan prestasi belajar siswa kelas XI IPA SMA Negeri 11 Malang. Untuk mengetahui lebih baik lagi penerapan pembelajaran inkuiri di kelas, maka dapat dilakukan pada materi lain. Untuk mengetahui keberhasilan setiap siswa hendaknya waktu yang

Pengaruh paparan berulang formalin melalui inhalasi terhadap kerusakan sel hati dan sel ginkal mencit betina (Mus musculus) galur Balb C / Yohana Hariyono

 

Kata kunci: formalin, kariolisis, karioreksis, piknosis, sel ginjal, sel hati Formalin merupakan larutan 30-50% formaldehida yang sangat toksik dengan bau yang sangat iritatif meskipun dengan kadar yang rendah (< 1 ppm). Meskipun banyak laporan penelitian tentang formalin yang menyebabkan kerusakan sel hati dan sel ginjal mencit, namun belum ditemukan pengaruh formalin terhadap kerusakan sel hati dan sel ginjal yang meliputi kariolisis, karioreksis dan piknosis dengan paparan yang sangat rendah. Penelitian ini bertujuan untuk: (1) mengetahui apakah paparan berulang formalin melalui inhalasi dengan tingkat konsentrasi yang berbeda dapat menyebabkan kerusakan sel hati, (2) mengetahui apakah paparan berulang formalin melalui inhalasi dengan tingkat konsentrasi yang berbeda dapat menyebabkan kerusakan sel ginjal. Penelitian ini adalah penelitian eksperimen dengan rancangan penelitian faktorial dengan rancangan dasar Rancangan Acak Kelompok (RAK). Subjek penelitian adalah mencit betina (Mus musculus) yang berumur 30 hari, jenis kelamin betina dengan berat badan 18-20 gram. Konsentrasi formalin yang diberikan yaitu 0 ppm sebagai kontrol, 2 ppm, dan 4 ppm yang dipaparkan setiap hari selama 6 jam dan 8 jam selama 7 hari 8 minggu. Efek dari paparan yang diamati adalah kerusakan sel hati dan sel ginjal yang meliputi kariolisis, karioreksis, dan piknosis. Kerusakan sel diamati secara histopatologi menggunakan pewarnaan Hematoxilin Eosin Hasil penelitian ini menunjukkan: (1) paparan berulang formalin melalui inhalasi dengan konsentrasi yang berbeda dapat menyebabkan kerusakan sel hati dan sel ginjal, (2) paparan dengan konsentrasi 2 ppm menyebabkan karioreksis sel hati, paparan dengan konsentrasi 4 ppm menyebabkan piknosis dan kariolisis sel hati. Sedangkan paparan dengan konsentrasi 4 ppm menyebabkan karioreksis, piknosis dan kariolisis sel ginjal, (3) paparan berulang formalin melalui inhalasi dengan lama paparan 8 jam berpengaruh terhadap kerusakan sel hati dan sel ginjal, (4) kombinasi antara paparan dan 4 ppm 8 jam berpengaruh menyebabkan kerusakan hati dan ginjal mencit betina (Mus musculus) Galur Balb C. Pada penelitian ini disarankan untuk dilakukan penelitian lanjutan kerusakan struktur sel hati dan sel ginjal dengan lebih teliti lagi.

Pengembangan paket bimbingan pribadi sosial untuk meningkatkan penyesuaian diri siswa SMA / Evi Fitriah

 

Key words: guidance packet, social personal, adaptation Students in Senior High have been center age adolescence and start to find out self identify. In this teen age happen change of physical or psychological. The change of physical sometimes make disadvantage at partly adolescent so this disadvantage make adolescent become less could to adaptation. Adolescent who have low acclimatization will do the thing which can disadvantages for their self, like imitate, played truant and collide with the rule of school. Concerned with acclimatization, conselor has duty to guidance the students in make their positive acclimatization ability. One of effort which can do with give guidance servive about acclimatization. The purpose of this development is produce social personal packet development to improve the acclimatization the students in Senior High School Class X which in theoritical and practical manner can used by conselor in Senior High School as a media which give information about acclimatization. Development packet of social personal guidance to improve acclimatization adapt the steps of model development instructional Dick and Carey which consists of step (1) do need assesment, (2) arrange of guidance packet of acclimatization,(3) Experiment expert of BK and media expert, (4) revision from experiment expert of BK and media expert, (5)experiment candidat of consumer, (6) revision from the experiment result of consumer that is conselor. The assessment do by expert of counseling guidance and expert media of learning. Data which get from qualitativeand quantitative data. Technique of collect data in this research is interview and questionnaire to assessment of experiment expert and candidat consumer. Technique of analysis data which used is technique of descriptive analysis mode central mainstream. Product which developed is Social Personal Packet Guidance To Improve Acclimatization The Student In Senior High School which consists of (1) hand book of acclimatization packet guidance to conselor, and (2) the material of social personal guidance for students, which consists of three cut-off that is: (1) basic concept of acclimatization, (2) acclimatization of adolescent, (3) adjusment in daily life. The result of development shows valid level packet guidance of acclimatization at function aspect get 4 score (expert experiment and candidat of consumer) with the criteria is very useful. In practical aspoect get 3 score (expert experiment and candidat of consumer) with practical aspect.In accuracy aspect get 3 score ( expert experiment and candidat of consumer) with accuracy criteria. In conspicuousness aspect get 4 score (expert experiment and candidat of consumer) with interest criteria. The result of data analysis qualitative shows that there are some of packet components which must revision : (1) physical screen (size/ book dimension, colouring, lay-out for too formal), (2) cover design and icons in text book BPS had better refer to audience segment that is students, (3) colour screen which not too strong in acclimatization packet had better make more soft (4) text font in hand book cover to conselor had better formal (font calibri, arial or times new roman), (5) instruction to answer the quistionnaire must more clear so answer refer to questionnaire directly, (6) the wrong process of writing and language must refer to orthographic not contamination with javanese. According the experiment result, so advise which given : (1) conselor as lecture must understand guidance of procedur and material to the students can get the purpose of guidance what they want, (2) conselor can add the other media to can make students interest in comprehend the material of acclimatization, (3) further to this research so need experiment the product to the target that is the student in order to know product earnings effectively.

Penerapan permainan susun kata untuk mengembangkan kemampuan berbahasa anak kelompok B Taman Kanak-kanak PKK Kelurahan Klampok Kecamatan Sananwetan Kota Blitar / Winarsih

 

Kata kunci : Permainan Susun Kata, Kemampuan Berbahasa, TK PKK Klampok Kota Blitar. Pendidikan anak usia dini adalah suatu upaya pembinaan yang ditujukan kepada anak sejak lahir sampai dengan usia enam tahun, yang dilakukan melalui rangsangan pendidikan untuk membantu partumbuhan baik jasmani dan rohani, agar anak memiliki kesiapan dalam memasuki jenjang pendidikan selanjutnya (Wijana, dkk, 1989:25). Dari hasil pengamatan yang dilakukan di TK PKK Kelurahan Klampok di temukan bahwa anak kelompok B masih kesulitan dalam berbahasa, hal ini di tandai adanya lima anak yang diam saja, anak yang sulit menemukan kata-kata yang tepat untuk menjawab pertanyaan dari guru, anak kurang mengerti setiap kata dalam hal ini mengartikan dan menyampaikan secara utuh kepada orang lain, anak yang sering keluar masuk kelas, anak yang tidak pernah selesai dalam mengerjakan kegiatan. Hal ini disebabkan karena belum ditemukannya kegiatan yang tepat untuk meningkatkan kemampuan berbahasa, kemampuan dalam berkomunikasi dengan guru, teman dan orang lain. Tujuan kenapa penelitian tindakan kelas ini dilakukan adalah untuk mendeskripsikan penerapan permainan susun kata dalam mengembangkan kemampuan berbahasa pada anak kelompok B TKK PKK Klampok dan mendeskripsikan peningkatan kemampuan berbahasa anak kelompok B TK PKK Klampok setelah diberi permainan susun kata. Desain penelitian ini adalah menggunakan desain Penelitian Tindakan Kelas (PTK). Elliot (1992:69) menyatakan bahwa penelitian tindakan dapat didefinisikan sebagai penelitian situasi sosial dengan pandangan untuk meningkatkan kulaitas aksi yang ada dalam penelitian tersebut. PTK untuk pembelajaran bahasa ditujukan pada penemuan strategi belajar dan mengajar yang cocok dengan gaya pembelajar dan strategi dalam belajar bahasa (Latief, 2003:99). Berdasarkan Kemmis and McTaggart (1988:6), istilah aksi dan penelitian menggarisbawahi fitur penting dari sebuah pendekatan: uji coba ide dalam melatih sebagai alat peningkatan dan sebagai alat perbaikan pengetahuan tentang kurikulum, pengajaran, dan pengajaran. Desain penelitian tindakan kelas pada penelitian ini ditujukan untuk mengembangkan sebuah strategi untuk memecahkan masalah dan meningkatkan kemampuan anak berbahasa. Kemampuan berbahasa yang ada dalam penelitian tindakan kelas yang memiliki fungsi sebagai alat komunikasi menurut Nelson Francis (1957:12) didiskusikan peningkatannya sehingga dapat diketahui bahwa pada kemampuan awal anak berbahasa 51,67 rata-rata nilai kelompok B TK PKK Klampok Kota Blitar kemudian meningkat dengan diterapkannya metode permainan susun kata menggunakan kartu huruf dan kartu suku kata. Peningkatan pada siklus I penelitian tindakan kelas ini meningkat dengan rata-rata 73,33 dengan tidak adanya anak yang beerkemampuan bahasa sedang. Dalam pembuktian peningkatan kemampuan bahasa anak, peneliti dan kolaborator melaksanakan siklus II untuk melakukan upaya peningkatan yang lebih dari penerapan metode permainan susun kata yang mana kemudia hasil nilai rat-rata anak menjadi 88, 33. Deskrisi peningkatan kemampuan tersebut diatas dikombinasikan dengan deskripsi penerapan metode permainan susun kata yang meningkatkan komponen bahasa anak dalam hal penguasaan perbendaharaan kata. Dari hasil yang didapat, penelitian ini diharapkan dapat membantu meningkatkan kualitas proses belajar da mengajar dan memotivasi guru dalam melakukan peningkatan kualitas pembelajran yang aktif, kreatif, dan menyenangkan.

Peningkatan kemampuan kognitif melalui permainan kotak angka dan gambar pada anak kelompok B TK Dharma Wanita Kerjen Srengat / Septi Wahyu Yudhaningsih

 

Keywords: Cognitive Ability, Play, Box Score And Pictures This is because the learning activities do not involve children and not giving freedom to children to express and try fun activities for children. The research aims to describe the application of game box numbers and images that can improve the cognitive abilities of children and described the increase in cognitive abilities of children in group B TK Dharma Wanita Kerjen after through the game box numbers and images. The research design used was the design of classroom action research with process II cycles.. In each cycle consisting of the stages of planning, execution, observation, and reflection. The results showed that the application of game box numbers and pictures shown to be utilized in the learning activities to enhance cognitive abilities of children. In the first cycle of cognitive ability of children to 70%, increased to 93.3% in cycle II. Improving cognitive abilities of children marked by increasing the ability of color grouping, sort the numbers 1-10 with the object, the symbol pair numbers with pictures and sort the colors fit the pattern. It is suggested that cognitive learning should be implemented in the game box numbers and pictures and it is suggested that further research with other problems that can be utilized in the learning field of development in addition to the field of cognitive abilities, namely language, art, physical and motor.

Peningkatan kemampuan sosial emosional anak melalui metode permainan mencari teman di kelompok A TK Dharma Wanita II Tapakrejo Kabupaten Blitar / Siti Nuryatin

 

Kata Kunci : Kemampuan Sosial Emosional, Permainan Mencari Teman, Taman Kanak-kanak. Penelitian ini berlatarbelakang kurangnya kemampuan sosial emosional anak, hal ini disebabkan karena strategi yang digunakan guru kurang menarik minat anak, dan kurangnya guru dalam memberikan stimulasi dengan berbagai macam permainan. Peningkatan kemampuan sosial emosinal anak melalui permainan mencari teman ini bertujuan : (1) mendeskripsikan penerapan permainan mencari teman dalam pengembangan kemampuan sosial emosional anak di kelompok A TK Dharma Wanita II Tapakrejo. (2) mendeskripsikan peningkatan kemampuan sosial emosional anak melalui kegiatan permainan mencari teman di kelompok A TK Dharma Wanita II Tapakrejo. Metode penelitian yang digunakan dalam penelitian ini adalah penelitian deskriptif dengan rancangan PTK yang terdiri atas 2 siklus. Masing – masing siklus memiliki 4 tahapan: perencaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian ini adalah 12 anak kelompok A TK Dharma Wanita II Tapakrejo Kabupaten Blitar. Instrumen yang digunakan adalah Lembar Penialian dan Observasi. Tehnik analisis yang digunakan adalah deskriptif. Dalam penelitian ini peneliti juga berkolaborasi dengan teman sejawat. Hasil analisis data dari pembelajaran kemampuan sosial emosional melalui permainan mencari teman dapat dideskripsikan sebagai berikut: dari hasil pengamatan siklus I memperoleh prosentase sebesar 53,1%, dan dari hasil pengamatan siklus II memperoleh prosentase sebesar 75,7%, terdapat peningkatan sebesar 22,6%. Kesimpulan melalui permainan mencari teman dapat meningkatkan kemampuan sosial emosional anak di kelompok A TK Dharma Wanita II Tapakrejo, dari 12 anak yang mendapat bintang 3 ada 5 anak sedangkan anak yang mendapat bintang 4 ada7 Berdasarkan kesimpulan maka dapat diberikan saran sebagai berikut: (1) Guru TK diharapkan dapat menggunakan permainan mencari teman untuk mengembangkan kemampuan sosial emosional. (2) Sekolah agar terus memantau para guru untuk terus bekerja sama dan meningkatkan kreativitas dalam pengembangan pembelajaran.

Kegagalan inovasi pertanian desa Pule 1968-1984 / Heti Fitarida

 

Kata Kunci : Petani Padi, Modernisasi Desa, Inovasi Pertanian, Revolusi Hijau. Padi mempunyai peranan yang sangat penting dalam bidang perekonomian, karena perekonomian merupakan bagian dari kegiatan yang harus dilakukan untuk menentukan berhasil tidaknya sebuah negara mensejahterakan rakyatnya. Indonesia adalah negara berkembang yang mencoba menerapkan program Revolusi Hijau. Revolusi Hijau tersebut bertujuan untuk dapat meningkatkan produksi padi guna menghindari impor beras yang pernah terjadi pada tahun 1971. Desa Pule merupakan desa agraris yang juga melaksanakan program Revolusi Hijau mulai tahun 1974. Pertanian Desa Pule sebelum Revolusi Hijau tahun 1968 bercirikan sebuah pertanian tradisional yang sangat bergantung dengan alam, sampai dilaksanakannya Bimas tahun 1974 pertanian berubah menjadi sebuah pertanian semi modern. Rendahnya tingkat pendidikan petani Desa Pule telah menyebabkan kegagalan proses Revolusi Hijau. Pada saat Indonesia berswasembada beras tahun 1984, Desa Pule tidak banyak mengalami perubahan dan menempati posisi terendah sekabupaten Trenggalek. Pada tahun 1984 hasil produksi padinya hanya mencapai rata-rata 4,7 ton/ha. Berdasarkan hasil paparan latar belakang di atas, penulis merumuskan masalah, yaitu, (1) bagaimana kondisi pertanian sebelum penerapan inovasi pertanian di Desa Pule 1968-1984, (2) bagaimana kondisi pertanian selama penerapan inovasi pertanian di Desa Pule 1968-1984, dan (3) apa yang menyebabkan inovasi pertanian di Desa Pule 1968-1984 mengalami kegagalan. Tujuan diadakan penelitian ini, antara lain sebagai berikut: (1) mendeskripsikan kondisi pertanian sebelum penerapan inovasi pertanian di Desa Pule 1968-1984, (2) mendeskripsikan kondisi pertanian selama penerapan inovasi pertanian di Desa Pule 1968-1984, dan (3) mendeskripsikan penyebab inovasi pertanian di Desa Pule 1968-1984 mengalami kegagalan. Pada penelitian ini peneliti menggunakan metode sejarah, yaitu pemilihan topik (memilih topik yang layak untuk tema penelitian), heuristik (pengumpulan sumber-sumber sejarah), verifikasi (melakukan kritik sumber, melalui kritik eksternal/pengujian terhadap aspek luar sumber sejarah dan kritik intern/ pengujian terhadap aspek dalam sumber sejarah), interpretasi (melakukan penafsiran terhadap fakta satu dengan fakta yang lain), dan historiografi (penulisan sejarah). Hasil penelitian ini sebagai berikut (1) kondisi pertanian Desa Pule sebelum Revolusi Hijau tahun 1968 merupakan sebuah desa dengan pertanian yang masih tradisional karena bergantung pada alam. Teknik bertani dan peralatan pertaniannya pun masih sangat sederhana sesuai dengan kondisi dan cara fikir petani awam yang masih berorientasi pada kebiasaan adat. (2) Pertanian Desa Pule mulai berubah pada tahun 1974 ketika petani Desa Pule mulai mengadopsi teknik bertani dan peralatan pertanian. Proses adopsi tersebut

Peningkatan kemampuan membaca permulaan melalui metode pemberian tugas pada anak kelompok B di TK Al-Hidayah 2 Jeblog Talun Kabupaten Blitar / Nanik Wijiatiningsih

 

Kemampuan Membaca Permulaan Metode Pemberian Tugas, TK Penelitian ini berlatar belakang pada rendahnya kemampuan membaca permulaan anak. Hal ini disebabkan karena kegiatan pembelajaran belum melibatkan anak dan anak belum hafal dengan huruf-huruf abjad serta 75% anak di TK Al-Hidayah 2 Jeblog Talun Blitar berasal dari keluarga yang tidak mampu dan perhatian orang tua terhadap pendidikan anak kurang. Penelitian bertujuan untuk (1) Mendeskripsikan penerapan Metode Pemberian Tugas dalam meningkatkan kemampuan membaca permulaan melalui Anak Usia Dini Kelompok B di TK Al-Hidayah 2 Jeblog Talun Blitar; (2) Mendeskripsikan hasil penerapan Metode Pemberian Tugas untuk Anak Usia Dini kelompok B di TK Al-Hidayah 2 Jeblog Talun Blitar. Rancangan penelitian yang digunakan adalah Rancangan Penelitian Tindakan Kelas dengan dua siklus. Setiap siklus terdiri dari tahap perencanaan, pelaksanaan, observasi dan refleksi. Instrumen yang digunakan adalah pedoman observasi, dan dokumentasi. Penelitian ini dilakukan di Kelompok B TK Al-Hidayah Jeblog Talun Blitar dengan subyek sebanyak 17 anak, terdiri dari 9 anak perempuan dan 8 anak laki-laki. Hasil penelitian menunjukkan bahwa penerapan tugas memasangkan huruf-huruf pada gambar dengan metode Pemberian Tugas dapat meningkatkan kemampuan membaca permulaan pada Siklus I dari 76,5% meningkat menjadi 94,1% pada Siklus II. Peningkatan Bahasa anak ditandai dengan mengelompokkan kata-kata yang sejenis pada siklus I mencapai 76,5% meningkat menjadi 88,2% pada siklus II. Peningkatan menghubungkan dan menyebutkan tulisan sederhana dengan simbol yang melambangkannya pada Siklus I mencapai 70,6% meningkat menjadi 88,2% pada Siklus II. Berdasarkan hasil analisa penelitian tersebut di atas dapat disimpulkan : (1) penerapan metode Pemberian Tugas dapat dimanfaatkan untuk Anak TK; (2) penerapan metode Pemberian Tugas dapat meningkatkan kemampuan membaca permulaan anak TK. Disarankan pada pendidik untuk menerapkan kegiatan memasangkan huruf pada gambar untuk mengembangkan kemampuan membaca permulaan anak TK.

Meningkatkan kemampuan membaca cerita berbahasa Indonesia melalui buku cerita bergambar Big Book di kelas I MI Al Islamiyah Kauman-Bangil / Zainab

 

Kata Kunci: Kemampuan membaca, Media, Big Book. Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik dan merupakan penunjang keberhasilan dalam mempelajari semua bidang studi. Pembelajaran diarahkan untuk meningkatkan kemampuan peserta didik untuk berkomunikasi dalam Bahasa Indonesia dengan baik dan benar, baik secara lisan maupun tulisa. Tujuan penulisan skripsi ini adalah: (1) Mendeskripsikan penggunaan media buku cerita bergambar big book dalam meningkatkan kemampuan membaca cerita pendek dalam pembelajaran bahasa Indonesia siswa kelas I MI Al Islamiyah. (2) Mendeskripsikan peningkatan kemampuan siswa dalam membaca cerita pendek dengan menggunakan media buku cerita bergambar big book pada pembelajaran Bahasa Indonesia kelas I Semester I MI Al Islamiyah. Penelitian ini menggunakan jenis Penelitian Tindakan Kelas (PTK) yang terdiri dari dua siklus. Masing-masing siklus memerlukan waktu 4 x 30 menit. Tehnik pengumpulan data yang digunakan antara lain: observasi, Wawancara, dokumentasi, dan tes. Hasil penelitian menunjukkan adanya peningkatan kemampuan mendeskripsikan secara tertulis melalui pemanfaatan media gambar dengan peningkatan 27,3% pada siklus I dibandingkan dengan nilai pratindakan, dan peningkatan 13,6% pada siklus II. Dengan identifikasi gambar secara teliti didukung kemampuan siswa membaca cerita pendek dan bimbingan guru selama kegiatan berlangsung maka terjadi peningkatan pada hasil belajar siswa kelas I MI Al Islamiyah. Untuk membantu siswa membaca cerita pendek sebaiknya guru memanfaatkan buku cerita bergambar big book dalam pembelajaran membaca cerita pendek agar kemampuan siswa dapat meningkat.

Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA pada siswa kelas IV SDN Sundil Kecamatan Praya Kabupaten Lombok Tengah / Muh. Syukri Ghazali

 

Kata Kunci: Model Pembelajaran Inkuiri, Hasil Belajar SDN Sundil terletak di Desa Montong Terep, Praya, Kabupaten Lombok Tengah. Berdasarkan hasil observasi di kelas IV SDN Sundil dalam pembelajaran IPA, guru lebih banyak menggunakan metode ceramah dan siswa mendengarkan kemudian mencatat materi yang ditulis dipapan tulis. Kondisi ini membuat siswa menjadi pasif untuk belajar IPA sehingga hasil belajar IPA siswa kelas IV SDN Sundil masih banyak yang memperoleh nilai dibawah standar ketuntasan minimal yang ditetapkan oleh sekolah yaitu 70,00. Masalah yang ditemukan di kelas IV SDN Sundil antara lain rendahnya hasil belajar dan aktivitas belajar siswa. Oleh karena itu, penelitian ini bertujuan untuk mendeskripsikan proses dan hasil pembelajaran inkuiri dalam upaya meningkatkan hasil belajar IPA siswa kelas IV SDN Sundil. Selain itu juga untuk mendeskripsikan proses dan hasil pembelajaran inkuiri dalam upaya meningkatkan aktivitas belajar siswa kelas IV SDN Sundil. Penelitian ini dilaksanakan di kelas IV SDN Sundil yang berjumlah 37 siswa. Pelaksanaan tindakan mulai bulan Juni sampai Juli 2010. Penelitian ini dilaksanakan secara bersiklus dengan mengacu pada model Kemmis dan Mc Taggart yang terdiri dari empat fase, yaitu perencanaan, pelaksanaan, tindakan dan observasi, refleksi dan revisi. Data yang dikumpulkan dalam penelitian ini meliputi, hasil belajar dan aktifitas belajar siswa. Data hasil belajar diperoleh melalui hasil tes yang dilakukan di akhir siklus, sedangkan nilai aktivitas belajar siswa diperoleh melalui observasi selama melakukan kegiatan pembelajaran melalui penerapan model pembelajaran inkuiri. Hasil penelitian menggunakan model pembelajaran inkuiri menunjukkan bahwa hasil belajar IPA siswa kelas IV SDN Sundil meningkat, sebelum tindakan rata-rata hasil belajara siswa 59,6, pada siklus I pertemuan 1 meningkat menjadi 61,35, siklus I pertemuan 2 sebesar 65, kemudian pada siklus II pertemuan 1 sebesar 70 dan meningkat pada pertemuan ke 2 menjadi 72,2. Aktivitas belajar siswa juga mengalami peningkatan, pada siklus I pertemuan I sebesar 7,7 pada pertemuan ke 2 sebesar 7,9. Selanjutnya pada siklus II pertemuan 1 mengalami peningkatan sebesar 8,6 dan pertemuan ke 2 sebesar 9,5. Hasil penelitian tersebut menunjukkan bahwa penerapan model pembelajaran inkuiri dapat meningkatkan hasil belajar IPA siswa kelas IV SDN Sundil, Praya, Lombok Tengah. Namun demikian masih perlu upaya-upaya lebih lanjut untuk meningkatkan hasil belajar dan aktivitas belajar siswa di SDN Sundil.

Kecenderungan pola asuh orang tua dan status sosial ekonomi terhadap keterampilan asertif siswa SMA se Kota Malang / Diah Titi Palupi

 

Key Words: Parenting Methods, Economics Social Status, Students’ Asertif Competence The faster the development of information and technology, the more effects brought. They could be both good and bad effects. Teenagers are easily influenced by those effects, particularly senior high students who are unstable. To avoid the bad effects come into the teenagers, they must have an asertive behaviour. The asertive behaviour can be learnt and taught by their parents or a conselor. Based on those problems, a research was held to know the tendency of parenting methods and social economics status toward the students’ asertive competence. The objective of this study was to identify the students’ asertive competence coming from families who apply democracy, authoritative, and permisive parenting and also the students’ asertive competence coming from high, middle, and poor economics level. The design of this study was descriptive quantitative. The subjects of this study were senior high students of Malang which were 170 students. The technique used in this study was cluster sampling. The instruments used to collect the data were parenting methods questionnaire, asertive competence questionnaire, and economics social status. Meanwhile, the technique used to analyze the data was descriptive quantitative using percentage. The resulst of this study were the senior high students of Malang are inclined to have the asertive behaviour. The students who are both educated by using democracy, authoritative, and permisive parenting and come from high, middle, and poor economics level are able to behave asertively. Furthermore, most of senior high students of Malang are educated by using democracy parenting. There are onlly few of them educated by using authoritative and permisive parenting. Most of the students also come from middle economics level. Based on the result of this study, it is suggested: (1) the conselor should do an approach and guide the students in order that they can behave asertively for those who still cannot do and for those who are able to behave asertively, the conselor should motivate them to maintain it. (2) for the further researchers, ths study can be a reference to hold the next research related to parenting methods, social economics status, and students’ asertive competence.

Penggunaan metode bercerita melalui media gambar seri untuk meningkatkan kemampuan berbahasa anak TK kelompok B di TK Dharma Wanita 01 Binangun Kabupaten Blitar / Indrawan Danaviah

 

Keywords: language skills, story telling, media. This research background in the low language skills of children. This is because the learning activities have not given the child to freedom of expression, to express ideas orally and activities that are less fun for children. This study aims to: (1) Describe the application of the method through media images tell the series to improve the language skills of children in group B TK TK Dharma Wanita 01 Binangun, District of Blitar Binangun. (2) Describe the child's increasing proficiency in Group B at TK TK Dharma Wanita 01 Binangun, Binangun district, Blitar regency. This research was carried out in TK Dharma Wanita 01 Binangun, kecamatam Binangun, Blitar regency, on 1 and December 6, 2010. The design of the study design used was a class action with the process cycle. In each cycle consists of several stages, namely planning, execution, observation and reflection. In this study, researchers collaborate with B-grade teacher, Sri Indahwati, A.Ma.Pd. The results showed that the application method of telling through the medium of serial images to increase the ability bebahasa children. In the first cycle of children reach proficiency increased 69.3% to 90.6% in cycle II. Improving the ability of children is marked by the increasing ability to listen to stories, share the experience, telling stories about pictures that are available, as well as sort and telling picture series. It is recommended to educators to apply the method of telling the field of learning language development. In the implementation should consider telling the spatial concept of class and comfort the child during the activity

Penerapan metode bercerita untuk mengembangkan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Pasuruan / Mariatul Qibtiah

 

Kata Kunci : Penerapan metode bercerita, kemampuan berbahasa, anak usia dini. Berdasarkan hasil penelitian yang dilakukan di kelompok A yang berlatar belakang rendahnya kemampuan bahasa dalam menceritakan kembali isi cerita, keberanian tampil di depan kelas, bercerita tentang gambar disediakan, dan kelancaran bahasa dalam bercerita menunjukkan pembelajaran kurang optimal. Untuk mengembangkan kemampuan berbahasa anak, perlu adanya pembelajaran yang sesuai dengan pembelajaran yang diharapkan. Berdasarkan hal ini, metode bercerita sangat tepat digunakan sebagai alternatif dalam pembelajaran. Tujuan yang ingin dicapai dalam penelitian ini adalah : 1) Mendeskripsikan penerapan metode bererita dalam mengembangkan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Rejoso Pasuruan. 2) Mendeskripsikan pengembangan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Pasuruan. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dua siklus. Masing-masing siklus terdiri dari empat kegiatan yaitu : perencanaan, , pelaksanaan, pengamatan, dan refleksi. Subjek penelitian ini adalah anak kelompok A sebanyak 20 anak. Teknik pengumpulan data adalah pengamatan langsung terhadap kegiatan anak. Hasil kesimpulan menunjukkan penggunaan metode bercerita dapat meningkatkan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Pasuruan, terbukti dari hasil yang diperoleh anak dilihat dari rata-rata hasil pengamatan anak siklus I mendapatkan bintang 2 dan meningkat lagi siklus II mendapat bintang 3 yang terus mengalami peningkatan. Berdasarkan kesimpulan ini, dapat disarankan kepada guru yaitu agar dapat menggunakan metode bercerita untuk mengembangkan kemampuan berbahasa maupun kemampuan yang lain. Metode bercerita juga dapat digunakan dalam penelitian-penelitian lain sebagai bahan perbandingan, sehingga dikemudian hari menjadi lebih baik.

Peningkatan kemampuan membaca pemahaman melalui pembelajaran tematik pada siswa kelas III SDN Plumbangan 04 Kecamatan Doko Kabupaten Blitar / Bima Suhardianto

 

Kata kunci : membaca, pembelajaran tematik, siswa. Penelitian ini bertujuan untuk meningkatkan kemampuan membaca pemahaman siswa yang meliputi aspek pemahaman isi bacaan, dan mengungkapkan isi bacaan. Serta mendeskripsikan pelaksanaan pembelajaran tematik dapat meningkatkan kemampuan membaca pemahaman pada pelajaran bahasa Indonesia di kelas III SDN Plumbangan 04. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus yang sebelumnya diawali observasi pada pratindakan. Tiap siklus dilaksanakan dengan tahapan sebagai berikut. (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan pembelajaran tematik dapat meningkatkan kemampuan membaca pemahaman siswa, yaitu pada aspek pemahaman isi bacaan hasil yang diperoleh pada pratindakan persentase ketuntasan siswa 27,27%, pada siklus I persentase ketuntasan siswa 69,70%, dan pada siklus II naik menjadi 96,97%. Pada aspek mengungkapkan isi bacaan hasil yang diperoleh pada pra tindakan nilai rata-rata siswa 63,64, pada siklus I nilai rata-rata siswa 69,70, dan pada siklus II naik menjadi 96,97. Dari data tersebut dapat disimpulkan bahwa penerapan pembelajaran dengan menggunakan pembelajaran tematik dapat meningkatkan kemampuan membaca pemahaman siswa. Dari hasil penelitian tersebut diharapkan agar guru memilih strategi yang tepat dengan menerapkan pembelajaran tematik untuk membantu meningkatkan pemahaman siswa pada pembelajaran membaca, sedangkan untuk peneliti lain diharapkan dapat menyempurnakan penelitian ini dengan menerapkannya pada ruang lingkup yang lebih luas.

Penerapan permainan fantastic card untuk mengembangkan kemampuan berbahasa di RA. Miftahul Ulum Gempol / Nurul Aziza

 

Kata Kunci : Pengembangan Bahasa dengan Media Fatastic Card Penelitian ini berlatar belakang dalam praktek pembelajaran di kelompok B memiliki perbendaharaan kata yang terbatas, kosakata dalam komunikasi melalui suara huruf yang belum berkembang, media pembelajaran yang belum optimal, pembelajaran dilakukan secara metode tanya jawab dan pemberian tugas sehingga kegiatan pembelajaran cenderung membosankan. Adapun ketrampilan dasar pengembangan berbahasa anak usia dini yang terdapat diuraian indikator yang dicapai yaitu berbicara, menyimak, pramembaca, membaca dan pramenulis. Penelitian ini bertujuan untuk mengetahui peningkatan bahasa anak melalui penerapan permainan fantastic card. Rancangan permainan melalui media, memberikan kebebasan dalam bereksplorasi melalui lingkungan, terjadi peningkatan pembelajaran dalam proses belajar yang menyenangkan, pemahaman jalannya pembelajaran, menimbulkan pengetahuan yang melekat pada benak anak. Metode yang digunakan dalam penelitian melalui rancangan Penelitian Tindakan Kelas (PTK) dengan model kolaboratif. Penelitian melakukan kolaborasi dengan guru kelas B di RA. Miftahul Ulum mulai dari tahap proses identifikasi masalah, perencanaan tindakan, pelaksanaan tindakan, observasi dan refleksi. Hasil penelitian menunjukkan bahwa peningkatan pengembangan bahasa, dapat meningkatan pengembangan bahasa di RA. Miftahul Ulum Kejapanan, peningkatan pengembangan bahasa tersebut ditandai dengan : 1) Diterapkannya metode pembelajaran belajar sambil bermain, bermain seraya belajar melalui permainan fantastic card di RA. Miftahul Ulum sesuai dasar yang disusun secara kolaboratif dengan baik, 2) Metode ceramah, guru lebih berkurang karena guru dalam membelajarkan anak, lebih banyak anak langsung praktek, melalui permainan dengan menggunakann media pembelajaran, 3) Pembelajaran lebih terpusat pada anak dan lebih bersifat konstruktif, 4) Penilaian hasil belajar anak lebih komprehensif dan tak hanya melalui pemberian tugas secara tertulis saja, 5) Situasi pembelajaran terasa lebih kondusif. Penerapan permainan fantastic card dapat meningkatkan; aktifitas belajar anak, kreatifitas anak, menciptakan suasana belajar yang menyenangkan, peningkatan interaksi dalam proses pembelajaran, dan pemahaman konsep dalam pembelajaran mudah diingat dan melekat pada benak anak. Berdasarkan hasil penelitian ini, dapat disarankan bahwa pembelajaran dalam peningkatan pengembangan bahasa hendaknya menggunakan permainan fantastic card. Hasil penelitian ini sangat dimungkinkan dapat diterapkan di kelompok B sekolah lain, jika kondisinya relatif sama atau mirip dengan sekolah yang menjadi latar penelitian ini.

Efektivitas dry bed training untuk mengatasi enuresis nokturnal anak usia sekolah dasar / Nur Hidayati

 

Kata kunci: dry bed training, enuresis nokturnal Dry bed training adalah suatu pelatihan yang digunakan sebagai terapi pada anak yang mengalami enuresis nokturnal, yang dalam prosedurnya menggunakan detektor kencing, latihan kencing sebagaimana mestinya, serta pemberian reinforcement ketika perilaku yang diharapkan muncul. Enuresis nokturnal (enuresis nocturnal) merupakan peristiwa seorang anak kencing dalam keadaan tidur ketika anak seusianya seharusnya mampu menahan kencing dan ke toilet sendiri. Tujuan penelitian adalah untuk mengetahui efektivitas dry bed training untuk mengatasi enuresis nokturnal anak usia Sekolah Dasar. Penelitian ini merupakan penelitian eksperimen. Desain penelitian yang digunakan adalah one-group pre test post test design. Subjek yang digunakan dalam penelitian berjumlah 5 orang (N=5). Analisis data keseluruhan subjek menggunakan uji wilcoxon. Uji wilcoxon memperoleh hasil sign < α (0,041 < 0,05), maka hipotesis diterima, dry bed training efektif untuk mengatasi enuresis nokturnal anak usia Sekolah Dasar. Hasil eksperimen menunjukkan bahwa tatalaksana dry bed training sudah sesuai dengan teori dengan modifikasi pemberian kepingan bintang apabila perilaku yang diharapkan muncul. Dari lima subjek yang diberikan terapi, dua subjek dinyatakan sembuh dan yang lainnya mengalami penurunan frekuensi mengompol. Dua orang hanya mengalami satu kali mengompol saat posttest dan satu orang mengalami tiga kali mengompol. Berdasarkan hasil penelitian dapat diberikan saran pada beberapa pihak diantaranya: (1) subjek yang mengalami enuresis nokturnal dan memiliki keinginan kuat untuk sembuh serta bersedia menjalani terapi dengan teratur, maka dry bed training dapat digunakan sebagai terapi untuk mengurangi bahkan menyembuhkan perilaku mengompol, (2) orangtua diharapkan untuk lebih telaten membimbing anak dalam menjalani terapi, sehingga subjek dapat berangsur-angsur sembuh dari kebiasaan mengompol, (3) peneliti selanjutnya, diharapkan penelitian yang akan dilakukan selanjutnya lebih dipersiapkan. Persiapan-persiapan tersebut diantaranya mengenai jumlah sampel yang lebih besar, kontrol lingkungan yang lebih ketat, pembuatan detektor kencing yang lebih fleksibel, sehingga hasil dari dry bed training dapat lebih baik.

Perbedaan penggunaan stimulus unmeaningful (tidak bermakna) dan meaningful (bermakna) terhadap sikap konformitas rema awal / Fauziyah

 

Kata Kunci: stimulus unmeaningful (tidak bermakna), stimulus meaningful (bermakna), konformitas Stimulus Unmeaningful (tidak bermakna) adalah stimulus yang digunakan dalam Eksperimen Asch untuk mengukur konformitas. Stimulus meaningful (bermakna) pada penelitian ini digunakan untuk melengkapi Eksperimen Asch, di mana keputusan yang diambil akan memanfaatkan data informasi yang tersimpan dalam ingatan. Penelitian ini bertujuan untuk mengetahui apakah ada perbedaan sikap konformitas remaja awal pada pemberian stimulus Unmeaningful dengan sikap konformitas remaja awal pada pemberian stimulus Meaningful dan untuk mengetahui adanya perbedaan pilihan jawaban pribadi subjek dibawah pengaruh kelompok dengan pilihan jawaban pribadi subjek tanpa pengaruh kelompok. Penelitian dilakukan di Sekolah Menengah Pertama Negeri (SMPN) 1 Malang, tanggal 25 November sampai 1 Desember 2010. Digunakan desain penelitian One Group Repeated Trials Design. Variabel bebas penelitian ini ialah stimulus Ambiguity (stimulus unmeaningful dan meaningful) dan variabel terikatnya ialah sikap konformitas. Sampel penelitian ialah 34 siswa (19 laki-laki dan 15 perempuan) kelas VII. Setiap subjek diberikan 2 jenis stimulus yaitu stimulus unmeaningful dan meaningful. Urutan penyajian stimulus dikontrol dengan teknik counterbalance. Hasil penelitian menunjukkan bahwa ada perbedaan sikap konformitas (pilihan jawaban pribadi subjek dibawah pengaruh kelompok) dan pilihan jawaban pribadi subjek tanpa pengaruh kelompok (F = 28.746. Nilai Sig. 0.000 < 0,05). Tidak terdapat perbedaan yang signifikan antara sikap konformitas subjek terhadap pemberian stimulus unmeaningful dan stimulus meaningful (t = 0.673 Nilai Sig.503 > 0,05). Kepada praktisi psikologi yang tertarik melanjutkan penelitian eksperimen mengenai tingkat konformitas pada remaja disarankan untuk memperluas wilayah pengukuran pada remaja tengah, remaja akhir atau dewasa awal karena subjek dalam penelitian terbatas pada masa remaja awal saja, dan disarankan untuk memperkaya hasil penelitian dengan memperluas atau memperbanyak jenis masalah untuk dijadikan stimuli penelitian serta menggunakan jumlah sampel yang lebih besar yang berasal dari tingkat pendidikan yang berbeda dan rentang usia yang lebih luas guna memperdalam fokus penelitian mengenai konformitas.

Pelaksanaan pembelajaran nilai karakter di pesantren putri Al-Mawaddah 2 Desa Jiwut Kecamatan Nglegok Kabupaten Blitar / Dita Ayu Kusuma

 

Kusuma, Dita Ayu. 2013. Pelaksanaan Pembelajaran Nilai Karakter di Pesantren Putri Al-Mawaddah 2 Desa Jiwut Kecamatan Nglegok Kabupatern Blitar. Skripsi, Jurusan Hukum dan Kewarganegaraan Fakultas Ilmu Sosial Universitas Negeri Malang. Prodi S1- Pendidikan Pancasila dan Kewarganegaraan. Pembimbing: (1) Dra. Arbaiyah Prantiasih, M.Si. (II) Drs. H. Edi Suhartono, S.H. M.Pd. Kata Kunci: Nilai Karakter, Pesantren Era Globalisasi yang ditandai perkembangan teknologi komunikasi informasi dan gaya hidup mendunia memberikan dampak positif dan dampak negatif. Salah satu dampak positif yaitu adanya kemajuan teknologi yang semakin canggih, dan salah satu dampak negatifnya adalah masuknya budaya barat yang tidak sesuai dengan budaya Indonesia sehingga dapat melemahkan nilai moral bangsa Indonesia. Untuk itu diperlukan pendidikan karakter dengan membelajarkan nilai-nilai karakter kepada anak didik guna membentuk kepribadian dan bertanggung jawab dalam menjalani kehidupan sehari-hari. Selain dalam pendidikan formal nilai-nilai karakter ini perlu dikembangkan dalam dunia pesantren. Pesantren adalah sebuah lembaga pendidikan dan pengembangan agama Islam. Lembaga pesantren merupakan wadah untuk mentransformasikan nilai bagi para santri, dengan adanya pesantren sebagai lembaga pendidikan, diharapkan dapat menunjang peningkatan kualitas manusia Indonesia yang tidak hanya handal dalam menguasai ilmu pengetahuan dan teknologi, melainkan juga mendidik sikap dan kepribadian serta moralitas yang luhur sesuai dengan ajaran agama Islam. Penelitian ini dilakukan untuk mengetahui: (1) landasan pembelajaran nilai karakter di pesantren, (2) pelaksaan pembelajaran nilai karakter di Pesantren, (3) metode yang digunakan dalam membelajarkan nilai karakter, (4) kendala yang dihadapi dalam membelajaran nilai karakter, (5) upaya yang dilakukan untuk mengatasi kendala dalam membelajarkan nilai karakter. Penelitian ini menggunakan pendekatan deskritif kualitatif. Disebut pendekatan deskriptif kualitatif karena data yang dihasilkan bukan dalam bentuk angka-angka tetapi berupa kata-kata lisan atau tertulis. Teknik pengumpulan data dilakukan dengan teknik observasi, wawancara, serta dokumentasi. Analisis data hasil penelitian dilakukan dengan reduksi data, penyajian data, dan penarikan kesimpulan (verivikasi).     Hasil penelitian ini adalah: (1) Landasan dalam membelajarkan nilai karakter di pesantren ini diambil dari kurikulum yang sudah ditentukan oleh Kemenag dan juga menggunakan beberapa kitab kuning yang mendukung pembelajaran yaitu kitab Akhlakul Lilbanat dan Tanbihul Muta’alim, (2) Pelaksanaan pembelajaran nilai karakter di pesantren ini dilakukan melalui pembelajaran di dalam kelas secara klasikal yaitu dengan mengintregasikan nilai karakter pada setiap mata pelajaran yang di sampaikan oleh ustadzah dan juga dilakukan dengan penerapan nilai-nilai karakter yang sudah ada di pesantren dalam kehidupan sehari-hari, (3) Strategi dan metode dalam membelajarkan nilai karakter di pesantren ini adalah dengan melakukan pemantauan kepada santri yang dilakukan selama 24 jam. Selain itu, juga dilakukan dengan memberikan keteladan dan contoh nyata dari pengasuh dan ustadzah, (4) Kendala yang dihadapi dalam membelajarkan nilai karakter di Pesantren ini adalah latar belakang santri yang berbeda dan karakter santri yang berbeda, (5) Upaya mengatasi kendala dalam membelajarkan nilai karakter di pesantren adalah memberi nasehat kepada santri melalui kegiatan pengarahan mingguan setiap hari jumat, memberi bimbingan kepada santri melalui teladan yang diberikan langsung oleh ustadzah, memantau santri melalui organisasi OSWAH (organisasi santriwati Al-Mawaddah) Berdasarkan hasil penelitian di atas maka saran yang dapat disampaikan adalah bagi pengasuh dan ustadzah diharapkan mempertahankan nilai-nilai karakter yang sudah diterapkan di pesantren seperti nilai karakter disiplin, yang berupa dan mempertahankan ketelatenan dalam membimbing dan menasehati santri. Bagi peneliti selanjutnya diharapkan hasil penelitian ini dapat dijadikan sebagai referensi untuk mengadakan penelitian lebih lanjut.

Perbedaan motivasi berprestasi antara siswa MTs dengan siswa SMP negeri / Dwi Sulistyoningrum

 

Kata kunci: Siswa MTs dan siswa SMPN, Motivasi berprestasi Motivasi berprestasi merupakan usaha untuk mencapai keberhasilan dan kesuksesan. Motivasi pada siswa menjadi penting sebagai faktor yang memberi energi dan arah pada suatu perilaku. Siswa yang mempunyai motivasi berprestasi yang tinggi akan mengarahkan tingkah lakunya pada usaha pencapaian prestasi tertentu yang diukur berdasarkan standar kesempurnaan dalam dirinya. Penelitian ini bertujuan (1) Mengetahui gambaran motivasi berprestasi siswa MTs, (2) Mengetahui gambaran motivasi berprestasi siswa SMP Negeri, (3) Mengetahui apakah ada perbedaan motivasi berprestasi antara siswa MTs dengan siswa SMP Negeri. Subyek penelitian adalah siswa MTs Muhammadiyah dan siswa SMPN 4. Rancangan penelitian yang digunakan adalah Deskripstif Komparatif. Instrumen pengumpulan data EPPS digunakan untuk mengungkap motivasi berprestasi siswa. Data yang diperoleh dianalisis menggunakan teknik Analisis Deskriptif dan analisis Uji-t, yaitu Uji Independent Sample Test dengan taraf signifikansi 0,05. Hasil penelitian menunjukkan bahwa siswa MTs Muhammadiyah 2 terdapat 3,5% siswa memiliki motivasi berprestasi yang tinggi atau sebanyak 2 orang siswa, 28,1% atau 16 orang siswa memiliki motivasi berprestasi sedang, 8,8% atau sebanyak 5 orang siswa memiliki motivasi rendah, dan 3,5% lagi atau 2 orang siswa memiliki motivasi berprestasi yang sangat rendah. Siswa SMP Negeri 4 terdapat 1,8% siswa yang memiliki motivasi berprestasi tinggi sekali atau 1 orang siswa, 12,3% siswa yang memiliki motivasi berprestasi tinggi atau 7 orang siswa, 36,8% siswa yang memiliki motivasi berprestasi sedang atau 21 siswa dan 5,3% siswa yang memiliki motivasi berprestasi rendah atau sebanyak 3 orang siswa. Ada perbedaan motivasi berprestasi antara siswa MTs Muhammadiyah dengan siswa SMPN 4, dengan hasil uji t = 2,685, sig 0,010 < 0,05. Berdasarkan hasil penelitian siswa SMPN 4 memiliki motivasi lebih tinggi dengan mean 16,94 dan MTs memiliki motivasi lebih rendah dengan mean 15,00, ini dikarenakan siswa merasa jenuh dengan rutinitas yang ada selain itu lingkungan tempat tinggal siswa tidak dapat membuat siswa belajar dengan nyaman. Saran bagi pihak sekolah MTs sebagai pihak pendidik, hendaknya lebih dapat memotivasi siswanya dengan memberikan insentif eksternal seperti pujian atau memberikan evaluasi berkala terhadap siswa di sekolah agar lebih dapat bersaing. Serta memberikan fasilitas tempat tinggal yang mendukung belajar siswa. Bagi subyek penelitian khususnya siswa MTs harus lebih berusaha meningkatkan motivasi berprestasi yang lebih baik, siswa dapat membuat rencana kegiatan belajar yang dapat berupa jadwal belajar dan penyelesaian tugas sekolah yang dilakukan setiap hari secara teratur dan dapat disesuaikan dengan situasi kondisi. Bagi peneliti selanjutnya hendaknya lebih memperhatikan faktor-faktor lain seperti pola asuh, kebiasaan belajar, harapan orang tua dan lain-lain.

Penggunaan metode demonstrasi untuk meningkatkan kemampuan fisik motorik dengan teknik finger painting siswa kelompok A di RA Nurul Iman Karangrejo Kecamatan Gempol / Mutrofin

 

Kata kunci : Metode Demonstrasi, Fisik Motorik, Finger Painting, RA Sebagai guru berupaya agar anak didik dapat mengembangkan berbagai macam bakat dan kemampuan secara optimal dalan melakukan kegiatan. Semua itu akan berhasil dengan baik apabila kita selalu berusaha menciptakan suasana pembelajaran secara efektif, kreatif, dan menyenangkan. Sebaikya pendidik tidak melulu mencontohkan lalu anak mengikuti.tapi biarkan anak mencoba-mencoba, sehingga anak dapat menyelesaikan tugas secara mandiri. Yang dihadapi sekarang di RA Nurul Iman Karangrejo Kecamatan Gempol, misalnya pada pengembangan fisik motorik anak belum mampu menggerakkan jari tangan untuk kelenturan otot dan koordinasi untuk menerapkan melukis dengan jari yang sesuai dengan harapan guru. Penelitian ini bertujuan untuk mendiskrepsikan (1) langkah-langkah penggunaan metode demonstrasi untuk meningkatkan kemampuan fisik motorik dalam pembelajaran finger painting pada anak kelompok A RA Nurul Iman Karangrejo Kecamatan Gempol, (2) peningkatan kemampuan fisik motorik dan seni anak kelomok A RA Nuurul Iman Karangrejo Kecamatan Gempol dengan menggunakan metode demonstrasi dalam pembelajaran finger painting. Untuk meningkatkan kemampuan fisik motorik mengguanakan metodologi penelitian yaitu menggunakan rancangan PTK yang bertujuan untuk mengatasi masalah pembelajaran yang terjadi pada latar penelitian (kelas). Subyek penelitian adalah anak kelompok A dengan jumlah 20 anak. Lokasi penelitian adalah RA Nurul Iman Karangrejo Kecamatan Gempol Kabupaten Pasuruan. Teknik pengumpulan datanya dengan observasi dan portofolio. Kesimpulan dari penelitian adalah (1) langkah-langkah penggunaan metode demonstrasi telah berhasil meningkatkan kemampuan fisik motorik dengan teknik finger painting di kelompok A RA Nurul Iman Karangrejo Kecamatan Gempol Kabupaten Pasuruan, (2) peningkatan fisik motorik dari pra tindakan nilai rata-rata mendapat bintang 1 meningkat bintang 2 pada siklus I tatapi belum tuntas. Pada siklus II terjadi ketuntasan dengan nilai rata-rata bintang 3. Saran yang bisa diberikan dalam penelitian ini adalah (1) bagi pendidik hendaknya metode demonstrasi dengan teknik finger painting bisa menjadi salah satu alternatif peningkatan kualitas dalam pembelajaran fisik motorik, (2) bagi penelitian lain, penggunaan metode demonstrasi bisa dikembangkan pada penelitian lain, penelitian lain dengan metode pembelajaran yang lebih inovatif dan kreatif yang berkembang.

Studi pelaksanaan pembangunan jalan Widang - Gresik - Surabaya / Kamarissaw Septivana Eka Yeniwati

 

Kata kunci: pelaksanaan, konstruksi jalan, tebal perkerasan Salah satu tujuan dibangunnya jalan adalah untuk mengatasi daerah yang masih terisolasi, disamping itu dengan dibukanya daerah tersebut akan memberikan peluang pada masyarakatnya untuk melihat perkembangan daerah lain dengan harapan akan mendorong pertumbuhan dalam bidang ekonomi, sosial budaya dan politik. Pada umumnya hampir semua truk berat di Indonesia mengangkut beban melebihi batas beban normal tersebut. Truk pengangkut sirtu rata-rata memuat antara 2,5 s/d 3 kali lipat muatan ijinnya. Akibat beban yang melebihi batas ini jalan di Indonesia jadi cepat rusak sebelum waktunya. Berdasarkan uraian tersebut, maka proyek akhir ini akan mengkaji tentang pelaksanaan pekerjaan jalan serta mengkaji perhitungan tebal perkerasan jalan pada proyek pembangunan jalan Widang – Gresik – Surabaya. Metode pengumpulan data pada Proyek Akhir ini dengan melakukan pengamatan, wawancara, dan dokumentasi. Analisis data dilakukan dengan menelaah seluruh data yang tersedia dari berbagai sumber, kemudian dikelompokkan sesuai dengan konteks studi lapangan ini. Hasil yang diperoleh dari Proyek Akhir ini adalah (1) Pelaksanaan proyek pembangunan jalan Widang – Gresik – Surabaya terdiri dari pekerjaan pengukuran, pekerjaan pemasangan geotekstile, pekerjaan selected material, pekerjaan lapis pondasi bawah agregat kelas B, pekerjaan lapis pondasi atas agregat kelas A dan pekerjaan laston. Dari job mix formula didapatkan bahwa bahan yang digunakan untuk selected material harus mempunyai gradasi dibawah 50 cm, untuk lapis pondasi bawah agregat kelas B gradasinya harus lebih kecil dibanding selected material, untuk lapis pondasi atas agregat kelas A gradasinya harus lebih kecil dibandingkan lapis pondasi bawah agregat kelas B. Untuk bahan lapisan AC dari job mix formula baik AC-base, AC-BC, maupun AC-WC memiliki kadar aspal dan kombinasi gradasi butiran yang berbeda. Berdasarkan hasil di atas, dapat disimpulkan bahwa pelaksanaan dan bahan yang digunakan pada proyek pembangunan jalan Widang-Gresik-Surabaya sudah sesuai dengan Spesifikasi Teknik yang disyaratkan oleh Bina Marga. (2) Perhitungan ketebalan lapis perkerasan dengan menggunakan Metode Analisa Komponen didapatkan hasil sebagai berikut: lapis AC = 12 cm, lapis pondasi atas = 30 cm dan lapis pondasi bawah = 34 cm.

Implementasi sekolah menengah kejuruan bertaraf internasional (studi kasus di SMK Negeri 1 Bontang) / Muhammad Tang

 

Kata Kunci: implementasi, smk, bertaraf internasional. Sekolah Menengah Kejuruan Berstandar Internasional adalah lembaga yang menyelenggarakan program pendidikan dan pelatihan kejuruan yang tamatannya mendapatkan sertifikat berstandar internasional pada satu atau lebih program keahlian. Sekolah Menengah Kejuruan (SMK) dimaksudkan untuk meningkatkan kecerdasan, pengetahuan, kepribadian, akhlak mulia, serta keteramplan untuk hidup mandiri dan mengikuti pendidikan lebih lanjut sesuai dengan kejuruannya. Pengembangan sekolah menjadi tanggung jawab bersama. Salah satu usaha dengan pengembangan Sekolah Menengah Kejuruan Bertaraf Internasional (SMK-BI). Landasan perwujudan SMK-BI tertuang dalam UU No. 20 Tahun 2003 tentang Sisdiknas pasal 50 ayat (3), juga Peraturan Pemerintah (PP) No. 19 Tahun 2005 pasal 61 ayat (1). Pemerintah melalui Direktorat PSMK sejak tahun 2006 telah mengembangkan sekolah menengah kejuruan bertaraf internasional yang tersebar di seluruh kabupaten/kota. Salah satu rintisan SMK-BI di Kalimantan Timur adalah SMK Negeri 1 Bontang. Penelitian ini bertujuan untuk mengetahui implementasi sekolah menengah kejuruan bertaraf internasional pada SMK Negeri 1 Bontang berkaitan dengan persiapan, kesiapan input, proses, output, kendala dan solusi. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Metode yang digunakan dalam pengumpulan data adalah observasi, wawancara, dan dokumentasi. Hasil penelitian menunjukkan bahwa: (1) Persiapan awal pengembangan sekolah menengah kejuruan bertaraf internasional adalah menyusun School Development & Invesment Plan (SDIP); (2) kurikulum yang digunakan adalah Kurikulum Tingkat Satuan Pendidikan (KTSP) yang telah disesuaikan dengan standar isi dan standar kompetensi lulusan. Penyusunan KTSP berdsarkan standar kompetensi dan kompetensi dasar, belum mengadopsi kurikulum dari luar negeri atau Negara anggota OECD. Namun muatan pelajaran produktif telah mengadopsi dari perusahaan bertaraf internasional di Kota Bontang. Kemampuan bahasa Inggris guru masih minim. Kualifikasi magister guru baru tercapai 10%. Peralatan yang dimiliki cukup memadai secara kuantitas, kualitas, dan relevan dengan kebutuhan. Prasarana yang dimiliki meliputi lahan seluas 39.650 m2, ruang kelas/ruang teori sebanyak 21 ruang, ruang pimpinan yang nyaman, ruang guru, ruang tata usaha, ruang rapat, workshop, tempat berolahraga, tempat ibadah dan ruang lain yang menunjang pembelajaran. Perpustakaan sudah dilengkapi dengan sarana digital yang memberikan akses ke sumber pembelajaran berbasis TIK, memiliki bengkel/laoratorium untuk masing-masing program studi keahlian, dan memiliki layanan jaringan internet. Sarana pembelajaran yang menggunakan media belum terpenuhi secara maksimal. Siswa terdiri dari masyarakat Kota Bontang dan sekitarnya, pulau Jawa dan Sulawesi. Penerimaan siswa baru belum sistem on line; (3) model pembelajaran telah memanfaatkan teknologi informasi dan komunikasi. Penggunaan bahasa Inggris dalam proses pembelajaran belum terlaksana untuk semua program keahlian. Penyusunan modul dalam dwi bahasa sudah terlaksana. Kerjasama praktek industri dengan industri luar negeri masih belum ada. Kerja sama praktek industri berskala internasional. Bekerjasama dengan industri yang memiliki skala interasional dalam melakukan penilaian kempetensi siswa serta pemberian sertifikat kompetensi siswa. Dipimpin oleh kepala sekolah dibantu empat wakil yaitu: wakil bidang kurikulum, sarana dan prasarana, Sumber Daya Manusia (SDM) dan kesiswaan. Pengelolaannya menerapkan prinsip musyawarah mufakat. mendapatka sertifikat menajemen mutu ISO 9001:2000 dari sai global tahun 2007, pembiayaan bersumber dari APBD dan APBN, serta menerapkan sekolah gratis; (4) meluluskan siswanya 100% berturut-turut lima tahun terkahir sejak tahun 2006-2009. Lulusan disamping ada yang melanjutkan kejenjang pendidikan yang lebih tinggi juga banyak yang terseraf pada industri; (5) kendala yang utama adalah dana, untuk mengatasinya mengupayakan memperoleh bantuan dari pemerintah, baik pemerintah pusat, pemerintah propinsi, pemerintah kota, dan industri-industri yang ada di Kota Bontang. Kendala penggunaan bahasa Inggris, untuk mengatasinya mengupayakan pelatihan-pelatihan bahasa Inggris untuk guru dan karyawan, juga akan menerapkan penggunaan bahasa Inggris dalam kegiatan sehari-hari. Kendala hubungan kerjasama dengan industri dari luar negeri, untuk mengatasinya mengupayakan kunjungan luar negeri untuk menjalin hubungan dengan patner asing. Berdasarkan hasil penelitian ini dapat disarankan agar (1) lebih memperoritaskan kerjasama industri luar negeri yang memiliki skala internasional, (2) sarana pendukung pelaksanaan model pembelajaran berbasis teknologi informasi dan komunikasi agar segera dipasang secara permanen seperti LCD dan komputer di ruang teori maupun bengkel/laboratorium, (3) lebih meningkatkan keterapilan dalam bahasa Inggris, dengan mengikuti pelatihan-pelatihan yang diadakan sekolah, aktif menggunakan bahasa Ingris dalam kegiatan sehari-hari. Menerapan bahasa Inggris dengan sistem pin, bagi guru atau siswa yang memiliki kemampuan bahasa Inggris, jika bertemu dengan sesama pemakai pin wajib menggunakan bahasa Inggris, (4) dinas pendidikan agar mengembangkan sekolah menengah kejuruan bertaraf internasional yang lain di Kota Bontang, dan (5) bagi peneliti selanjutnya agar meneliti implementasi sekolah bertaraf internasional dengan fokus yang lebih luas.

Peningkatan kemampuan bercerita melalui strategi menyimak dan berpikir langsung (MBL) pada kelas V MI Miftahul Ulum Benerwojo Kejayan Pasuruan / Fauzi

 

Kata Kunci: bercerita, strategi menyimak dan berpikir langsung (MBL), SD Menyimak dan berbicara merupakan keterampilan berbahasa lisan yang amat fungsional dalam kehidupan manusia sehari-hari. Dengan keterampilan menyimak dan berbicara kita dapat memperoleh dan menyampaikan informasi. Kegiatan menyimak dan berbicara tidak dapat dipisahkan. Oleh sebab itu, siswa dituntut untuk mampu menyimak dan berbicara dengan baik. Bercerita merupakan salah satu kemampuan berbicara yang juga menuntut kemampuan dalam menyimak cerita dengan baik. Berdasarkan hasil observasi di kelas V MI Miftahul Ulum Benerwojo Kejayan Pasuruan, ditemukan permasalahan kemampuan bercerita siswa yang masih rendah. Salah satu penyebabnya diduga karena penggunaan strategi pembelajaran dan bahan ajar yang kurang bervariasi. Penelitian ini bertujuan untuk mendeskripsikan (1) perencanaan strategi menyimak dan berpikir langsung (MBL) untuk meningkatkan kemampuan bercerita siswa kelas V, (2) implementasi strategi menyimak dan berpikir langsung (MBL) untuk meningkatkan kemampuan bercerita siswa kelas V, (3) hasil implementasi strategi menyimak dan berpikir langsung (MBL) untuk meningkatkan kemampuan bercerita siswa kelas V. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK). Subyeknya 17 siswa kelas V MI Miftahul Ulum Benerwojo Kejayan Pasuruan. Instrumen pengumpulan data berupa lembar observasi, lembar penilaian proses, lembar penilaian kemampuan bercerita, tes dan wawancara. Analisa data dilakukan dengan mengelompokkan data kualitatif dan data kuantitatif. Data kualitatif diperoleh dari instrumen penilaian proses dan wawancara, sedangkan data kuantitatif diperoleh dari tes, instrumen observasi dan penilaian kemampuan bercerita. Hasil penelitian menunjukkan adanya peningkatan yang signifikan. Hal ini diketahui dari peningkatan pada komponen perencanaan meningkat dari skor rata-rata 2,8 menjadi 3,0. Implementasi pembelajaran meningkat dari skor rata-rata 2,8 menjadi 3,0. Hasil belajar siswa juga meningkat dari 47% menjadi 70,6% pada siklus 1 dan meningkat menjadi 88,2% pada siklus 2. Secara keseluruhan peningkatan yang diperoleh mulai dari pra tindakan sampai tindakan siklus 2 sebesar 41%. Secara umum disimpulkan strategi menyimak dan berpikir langsung (MBL) dapat meningkatkan kemampuan bercerita siswa kelas V melalui tahap persiapan menyimak, membaca nyaring, refleksi dan penyampaian pendapat. Disarankan kepada guru untuk menjadikan strategi menyimak dan berpikir langsung (MBL) sebagai alternatif dalam meningkatkan kemampuan bercerita di kelas V maupun di kelas yang lain.

Peningkatan hasil belajar IPS melalui pembelajaran peta konsep materi transportasi siswa kelas IV SDN Tanggulangin Kejayan Pasuruan / Rony Sultanudin

 

Kata Kunci: Hasil Belajar, IPS, Pembelajaran Peta Konsep, Transportasi. Ilmu Pengetahuan Sosial merupakan suatu program pendidikan yang mengintegrasikan konsep-konsep terpilih dari ilmu-ilmu sosial dan humaniora untuk tujuan pembinaan warga negara yang baik. Berdasarkan hasil observasi pra tindakan di SDN Tanggulangin Kejayan Pasuruan yakni guru dalam mengajar hanya melalui kegiatan ceramah dan penugasan, selain itu kurang tersedianya media pembelajaran yang dapat menunjang kegiatan belajar mengajar. Hal ini menunjukkan bahwa pemahaman siswa tentang materi Transportasi masih rendah. Adapun tujuan dari penelitian ini adalah: (1) untuk mendeskripsikan penerapan pembelajaran IPS dengan menggunakan peta konsep materi Transportasi bagi siswa kelas IV SDN Tanggulangin Kejayan Pasuruan, (2) untuk mendeskripsikan aktifitas siswa dalam mengikuti pembelajaran IPS dengan menggunakan Peta Konsep materi Transportasi bagi siswa kelas IV SDN Tanggulangin Kejayan Pasuruan, dan (3) untuk mendeskripsikan hasil belajar IPS dengan menggunakan peta konsep materi Transportasi bagi siswa kelas IV SDN Tanggulangin Kejayan Pasuruan. Landasan teori yang digunakan dalam penelitian ini adalah teori belajar bermakna dari David Ausuble. Belajar bermakna merupakan suatu proses untuk mengaitkan informasi baru dengan konsep-konsep relevan yang terdapat dalam struktur kognitif seseorang. Sedangkan model pembelajarannya adalah pembelajaran peta konsep, yaitu model pembelajaran yang dapat mengorganisasikan pengetahuan yang dimiliki dan yang akan dipelajari siswa dengan konsep-konsep yang relevan yang terdapat dalam struktur kognitifnya. Peta konsep dapat memvisualisasikan pengetahuan serta pemahaman konsep dalam suatu bagan atau skema yang sistematis, selanjutnya dapat menguji penguasaan pengetahuan tersebut. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) menggunakan model Kemmis dan Taggart. Penelitian ini dilakukan dalam 2 siklus, masing-masing siklus terdiri dari dua kali pertemuan. Setiap tindakan meliputi empat komponen yakni perencanaan tindakan, pelaksanaan tindakan, observasi, dan refleksi. Subyek penelitiannya adalah siswa kelas IV SDN Tanggulangin Kejayan Pasuruan sebanyak 35 siswa. Instrumen dalam penelitian ini antara lain lembar observasi, wawancara, tes tertulis, dan dokumentasi. Hasil penelitian ini menunjukkan adanya peningkatan, hal ini dapat dilihat dari rata-rata hasil belajar mulai pra tindakan (55,1), meningkat pada siklus I menjadi (66,8) dan pada siklus II meningkat menjadi (73,4). Berdasarkan penilaian lembar pengamatan aktifitas siswa juga mengalami peningkatan yang cukup siginifikan. Siklus I meliputi komponen: bertanya skor rata-rata (25,7), menjawab skor rata-rata (28,5) berdiskusi skor rata-rata (48,5), dan melaporkan skor rata-rata (51,4). Sedangkan pada siklus II meliputi komponen: bertanya skor rata-rata (48,5), menjawab skor rata-rata (52,8), berdiskusi skor rata-rata (60), dan melaporkan skor rata-rata (62,8). Sehingga dapat dinyatakan bahwa terdapat peningkatan skor rata-rata aktifitas siswa pada semua komponen. Pada komponen bertanya meningkat 47 %, aktifitas meningkat 46 %, berdiskusi meningkat 19,2 %, dan melaporkan meningkat 18,2 %. Maka rata-rata peningkatan seluruh komponen aktifitas siswa mulai siklus I dan siklus II sebesar 32,6 %. Kesimpulan dari penelitian ini adalah: (1) adanya peningkatan hasil belajar IPS melalui pembelajaran Peta Konsep materi Transportasi siswa kelas IV SDN Tanggulangin Kejayan Pasuruan, (2) pembelajaran peta konsep dapat meningkatkan aktifitas siswa kelas IV SDN Tanggulangin Kejayan Pasuruan, dan (3) hasil belajar siswa setelah mengikuti pembelajaran peta konsep mencapai KKM pada mata pelajaran IPS yang telah ditentukan di SDN Tanggulangin Kejayan Pasuruan. Berdasarkan dari hasil penelitian tindakan kelas, peneliti dapat memberikan saran: (1) untuk mendapatkan hasil belajar yang maksimal hendaknya guru dapat melaksanakan pembelajaran dengan menggunakan pembelajaran yang sesuai dengan karakteristik materi pembelajaran, (2) dalam melaksanakan penelitian tindakan kelas (PTK) hendaknya dilakukan dengan sungguh-sungguh dan terencana dengan baik. Dengan perencanaan yang baik, maka penelitian bisa mendapatkan hasil yang maksimal.

Penggunaan media konkrit untuk meningkatkan pembelajaran IPA tentang bagian-bagian tumbuhan pada siswa kelas IV SDN Sumber Banteng Kejayan Pasuruan / Mariyatul Kiptiyah

 

Kata Kunci: Hasil Belajar IPA, Media Benda Konkrit, Sekolah Dasar. Media konkrit merupakan alat bantu pembelajaran yang mampu memudahkan siswa dalam memahami konsep IPA. Namun kenyataannya pembelajaran IPA di SDN Sumber Banteng jarang sekali menggunakan media konkrit. Hasil observasi yang dilakukan menunjukkan bahwa nilai rata-rata kelas pembelajaran IPA di SDN Sumber Banteng adalah 56,73. Masalah yang menyebabkan pembelajaran IPA kurang berkembang adalah penyampaian materi yang dilakukan guru masih berorientasi pada buku teks, tidak menggunakan media/alat peraga, dan hanya mengutamakan aspek kognitif saja. Situasi pembelajaran terkesan sangat formal, kurang mengatifkan siswa dan kurang menyenangkan siswa. Penelitian ini bertujuan untuk (1) mendeskripsikan penggunaan media benda konkrit dalam pembelajaran IPA di kelas IV SDN Sumber Banteng Kejayan Pasuruan, (2) mendeskripsikan aktivitas belajar IPA siswa kelas IV SDN Sumber Banteng Kejayan Pasuruan dengan pengunaan media konkrit (3) mendeskripsikan hasil belajar IPA siswa kelas IV SDN Sumber Banteng Kejayan Pasuruan dengan penggunaan media benda konkrit. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK). Subyek penelitiannya adalah siswa kelas IV SDN Sumber Banteng Kejayan Pasuruan sebanyak 26 siswa. Pengumpulan data dilakukan melalui wawancara,observasi, dan hasil tes. Analisis data dilakukan dengan deskriptif kualitatif. Penelitian ini dilakukan dalam dua siklus, masing-masing siklus melalui empat tahap yaitu perencanaan, pelaksanaan, pengamatan, dan refleksi. Penggunaan media benda konkrit dapat meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Sumber Banteng Kejayan Pasuruan. Peningkatan aktivitas siswa meliputi; identifikasi masalah, pengumpulan data, pengolahan data, verivikasi data, dan menyimpulkan data. Untuk hasil belajar siswa dapat dilihat dari rata-rata hasil tes mulai pra tindakan (56,73), meningkat pada siklus I (69,11), dan meningkat lagi pada siklus II (82,89). Penggunaan media konkrit juga dapat meningkatkan aktivitas belajar siswa. Untuk itu peneliti menyarankan kepada guru SDN Sumber Banteng Kejayan agar setiap pembelajaran IPA berusaha untuk menggunakan media benda konkrit. Bagi kepala sekolah hendaknya mendukung tersedianya sarana dan prasarana pembelajaran terutama media pembelajaran dan memotivasi guru untuk memanfaatkannya.

Peningkatan keterampilan berbicara dengan pendekatan komunikatif pada siswa kelas III di MI Miftahul Huda I Kecamatan Beji Kabupaten Pasuruan / Cholilah

 

Aplikasi manajemen futsal berbasis visual basic 2005 dan SQL server / Sufyan Saifullah

 

Kata Kunci: Futsal, Microsoft Visual Basic 2005, database SQL Server. Futsal adalah permainan bola yang dimainkan oleh dua tim, yang masing-masing beranggotakan lima orang. Tujuannya adalah memasukkan bola ke gawang lawan, dengan memanipulasi bola dengan kaki. Selain lima pemain utama, setiap regu juga diizinkan memiliki pemain cadangan. Tidak seperti permainan sepak bola dalam ruangan lainnya, lapangan futsal dibatasi garis, bukan net atau papan. Olahraga futsal semakin digemari oleh masyarakat kota dari berbagai kalangan, mulai dari Anak Sekolah, Mahasiswa, Karyawan, dan banyak lagi. Tak heran di sudut kota cukup banyak yang menyediakan sarana tempat olahraga futsal ini. Alasan yang didapat dari berbagai pihak karena olahraga futsal adalah olahraga alternatif bagi kebanyakan warga kota, yang sulit mendapatkan lapangan sepak bola. Wajar apabila sekarang banyak orang yang membuka usaha untuk bidang ini, karena cukup menjanjikan. Namun saat ini biasanya masalah yang dihadapi oleh pengelola futsal adalah sistem pemesanan yang masih manual, dimana data masih dikelola oleh kemampuan manusia. Mulai dari pencatatan pemesanan, nota transaksi, jadwal permainan, selesai permainan hingga pembukuan masih dilakukan manual. Sistem pemesanan tersebut kurang efisien karena banyak menyita waktu. Dalam proyek akhir ini, telah dibuat suatu perangkat lunak aplikasi untuk memudahkan pengelolaan lapangan futsal. Aplikasi ini dibuat dengan menggunakan Microsoft Visual Basic 2005 dengan database SQL Server . Proyek akhir ini menghasilkan suatu aplikasi yang memudahkan para pemilik usaha arena futsal untuk memudahkan dalam dalam mengatur penjadwalan serta manajemen lapangan futsal.

Penerapan metode bermain balok berwarna untuk mengembangkan kemampuan seni kelompok B TK Dharma Wanita Desa Olak-alen Kabupaten Blitar / Sri Wahyuni

 

Kata Kunci: metode bermain balok berwarna, pengembangan seni, anak kelompok B .Dari hasil pengamatan dilapangan menunjukan bahwa kemampuan anak bidang pengembangan seni mencipta bentuk bangunan sebesar 32% dari 15 anak. hal itu menunjukan masih rendahnya kemampuan seni anak. Guru sebagai pelaku utama lebih banyak ceramah, anak hanya mendengarkan dan bermain sendiri, karena pembelajaran yang monoton, minimya media, pembelajaran belum melibatkan anak akibatnya anak tidak memiliki kebebasan untuk berekspresi, sehingga tidak menyenangkan bagi anak. Penelitian ini bertujuan untuk mendiskripsikan penerapan metode bermain balok berwarna yang dapat mengembangkan kemampuan seni kelompok B TK Dharma Wanita Desa Olak Alen Kabupaten Blitar dan mendeskripsikan pengembangan metode bermain balok berwarna di TK Dharma Wanita Desa Olak Alen Kabupaten Blitar. Metode dalam penelitian ini adalah penelitian deskriptif dengan rancangan PTK yang terdiri atas 2 siklus. Masing – masing siklus memiliki 4 tahapan: perencaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian ini adalah 15 anak kelompok B TK Dharma Wanita Desa Olak Alen Kabupaten Blitar. Instrumen yang digunakan adalah observasi dan dokumentasi. Tehnik analisis yang digunakan adalah deskriptif. Hasil penelitian menunjukan bahwa kemampuan seni mencipta bentuk bangunan dengan metode bermain balok berwarna, anak merasa senang dan bersemangat dalam melakukan kegiatan yang dirancang guru. Berdasarkan fakta tersebut dapat disimpulkan bahwa metode bermain balok berwarna dapat mengembangkan kemampuan anak dalam mencipta bentuk bangunan.

Penerapan metode eksperimen pencampuran warna untuk mengembangkan kemampuan kognitif anak kelompok A TK Al-Hidayah Dawuhan Kota Blitar / Endang Purwanti

 

Kata Kunci : Metode Eksperimen, Pencampuran Warna, Perkembangan Kognitif Permasalahan-permasalahan yang terjadi dalam proses kegiatan belajar mengajar tersebut berdampak pada hasil belajar anak, dimana 50% anak tidak mampu menyebutkan dan menceritakan. Dari fakta sederhana di atas, penyusun mencoba mengatasi permasalahan anak tersebut dengan menerapkan metode eksperimen untuk meningkatkan kemampuan kognitif anak khususnya dalam mengenal konsep pencampuran warna. Metode eksperimen dimanfaatkan sebagai metode dalam kegiatan pembelajaran karena masa kanak-kanak adalah masa bermain dan pembelajaran akan lebih bermakna jika dilakukan melalui bermain. Tujuan dari penelitian ini adalah untuk mendeskripsikan penerapan metode eksperimen pencampuran warna pada anak kelompok A TK Al-Hidayah Dawuhan Kota Blitar dan mendeskripsikan peningkatan kemampuan kognitif anak kelompok A TK Al-Hidayah Dawuhan Kota Blitar setelah belajar melalui metode eksperimen pencampuran warna. Penelitian ini dirancang dengan menggunakan rancangan penelitian tindakan kelas atau Classroom Action Research. Penelitian Tindakan Kelas adalah proses investigasi terkendali untuk menemukan dan memecahkan masalah pembelajaran di kelas. Proses pemecahan masalah tersebut dilakukan secara bersiklus, dengan tujuan untuk meningkatkan kualitas pembelajaran dan hasil pembelajaran di kelas tertentu. Hasil penelitian menunjukkan bahwa pada kemampuan awal kognitif anak 46,25 rata-rata nilai kelompok A TK Al-Hidayah Dawuhan Kota Blitar kemudian meningkat dengan diterapkannya metode eksperimen dalam pelajaran mencampur warna. Peningkatan pada siklus I penelitian tindakan kelas ini meningkat dengan rata-rata 68,75 dengan tidak adanya anak yang berkemampuan kognitif rendah. Dalam pembuktian peningkatan kognitif anak, peneliti dan kolaborator melaksanakan siklus II untuk melakukan upaya peningkatan yang lebih dari penerapan metode eksperimen yang mana kemudian hasil nilai rat-rata anak menjadi 88,75. Kesimpulan yang dapat diperoleh dari hasil penelitian ini adalah terjawbanya rumusan masalah yang selnajutnya diharapkan penelitian ini dapat berguna dalam meningkatkan proses belajar dan mengajar PAUD di sekolah manapun.

Manajemen pembelajaran rintisan sekolah bertaraf internasional (studi kasus di SMP Negeri 1 Sumenep) / Katrin Widariyati

 

Kata kunci: kurikulum, kegiatan pembelajaran, rintisan sekolah bertaraf Internasional Dalam upaya peningkatan mutu, efisiensi, relevansi, dan peningkatan daya saing secara nasional dan sekaligus internasional pada jenjang pendidikan dasar dan menengah, maka telah ditetapkan pentingnya penyelenggaraan satuan pendidikan bertaraf Internasional, baik untuk sekolah negeri maupun swasta. Pendidikan bertaraf Internasional harus memiliki daya saing yang tinggi dalam hasil-hasil pendidikan (output dan outcomes), proses, dan input sekolah baik secara nasional maupun internasional. Hal ini didasari oleh tuntutan kurikulum bertaraf Internasional yang mengharuskan peserta didik dalam masuk kelas Internasional harus mampu berkompetisi secara global dengan siswa dari negara lain. Beberapa kemampuan umum yang lazim menjadi tolak ukur keinternasional adalah kemampuan dalam sains, kemampuan dalam bidang teknologi, dan kemampuan lain yang bersifat karya-karya inovatif dan kreatif. Penelitian ini dilakukan di SMP Negeri 1 Sumenep dengan menggunakan pendekatan kualitatif dan studi kasus. Dalam penelitian ini, peneliti sebagai instrumen kunci , dengan subyek penelitian Kepala Sekolah, koordinator kurikulum, guru dan siswa RSBI SMP Negeri 1 Sumenep. Teknik pengumpulan data yang digunakan meliputi: (1) wawancara mendalam; (2) observasi; dan (3) dokumentasi. Data yang terkumpul melalui ketiga teknik tersebut dianalisis selama pengumpulan data dan setelah pengumpulan data. Pada saat pengumpulan data, data yang telah diperoleh kemudian diuji dengan menggunakan metode triangulasi sumber dan ketekunan pengamatan untuk mengetahui keabsahan data. Hasil penelitian di kelas RSBI SMP Negeri 1 Sumenep menunjukkan proses perencanaan kurikulum dan pembelajaran dilakukan dengan menyusun silabus, Rencana Pelaksanaan Pembelajaran, program semester, tahunan dan kalender pendidikan. Untuk proses pelaksanaan kurikulum dan pembelajaran terdiri dari Pengelolaan Kelas dan Proses pembelajaran bertaraf Internasional di kelas RSBI. Pengelolaan kelas di RSBI dilakukan dengan memenuhi jumlah siswa per kelas berkisar 25-30 siswa, beban mengajar guru minimal 24 jam tiap minggunya kecuali 12 jam tiap minggu untuk guru yang tugas belajar. Proses pembelajaran bertaraf Internasional terdapat tiga kegiatan, yaitu kegiatan awal, inti dan penutup. Kegiatan inti dibagi menjadi tiga bagian yaitu ekspositori, tanya jawab, dan penugasan. Evaluasi kurikulum dan pembelajaran dapat dinilai dari beberapa aspek, yaitu dilihat dari keseharian siswa di kelas bagaimana siswa menerima dan menyalurkan pelajaran yang diterima dengan baik; tugas-tugas yang diberikan oleh guru dikumpulkan tepat waktu; keaktifan dalam diskusi bagaimana siswa bertanya dan menjawab pertanyaan; Tes Formatif 1, Tes Formatif 2, Ujian Akhir Sekolah, dan penilaian dari sikap siswa. Ketuntasan belajar harus mencapai nilai 80, bagi siswa yang belum mencapai ketuntasan dalam belajar maka wajib untuk mengikuti remidi. Berdasarkan penelitian ini, dapat disarankan bagi : (1) Kepala Sekolah SMP Negeri 1 Sumenep hendaknya menerapkan sekolah Rintisan Sekolah Bertaraf Internasional sepenuhnya mulai dari kelas VII sampai kelas IX, sehingga tidak ada perbedaan antara kelas RSBI, unggulan dan reguler. Selain itu Kepala Sekolah harus dapat meningkatkan dan mengembangkan kurikulum, menciptakan tenaga pendidik yang berkualitas sehingga lulusannya dapat memiliki kemampuan daya saing Internasional; (2) Kepala Dinas Pendidikan Kota Sumenep dalam bidang kurikulum dan pembelajaran hendaknya selalu mengevaluasi penerapan Rintisan Sekolah Bertaraf Internasional terutama dalam hal kurikulum, sarana dan prasarana, tingkat keberhasilan RSBI jika dilihat dari proses belajar-mengajar dan guru pengajar, agar sekolah tersebut senantiasa memberikan pelayanan kepada siswa sesuai dengan tujuan yang telah ditetapkan yaitu mencapai sekolah bertaraf Internasional. Dengan adanya keberhasilan dari satu sekolah yaitu SMP Negeri 1 Sumenep, Kepala Diknas dapat memotivasi sekolah yang lain untuk menjadi RSBI sehingga pendidikan yang ada di Sumenep dapat berkembang dengan baik dan mempunyai daya saing Internasional; (3) Wakasek kurikulum seharusnya tetap mempertahankan dan meningkatkan kurikulum RSBI SMP Negeri 1 Sumenep yang mengacu pada standar pendidikan untuk mewujudkan tujuan pendidikan nasional. Pengembangan kurikulum juga harus senantiasa dilakukan secara berkesinambungan sehingga proses belajarmengajar dapat berjalan dengan lancar;(4) Guru Rintisan Sekolah Bertaraf Internasional SMP Negeri 1 Sumenep selalu meningkatkan kinerja dan kualitas dalam proses belajar-mengajar agar siswa termotivasi dalam belajar dan memperoleh hasil yang memuaskan dalam pendidikan yang ditempuh dengan cara selalu mengembangkan silabus dan Rencana Pelaksanaan Pembelajaran sesuai dengan pengetahuan pendidikan yang semakin berkembang. Guru juga harus dapat menggunakan sarana dan prasarana dengan seefisien mungkin seperti LCD, laptop, serta media pembelajaran lainnya; (5) Pengelola Jurusan Administrasi Pendidikan, hasil penelitian ini hendaknya menjadi tambahan referensi mengenai program sekolah bertaraf Internasional yang saat ini sudah mulai menjadi perhatian penting pemerintah khususnya dalam dunia pendidikan; dan (6) Peneliti Lain, diharapkan melakukan penelitian sejenis pada berbagai aspek lain yang bermanfaat dari manajemen Rintisan Sekolah Bertaraf Internasional. Aspek yang bermanfaat untuk diteliti, misalnya manajemen sarana dan prasarana Rintisan Sekolah Bertaraf Internasional.

Peningkatan kecerdasan interpersonal melalui bermain kooperatif ikan dan nelayan pada anak kelompok A do RA Nurul Islam Ngadimulyo Sukorejo Pasuruan / Dewi Khoiriyah

 

Kata kunci: Kecerdasan Interpersonal, Bermain Kooperatif, Anak kelompok A Berdasarkan hasil penelitian yang dilakukan di kelompok A RA Nurul Islam Ngadimulyo Kecamatan Sukorejo Kabupaten Pasuruan, terdapat rumusan masalah sebagai berikut: 1) Bagaimana penerapan metode bermain kooperatif dalam meningkatkan kecerdasan Interpersonal anak kelompok A RA Nurul Islam Ngadimulyo Sukorejo Pasuruan. 2) Apakah penerapan metode bermain kooperatif dapat meningkatkan kecerdasan interpersonal anak kelompok A RA Nurul Islam Ngadimulyo Sukorejo Pasuruan. Tujuan penelitian ini adalah untuk: 1) Mendeskripsikan penerapan bermain kooperatif dalam meningkatkan kecerdasan interpersonal anak kelompok A RA Nurul Islam Ngadimulyo Sukorejo Pasuruan. 2) Mendeskripsikan peningkatan kecerdasan interpersonal dengan penerapan metode bermain kooperatif anak kelompok A RA Nurul Islam Ngadimulyo Sukorejo Pasuruan. Metode penelitian yang digunakan dalam penelitian ini adalah deskriptif kualitatif dan kuantitatif berbentuk tindakan kelas dan dirancang dalam 2 siklus. Masing-masing siklus terdiri dari 4 tahapan, yaitu perencanaan (planning), pelaksanaan tindakan (action), pengamatan (observation), dan refleksi (reflection). Subyek penelitian adalah anak kelompok A RA Nurul Islam Ngadimulyo Kecamatan Sukorejo Kabupaten Pasuruan yang berjumlah 20 anak. Metode pengumpulan data diperoleh melalui observasi, APKG I & II serta dokumentasi. Hasil penelitian menunjukkan bahwa penerapan bermain kooperatif ikan dan nelayan dapat meningkatkan kecerdasan interpersonal anak kelompok A. Berdasarkan lembar observasi pada siklus I hasil aktifitas pembelajaran pada pengembangan kecerdasan interpersonal adalah rata-rata anak mendapat 2. Pada siklus II hasil observasi pada pengembangan kecerdasan interpersonal meningkat, rata-rata anak mendapat bintang 3. Berdasarkan hasil penelitian tersebut, dapat disimpulkan bahwa penerapan bermain kooperatif ikan dan nelayan dapat meningkatkan kecerdasan interpersonal anak. Terdapat peningkatan kecerdasan interpersonal melalui bermain kooperatif ikan dan nelayan dari bintang 2 menjadi bintang 3. Oleh karena itu disarankan bagi guru RA dapat menerapkan bermain kooperatif ikan dan nelayan untuk meningkatkan kecerdasan interpersonal anak. Bagi peneliti yang lain dapat dijadikan sebagai bahan acuan dalam pengembangan penelitian berikutnya

Peningkatan keterampilan menulis melalui menulis pengalaman pribadi siswa kelas V SDN Karangrejo 2 Kabupaten Blitar / Agustin Dewi Puspitasari

 

Kata kunci : peningkatan, ketrampilan menulis, pengalaman pribadi Permasalahan yang timbul pada pembelajaran Bahasa Indonesia pembelajaran menulis adalah siswa kurang mampu dalam mengungkapkan ide, perasaan, dan pengalaman kedalam bentuk tulisan dengan menggunakan kalimat yang efektif, dan belum menggunakan ejaan yang benar, oleh karena itu siswa mengatasi masalah tersebut yaitu melalui menulis pengalaman pribadi siswa. Tujuan dari penelitian ini adalah untuk mendeskripsikan pelaksanaan pembelajaran melalui menulis pengalaman pribadi dan untuk mendeskripsikan hasil pelaksanaan pembelajaran menulis melalui menulis pengalaman pribadi siswa kelas V SDN Karangrejo 2 Kabupaten Blitar. Penelitian ini bermanfaat untuk membantu siswa dalam meningkatkan ketrampilan menulis baik dalam pembelajaran Bahasa Indonesia maupun dalam penerapan pada pembelajaran lain dan dapat menumbuhkan semangat pada siswa untuk lebih giat belajar. Penelitian ini dilakukan di kelas V SDN Karangrejo 2 Kecamatan Garum Kabupaten Blitar. Subject penelitian adalah siswa kelas V SDN Karangrejo 2 Kecamatan Garum Kabupaten Blitar semester 1 tahun pelajaran 2010/2011. Teknik pengumpulan data yang digunakan dalam penelitian ini adalah pedoman observasi dan pedoman tes. Jenis penelitian yang digunakan adalah model penelitian tindakan kelas (PTK). Hasil penelitian ini menunjukkan bahwa ketrampilan menulis siswa kelas V SDN Karangrejo 2 mengalami peningkatan. Peningkatan tersebut dicapai setelah dilakukan pembelajaran menulis melalui menulis pengalaman pribadi siswa. Pada siklus 1 aspek kesesuaian judul dengan isi meningkat 40%, aspek keterkaitan isi tulisan antar paragraph mengalami peningkatan sebesar 33,33%, pada aspek penggunaan ejakan meningkat 13,33% dari pra tindakan. Pada siklus 2 telah mencapai ketuntasan belajar secara klasikal yaitu mencapai lebih dari 70%. Pelaksanaan pembelajaran menulis melalui menulis pengalaman pribadi dapat meningkatkan ketrampilan menulis siswa kelas V SDN Karangrejo 2 Kabupaten Blitar. Saran yang peneliti sampaikan hendaknya dalam pembelajaran menulis guru menggunakan strategi menulis melalui pengalaman pribadi siswa, hal ini dapat melatih siswa bercerita dalam bentuk tulisan, memperkaya pengalaman sehingga mengembangkan daya nalar dan kreatifitas. Menulis melalui pengalaman pribadi dapat membantu siswa dalam belajar menuangkan ide kreatifnya dalam bentuk tulisan dan pengalaman yang dialaminya sendiri.

Peningkatan kemampuan kognitif melalui bermain menggunakan kartu gambar kelompok B TK Dharma Wanita Pagerwojo Kecamatan Kesamben Kabupaten Blitar / Enik Srihayati

 

Kata Kunci: Kemampuan Kognitif, Bermain Kartu Gambar, TK Penelitian ini berlatar belakang pada kurangnya kemampuan kognitif anak. Hal ini disebabkan karena kegiatan pembelajaran cenderung dilakukan dengan klasikal belum melibatkan anak untuk bermain dan belum memberikan kebebasan untuk berekspresi dan mencoba kegiatan yang menyenangkan bagi anak. Penelitian bertujuan untuk mendeskripsikan penerapan bermain menggunakan kartu gambar dan peningkatan kemampuan kognitif anak di kelompok B. Penelitian dilakukan di TK Dharma Wanita Pagerwojo Kecamatan Kesamben Kabupaten Blitar pada bulan Desember 2010. Rancangan penelitian menggunakan penelitian tindakan kelas dengan 2 siklus. Dalam setiap siklus terdiri dari empat tahapan, yaitu perencanaan, pelaksanaan, observasi, dan refleksi. Pelaksanaan penelitian berkolaborasi dengan teman sejawat sebagai observer. Metode pengumpulan data yang digunakan adalah observasi dan penilaian. Instrumen yang digunakan adalah lembar observasi dan lembar penilaian Hasil penelitian menunjukkan bahwa bermain menggunakan kartu gambar terbukti dapat dimanfaatkan dalam kegiatan pembelajaran untuk meningkatkan kemampuan kognitif anak TK. Bermain menggunakan kartu gambar dapat meningkatkan kemampuan kognitif anak. Peningkatan ditandai dengan meningkatnya kemampuan kognitif anak dalam menyebut bentuk yang sama, mengelompokkan warna dan menyusun urutan gambar secara wajar. Disarankan bahwa dalam pembelajaran bidang kemampuan kognitif hendaknya menerapkan bermain menggunakan kartu gambar dan disarankan agar dilakukan penelitian lebih lanjut dengan masalah yang lain yang dapat dimanfaatkan dalam pembelajaran bidang pengembangan selain kognitif, yaitu pada bidang pengembangan sosial emosional, bahasa, dan seni.

Penerapan pembelajaran inkuiri untuk meningkatkan hasil belajar PKn kelas V SDN Beji II Kecamatan Beji Kabupaten Pasuruan / Sufa'at

 

Kata kunci: Penerapan Inkuiri, Prestasi belajar, PKn SD PKn merupakan pelajaran yang memegang peranan penting karena berhubungan dengan sikap atau mental anak dimasa datang. Model pembelajaran yang digunakan dalam pembelajaran PKn harus mencakup aspek kognitif, afektif dan psikomotorik. Hasil observasi awal ditemukan bahwa siswa SDN Beji Ii Kecamatan Beji Kabupaten Pasuruan belum menerapkan model pembelajaran inkuiri. Sebagian siswa belum mampu mencapai kriteria ketuntasan kelas 80% dan ketuntasan individu 75 dari materi. Berdasarkan hal ini, model pembelajaran inkuiri sangat tepat digunakan sebagai proses pembelajaran, karena dapat mencakup aspek kognitif, afektif dan psikomotorik.Tujuan yang ingin dicapai dalam penelitian ini adalah: 1) mendeskripsikan penerapan model pembelajaran inkuiri dalam pembelajaran PKn pada siswa kelas V SDN Beji Ii Kecamatan Beji Kabupaten Pasuruan Pasuruan; 2) mendeskripsikan dampak penerapan model pembelajaran inkuiri terhadap aktifitas dan partisipasi siswa kelas V SDN Beji Ii Kecamatan Beji Kabupaten Pasuruan; 3) mendeskripsikan peningkatan prestasi belajar PKn pada pokok bahasan kesatuan NKRI melalui model pembelajaran inkuiri. Penelitian ini menggunakan metode Deskriptif dengan 2 (dua) siklus. Masing-masing siklus terdiri atas tahapan: Perencanaan, Pelaksanaan, Observasi, dan Refleksi. Standar nilai ketuntasan minimal 75 dengan ketuntasan belajar 80% dari jumlah subyek penelitian.subyek penelitian ini adalah guru dan siswa kelas V SDN Beji Ii Kecamatan Beji Kabupaten PasuruaN. Teknik pengumpulan data yang digunakan adalah observasi, wawancara, dan tes. Instrument pengumpulan data yang digunakan berupa pedoman wawancara, APKG II, alat penilaian aktifitas belajar siswa, pedoman observasi partisipasi siswa dalam inkuiri, dan post test. Hasil penelitian bahwa peenerapan inkuiri dalam PKn mengalami peningkatan aktivitas pembelajaran.dampak dari pembelajaran inkuiri menjadikan siswa lebih berkembang keaktivitasannya dan dapat memecahkan permasalahan dalam pembelajaran PKn dengan penerapan model pembelajaran inkuiri dengan ketuntasan belajar kelas sudah tercapai 88,46%. Hasil penelitian ini menunjukkan penerapan model pembelajaran inkuiri pada pembelajaran PKn siswa kelas V SDN Beji Ii Kecamatan Beji Kabupaten Pasuruan dapat meningkatkan hasil belajar siswa, terbukti dari hasil yang diperoleh siswa rata-rata pada pre test sebesar 57,3 meningkat pada post test siklus I sebesar 71,1 dengan ketuntasan belajar kelasnya sebesar 50,0 % dan kemudian meningkat menjadi 88 ,4. pada siklus II dengan ketuntasan belajar kelas sebesar 88,4 %. Pada siklus II telah tercapai ketuntasan belajar secara klasikal yaitu sudah mencapai standar ketuntasan yang ditentukan yaitu 75. Akan tetapi untuk ketuntasan individual masih ada 3 siswa yang belum mencapai ketuntasan individu karena pasif dalam belajar sehingga nilai yang didapat belum memenuhi kriteria ketuntasan belajar, dan perlu diberikan program remedial. sebelum dan sesudah penerapan model pembelajaran inkuiri, post test siklus I dan post test siklus II yang terus mengalami peningkatan.Saran yang disampaikan kepada guru yaitu agar dapat menerapkan model pembelajaran inkuiri pada pembelajaran PKn dengan kompetensi lain ataupun mata pelajaran lain. Model pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian lain sebagai bahan bandingan sehingga dikemudian hari menjadi lebih baik. Dan diharapkan agar peneliti lain dapat mengembangkan pembelajaran agar menjadi lebih baik dan bagi tiga siswa yang belum tuntas dikarenakan broken home yang akibat sering dimarahi orang tua dan perceraian orang tuanya

Pengembangan kecerdasan intrapersonal melalui metode bermain peran pada anak kelompok B di RA Jamilah 45 Ngembe Beji Pasuruan / Khusnul Khotimah

 

Kata Kunci: Metode bermain peran, Kecerdasan intrapersonal. Kecerdasan intrapersonal yang dimiliki semua anak sejak lahir perlu dikembangkan supaya menjadi orang yang sukses dalam hidup dan karirnya. Guru dan orang tua mempunyai tugas untuk mengembangkannya, dengan menggunakan berbagai cara. Salah satu di antaranya adalah menggunakan metode bermain peran, karena metode ini dapat mengembangkan imajinasi dan penghayatan terhadap peristiwa yang dihadapi. Berkaitan dengan itu, maka diperlukan pembahasan mengenai pengembangan kecerdasan intrapersonal tersebut. Penelitian ini bertujuan untuk mengembangkan kecerdasan intrapersonal anak kelompok B melalui metode bermain peran pada RA Jamilah 45 Ngembe Beji Pasuruan yang dilakukan pada bulan November 2010. Metode yang digunakan adalah penelitian tindakan kelas yang terdiri dari dua siklus, masing-masing siklus terdiri dari tahap perencanaan, tindakan, observasi dan refleksi. Sampel yang digunakan anak kelompok B di RA Jamilah 45, sebanyak 17 anak, yang melibatkan dua orang kolaborator. Teknik pengumpulan data dilakukan melalui teknik interview, penilaian hasil karya anak, dan observasi terhadap gejala kecerdasan intrapersonal anak yang diperoleh di lapangan dengan menggunakan pedoman penilaian kecerdasan intrapersonal. Teknik analisis data yang digunakan untuk menguji hipotesis tindakan yaitu secara deskriptif baik secara kualitatif maupun kuantitatif dengan pencapaian skor maksimal 75 % dari skor yang diharapkan. Hasil analisis data kuantitatif pada siklus I yang dilakukan selama dua kali pertemuan pada tanggal 15 dan 16 November 2010, diperoleh skor rata-rata sebesar 66,57 %, mengalami kenaikan skor pada siklus II yang juga dilakukan selama dua kali pertemuan pada tanggal 19 dan 20 November 2010, sebesar 84,87%, terdapat kenaikan skor sebesar 18,3 % dari siklus I ke siklus II. Kesimpulan hasil penelitian : (1) pelaksanaan metode bermain peran harus menggunakan langkah-langkah yang tepat, (2) metode bermain peran dapat mengembangkan kecerdasan intrapersonal anak kelompok B di RA Jamilah 45 Ngembe Beji Pasuruan. Saran disampaikan kepada (1) guru yang akan menggunakan metode bermain peran supaya mempersiapkan segalanya dengan matang (2) orang tua supaya memberi keleluasaan kepada anaknya untuk mengekspresikan kreativitasnya melalui bermain peran dengan pengawasan serius, (3) peneliti selanjutnya supaya menggunakan tema-tema yang berbeda dan aspek-aspek yang lebih luas.

Peningkatan kemampuan membaca pemahaman melalui model Student Teams Achievement Divisions (STAD) di kelas IV SDN Kaligambir 02 Kabupaten Blitar / Rohmawati

 

Kata kunci: kooperatif STAD, membaca pemahaman Masalah yang dihadapi oleh guru adalah tingkat keterampilan membaca pemahaman siswa kelas IV di SDN Kaligambir 02 masih sangat rendah. Hal ini dapat dilihat dari kebanyakan siswa yang masih menggunakan cara-cara membaca yang menghambat untuk memahami bacaan. Pada umumnya siswa membaca dengan suara keras, tidak fokus pada bacaan dan sering melihat gambar. Rumusan masalah dalam penelitian ini adalah : (1) Bagaimanakah penerapan pembelajaran kooperatif model STAD untuk meningkatkan kemam-puan membaca pemahaman siswa kelas IV di SDN Kaligambir 02 Kabupaten Blitar? (2) Apakah pembelajaran kooperatif model STAD dapat meningkatkan kemampuan membaca pemahaman siswa kelas IV SDN Kaligambir 02 Kabupaten Blitar? Penelitian ini bertujuan untuk meningkatkan kemampuan membaca pemahaman. Kemampuan membaca pemahaman ditekankan pada aspek pemahaman menemukan pikiran pokok tiap paragraf dan menjelaskan isi teks bacaaan dengan kalimat yang runtut. Serta mendeskripsikan pelaksanaan pembelajaran kooperatif STAD pada pelajaran bahasa Indonesia siswa kelas IV SDN Kaligambir 02. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran kooperatif STAD dapat meningkatkan kemampuan membaca pemahaman. Hasil kemampuan membaca pemahaman pada siklus I diperoleh persentase ketuntasan belajar siswa 26,3% dan pada siklus II naik menjadi 100%. Nilai proses belajar siswa pada siklus I sebesar 71,73%, sedangkan pada siklus II sebesar 86,68%. Berdasarkan data dapat disimpulkan bahwa pembelajaran kooperatif STAD dapat meningkatkan kemampuan membaca pemahaman. Dari hasil penelitian tersebut diharapkan agar guru mencoba menerapkan pembelajaran kooperatif STAD untuk mengatasi kesulitan belajar siswa khususnya pada aspek membaca pemahaman. Sedangkan untuk peneliti lain diharapkan dapat menyempurnakannya pada ruang lingkup yang lebih luas.

Perancangan environmental sign goa Gong Kabupaten Pacitan / Urip Tri Ariyadi

 

Kata kunci: Perancangan, Sign,Goa Gong, Pacitan Pacitan adalah salah satu kota di Indonesia yang memiliki obyek wisata alam yang menarik. Baik berupa gua, pantai, pemandian air hangat, pegunungan, hutan wisata, bahkan situs-situs purbakala, dengan berbagai kelebihan dan keistimewaannya yang tersebar di berbagai sudut wilayah Kabupaten Pacitan. Namun, sebagian besar wisatawan baik dari dalam maupun luar negeri hanya mengetahui sebagian kecil obyek wisata alam di Kabupaten Pacitan. Goa Gong merupakan salah satu objek wisata alam yang ada dan menjadi andalan dalam sektor pariwisata Kabupaten Pacitan. Namun, letak yang kurang strategis membuat objek wisata ini kurang begitu terkenal di mata masyarakat luas. Hal ini terlihat dengan kurangnya media promosi dan sign system yang mendukung objek wisata alam Goa Gong. Sehingga, perlu adanya suatu perbaikan mengenai hal tersebut, untuk meningkatkan citra pariwisata Kabupaten Pacitan, khususnya Goa Gong. Hasil akhir perancangan ini adalah enterance sign, yang berfungsi sebagai media informasi dan sebagai alat untuk menggambarkan ikon dari wisata Goa Gong. Disamping enterance sign, dihasilkan juga peta goa, landmark, guide sign, poster, spanduk, umbul-umbul, billboard, wayfinding, sign age, dan advertising sign. Diharapkan media-media tersebut berkolaborasi sebagai satu kesatuan untuk mempromosikan Goa Gong secara efektif dan efisien.

Peran personil hubungan masyarakat dalam mempublikasikan Universitas Negeri Malang kepada masyarakat / Salmaniah

 

Kata kunci: peran humas, publikasi Universitas Negeri Malang Keberhasilan humas dalam melaksanakan publikasi kepada masyarakat, sebagai upaya peningkatan kualitas kerja humas di perguruan tinggi UM tidak dapat dilepaskan dari kemampuan dan komitmen kepala humas dan personil humas dalam menjalankan semua peran, tugas dan tanggungjawabnya. Penelitian ini bertujuan untuk mendeskripsikan: (1) peran humas dalam mempublikasikan UM kepada masyarakat; (2) kegiatan-kegiatan yang dapat menunjang proses publikasi UM kepada masyarakat; (3) faktor pendukung humas dalam melakukan proses publikasi; dan (4) partisipasi dan kontribusi yang diberikan oleh masyarakat kepada UM. Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian ini adalah studi kasus, Instrumen kunci adalah peneliti sendiri. Subjek penelitian adalah kepala humas, sekretaris humas dan para personil humas. Data diperoleh melalui wawancara, observasi dan dokumentasi. Data yang telah didapatkan dianalisis selama pengumpulan data, kemudian diklasifikasikan, disaring dan ditarik sebuah kesimpulan. Keabsahan data yang telah dianalisis menggunakan kriteria credibility (kepercayaan), dependability (kebergantungan), transferability (keteralihan) dan konfirmability (kepastian). Kesimpulan penelitian meliputi: (1) peran humas di UM ditunjukkan melalui publikasi yang dilakukan oleh humas secara terus menerus dan berkelanjutan, serta kegiatan-kegiatan humas yang direalisasikan dan dilaksanakan demi kemajuan lembaga; (2) kegiatan-kegiatan humas melalui keaktifan humas dalam menyampaikan dan menginformasikan semua berita dan informasi tentang lembaga kepada masyarakat, menghadiri semua acara lembaga yang berkaitan dengan humas; (3) faktor pendukung humas lebih menekankan pada aspek kerjasama antara kepala humas dengan bawahannya, perusahaan, lembaga perguruan tinggi lainnya, dan masyarakat luas; (4) partisipasi dan kontribusi masyarakat berupa pemberian kritik dan saran yang ditujukan kepada UM, bantuan yang diberikan berupa jasa dan finansial, serta dukungan moril terhadap kemajuan perguruan tinggi. Berdasarkan kesimpulan penelitian tersebut, dapat disarankan bagi: (1) Rektor UM diharapkan agar dapat merubah struktur organisasi humas UM; (2) Kepala Humas UM diharapkan dapat terus membina dan meningkatkan kinerjanya serta kinerja para personil setiap tahun; (3) Ketua Jurusan Administrasi Pendidikan diharapkan lebih memperbanyak pengembangan ilmu dan mengadakan sosialisasi dan bentuk pelatihan mengenai pentingnya humas di lembaga pendidikan; dan (4) Peneliti lain diharapkan dapat melanjutkan penelitian yang sejenis di berbagai aspek humas pada perguruan tinggi UM serta penelitian pengembangan untuk mengetahui peran humas di masa yang akan datang.

Penerapan model siklus belajar untuk meningkatkan pembelajaran IPS kelas IV MI As-Sholihin Rebalas Grati Pasuruan / Misbahul Munir

 

Kata kunci: IPA, Siklus Belajar, Pembelajaran. Berdasarkan hasil observasi awal di MI As-Sholihin Rebalas Kecamatan Grati Kabupaten Pasuruan ditemukan (1) Guru lebih sering menggunakan metode ceramah, tanya jawab, penugasan dalam pembelajaran IPA, (2) Siswa dalam merespon pembelajaran IPA selama ini cenderung sebagai pendengar atau penerima materi saja, sehingga mereka menjadi pasif, kurang kreatif dan mengalami kejenuhan, serta sulit memahami konsep-konsep IPA. Penelitian ini dilakukan dengan tujuan untuk (1) Mendeskripsikan penerapan model siklus belajar pada pembelajaran IPA, (2) Mendeskripsikan aktivitas belajar siswa selama penerapan model siklus belajar, (3) Mendeskripsikan hasil belajar siswa setelah penerapan model siklus belajar. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) yang bersifat kolaboratif. Langkah-langkah penelitian dilakukan dengan tahap perencanaan, pelaksanaan, observasi, dan refleksi. Siklus tindakan dihentikan apabila mencapai kriteria ketuntasan belajar kelas yaitu 75% dari jumlah subyek penelitian 19 siswa yang terdapat pada Standar Ketuntasan Belajar Madrasah (SKBM) yang disesuaikan dengan tingkat ketuntasan belajar yang ditetapka oleh sekolah yaitu minimal 65. Teknik pengumpulan data dengan menggunakan observasi, tes, dan wawancara. Pedoman observasi siklus belajar untuk menilai aspek afektif dan menilai aspek psikomotor. Analisis data dilaksanakan secara deskriptif kualitatif dengan mengkaji semua data yang diperoleh dilakukan secara berurutan yaitu: (1) Reduksi Data (2) Penyajian Data, (3) Kesimpulan. Hasil penelitian menunjukkan bahwa penerapan model siklus belajar dapat meningkatkan pembelajaran IPA. Pada siklus I siswa lebih aktif dari sebelumnya namun masih ada sebagian siswa yang kurang aktif sehingga rata-rata hasil belajar siswa yaitu 70,52. sedangkan pada siklus II peneliti dan guru melaukan perbaikan sehingga siswa tampak antusias dan hasil belajar siswa meningkat menjadi 78,42. dari perbandingan kedua siklus tersebut menunjukkan adanya peningkatan sebesar 7,9. dan semua siswa sudah mencapai Standar Ketuntasan SKBM. Saran bagi guru dan peneliti lain model siklus belajar sebaiknya dapat dijadikan sebagai alternatif untuk meningkatkan hasil belajar dan aktivitas siswa selama pembelajaran berlangsung. Dan hendaknya dijadikan acuan untuk mengadakan penelitian yang sejenis dengan permasalah yang lain.

Analisis penerapan akuntansi perbankan syariah dalam pembiayaan murabahah pada PT. Bank BRI Syariah Cabang Malang / Ardiana Kusuma Wijaya

 

Kata Kunci: Pembiayaan murabahah, PSAK No.59. Pembiayaan murabahah merupakan akad jual beli barang dengan menyatakan harga perolehan dan keuntungan (margin) yang disepakati oleh penjual dan pembeli. Pembiayaan murabahah berbeda dengan produk pembiayaan yang ditawarkan oleh bank konvensional. Pada pembiayaan murabahah diterapkan keadilan, kejujuran dan transparansi dari kedua belah pihak. Hubungan antara bank dan nasabah tidak hanya sebagai debitor dengan kreditor saja, tetapi hubungan keduanya diakui sebagai mitra kerja yang lebih dekat dan lebih humanis. Pada penerapan sistem syariah, sistem perlakuan akuntansinya berbeda dengan perlakuan akuntansi konvensional pada umumnya. Kebutuhan dalam menetapkan metode pengukuran akuntansi, terutama pembiayaan murabahah harus disesuaikan dengan peraturan perbankan dan ketentuan-ketentuan syariah yang telah diatur. Penulisan Tugas Akhir ini bertujuan untuk mengetahui bagaimana penerapan akuntansi perbankan syariah dalam pembiayaan murabahah pada Bank BRI Syariah cabang Malang. Selain itu, juga untuk mengetahui kesesuaian penerapan akuntansi yang diterapkan Bank BRI Syariah dengan PSAK No.59. Berdasarkan pembahasan yang telah dilakukan, penerapan pembiayaan murabahah yang diterapkan oleh BRI Syariah Cabang Malang telah sesuai dengan PSAK No. 59 kecuali pada uang muka. Uang muka (urbun) yang diterapkan Bank BRI Syariah adalah apabila nasabah membatalkan pemesanan dan pihak Bank mengalami kerugian, maka nasabah harus memberikan ganti rugi dengan uang muka tersebut. Padahal berdasarkan PSAK No.59, uang muka (urbun) dikembalikan setelah dikurangi dengan kerugian dari pihak Bank berdasarkan kesepakatan. Dengan adanya ketidaksesuaian tersebut, Bank BRI Syariah sebaiknya mengubah prinsip uang muka (urbun) yang diterapkan pada Bank tersebut sesuai dengan PSAK No.59 supaya dampak yang diprediksi yaitu berkurangnya nasabah yang melakukan pembiayaan dan pindah ke bank yang lain tersebut dapat diatasi.

Penerapoan pendekatan komunikatif untuk meningkatkan kemampuan membaca pemahaman pada pembelajaran bahasa Indonesia siswa kelas IV SDN Kayoman Purwosari Pasuruan / Augustina Sugiarti

 

Kata Kunci: Pendekatan Komunikatif, Membaca Pemahaman Pembelajaran Bahasa Indonesia, Sekolah Dasar. Sekolah Dasar merupakan tumpuan dari proses pendidikan yang ada pada jenjang berikutnya. Untuk itu pendidikan pada Sekolah Dasar harus dilaksanakan dengan cara yang benar-benar mampu menjadi landasan yang kuat ke jenjang berikutnya. Sekolah Dasar adalah salah-satu lembaga yang mendidik dan mengembangkan potensi siswa dalam rangka mencapai tujuan pendidikan nasional. Rumusan masalah penelitian adalah (1). Bagaimanakah penerapan pendekatan komunikatif untuk meningkatkan kemampuan membaca pemahaman pada pembelajaran bahasa indonesia siswa kelas IV SDN Kayoman Purwosari Pasuruan? (2). Apakah penerapan pendekatan komunikatif dapat meningkatkan kemampuan membaca pemahaman pada pembelajaran bahasa indonesia siswa kelas IV SDN Kayoman Purwosari Pasuruan?. Tujuan penelitian ini adalah (a) mendeskripsikan penerapan pendekatan komunikatif untuk meningkatkan kemampuan membaca pemahaman pada siswa kelas IV SDN Kayoman Purwosari Pasuruan. (b) mendeskripsikan kemampuan membaca pemahaman pada siswa kelas IV SDN Kayoman Purwosari Pasuruan setelah menjalani pembelajaran dengan pendekatan komunikatif. Metode yang digunakan adalah pendekatan komunikatif. Penerapan pendekatan komunikatif pada mata pelajaran Bahasa Indonesia di kelas IV SDN Kayoman Purwosari Pasuruan mengacu pada Puji santoso (2006:36-37) bahwa ada 9 langkah dalam pendekatan komunikatif yaitu: (1) menyajikan dialog singkat, untuk memberikan motivasi siswa, (2) pelatihan lisan dialog yang diberikan, siswa kemudian mengulang yang dilisankan guru, (3) Penyajian tanya jawab, (4) penelaah dan pengkajian, (5) penarikan simpulan, (6) aktivitas interpretative, mengarahkan siswa agar dapat menginterpretasikan beberapa dialog yang dilisankan, (7) aktivitas produksi lisan yang dimulai dari aktivitas komunikasi terbimbing sampai dengan aktivitas yang bebas, (8) pemberian tugas, (9) pelaksanaan evaluasi. Hasil penelitian menunjukkan bahwa pelaksanaan tindakan pada pra tindakan rata-rata proses belajar siswa secara klasikal adalah 56,63% dikategorikan cukup, pada siklus I adalah 62%, dan siklus II adalah 79% dikategorikan baik. Sedangkan hasil belajar berdasarkan ketuntasan belajar siswa pada pra tindakan adalah 33%, siklus I adalah 50%, dan siklus II adalah 74%. Dari hasil penelitian ini dapat disimpulkan bahwa penerapan pembelajaran pendekatan komunikatif pada mata pelajaran Bahasa Indonesia dapat meningkatkan hasil belajar siswa kelas IV SDN Kayoman Purwosari Pasuruan. Saran peneliti adalah pendekatan komunikatif pada pembelajaran bahasa Indonesia bisa juga digunakan pada bidang studi yang lain.

Hubungan supervisi akademik yang diperoleh guru dari pengawas dengan kualitas mengajarnya di sekolah dasar negeri se Kecamatan Bangkalan Kabupaten Bangkalan / Ema Ratna Wulandari

 

Kata kunci: supervisi akademik, pengawas sekolah, kualitas mengajar guru Pengawas sekolah adalah salah satu orang yang bertanggung jawab terhadap kondisi belajar mengajar di sekolah hendaknya juga memperhatikan terhadap kemajuan guru dalam mengajar. Pengawas sekolah harus mampu dalam melaksanakan supervisi baik terhadap sekolah secara umum dan kegiatan belajar guru. Supervisi akademik oleh pengawas merupakan bantuan profesional yang berkaitan dengan proses pembelajaran di kelas sehingga dapat membantu guru agar selalu berkualitas dalam kegiatan belajar mengajar setiap hari karena guru adalah orang yang terlibat langsung dengan peserta didik sebagai salah satu output pendidikan yang akan menyukseskan tujuan pendidikan. Tujuan yang hendak dicapai dalam penelitian ini terbagi menjadi tujuan umum dan tujuan khusus. Tujuan umumnya adalah untuk mengetahui tingkat hubungan supervisi akademik yang diperoleh guru dari pengawas dan kualitas mengajarnya. Sedangkan tujuan khususnya adalah untuk: (1) mengetahui tingkat supervisi akademik yang diperoleh guru dari pengawas di SD Negeri se-Kecamatan Bangkalan Kabupaten Bangkalan; (2) mengetahui tingkat kualitas mengajar guru di SD Negeri se-Kecamatan Bangkalan Kabupaten Bangkalan; (3) mengetahui tingkat hubungan supervisi akademik yang diperoleh guru dari pengawas dengan kualitas menyusun perencanaan pembelajaran, (4) mengetahui tingkat hubungan supervisi akademik yang diperoleh guru dari pengawas dengan kualitas dalam melaksanakan pembelajaran, (5) mengetahui tingkat hubungan supervisi akademik yang dilakukan diperoleh guru dari pengawas dengan kualitas dalam evaluasi pembelajaran. Penelitian ini menggunakan rancangan deskriptif korelasional. Populasi penelitian ini yaitu guru SD Negeri se-Kecamatan Bangkalan Kabupaten Bangkalan dengan jumlah 371 orang. Pengambilan sampel dalam penelitian ini menggunakan teknik proportional random sampling dengan jumlah sampel menurut tabel Morgan dan Krejcie ditentukan sebanyak 191 orang guru. Sedangkan instrumen pengumpulan data dalam penelitian ini menggunakan angket. Skala yang digunakan merupakan skala Likert dengan 5 (lima) pilihan jawaban. Data yang terkumpul kemudian dianalisis dengan teknik analisis deskriptif dan teknik korelasi product moment. Untuk menguji kelayakan instrumen yang disusun digunakan uji validitas dan reliabilitas. Analisis data dalam penelitian ini yaitu korelasi product moment dengan menggunakan program SPSS (Statistical Product and Special Services) 16.0 for windows. Hasil analisis data yang diperoleh dalam penelitian ini yaitu rhitung sebesar 0,616 > rtabel 0,141 dengan taraf signifikansi 5% dengan ii probabilitas 0,000 <0,05. Maka dapat disimpulkan bahwa ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dengan kualitas mengajarnya di SD Negeri se-Kecamatan Bangkalan Kabupaten Bangkalan. Selain itu kesimpulan lain yang dapat diambil adalah: (1) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dengan kualitas dalam menyusun perencanaan pembelajaran, (2) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dari pengawas dengan kualitas dalam melaksanakan pembelajaran, (3) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dari pengawas dengan kualitas dalam evaluasi pembelajaran. Kesimpulan yang dapat diambil dalam penelitian ini adalah: (1) supervisi akademik yang diperoleh guru SD Negeri se-Kecamatan Bangkalan Kabupaten Bangkalan dari pengawas termasuk dalam kualifikasi tinggi, (2) kualitas perencanaan pembelajaran yang dilakukan oleh guru SD Negeri di Kecamatan Bangkalan Kabupaten Bangkalan termasuk dalam kualifikasi tinggi, (3) kualitas pelaksanaan pembelajaran yang dilakukan oleh guru SD Negeri di Kecamatan Bangkalan Kabupaten Bangkalan termasuk dalam kualifikasi tinggi, (4) kualitas evaluasi pembelajaran yang dilakukan oleh guru SD Negeri di Kecamatan Bangkalan Kabupaten Bangkalan termasuk dalam kualifikasi tinggi, (5) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dari pengawas dengan kualitas mengajarnya, (6) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dari pengawas dengan kualitas dalam perencanaan pembelajaran, (7) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dari pengawas dengan kualitas dalam melaksanakan pembelajaran, (8) ada hubungan yang signifikan antara supervisi akademik yang diperoleh guru dari pengawas dengan kualitas dalam evaluasi pembelajaran. Berdasarkan hasil penelitian ini, saran yang dapat dikemukakan yaitu: (1) Bagi pengawas SD Negeri di Kecamatan Bangkalan Kabupaten Bangkalan sebaiknya lebih meningkatkan intensitas kegiatan supervisi akademik kepada guru-guru agar kualitas mengajar guru di sekolah juga ikut meningkat; (2) bagi Kepala Sekolah SD Negeri di Kecamatan Bangkalan Kabupaten Bangkalan sebaiknya membantu guru dalam meningkatkan perolehan supervisi akademik dari pengawas serta membantu meningkatkan kualitas mengajar guru dengan memberikan bantuan profesional juga terhadap guru; (3) bagi guru-guru SD Negeri di Kecamatan Bangkalan Kabupaten Bangkalan sebaiknya lebih sering dalam mengikuti kegiatan supervisi akademik oleh pengawas sekolah serta selalu mengikuti perkembangan sistem mengajar yang baik sehingga meningkatkan kualitas mengajarnya dan akan meningkatkan hasil belajar siswa; (4) bagi peneliti lain yang ingin meneliti tentang kualitas mengajar guru sebaiknya menggunakan teknik dan instrumen yang lebih baru sesuai dengan peraturan yang telah ditetapkan sehingga hasil penilaian terhadap guru lebih akurat. iii

Penerapan pendekatan whole language dengan fokus pembelajaran shared reading untuk meningkatkan keterampilan membaca permulaan siswa kelas 1 MI. Ma'arif Nogosari Pandaan / Yamyunah

 

Kata Kunci : Whole Language, Shared Reading, Membaca Permulaan Berdasarkan observasi awal pada tanggal 12 Juli 2010 yang dilakukan pada pembelajaran Bahasa Indonesia di kelas I MI Ma’arif Nogosari Pandaan, ditemukan fakta yaitu guru menggunakan metode ceramah, tidak menggunakan media, guru dan siswa hanya menggunakan buku paket. Pada evaluasi akhir dihasilkan skor rata-rata 64,39. Dari 33 siswa hanya 11 siswa yang lancar membaca, 8 siswa membaca eja, dan 14 siswa belum mampu membaca. Menyikapi permasalahan tersebut, berbagai cara dapat dilakukan, diantaranya penerapan pendekatan whole language dengan fokus pembelajaran shared reading. Pendekatan ini diharapkan dapat menjadi solusi pemecahan masalah yang dihadapi oleh siswa. Tujuan Penelitian ini adalah untuk (1) mendeskripsikan penerapan pendekatan whole language dengan fokus pembelajaran shared reading untuk meningkatkan keterampilan membaca permulaan siswa kelas I di MI Ma’arif Nogosari; (2) mendeskripsikan peningkatan keterampilan membaca permulaan siswa kelas I MI Ma’arif Nogosari melalui pembelajaran shared reading. Penelitian ini menggunakan desain Penelitian Tindakan Kelas yang dilakukan sebanyak dua siklus setiap siklus dua pertemuan Subyek penelitian adalah siswa kelas I di MI Ma’arif Nogosari yang terdiri dari 33 siswa. Adapun teknik pengumpulan data yang digunakan adalah observasi, wawancara, dokumentasi dan tes. Penelitian ini menggunakan instrument pedoman observasi, pedoman wawancara, dokumen, dan soal-soal tes Hasil penelitian menunjukkan bahwa Pembelajaran shared reading pada pembelajaran Bahasa Indonesia di kelas I MI Ma’arif Nogosari sudah sesuai dengan langkah-langkah shared reading. Pembelajaran shared reading pada pembelajaran Bahasa Indonesia di kelas I MI Ma’arif Nogosari sudah dapat dikatakan berhasil dengan adanya peningkatan aktivitas, interaksi, dan hasil belajar siswa. Hal itu ditunjukkan dari hasil analisis rata-rata hasil belajar siswa secara keseluruhan terjadi peningkatan yaitu pada refleksi awal rata-rata hasil belajar siswa 64,39. Pada siklus I rata-rata hasil belajar siswa 76,8 Pada siklus 2 rata-rata hasil belajar siswa 80.4. Hasil tersebut menunjukkan siswa telah mencapai nilai di atas KKM yaitu 70,00. Penelitian ini disarankan kepada:1) guru kelas rendah untuk menerapkan shared reading dalam pembelajaran membaca permulaan; 2) sekolah dan kepala sekolah yang ingin meningkatkan kualitas pembelajaran dan hasil belajar disarankan untuk menerapkan pembelajaran shared reading; 3) Bagi peneliti lanjut disarankan untuk menambah waktu/pertemuan dalam setiap siklus dan lebih kreatif dalam memanfaatkan benda-benda di lingkungan sekitar.

Studi evaluasi operasi asphalt mixing plant pada pelaksanaan proyek pembangunan jalan Widang-Gresik-Surabaya / Kharis Uddin

 

Kata kunci: evaluasi, pengoperasian, AMP Asphalt Mixing Plant (AMP) adalah suatu unit untuk mencampur aspal dengan agregat pada suhu tertentu sehingga menghasilkan campuran aspal yang baik. Tujuan studi lapangan adalah: (1) mengetahui bagaimana pengoperasian AMP pada Pelaksanaan Proyek Pembangunan Jalan Widang-Gresik-Surabaya, (2) mengetahui quality control di AMP sebelum dan sesudah dihampar dilapangan pada Pelaksanaan Proyek Pembangunan Jalan Widang-Gresik-Surabaya. Hasil studi lapangan menyebutkan bahwa: (1) proses pengoperasian AMP pada proyek pembangunan jalan Widang-Gresik-Surabaya meliputi survei, pengecekkan dan kesiapan peralatan dan kesiapan bahan material sebelum proses pencampuran dilaksanakan, (2) agregat yang akan digunakan untuk proses pencampuran harus bersih dan kering dari kotoran dan air, (3) aspal sudah tersedia 25.000-30.000 liter pada penampung aspal dan suhunya berkisar 110º-120º C agar mudah dialirkan ke pencampur aspal, (4) aspal yang keluar dari AMP berkisar 167º C supaya dalam penghamparan dilapangan campuran aspal tidak mengalami penurunan suhu secara drastis, dan (5) campuran aspal diangkut ke lapangan menggunakan dum truck dengan kapasitas 7 ton, pada bagian bak truk dilapisi pelumas supaya aspal tidak melekat pada bak truk, setelah campuran dimuat selanjutnya bak ditutup menggunakan terpal. Berdasarkan hasil studi lapangan ini disarankan: (1) dalam pengecekkan peralatan sebaiknya dilakukan setiap 1 minggu sekali supaya dapat diketahui kelayakan dari semua komponen AMP, dan pada saat AMP akan beroperasi dapat langsung memulainya tanpa menunggu pengecekkan lagi.

Implementasi permainan gobak sodor untuk pencapaian kerjasama tim pada anak kelompok B TK ABA 19 Malang / Anis Istika Rahayu

 

Kata Kunci: kemampuan kerjasama tim, bermain, TK Penelitian ini berlatar belakang pada kurangnya kemampuan kerjasama tim pada anak. Hal ini disebabkan karena kegiatan pembelajaran lebih sering bersifat individual dan jarang memberikan kesempatan kepada anak untuk bekerja bersama dalam suatu kelompok dan mencoba kegiatan baru yang menyenangkan bagi anak. Penelitian ini bertujuan untuk:(1) Mendeskripsikan penerapan aktivitas bermain Gobak Sodor pada anak kelompok B TK ABA 19 Malang. (2) Mendeskripsikan kemampuan kerjasama tim seperti apa yang dapat dicapai di Kelompok B TK ABA 19 Malang melalui permainan Gobak Sodor. Penelitian ini dilakukan di TK ABA 19 Malang, tanggal 26 dan 27 November 2010. Rancangan penelitian yang digunakan adalah penelitian deskriptif kualitatif. Dalam pelaksanannya terdiri dari beberapa tahapan, yaitu perencanaan, pelaksanaan, observasi, dan analisis. Hasil penelitian menunjukkan bahwa penerapan aktivitas bermain Gobak Sodor dapat membantu anak dalam pencapaian kemampuan kerjasama tim. Pada akhir penelitian dapat digambarkan bahwa anak aktif selama permainan berlangsung, anak menunjukkan rasa senang terhadap permainan yang dilakukann dan anak juga menunjukkan semangat kerjasama yang bagus dengan teman. Pencapaian kemampuan kerjasama tim pada anak ditandai dengan minat mereka yang begitu besar terhadap permainan ini. Kesimpulan dari penelitian ini bahwa permainan Gobak Sodor dapat membantu anak daam pencapaian kerjasama tim. Disarankan kepada pendidik untuk menerapkan aktivitas bermain Gobak Sodor pada pembelajaran untuk membantu pencapaian kemampuan kerjasama tim pada anak. Pada pelaksanaan aktivitas bermain Gobak Sodor hendaknya pendidik memperhatikan keamanan dan kenyamanan anak selama kegiatan berlangsung.

Peningkatan pembelajaran penjumlahan bilangan cacah melalui model contextual teaching and learning (CTL) pada siswa kelas III SDN Bendo 1 Kota Blitar / Suin Indriana

 

Kata Kunci : Pembelajaran, Matematika, Model Contextual Teaching and Learning (CTL) Berdasarkan hasil observasi yang peneliti lakukan di kelas III pada waktu pembelajaran Matematika terdapat: (1) guru memberikan soal mencongak tentang penjumlahan, banyak siswa yang mengalami kesalahan yaitu terletak pada nilai tempat, (2) siswa saat pembelajaran ada yang bermain sendiri dengan memutar-mutarkan pensilnya, bermain kertas yang dilipat-lipat jadi perahu , kepala diletakkan di atas meja, (3) guru tidak memberikan penekanan materi yang jelas tentang cara mengerjakan soal penjumlahan, (4) setelah memberikan tugas, siswa ditinggal keluar oleh guru, dan (5) akhir pembelajaran tugas dinilai, hasil belajar yang diperoleh yaitu nilai ≤ 69 ada 17 siswa dan nilai ≥ 70 ada 11 siswa. Ada 17 siswa yang hasil belajarnya di bawah KKM, sehingga mereka belum tuntas. Berdasarkan wawancara peneliti terhadap siswa setelah pembelajaran siswa bingung dan tidak mengerjakan soal, tidak mau menghiraukan lagi didekatipun hanya tersenyum saja. Untuk itu, agar dapat meningkatkan hasil belajar siswa dan tercapainya tujuan pembelajaran perlu diadakan perbaikan pembelajaran dengan model pembelajaran Contextual Teaching and Learning (CTL). Penelitian ini bertujuan untuk:(1)untuk mengetahui dan mendeskripsikan penerapan model Contextual Teaching and Learning (CTL) pada pembelajaran Matematika tentang penjumlahan bilangan cacah di kelas III, (2) untuk mengetahui dan mendeskripsikan peningkatan hasil belajar Matematika tentang penjumlahan bilangan cacah melalui model Contextual Teaching and Learning (CTL) di kelas III. Penelitian ini menggunakan pendekatan deskriptif kualitatif jenis penelitian tindakan kelas dengan model kolaboratif partisipatoris. Subyek penelitian adalah siswa kelas III. Dalam penelitian ini peneliti sebagai guru (pengajar) dan guru kelas (mitra peniliti) sebagai observer. Hasil penelitian menunjukkan bahwa penerapan model Contextual Teaching and Learning (CTL) pada matematika di kelas III sudah sangat baik. Hal ini didukung dengan sudah munculnya semua komponen model Contextual Teaching and Learning (CTL) pada saat pembelajaran berlangsung. Hal ini diikuti dengan adanya peningkatan hasil belajar siswa yang sangat baik.Persentase ketuntasan belajar siswa pada pratindakan adalah 39,28%, pada siklus I adalah 84,6% dan pada siklus II adalah 88,5%. Berdasarkan hasil kesimpulan, disarankan kepada guru kelas III SDN Bendo 1 untuk menggunakan model Contextual Teaching and Learning (CTL) sehingga pembelajaran matematika hasil belajar siswa maksimal.

Hubungan antara kontrol diri dan kecanduan game online pada remaja di Malang / Indah Widarti

 

Kata Kunci : kontrol diri, kecanduan game online Kecanduan game online adalah fenomena yang umum terjadi pada saat ini seiring dengan meningkatnya pengunaan internet. Penelitian ini bertujuan untuk mengetahui: (1) gambaran tingkat kontrol diri, (2) gambaran tingkat kecanduan game online, dan 3) hubungan antara kontrol diri dan kecanduan game online pada remaja di Malang. Desain yang digunakan adalah deskriptif korelasional dengan subyek sebanyak 80 remaja yang bermain game online di warnet, ditentukan dengan cluster sampling. Data kontrol diri dikumpulkan dengan skala kontrol diri (koefisien validitas item antara 0,351 sampai 0,682 dan koefisien relibialitas 0,935), dan data kecanduan game online dikumpulkan dengan skala kecanduan game online (koefisien validitas item antara 0,311 sampai 0,621 dan koefisien reliabilitas item 0,927). Hasil penelitian menunjukkan bahwa terdapat hubungan negatif antara kontrol diri dan kecanduan game online (rxy = - 0,884 sig = 0,000 < 0,05). Artinya, semakin tinggi kontrol diri semakin rendah kecanduan game onlinenya, sebaliknya semakin rendah kontrol dirinya semakin tinggi kecanduan game onlinenya. Hasil analisis deskriptif menunjukkan tingkat kontrol diri remaja sebanyak 20 orang (25%) termasuk tinggi, 56 orang (70%) termasuk sedang, dan 4 orang (5%) termasuk rendah. Sedangkan tingkat kecanduan game online remaja sebanyak 23 orang (28,75%) termasuk sedang dan 57 orang (67,5%) termasuk tinggi. Berdasarkan hasil penelitian ini, dapat disarankan remaja yang bermain game online meningkatkan kontrol diri, melalui teknik self monitoring, self reward dan stimulus control sehinga mampu mengunakan kontrol diri untuk tujuan jangka panjang, dapat menghindari perilaku yang merugikan, dan merubah perilaku tersebut dengan perilaku yang lebih positif. Bagi sekolah adalah dengan memberikan kesempatan kepada siswa untuk menyalurkan bakat dan minat dengan cara mengembangkan dan meningkatkan kegiatan positif di luar jam sekolah misalnya ekstrakulikuler, study tour, PERSAMI dan lain-lain. Bagi pemerintah, hendaknya membuat peraturan tertulis untuk mengurangi kecanduan game online misalnya menerapkan jam malam, mewajibkan meregister identitas dan membatasi waktu bermain game online. Disamping itu mengadakan sosialisasi tentang dampak negatif kecanduan game online melalui media, seminar dan mendirikan tempat rehabilitasi. Bagi peneliti selanjutnya, menambah subyek penelitian dan melakukan penelitian yang lebih komperhensif dengan metode kualitatif.

Peningkatan kemampuan menulis melalui model pakem dengan media audio visual di kelas V SDN Wonorejo 02 Kabupaten Blitar / Dian Ayu Ambarwati

 

Kata Kunci: menulis, pakem, media, audio visual Penggunaan media yang belum maksimal dalam pembelajaran menjadi salah satu faktor kurangnya kemampuan menulis siswa. Guru hanya menggunakan metode ceramah untuk menjelaskan kepada siswa tentang penggunaan ejaan dan kesesuaian karangan, selanjutnya siswa diberi tugas untuk membuat karangan bebas. Setelah pembelajaran ini siswa mengumpulkan hasil kerjanya yang selanjutnya diadakan penilaian oleh guru. Tujuan dari penelitian ini adalah mendeskripsikan penerapan media audio visual dalam upaya meningkatkan kemampuan menulis siswa di kelas V SDN Wonorejo 02 Kabupaten Blitar. Melalui media audio visual diharapkan pembelajaran akan lebih menarik perhatian dan minat belajar siswa, sehingga dapat meningkatkan prestasi dan kemampuan menulis siswa sesuai tujuan model pembelajaran pakem. Pembelajaran menggunakan model pakem dengan media audio visual di kelas V SDN Wonorejo 02 melalui langkah-langkah pembelajaran yang diawali dengan mempersiapkan dan merencanakan materi sebelum diajarkan, selanjutnya membangkitkan kesiapan siswa dalam pembelajaran yang diawali dengan apersepsi, kemudian siswa diajak untuk menyimak media audio visual yang digunakan guru dalam bentuk film anak, langkah berikutnya siswa diajak untuk lebih memahami film yang mereka lihat dengan beberapa pertanyaan yang membangun pemahaman siswa, dan yang terakhir dilakukan evaluasi sebagai hasil belajar yang akan digunakan untuk mengukur kemampuan menulis siswa. Metode penelitian yang digunakan melalui jenis Penelitian Tindakan Kelas dengan dua siklus. Setiap siklus dengan dua kali pertemuan yang masing-masing terdiri dari empat tahap yaitu: perencanaan, pelaksanaan, observasi dan refleksi. Sasaran penelitian ini adalah siswa Kelas V SDN Wonorejo 02 kabupaten Blitar. Data yang diperoleh berupa hasil tes, lembar observasi kegiatan belajar mengajar (aktivitas guru dan siswa di dalam kegiatan pembelajaran), wawancara, dan dokumentasi. Berdasarkan hasil penelitian yang telah dilaksanakan, maka diperoleh peningkatan kemampuan menulis siswa di kelas V dari sebelum siklus adalah 57,83 mengalami peningkatan pada siklus I menjadi 68,53, siklus II dengan nilai rata-rata 75,56. Kesimpulan dari penelitian ini berdasarkan paparan data bahwa penggunaan media audio visual dapat meningkatkan aktivitas dalam belajar dan kemampuan menulis siswa.

A proposed English course syllabus for economics education department State University of Islamic Studies (IAIN) Mataram / Titik Agustina

 

Key words: ESP courses, syllabus, syllabus development, economics education Developing a syllabus to second and foreign language teaching is inevitable especially in the context of ESP wherein student’ needs for learning English should be taken into fundamental consideration of the development. This paper critically proposes a syllabus to the teaching of English at Economics Education Department of IAIN Mataram. It is a syllabus developed on the basis of student’ needs and through a systematic procedure called Yalden’ Model with some modifications. The syllabus is the combination of theme-and-competency based that focuses the instruction on language use and function, particularly of those used to comprehend and to learn subject contents in the fields of education and economics education, in which the skill of using language and its communicative functions to explore the contents underlie the objective. The proposed syllabus is projected to fulfill the student’ needs and it decisively serves as a means of overcoming the main problem of English instruction at the Department, that is the absence of syllabus that hinge on the students’ needs for learning English.

Studi kasus penyesuaian sosial pada pasien yang mengalami depresi pasca stroke / Nancy Margaretha Simanjuntak

 

Kata kunci : penyesuaian sosial, depresi pasca stroke Depresi pasca stroke merupakan salah satu masalah utama pasca stroke, dengan dimensi biologis dan psikososial yang kompleks. Terdapat sejumlah faktor yang menimbulkan depresi pasca stroke, salah satunya adalah aspek psikosial berupa penyesuaian terkait pasca stroke. Penderita stroke yang mengalami depresi pasca stroke mengalami kesulitan dalam penyesuaian di dalam keluarga maupun lingkungan sosialnya. Hal ini terjadi karena keterbatasan mereka akibat stroke yang diderita sehingga mereka tidak dapat beraktivitas seperti sebelum terkena stroke. Tujuan dari penelitian ini adalah: (1) Untuk mengetahui penyesuaian sosial pasien sebelum terkena stroke, (2) Untuk mengetahui keadaan pasien yang mengalami depresi pasca stroke; (3) Untuk mengetahui penyesuaian sosial pasien yang mengalami depresi pasca stoke. Jenis pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif dengan model penelitian studi kasus. Berdasarkan kriteria yang sesuai dengan tujuan penelitian, dipilih tiga subyek untuk menjadi subyek penelitian. Adapun metode pengumpulan data yang digunakan adalah: (1) wawancara mendalam, (2) Observasi. Data yang diperoleh kemudian dianalisis menggunakan analis tematik.Teknik pengecekan keabsahan data yang digunakan adalah: (1) Ketekunan pengamatan,(2) Triangulasi sumber, (3) Kecukupan Refrensial. Hasil penelitian yang diperoleh adalah: (1) Penyesuaian sosial pasien sebelum terkena stroke yaitu dapat berperilaku secara sosial dan dapat memainkan peran di dalam kehidupan sosialnya; (2) Keadaan pasien yang mengalami depresi pasca stroke yaitu: subyek mengalami penurunan minat dalam hampir semua aktivitas yang biasa dilakukan sebelum terkena stroke, subyek penelitian mengalami penurunan berat badan karena nafsu makan yang berkurang, subyek penelitian mengalami gangguan tidur insomnia, subyek penelitian mengalami respon yang lambat (agitasi), subyek penelitian mengalami rasa lelah yang berlebihan serta berkurangnya kemampuan untuk berkonsentrasi atau berpikir jernih; (3) Penyesuaian sosial pada pasien yang mengalami depresi pasca stroke yaitu ketiga subyek mengalami hambatan untuk berperilaku sosial dan untuk menjalankan perannya karena beberapa faktor penghambat yaitu keterbatasan fisik pasca stroke (gerak motorik yang lambat serta penurunan kemampuan berkomunikasi), faktor psikologis subyek serta faktor lingkungan subyek. Berdasarkan hasil penelitian yang telah dilakukan disarankan: (1) Pasien yang mengalami depresi pasca stroke dapat menerima kondisi dirinya secara utuh sehingga dapat berperilaku dan menjalankan perannya dalam masyarakat; (2) Keluarga dapat mendukung dan memotivasi pasien agar dapat melakukan penyesuaian sosial; (3) Bagi peneliti selanjutnya agar menambah jumlah subyek dengan kondisi dampak dan lingkungan pasien stroke yang berbeda sehingga diperoleh data yang lebih bervariasi.

Evaluasi kapasitas tempat parkir kendaraan roda empat di kampus Universitas Negeri Malang (UM) / Diyan Trisno Susilo

 

Kata kunci: kapasitas parkir, kendaraan roda empat. Adanya peningkatan jumlah mahasiswa baru maka jumlah mahasiswa yang membawa kendaraan bermotor khususnya kendaraan roda empat juga akan ikut bertambah. Dengan adanya hal tersebut maka permintaan akan tempat parkir kendaraan roda empat juga akan ikut meningkat. Selain dipengaruhi oleh penambahan jumlah mahasiswa permintaan tempat parkir di kampus Universitas Negeri Malang (UM) juga dipengaruhi oleh bertambahnya kepemilikan kendaraan roda empat bagi dosen dan karyawan. Penelitian ini dilakukan dengan tujuan untuk mengetahui kemampuan kapasitas tempat parkir kendaraan roda empat yang tersedia di kampus UM saat ini terhadap nilai akumulasi maksimum kendaraan roda empat yang masuk ke kampus UM, mengetahui karakteristik parkir, dan mengetahui karakteristik pengguna parkir. Karaktersitik parkir yang diteliti meliputi volume parkir, akumulasi parkir, durasi parkir, parking turnover, dan indeks parkir. Pengambilan data yang diterapkan dalam penelitian ini adalah dengan mencatat plat nomor kendaraan roda empat yang masuk kampus UM, yang masuk area off street parking yang ada di kampus UM, yang keluar dari kampus UM, yang keluar dari area off street parking yang ada di UM, dan menyebarkan kuesioner bagi para pengguna area off street parking yang ada di kampus UM. Lama penelitian adalah tiga hari yaitu hari Senin, Selasa, dan Kamis pada tanggal 4, 5, dan 7 Oktober 2010 mulai pukul 06.00–16.00 WIB. Berdasarkan penelitian didapatkan kesimpulan bahwa jumlah total kapasitas tempat parkir yang tersedia di kampus UM saat ini adalah 403 Satuan Ruang Parkir (SRP). Akumulasi maksimum pada lokasi kampus UM (4 pintu gerbang) terjadi pada hari Kamis sebanyak 407 kendaraan. Akumulasi maksimum pada tempat parkir sebelah Barat LEPPA terjadi pada hari Senin, 04 Oktober 2010 sebesar 24 kendaraan dengan indeks parkir sebesar 141,18%. Untuk parking turnover rata-rata sebesar 2,35 kendaraan/petak parkir. Karakteristik pengguna parkir didapatkan bahwa berdasarkan asal perjalanan paling banyak berasal dari rumah sebesar 89,61% dan jarak dari tempat tinggal < 2 km sebesar 6,49%, 2-4 km sebesar 22,73%, 5-7 km sebesar 30,52%, 8-10 km sebesar 19,48%, dan > 10 km sebesar 18,83%. Berdasarkan jumlah penumpang paling banyak berkendara sendiri sebesar 54,55% dan berdasarkan pekerjaan paling banyak berprofesi sebagai dosen sebesar 49,35% maksud perjalanan 41,56% mengajar. Berdasarkan penelitian yang telah dilakukan, dapat disarankan: (1) bagi pengelola parkir UM harus segera melakukan manajemen perparkiran, (2) agar dilakukan pengkajian ulang mengenai penerapan tarif parkir untuk kendaraan roda empat, dan (3) agar dilakukan penelitian lanjutan untuk mengantisipasi peningkatan kebutuhan parkir pada masa yang akan datang.

The effectiveness of literature circles on students' reading comprehension / Neng Syifa Masnoneh

 

Key words: effectiveness, literature circles, reading comprehension The research was conducted into the effectiveness of literature circles on students’ reading comprehension. The research problem is “Do the students who are taught using literature circles achieve significantly higher reading comprehension than those who are taught using conventional teaching reading activity?”As a tentative answer, the research hypothesis is “The students who are taught using literature circles achieve significantly higher reading comprehension than those who are taught using conventional teaching reading activity”. To answer the question, a quasi experimental research was conducted using nonrandomized control group pretest-posttest design involving two variables. Teaching strategies were the independent variable, and the dependent variable was the students’ reading comprehension. The samples were taken from the population of the second semester students of PAI (Pendidikan Agama Islam/ Islamic Studies) STAI (Sekolah Tinggi Agama Islam/ College for Islamic Studies) Daarussalaam in the academic year 2009/2010. There were three classes (class A: 23 students, B: 23 students, and C: 22 students). To choose the experimental and control group, the researcher used simple sampling technique, by which class A (23 students) was assigned to experimental group while class B (23 students) was assigned to control group. The instrument of data collection was a multiple choice test consisting of 30 items used in pretest and posttest. The pretest means were analyzed statistically to see the equivalence of the experimental and control group before the experiment. An independent t-test analysis of the difference between the pretest means yielded a t of 0.33. This was not significant at the level of significance of .05 one-tailed (with df 44). The t-value was lower than the critical value (1.678). This indicates that there is not a significant difference between the experiment and control group on their pretest. Therefore, an independent t-test was used to analyze the posttest means. Based on the statistical computation using an independent t-test, the t-value for the posttest means were 3.11. This was significant at the level of significance of .05 one-tailed (with df 44). The t-value was higher than the critical value (1.678). Therefore, Ho was rejected. It is concluded that literature circles is effective. Based on the findings, recommendations are addressed to English teachers/ instructors and future researchers. English teachers/ instructors should consider utilizing literature circles due to the benefits of the strategy. For future researchers, it is suggested to conduct more sophisticated research on the same topic.

Meningkatkan kemampuan berpikir logis dan sikap positif siswa terhadap matematika melalui realistic mathematics education (RME) pada materi aritmatika sosial siswa kelas VII MTs Surya Buana Malang / Anas Malik

 

Kata kunci: Berpikir Logis, Sikap Positif, Realistic Mathematics Education (RME), Aritmatika Sosial. Pembelajaran merupakan proses komunikasi, agar pelaksanaannya berjalan efektif diperlukan alat bantu serta penggunaan metode tertentu yang lebih variatif. Idealnya dalam pembelajaran matematika, guru hendaknya menggunakan metode tertentu agar proses belajar dan kemampuan berpikir logis dan sikap positif siswa terhadap matematika lebih optimal. Berdasarkan hasil wawancara dan observasi terhadap guru matematika di MTs Surya Buana Malang, diperoleh fakta bahwa sebagian besar guru belum menggunakan metode pembelajaran yang memadahi dan menerapkan metode-metode yang memotivasi siswa untuk belajar. Proses pembelajaran yang dilakukan guru selama ini hanya mentransfer pengetahuan melalui buku-buku dengan cara mencatat dan menerangkan. Pembelajaran yang dilakukan guru belum diupayakan berpusat pada siswa. Mencermati berbagai permasalahan tersebut, penelitian tentang meningkatkan kemampuan berpikir logis dan sikap positif siswa terhadap matematika melalui Realistic Mathematics Education (RME) penting untuk dilakukan. Penelitian dilaksanakan sejak bulan Oktober sampai Desember 2008 kelas VIIB di MTs Surya Buana Malang . Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam 2 siklus dengan desain mengacu pada model Kemmis dan Taggart yang meliputi: tahap perencanaan, pelaksanaan tindakan, observasi/evaluasi dan refleksi. Penelitian ini bertujuan untuk meningkatkan kemampuan berpikir logis dan sikap positif siswa terhadap matematika melalui Realistic Mathematics Education (RME) pada materi Aritmatika Sosial. Untuk mengetahui proses tersebut dilakukan pengamatan terhadap sintaks pembelajaran oleh guru dan siswa, sedangkan kemampuan berpikir logis siswa terhadap matematika diketahui melalui kemampuan kognitif siswa selama proses pembelajaran berlangsung. Selain itu, untuk mengetahui sikap positif dan persepsi siswa terhadap proses pembelajaran melalui Realistic Mathematics Education (RME) digunakan tes skala sikap dan angket persepsi. Adapun model Realistic Mathematics Education (RME) yang diterapkan dalam penelitian ini menggunakan langkah-langkah berikut ini. Pertama, Pendahuluan (Kegiatan Awal), meliputi (a) Pra Kegiatan; (b) Apersepsi; (c) Informasi materi dan informasi tujuan; dan Kedua Keadaan Pelaksanaan (Kegiatan inti), mencakup: (1) Penjelasan singkat tentang cara kerja; (2) Pembentukan kelompok/ Kerja individu; (3) Pemberian media pemecahan masalah termasuk LKS; (4) Siswa bekerja dalam kelompok secara berdiskusi sesuai dengan masalah yang harus diselesaikan; dan (5) Berdiskusi dan presentasi kelompok, Ketiga, Penutup (Kegiatan Akhir), mencakup: (a) Pembahasan hasil; (b) Simpulan; (c) Evaluasi; dan (d) refleksi dan pemberian tindak lanjut. Hasil penelitian tentang meningkatkan kemampuan berpikir logis dan sikap positif siswa terhadap matematika melalui Realistic Mathematics Education (RME) dapat meningkatkan proses pembelajaran dari siklus I sebesar 83,3% menjadi 94,3% pada siklus II. Hal ini terjadi karena guru dalam melaksanakan kegiatan pembelajaran mengacu pada sintaks yang telah ditetapkan dalam program, demikian pula siswa dalam melaksanakan kegiatan pembelajaran mengikuti pola yang telah ditetapkan oleh guru. Peningkatan juga terjadi pada kemampuan kognitif subjek penelitian, pada siklus I nilai rata-rata 75,63 meningkat menjadi 84,00 pada siklus II. Hasil tes skala sikap siswa terhadap Realistic Mathematics Education (RME) secara klasikal juga meningkat, dari siklus I sebesar 67,17% menjadi 82,75% pada siklus II. Hasil tersebut menunjukkan bahwa pembelajaran yang dilakukan guru dengan Realistic Mathematics Education (RME) dapat menciptakan kondisi pembelajaran kondusif. Ketertarikan siswa dalam pembelajaran tersebut dapat dilihat dari hasil angket persepsi yang menunjukkan bahwa sejak awal siklus siswa memiliki persepsi positif terhadap Realistic Mathematics Education (RME). Hasil tes skala sikap siswa terhadap matematika juga meningkat dari hasil tes awal sebesar 7,00% sangat positif menjadi 40% sangat positif. Hal ini menunjukkan bahwa dengan dilakukannya Realistic Mathematics Education (RME) sikap siswa terhadap matematika meningkat sangat positif. Kesimpulan yang diperoleh dari penelitian tindakan ini adalah Realistic Mathematics Education (RME) dapat meningkatkan : 1) proses pembelajaran, 2) kemampuan berpikir logis siswa tehadap matematika, 3) persepsi positif bagi siswa, 4) sikap positif siswa tehadap matematika. Dengan demikian disarankan agar pembelajaran materi Aritmatika Sosial dilakukan oleh guru hendaknya menerapkan Realistic Mathematics Education (RME), agar pembelajaran berjalan dengan kondusif.

Improving the speaking skill through sound-consciousness-raising activities and question-answer technique / Martin Surya Putra

 

Kata Kunci: Berbicara, Penyadaran Bunyi , Teknik Tanya-Jawab Penelitian ini bertujuan meningkatkan kemampuan berbicara mahasiswa D-3 Jurusan Administrasi Bisnis Politeknik Negeri Samarinda melalui kegiatan penyadaran sistem bunyi dan Teknik Tanya-Jawab. Kedua strategi ini dipilih karena memberikan model, konsep, latihan dan kegiatan yang diperlukan dalam berkomunikasi menggunakan bahasa kedua. Masalah penelitian adalah bagaimana kegiatan penyadaran sistem bunyi dan Teknik Tanya-Jawab dapat diimplementasikan guna meningkatkan kemampuan berbicara mahasiswa D-3 Jurusan Administrasi Bisnis Politeknik Negeri Samarinda. Karena disain penelitian ini adalah tindakan kelas, maka koloborator dan peneliti bekerja sama merancang rencana pembelajaran, melakukan observasi dan membuat refleksi. Karena dilakukan dalam proses siklus, maka penelitian ini bertolak dari perencanaan tindakan, pelaksanaan tindakan, observasi dan refleksi. Ada dua jenis data: kualitatif dan kuantitatif. Kualitatif diperoleh dari formulir observasi dan panduan wawancara, sementara kuantitatif diperoleh dari hasil penilaian kinerja. Hasil penelitian mengungkapkan bahwa pengimplementasian kegiatan dan teknik yang digunakan mampu meningkatkan kemampuan berbicara mahasiwa tercermin dari nilai rata-rata pengucapan dari 55.03, 65.52 dan 70.85 sedangkan nilai rata-rata keterampilan berbicara dari 56.18, 66.82 dan 71.91 dalam dua siklus.Ada beberapa prosedur yang digunakan hingga mampu meningkatkan ucapan dan keterampilan berbicara seperti model pengucapan, latihan pengucapan, pengumpanan membuat kalimat, latihan terkendali dan latihan bebas. Disamping itu, proses belajar mengajar berjalan cukup berhasil dengan bantuan topik-topik kehidupan nyata yang diumpan kepada mahasiswa, penyajian berbagai penggunaan bentuk waktu, pemberian instruksi yang jelas, penjelasan kata-kata asing, pendemonstrasian makna kata dalam konteks, penyajian inti percakapan fungsional untuk topik komunikasi tertentu, pengajaran pola intonasi naik dan turun dan pengajaran kata-kata pelengkap agar dapat menghasilkan percakapan Dari hasil temuan dapat disimpulkan bahwa kegiatan penyadaran sistem bunyi dan Teknik Tanya-Jawab tidak hanya efektif dalam meningkatkan kemampuan berbicara mahasiwa, namun juga dalam memotivasi mereka belajar bahasa kedua selama proses belajar mengajar di kelas. Sehingga disarankan agar para guru bahasa Inggris menerapkan kegiatan penyadaran sistem bunyi dan Teknik Tanya-Jawab dalam pengajaran bahasa Inggris karena bermanfaat dalam meningkatkan kemampuan berbicara serta dapat memotivasi mahasiswa menggunakan lebih banyak bahasa kedua dari pada harus terperangkap menggunakan bahasa ibu.

Peningkatan hasil belajar IPS melalui pendekatan inkuiri (inquiry approach) siswa kelas V SDN Sumberdiren 02 Kecamatan Garum Kabupaten Blitar / Alfiana

 

Kata Kunci : Hasil Belajar, IPS, Pendekatan Inkuiri Berdasarkan hasil observasi yang peneliti lakukan di kelas V pada waktu pembelajaran IPS adalah: (1) didominasi oleh metode ceramah (preaching method), (2) pembelajaran kurang bermakna, (3) pembelajaran terpusat kepada aktivitas guru, (4) siswa kurang aktif dalam pembelajaran, (5) siswa jarang sekali bertanya, (6) siswa kurang mengungkapkan gagasannya, (7) suasana pembelajaran kurang menyenangkan. Berdasarkan alasan tersebut, peneliti mengadakan kerjasama dengan SDN Sumberdiren 02 Kecamatan Garum Kabupaten Blitar untuk mengadakan perbaikan pembelajaran IPS dengan penerapan pendekatan inkuiri. Penelitian ini bertujuan untuk: (1) mendeskripsikan pembelajaran IPS melalui pendekatan inkuiri (inquiry approach) pada siswa kelas V SDN Sumberdiren 02 Kecamatan Garum Kabupaten Blitar, (2) mendeskripsikan peningkatan hasil belajar IPS siswa kelas V SDN Sumberdiren 02 setelah dilakukan pembelajaran dengan pendekatan inkuiri (inquiry approach). Metode penelitian yang digunakan adalah pendekatan deskriptif kualitatif jenis penelitian tindakan kelas dengan model kolaboratif partisipatoris. Subyek penelitian adalah siswa kelas V. Dalam penelitian ini peneliti sebagai guru (pengajar) dan guru kelas (mitra peniliti) sebagai observer. Hasil penelitian menunjukkan bahwa penerapan pendekatan inkuiri pada mata pelajaran IPS di kelas V sudah sangat baik. Hal ini didukung dengan sudah munculnya semua aspek dalam setiap tahapan pendekatan inkuiri pada saat pembelajaran berlangsung. Penilaian aktivitas guru dalam kegiatan pembelajaran pada siklus I sebesar 87,78% dan pada siklus II sebesar 96,67% atau mengalami peningkatan sebesar 8,89%. Penilaian aktivitas siswa dalam kegiatan pembelajaran pada siklus I sebesar 85,56% dan pada siklus II sebesar 95,56% atau mengalami peningkatan sebesar 10,00%. Hal itu juga diikuti dengan adanya peningkatan hasil belajar siswa yang sangat baik pula. Persentase ketuntasan belajar pada pra tindakan ke siklus I mengalami peningkatan sebesar 45,83% atau dari 41,67% (10 siswa tuntas belajar) menjadi 87,50% (21 siswa tuntas belajar). Persentase ketuntasan belajar pada siklus I ke siklus II mengalami peningkatan sebesar 8,30% atau dari 87,50% (21 siswa tuntas belajar) menjadi 95,80% (23 siswa tuntas belajar). Berdasarkan paparan data di atas dapat disimpulkan bahwa penerapan pendekatan inkuiri dapat meningkatkan kwalitas kegiatan belajar siswa dan dapat meningkatkan hasil belajar dalam pembelajaran IPS siswa kelas V SDN Sumberdiren 02 Kecamatan Garum Kabupaten Blitar.

Peningkatan aktifitas dan hasil belajar siswa kelas IV pada mata pelajaran IPS melalui pendekatan sains teknologi masyarakat (STM) di SDN Sladi Kabupaten Pasuruan / Mukhamad Sukron

 

Kata Kunci: Pendekatan Sains Teknologi Masyarakat, Hasil Belajar, IPS SD. Bedasarkan pengamatan dilapangan, kurang berhasilnya pembelajaran IPS disebabkan guru kurang melibatkan siswa dalam proses belajar mengajar, guru hanya terpaku pada buku teks tanpa menggunakan alat peraga dan model pembelajaran yang mendorong siswa untuk aktif dalam proses belajar mengajar. Terbukti dari hasil tes evaluasi yang dilakukan, diperoleh rata-rata nilai kelas 58,89, dari hasil ini ada 11 siswa dinyatakan belum tuntas dan 7 siswa yang dinyatakan tuntas dengan mengacu pada SKBM yang ada di SDN Sladi yaitu 70.. Tujuan penelitian ini yaitu untuk : (1) mendiskripsikan penerapan pendekatan Sains Teknologi Masyarakat (STM) pada mata pelajaran IPS Kelas IV di SDN Sladi Kecamatan Kejayan Kabupaten Pasuruan, (2) mengetahui sejauh mana peningkatan aktifitas siswa dalam proses pembelajaran IPS setelah menerapkan pendekatan Sains Teknologi Masyarakat (STM) pada siswa Kelas IV di SDN Sladi Kecamatan Kejayan Kabupaten Pasuruan, (3) mengetahui sejauh mana peningkatan hasil belajar IPS setelah menerapkan pendekatan Sains Teknolgi Masyarakat (STM) pada siswa Kelas IV di SDN Sladi Kecamatan Kejayan Kabupaten Pasuruan. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan Deskriptif Kualitatif, yaitu penelitian yang menguraikan keadaan mutu/kwalitas sesuatu dengan apa adanya. Sedangkan jenis penelitian ini adalah penelitian tindakan kelas (PTK) langkah-langkahnya diadopsi dari model Suharsimi Arikunto. Subyek penelitian ini adalah siswa kelas IV SDN Sladi Kejayan Pasuruan sebanyak 18 siswa. Teknik pengumpulan data menggunakan lembar observasi, dokumentasi, dan test. Hasil penelitian ini menunjukkan bahwa penerapan pendekatan Sains Teknologi Masyarakat dapat meningkatkan pembelajaran IPS kelas IV SDN Sladi. Hal ini terjadi karena guru telah menerapkan pendekatan Sains Teknologi Masyarakat (STM) sesuai dengan tahap-tahap implementasi pendekatan Sains Teknologi Masyarakat (STM). Untuk aktifitas siswa pada siklus I menunjukkan nilai (73,33) sedangkan pada siklus II meningkat menjadi (76,11). Nilai rata-rata hasil belajar siswa meningkat mulai dari sebelum dilakukannya tindakan (58,89), dilakunnya tindakan pada siklus I (75,0), selanjutnya tindakan pada siklus II (78,89) Berdasarkan hasil penelitian disarankan: (1) Guru dapat menerapkan pendekatan Sains Teknologi Masyarakat (STM) dalam pembelajaran bidang studi lain dalam matei yang sesuai, agar mendapatkan hasil yang maksimal. (2) Peneliti lainnya agar dapat mengembangkan penelitian ini disekolah atau tempat yang lain agar mendapatkan temuan yang lebih komperhensif.

Perbedaan kemampuan bercerita antara sebelum dan sesudah pembelajaran dengan metode bercerita berbantuan media "big book" anak kelas B se gugus I Sumber Pucung-Malang / Erlin Isnaning Lina

 

Kata Kunci: Perbedaan bercerita, sebelum sesudah,“Big Book” Bercerita dalam kegiatan pengajaran pada anak Taman Kanak-kanak mempunyai beberapa manfaat penting bagi pencapaian tujuan pendidikan di TK . Sebelum menggunakan media Big Book sejauh ini kemampuan bercerita anak sangat rendah, sehingga anak kurang termotivasi untuk melakukan kegiatan bercerita. Sampel penelitian ini adalah TK Se Gugus I Sumberpucung, dengan jumlah sampel 200 siswa dengan jumlah keseluruhan TK 10, masing-masing dari keseluruhan TK B dalam satu kelasnya 20 siswa, yang diambil dalam satu gugus I Sumberpucung adalah TK Inti dan TK imbas yaitu TK inti ABA I Sumberpucung dan TK imbasnya TK Al-Ikhlas Karangkates Kabupaten Malang. Jumlah dari keseluruhan sampel yang di ambil dari masing-masing TK inti ABA 1 kelas B berjumlah 20 siswa dan TK Imbas Al-Ikhlas kelas B berjumlah 20 siswa. Sedangkan jumlah sampel dari keseluruhan TK Inti dan TK Imbas adalah 40 siswa dalam 2 kelas, pengambilan sampel dengan cara randem. Data yang terkumpul menggunakan (1) Observasi dan tes; (2) Instrumen penelitian, bentuk tes berupa tes lisan dan instrument pendukung berupa pedoman observasi yang berbentuk checklist, berbentuk daftar kegiatan yang diamati. Dari hasil analisa nilai rata-rata keseluruhan yang diperoleh sebelum menggunakan Big Book (Pre-test) sebesar 10,65, sedangkan nilai rata-rata setelah menggunakan Big Book (Post-test) adalah sebesar 14,17 sehingga meningkat 3,52. Hal ini dapat diketahui bahwa dengan metode bercerita berbantuan media Big Book memberikan peningkatan bagi siswa ABA I dan TK Al-Ikhlas dalam pembelajaran bercerita. Hasil analisis uji beda menunujukkan bahwa ada perbedaan hasil belajar yang signifikan antara sebelum dan sesudah pembelajaran berbantuan media “Big Book” di TK se gugus I Sumberpucung-Malang.

Hubungan antara self esteem dan perilaku agresif siswa SMA Yayasan Pendidikan Kotamadya Blitar / Triyuni Trisna Watiningsih

 

Kata Kunci : self esteem, perilaku agresif Dalam dunia pendidikan, self esteem adalah kunci utama untuk mencapai sukses dalam kehidupan. Penghargaan terhadap diri sendiri secara positif sangat penting bagi kebahagiaan dan keberhasilan anak dan remaja, terutama saat yang bersangkutan menempuh ilmu pada lembaga pendidikan. Self esteem adalah evaluasi yang dilakukan oleh individu yang mengandung adanya penghargaan terhadap dirinya sendiri, mengekspresikan sikap menyukai atau tidak menyukai, dan mengindikasikan apakah individu mempercayai bahwa dirinya mampu, signifikan, atau berarti, sukses, dan berharga. Self esteem seseorang akan tercermin pada perilakunya. Self esteem positif akan tercermin dari perilaku individu yang positif pula. Sehingga, adanya perilaku agresif yang merupakan perilaku negatif dapat terkontrol atau dapat diminimalkan kemunculannya. Penelitian ini bertujuan untuk: (1) memperoleh gambaran deskriptif mengenai tingkat self esteem pada siswa (2) memperoleh gambaran deskriptif mengenai tingkat perilaku agresif pada siswa, dan (3) memperoleh gambaran deskriptif mengenai hubungan self esteem dan perilaku agresif siswa. Rancangan penelitian ini adalah deskriptif korelasional. Penelitian ini menggunakan teknik penarikan sampel proportional random sampling dengan jumlah sampel 58 siswa. Instrumen yang digunakan adalah kuesioner. Analisis data menggunakan dua cara, yaitu data dianalisis dengan teknik persentase dan uji korelasi product moment. Hasil penelitian menunjukkan sebagai berikut: (1) Sebanyak 56,90% siswa SMA Yayasan Pendidikan Kotamadya Blitar memiliki self esteem yang tinggi. (2) Sebanyak 56,90% siswa SMA Yayasan Pendidikan Kotamadya Blitar memiliki perilaku agresif yang rendah. (3) Ada hubungan negatif yang signifikan antara self esteem dan perilaku agresif siswa SMA Yayasan Pendidikan Kotamadya Blitar. Berdasarkan hasil penelitian ini, maka saran yang dapat diberikan pada: (1) Konselor sekolah adalah hendaknya memprogramkan bimbingan kelompok kepada siswa yang sudah memliki self esteem tinggi, memprogramkan konseling kelompok dan diberikan kepada siswa yang memiliki self esteem rendah dengan tema peningkatan harga diri. (2) Guru hendaknya dapat memberikan kesempatan kepada siswa untuk unjuk diri, memberikan reinforcment kepada siswa yang mempunyai kelebihan pada mata pelajaran tertentu. (3) Bagi peneliti selanjutnya yang tertarik untuk melakukan penelitian lanjutan mengenai hubungan self esteem dan perilaku agresif, hendaknya memperluas populasi penelitian supaya dapat menggeneralisasikan yang lebih luas.

Penerapan manajemen berbasis sekolah di SD Negeri Rejosalam 2 Kecamatan Pasrepan Kabupaten Pasuruan / Muhamad Hasan

 

Kata kunci : Manajemen Berbasis Sekolah. Perubahan paradigma penyelenggaraan pendidikan di Indonesia dari sentralistik menjadi desentralistik, sehingga sekolah-sekolah memperoleh hak otonomi untuk mengelola sumber-sumber daya pendidikan yang dimilikinya, akan tetapi pada kenyataannya masih banyak sekolah yang belum memahami bagaimana cara menyelenggarakan pendidikan yang lebih baik, bermutu, dan lebih memadai. Penelitian ini bertujuan mengetahui penerapan Manajemen Berbasis Sekolah, kendala selama menerapkan Manajemen Berbasis Sekolah dan upaya yang dilakukan untuk mengatasi kendala tersebut, serta untuk mengetahui prestasi sekolah yang telah dicapai selama pelaksanaan Manajemen Berbasis Sekolah. Penelitian ini dilakukan di SD Negeri Rejosalam 2 Kecamatan Pasrepan Kabupaten Pasuruan. Rancangan penelitian yang digunakan adalah pendekatan kualitatif metode studi kasus. Analisis hasil penelitian yang dipakai adalah analisis secara induktif, yaitu dimulai dari lapangan atau fakta empiris dengan terjun ke lapangan, mempelajari, menganalisis, menafsir dan menarik kesimpulan dari fenomena yang ada di lapangan. Hasil penelitian ini menunjukkan bahwa penerapan Manajemen Berbasis Sekolah dapat berlangsung secara efektif dengan didukung oleh sumber daya manusia yang profesional untuk mengoperasikan sekolah, dana yang cukup dimiliki sekolah untuk menggaji staf sesuai dengan fungsinya, sarana dan prasarana yang mendukung proses belajar mengajar, serta dukungan masyarakat (orang tua) yang tinggi. Dari hasil yang ada dapat disimpulkan bahwa SDN Rejoasalam 2 sudah menerapkan MBS meskipun masih belum optimal, kendala-kendala yang ada sudah dapat diatasi dan prestasi SDN Rejoasalam 2 sudah ada yang ditingkat kabupaten. Berdasarkan hasil penelitian ini, dapat disarankan agar semua warga sekolah, orang tua, dan masyarakat memiliki rasa tanggung jawab dalam penerapan manajemen berbasis sekolah sehingga prestasi belajar anak didik akan ikut meningkat sesuai dengan apa yang diharapkan.

Peningkatan hasil belajar operasi hitung bilangan cacah melalui pembelajaran realistic mathematic education (RME) pada siswa kelas III di SDN Tuliskriyo 01 Kabupaten Blitar / Maria Susilawati

 

Kata Kunci : Hasil Belajar, Bilangan Cacah, RME Berdasarkan hasil observasi yang peneliti lakukan di kelas III pada waktu pembelajaran Matematika adalah sebagai berikut: (1) proses belajar mengajar masih berpusat pada guru sehingga siswa kurang aktif dan kreatif dalam menemukan sendiri konsep, (2) penjelasan guru kurang dapat dipahami siswa dengan baik, (3) siswa yang ramai di dalam kelas cukup banyak, (4) dalam pembelajaran guru hanya menggunakan metode ceramah dan pemberian tugas, dan (5) siswa kurang terampil mengerjakan operasi hitung bilangan cacah. Berdasarkan pengalaman yang dilakukan terhadap proses pembelajaran Matematika yang berlangsung diperoleh hasil yang kurang memuaskan, yaitu dari 15siswa hanya 4 siswa saja yang nilainya dapat mencapai KKM (kriteria ketuntasan minimal) atau ≥ 60, sedangkan 11 siswa lainnya masih belum dapat mencapai KKM atau < 60. Untuk itu agar dapat meningkatkan hasil belajar siswa dan tercapainya tujuan pembelajaran perlu diadakan perbaikan pembelajaran dengan menerapkan pembelajaran Realistic Mathematic Education (RME). Rumusan masalah penelitian ini: (1) Bagaimana penerapan pembelajaran Realistic Mathematic Education (RME) tentang operasi hitung bilangan cacah pada siswa kelas III di SDN Tuliskriyo 01 Kabupaten Blitar? (2) Apakah ada peningkatan hasil belajar operasi hitung bilangan cacah melalui pembelajaran Realistic Mathematic Education (RME) pada siswa kelas III di SDN Tuliskriyo 01 Kabupaten Blitar? Penelitian ini menggunakan jenis penelitian tindakan kelas (PTK). Subyek penelitian adalah siswa kelas III. Dalam penelitian ini peneliti sebagai guru (pengajar), guru kelas (mitra peniliti) sebagai observer, dan rekan mahasiswa sebagai pengambil foto dalam proses pembelajaran perkalian bilangan cacah. Hasil penelitian menunjukkan bahwa penerapan pembelajaran RME tentang operasi hitung bilangan cacah pada kelas III di SDN Tuliskriyo 01 Kabupaten Blitar sangat baik. Hal ini dapat dibuktikan dengan adanya peningkatan hasil belajar siswa yang sangat baik pula. Persentase ketuntasan belajar siswa pada pra tindakan adalah 26,67%, pada siklus I 80% dan pada siklus II adalah 100%. Berdasarkan hasil kesimpulan disarankan kepada guru kelas III SDN Tuliskriyo 01 Kabupaten Blitar untuk menggunakan pembelajaran Realistic Mathematic Education (RME) dalam pembelajaran Matematika khususnya pada materi operasi hitung bilangan cacah agar hasil belajar siswa meningkat dan lebih optimal.

Penerapan pendekatan pemecahan masalah heuristik 1 untuk meningkatkan hasil belajar pengurangan bilangan bulat kelas IV SD / Ririn Tri Setyaningtyas Anggraini

 

Kata Kunci : Heuristik I, Hasil Belajar, Bilangan Bulat. Hasil observasi awal di SDN Pandanrejo 01 pada saat pembelajaran pengurangan bilangan bulat, peneliti dapat mengambil kesimpulan bahwa penyebab kesulitan siswa yaitu : (1) Siswa belum mengerti tentang konsep dasar operasi pengurangan bilangan bulat, (2) Guru belum menggunakan media dalam pembelajaran yang tepat , (3) Guru belum menerapkan pendekatan pemecahan masalah Heuristik I dalam pembelajaran. Pembelajaran yang monoton sering membuat siswa salah tafsir dalam menyelesaikan soal yang diberikan oleh guru. Hal ini terbukti bahwa setelah proses pembelajaran berlangsung selama pra tindakan diketahui 12 anak dari 25 anak atau sebanyak 48 % kelas IV masih mendapatkan hasil belajar di bawah kriteria ketuntasan minimum (KKM), sedangkan yang berhasil masih 52% saja. Padahal pada saat ini kriteria Ketuntasan yang harus dicapai adalah di atas 60 %, jadi dapat disimpulkan bahwa pembelajaran mengenai materi pokok pengurangan bilangan bulat pada siswa kelas IV di SD Pandanrejo 01 pada fase pra tindakan belum mencapai Kriteria Ketuntasan Minimum yang telah ditentukan. Penelitian ini bertujuan : Mendeskripsikan keterlaksanaan pendekatan pemecahan masalah Heuristik I terhadap hasil belajar operasi pengurangan bilangan bulat dan mengetahui sejauhmana pendekatan pemecahan masalah Heuristik I dapat meningkatkan hasil belajar operasi pengurangan bilangan bulat pada siswa kelas IV SDN Pandanrejo 01. Penelitian ini menggunakan rancangan penelitian pendekatan kualitatif. Sedangkan jenis PTK diterapkan model pelaksanaan penelitian guru sebagai peneliti dan penelitian dilaksanakan dua siklus. Pada penerapan bahwa hasil belajar siswa pada pra tindakan mencapai 52%, selanjutnya pada siklus I adalah 72 %, yang berarti terjadi peningkatan sebesar 20 %. Pada pelaksanaan siklus I dinyatakan belum berhasil karena belum mencapai ketuntasan individu maupun kelompok. Pada siklus II pertemuan adalah 96 %, yang berarti ada peningkatan sebesar 44 %. Dengan demikian dapat disimpulkan bahwa penerapan pendekatan pemecahan masalah Heuristik I dapat meningkatkan hasil belajar matematika siswa kelas IV SDN Pandanrejo 01 Kecamatan Wagir Kabupaten Malang. Disarankan guru diharapkan dapat menerapkan langkah-langkah pelaksanaan pendekatan heuristik 1 melalui kegiatan menggambar atau membuat diagram serta hendaknya menggunakan media yang tepat dan yang bersifat menyenangkan bagi siswa agar hasil yang dicapai dapat lebih maksimal.

Pengembangan bentuk latihan kombinasi ball handling dengan dribble pada tim ekstrakurikuler bolabasket SMP Marsudisiwi Malang / Bara Bangkit Ari Rachman Prasetya

 

Kata kunci: pengembangan, bentuk latihan kombinasi ball handling dengan dribble. Dribble adalah teknik dasar yang sangat penting dalam permainan bolabasket. Ball handling ditujukan agar pemain memiliki pengenalan dan kontrol bolabasket yang baik. Dalam latihan dribble khususnya dribble di tempat, pemain terkadang mengalami kejenuhan dalam latihan sehingga peserta latihan tidak bisa berlatih dengan baik. Untuk mengatasi hal tersebut diperlukan bentuk latihan yang bervariasi. Oleh karena itu perlu dikembangkan bentuk latihan kombinasi ball handling dengan dribble. Tujuan dari penelitian pengembangan bentuk latihan kombinasi ball handling dengan dribble ini adalah untuk meningkatkan keterampilan dribble siswa dengan latihan yang lebih baik, bervariasi, dan mudah dilakukan siswa. Prosedur pengembangan bentuk latihan kombinasi ball handling dengan dribble melalui tahap-tahap sebagai berikut: 1.Analisis Kebutuhan 2. Pembuatan Produk Awal 3. Revisi Produk Awal 4.Uji Coba Produk 5.Revisi Produk Uji Coba 6.Uji Coba Lapangan 7.Revisi Produk Akhir 8. Hasil Akhir. Lokasi penelitian dilakukan di SMP Marsudisiwi Malang. Sasaran pebelajar adalah siswa ekstrakurikuler bolabasket SMP Marsudisiwi Malang. Subyek uji coba terdiri dari 1) tinjauan ahli, terdiri dari 3 orang ahli yaitu 1 ahli pengembangan dan 2 ahli kepelatihan bolabasket, 2) uji kelompok kecil adalah menggunakan 12 siswa ekstrakurikuler bolabasket SMP Marsudisiwi Malang, 3) uji lapangan yang terdiri dari 30 siswa ekstrakurikuler bolabasket SMPK Marsudisiwi Malang. Dari pengembangan dan prosedur yang telah dilakukan, maka diperoleh hasil pengembangan bentuk latihan kombinasi ball handling dengan dribble pada tim ekstrakurikuler bolabasket di SMP Marsudisiwi Malang. Berdasarkan hasil penelitian ini, disarankan untuk diujicobakan pada sekolah-sekolah atau klub-klub bolabasket yang lebih banyak sehingga dapat diketahui keefektivitasan produk. Penelitian ini hanya sebatas suatu bentuk latihan, jadi lebih baiknya apabila ada suatu pengembangan VCD untuk memperjelas produk ini.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 |