Penerapan metode pemberian tugas menggambar bebas untuk mengembangkan kemampuan seni anak kelompok B TK Al Hidayah I Talun / Anis Sofiana

 

Kata Kunci: metode pemberian tugas, kegiatan menggambar bebas, TK Penelitian ini berlatar belakang pada kurang percaya diri anak dalam menuangkan ide, imajinasi dan kreativitas dalam menggembangkan kemampuan seni menggambar bebas. Hal ini disebabkan karena dalam kegiatan pembelajaran anak cenderung dibimbing terus oleh guru, kurangnya media pembelajaran dan dalam menggambar bebas anak belum tuntas, sehingga anak tidak dapat menggembangkan kreativitasnya melalui gambar. Penelitian ini bertujuan untuk mendeskripsikan penerapan metode pemberian tugas untuk mengembangkan kemampuan seni menggambar bebas dan mendiskripsikan pennggunaan metode pemberian tugas dapat menggembangkan kemampuan seni menggambar bebas anak kelompok B TK Al Hidayah I Talun. Penelitian ini dilakukan di TK Al Hidayah I Talun, tanggal 15, 16 dan 18 Novenber 2010. Rancangan penelitian menggunakan penelitian tindakan kelas dengan 2 siklus. Dalam setiap siklus terdiri dari beberapa tahapan, yaitu perencanaan, pelaksanaan, observasi, dan refleksi. Dalam penelitian ini peneliti juga berkolaborasi dengan Guru Kelas B. Instrumen penelitian yang digunakan untuk mendukung data penellitian ini meliputi: (1) Kemampuan seni menggambar berupa imajinasi, kreativitas dan komposisi (2) keminatan dan keaktivan dalam tanya jawab, bercerita tentang gambar yang dibuat sendiri dan menggambar bebas. Penerapan metode pemberian tugas menggambar bebas dapat meningkat melalui kegiatan tanya jawab dengan gambar sesuai tema binatang dan sub tema binatang peliharaan. Hasil penelitian menunjukkan bahwa, (1) metode pemberian tugas dapat menggembangkan kemampuan seni menggambar bebas anak melalui kegiatan berbagi dan bertanya. Dengan melakukan Tanya jawab, menggunakan media gambar yang diberikan guru dan dapat melatih kemandirian percara diri anak dalam menuangkan ide dan inspirasinya melalui gambar, (2) Hal ini dapat diketahui dari peningkatan nlai proses dari pra tindakan sampai siklus II mengalami kenaikan 26% dengan rincian sebangai berikut: Pra tindakan menggambar bebas 49%, Siklus I 58% dan siklus II 74 %. Saran yang diajukan dalam penelitian ini adalah dalam pembelajaran bidang kemampuan seni hendaknya media pembelajaran harus riil, harus komunikasi dan harus idukatif sehingga anak dapat berkembang dengan sendirinya dengan metode pemberian tugas dapat mengembangkan kreativitas anak dalam bidang pengembangan selain seni, yaitu pada bidang pengembangan kognitif, bahasa, dan sosial emosional.

Penggunaan lagu anak islami untuk mengembangkan kecerdasan musikal pada anak kelompok A di RA Persis Bangil / Widad

 

Kata kunci : Lagu Anak Islami, Kecerdasan Musikal Penelitian ini dilakukan karena semakin sedikitnya penggunaan Lagu Anak Islami yang digunakan bagi lembaga TK/RA sehingga pengembangan kecerdasan musikal belum maksimal terlihat.Penelitian ini bertujuan untuk (1) mengetahui apakah penggunaan lagu anak Islami dapat mengembangkan kecerdasan musikal pada anak kelompok A di RA PERSIS Bangil, (2) untuk mendeskripsikan kecerdasan musikal pada kelompok A di RA PERSIS Bangil setelah mengikuti kegiatan dengan pembelajaran Lagu Anak Islami. Penelitian ini menggunakan penelitian tindakan kelas (Class room action Research). Dengan tahapan siklus (1) perencanaan tindakan (2) perilaku tindakan (3) observasi (4) refleksi. Subjek penelitian ialah 20 anak yang terdiri dari 12 laki dan 8 perempuan. Instrumen yang digunakan dalam penelitian ini adalah pedoman observasi pedoman observasi analisis data dilakukan dengan tehnik analisis adalah deskriptif kualitatif. Hasil penelitian ini adalah penggunaan lagu anak Islami untuk mengembangkan kecerdasan musikal pada anak kelompok A RA PERSIS Bangil Kabupaten Pasuruan. Pembelajaran dengan Lagu Anak Islami semakin berkembang, hal ini bisa dilihat dari perubahan siswa dari yang belum dapat menyanyikan Lagu Anak Islami menjadi dapat menyanyikan Lagu Anak Islami dengan expresi yang tampak pada wajah-wajah mereka ketika menikmati jalannya proses pembelajaran dengan rasa senang. Penggunaan Lagu Anak Islami dapat mengembangkan kecerdasan musikal pada RA PERSIS Bangil Pasuruan, hal ini tampak pada hasil observasi pada siklus I sebagian anak yang dapat mengembangkan kecerdasan musikal Lagu Anak Islami ( 39,1 %). Pada siklus II terjadi peningkatan penggunaan Lagu Anak Islami yaitu (10,15 %) Guru berperan sebagai fasilitator. Suasana proses belajar dengan menggunakan lagu anak islami lebih menyenangkan karena siswa dapat mengekspresikan dirinya.

Pengembangan inventori kebiasaan belajar berbasis komputer bagi siswa SMA / Varizal Amir

 

Key word: inventory, study habit, computer Study habit is learning method to be done by learner in the school or home, by constantly, uniformly and automatically. Study habit is one of factor can influence learning achieevement. More exellent study habit can help student get expected achieevement. To know a student is succeed or not in studying it can be known from study habit. One of way to know student tudy habit is completely. For that, it need to be developed a study habit inventory based computer. The object of development is resulted study habit inventory based compter software for Senior Hig School student can be aceepted theorycally, and then it be used by counsellor and student which tool know study habit. Methods of development research used Borg and Gall method. The development of study habit inventory based computer happened include: (1) determine topic to be developed, (2) planning (3) explain variable, indicator, descriptor, (4) developed statement item, (5) guidance expert test, (6) instrument test and observable test in field, (7) data input software, (8) media expert test, and (9) Counsellor expert test. A data is qualitative and quantitative data. Qualitative data get from input, suggest by promotor, guiadace lecturer, media expert and suggest counsellor beside that researcher accept input, comment and suggest from student about observable test in study habit inventory. Quantitative data is get from numbers in result of instrument test with statistics to know student score frecuency, calculation of validiy and reliablity coefficient. Result of development show that study habit inventory based computer have been developed: (1) has high accuracy in shown, (2) has high utility (3) the operating is easy to be used by counsellor and student (4) effective and efficient. According to result of deveopment research, suggest that will be given is: (1) counsellor, is a first promotor in implementation usage software and promotor explain the way of usage software to be learner, should comprehard software and hardware computer, because releated to software installation and to get succes implementation usage of software. Head master should provide some special computer for guidance activity and then should not join to TIK laboratory school for software aplication study habit inventory. It be done for easily and get succes implementation software completly study habit inventory. (3) To be continued in research, researcher need experiment of product to unit analysis is student to know effectiveness of output is accuracy, utility, easy and effective and efficient.

Peningkatan kemampuan membaca pemahaman melalui model talking stick siswa kelas V SDN Kepanjenkidul 3 Kota Blitar / Mohamad Fatih

 

Kata kunci: membaca pemahaman, model talking stick. Berdasarkan hasil observasi diketahui bahwa siswa belum mempunyai dan menggunakan keterampilan membaca pemahaman. Hal ini dapat diketahui dari hasil pemahaman membaca siswa kelas V di SDN Kepanjenkidul 3 Kota Blitar masih rendah. Hal ini disebabkan siswa belum sepenuhnya memahami bacaan pada materi pembelajaran. Untuk mengatasi masalah tersebut, digunakan dan diterapkan model tallking stick untuk meningkatkan kemampuan membaca pemahaman, yang pada penelitian ini bertujuan untuk (1) mendeskripsikan implementasi model talking stick terhadap kemampuan membaca pemahaman siswa kelas V SDN Kepanjenkidul 3 Kota Blitar, (2) mendeskripsikan peningkatan kemampuan membaca pemahaman melalui model pembelajaran talking stick siswa kelas V SDN Kepanjenkidul 3 Kota Blitar. Untuk mencapai tujuan tersebut, penelitian ini menggunakan pendekatan deskriptif kualitatif. Rancangan yang digunakan dalam penelitian ini adalah penelitian tindakan kelas. Instrumen dalam pengumpulan data penelitian ini adalah lembar wawancara, lembar observasi baik untuk aktivitas siswa maupun kemampuan guru, hasil tes dan dokumentasi. Berdasarkan hasil observasi awal terhadap pembelajaran yang dilakukan oleh guru kelas V, dapat diketahui bahwa nilai yang diperoleh siswa masih berada di bawah KKM, yaitu 70, yaitu hanya 17%. Setelah menggunakan model talking stick, nilai evaluasi membaca pemahaman individu pada siklus I meningkat, yaitu menjadi 35%. Prosentase tersebut masih belum memenuhi standar yang telah ditetapkan, yaitu 70%. Maka perlu dilakukan siklus II, dan pada siklus II nilai siswa meningkat menjadi 92%. Sedangkan nilai pada kelompok juga mengalami peningkatan yaitu 50% pada siklus I meningkat menjadi 100% pada siklus II. Aktivitas siswa dalam pembelajaran juga mengalami peningkatan, pada siklus I yaitu 60% meningkat menjadi 94% pada sikus II. Demikian juga dengan kemampuan guru dalam menerapkan model pembelajaran talking stick juga mengalami peningkatan. Pada siklus I yaitu 60% meningkat pada siklus II menjadi 93%. Berdasarkan hasil penelitian dapat disimpulkan bahwa penggunaan model pembelajaran talking stick terbukti dapat meningkatkan pemahaman membaca siswa baik hasil kerja kelompok, evaluasi individu maupun aktivitas siswa dalam pembelajaran. Oleh karena itu disarankan bagi guru agar menggunakan model talking stick dalam pembelajaran agar hasil yang diperoleh menjadi maksimal.

Penerapan model pembelajaran learning cycle untuk meningkatkan hasil belajar IPS siswa kelas IV di SDN Karangbesuki 04 Malang / Yayuk Supatmi

 

Kata kunci: model Learning Cycle, IPS SD, hasil belajar Pembelajaran IPS dengan metode ceramah menjadikan pembelajaran berkesan verbalisme dan monoton. Karena kegiatan siswa hanya melihat, mendengar dan mencatat, karena itu rata-rata nilai yang dicapai siswa masih dibawah kriteria yang ditetapkan disekolah yaitu 63, maka dalam penelitian ini mencoba menggunakan model pembelajaran Learning Cycle untuk mengatasi permasalahan tersebut. Dengan model pembelajaran Learning Cycle dalam pembelajaran IPS diharapkan siswa dapat meningkatkan hasil belajar tentang materi sumber daya alam dan kegiatan ekonomi dan siswa memiliki ketrampilan yang sesuai dengan tujuan pembelajaran dalam kurikulum 2006. Penelitian ini bertujuan untuk mengetahui: (1) pelaksanaan pembelajaran IPS dengan model pembelajaran Learning Cycle materi sumber daya alam kelas IV semester I, (2) meningkatkan hasil belajar siswa kelas IV SDN Karangbesuki 04 Malang. Rancangan dalam penelitian ini menggunakan PTK dengan model Kemmis dan Mc Taggart. Penelitian ini dilaksanakan dalam dua siklus masing-masing siklus terdiri dari dua kali pertemuan. Subyek penelitiannya adalah siswa kelas IV SDN Karangbesuki 04 Malang yang berjumlah 32 anak. Adapun instrument yang digunakan dalam penelitian ini adalah pedoman observasi, pedoman wawancara, lembar test, dan dokumentasi. Untuk test yang diberikan pada siswa, sebelumnya dilakukan pre test dengan rata-rata 37,68. Nilai ini masih jauh di bawah standar minimal ketuntasan kelas yang ditentukan oleh sekolah yaitu 63. Dari penelitian ini dapat dikemukan bahwa pelaksanaan pembelajaran IPS dengan model pembelajaran Learning Cycle menjadi efektif karena siswa berperan aktif dalam pembelajaran. Kemampuan guru mengajar sudah sesuai dengan RPP ini dilihat dari nilai akhir yang diperoleh dari siklus I dan II yaitu 93,23%. Kemampuan siswa terhadap pembelajaran IPS dengan model pembelajaran Learning Cycle dari siklus I dan II menunjukkan hasil rata-rata yaitu 63,61 dan 74,83.Untuk ketuntasan kelas secara keseluruhan pada kemampuan siswa terhadap model pembelajaran Learning Cycle dari siklus I dan II mengalami peningkatan yaitu 56,25% menjadi 100%. Penerapan model pembelajaran Learning Cycle dalam pembelajaran IPS di kelas IV SDN Karangbesuki 04 Malang dapat meningkatkan hasil belajar siswa yang menunjukkan skor rata-rata kemampuan tes siswa meningkat dari siklus I 61,90 menjadi 73,25 pada siklus II. Peningkatan skor tes siswa dari siklus I ke siklus II dengan prosentase ketuntasan sebesar 8,3%. Sedangkan hasil proses individu siswa pada siklus I 65,31 telah mengalami peningkatan menjadi 74,83. Berdasarkan hasil olahan peneliti skor rata-rata akhir siswa meningkat dari siklus I sebesar 63,61 menjadi 74,83 pada siklus I. Terjadi peningkatan skor sebesar 11,22 dengan prosentase peningkatan sebesar 8,1%. Peneliti menyarankan agar guru menerapkan model pembelajaran ini, karena sangat efektif untuk meningkatkan hasil belajar siswa.

Sikap dasar konselor da teknik pengubahan tingkah laku khas budaya Indonesia: sebuah studi perspektif hermeneutika gadamerian atas teks mengenai dakwah Walisongo / Sari Titisandy

 

Kata kunci: konselor, sikap dasar, pengubahan tingkah laku, khas budaya Indonesia, dakwah Walisongo. Perkembangan agama Islam di Jawa tidak lepas dari upaya Walisongo yang senantiasa melakukan dakwah mengenai Islam pada masyarakat Jawa. “Walisongo" berarti sembilan Wali yang menyebarkan ajaran Islam di Pulau Jawa. Mereka adalah Sunan Maulana Malik Ibrahim, Sunan Ampel, Sunan Giri, Sunan Bonang, Sunan Drajat, Sunan Kalijaga, Sunan Kudus, Sunan Muria, dan Sunan Gunung Jati. Sikap-sikap terkenal Walisongo adalah bijaksana dan peka dalam beradaptasi dengan masyarakat Jawa. Itu semua dapat diserap sebagai sikap dasar bagi konselor Indonesia yang khas budaya Indonesia. Dalam praktiknya, konselor kurang memiliki sikap dasar yang layak sebagai konselor profesional. Konselor diharapkan memiliki sikap atau kualitas kepribadian yang ditunjukkan oleh para Wali, sehingga konselor dapat dipercaya, dihormati, dan disegani oleh konseli. Kinerja yang disertai sikap dasar kurang layak konselor seperti menghakimi konseli, menghukum konseli, atau tidak memahami kebiasaan konseli dapat menimbulkan rasa tidak nyaman konseli. Untuk itu, konselor diharapkan mampu mengaplikasikan sikap-sikap dan teknik pengubahan perilaku yang digunakan oleh Walisongo. Hal ini hendaknya dilakukan oleh konselor agar konseli merasa aman, nyaman, dan mempercayai konselor. Penelitian ini berfokus pada: 1) Apa dan bagaimanakah sikap dasar Walisongo yang dapat diserap menjadi sikap dasar konselor yang khas budaya Indonesia?, 2) Apa dan bagaimanakah teknik pengubahan perilaku yang digunakan Walisongo yang dapat diserap oleh konselor menjadi teknik pengubahan perilaku dalam konseling yang khas budaya Indonesia?. Penelitian ini menggunakan metode kualitatif dengan tipe Hermeneutika Gadamerian, yaitu cara menafsirkan teks-teks lama sehingga didapatkan suatu informasi baru yang sesuai dengan jaman sekarang. Adapun tahap-tahap dari penelitian ini adalah: mengumpulkan teks dan buku-buku sumber, penafsiran praandaian, dan pemaparan realitas secara historis. Dalam penelitian ini, ada dua bagian kesimpulan atau hasil penelitian yaitu: pertama, ada sembilan sikap dasar konselor berdasarkan sikap Walisongo; dan kedua, ada tiga teknik pengubahan tingkah laku yang digunakan Walisongo dalam menyebarkan ajaran agama Islam pada masyarakat Jawa. Sikap dasar dan teknik pengubahan tingkah laku oleh Walisongo itu dapat diserap oleh konselor sebagai sikap dasar dan teknik pengubahan tingkah laku yang khas budaya Indonesia. Sikap dasar yang dimaksud adalah: 1) toleran, 2) rela berkorban, 3) bertanggung jawab, 4) peka, 5) penerimaan dan empati, 6) luwes atau fleksibel, 7) egaliter, 8) respek atau penuh perhatian, dan 9) narima ing pandum yang diuraikan dalam lima sifat (rela, narima, temen, sabar, dan budi luhur). Adapun tiga teknik pengubahan tingkah laku Walisongo yang dapat diserap oleh konselor adalah: 1) klarifikasi nilai, 2) teknik seni/art, dan 3) modeling. Berdasarkan hasil penelitian ini, disarankan agar konsep temuan atau penteorian yang telah dipaparkan di sini dijadikan sebagai pedoman dan acuan oleh konselor dalam bimbingan dan konseling dengan nilai-nilai dan budaya khas Indonesia. Konselor dapat mengetahui dan memahami ciri kepribadian atau sikap dasar dan teknik pengubahan perilaku oleh Walisongo yang terkandung dalam nilai-nilai dan budaya Indonesia sebagaimana ditemukan dalam teks dakwah Walisongo. Di samping itu, dari hasil-hasil penelitian ini, konselor dapat meningkatkan kompetensi pribadi dengan cara mempelajari dan menyerap sikap dasar yang dimiliki Walisongo yang telah dipaparkan dalam penelitian ini. Diharapkan konselor mengaplikasikan sikap dasar Walisongo yang khas budaya Indonesia, misalnya, peka terhadap budaya yang dimiliki oleh konseli, peka terhadap konseli yang segera memerlukan bantuan konselor, luwes dalam menghadapi konseli, mempelajari karakter konseli, kebiasaan, budaya, serta adat istiadat yang dimiliki oleh konseli. Konselor juga dituntut bersikap egaliter dalam arti mengutamakan kesetaraan dan tidak membeda-bedakan konseli. Konselor juga diharapkan menggunakan teknik pengubahan perilaku yang digunakan oleh Walisongo yang telah ditemukan dalam wacana Walisongo untuk membantu konseli, misalnya konselor menggunakan teknik seni/art. Konselor diharapkan memiliki jiwa seni dan kreatif dalam memberikan bantuan kepada konseli, misalnya meminta konseli membuat puisi dengan arahan tema dari konselor dalam penyusunan komitmen atau kontrak perilaku untuk pengubahan perilaku konseli. Untuk peneliti selanjutnya, penelitian ini berguna sebagai bahan pustaka dalam kegiatan penelitian lebih lanjut tentang nilai-nilai budaya Indonesia, khususnya dakwah Walisongo dalam hubungannya dengan bimbingan dan konseling.

Penerapan metode karyawisata untuk mengembangkan emosi dan sosial siswa kelompok B di RA Al-Hamidiyah Sukorejo Pasuruan / Maria Ulfa

 

Kata Kunci : Mengembangkan, emosi sosial, RA, Karyawisata. Pengembangan emosi dan sosial di RA Al Hamidiyah mengalami kesulitan. Kesulitan ini disebabkan oleh teknik pembelajaran guru yang kurang tepat karena kurangnya permainan di dalam maupun di luar kelas. Dengan menggunakan metode karyawisata peneliti berusaha mengembangkan emosi dan sosial anak di RA Al Hamidiyah Sukorejo-Pasuruan. Penelitian ini bertujuan untuk mendeskripsikan penerapan metode karyawisata untuk mengembangkan emosi dan sosial anak di RA Al Hamidiyah Sukorejo-Pasuruan. Penelitian menggunakan pendekatan kualitatif dengan rancangan PTK yang di lakukan mulai awal februari sampai akhir februari 2010. subyek penelitian adalah anak RA Al hamidiyah sukorejo pasuruan yang terdiri dari 30 siswa di harapkan dengan pembelajaran metode karya wisata yang di terapkan dalam penelitian ini dapat mengembangkan emosi dan sosial di RA Al hamidiyah sukorejo pasuruan. Penelitian ini menggunakan desain action Reseach kemmis dan tanggart. Yang terdiri dari 4 tahap yaitu Perencanaan, Pelaksanaaa, Observasi, Refleksi. Hasil penelitian di kemukakan sebagagi berikut: (1) hasil observasi siswa RA Al hamidiyah pada pengembangan emosi pada siklus I pertemuan ke I sebesar 58,4% dan siklus I pertemuan ke II 78,3% maka rata-rata peningkatan pada siklus I ± 19,9%. Sedangkan pengembangan sosial pada siklus II pertemuan ke I 59,1% dan siklus ke II pertemuan II 76,9% maka rata-rata peningkatan pada siklus II adalah ± 17,8%. Dari hasil penelitian dan pembahasan dapat disimpulkan, bahwa pengembangan emosi dan sosial dapat diterapkan melalui metode karyawisata yang diterapkan dengan baik. Disarankan kepada guru agar menggunakan metode karyawisata untuk mengembangkan emosi dan sosial yang merupakan salah satu pembelajaran mengatasi permasalahan yang terjadi di RA.

Pengembangan media pembelajaran interaktif pada mata pelajaran Bahasa daerah kelas IV materi pengenalan aksara jawa Sekolah Dasar Negeri Penanggungan Kota Malang/ Tossy Aguk Satriangun

 

Kata kunci : Pengembangan,Media Pembelajaran Interaktif,Pelajaran Bahasa Daerah Media dapat diartikan suatu perantara atau pengantar pesan yang dapat digunakan dalam proses pembelajaran. Sedangkan Media interaktif adalah media yang dapat berinteraksi secara langsung dengan pebelajar, karena interaktif memiliki komunikasi yang bersifat dua arah. Pengembangan ini dilaksanakan dengan tujuan menghasilkan media pembelajaran interaktif yang telah melalui proses validasi pada mata Pelajaran Bahasa Daerah Kelas IV di Sekolah Dasar Penanggungan Kota Malang Media interaktif ini mempunyai beberapa kelebihan dan kekurangan. Adapun kelebihan dari media ini adalah (1) dapat digunakan secara individu (2) tidak membutuhkan waktu yang lama dalam menggunakan media ini (3) bahan ajar media bersifat interaktif sehingga siswa langsung mendapatkan feedback (balikan) dari media ini (4) dilengkapi dengan petunjuk pemanfaatan,dan kuis atau soal latihan (5) tampilan media disesuaikan dengan karakteristik siswa kelas IV yaitu dengan penggunaan warna yang cerah dan gambar-gambar yang dapat membuat siswa tertarik dan termotivasi untuk belajar. Sedangkan kekurangan media ini adalah bahan ajar media ini hanya terbatas pada pokok materi pengenalan aksara jawa. Data pengembangan media pembelajaran interaktif ini menggunakan instrument berbentuk angket kepada ahli media, ahli materi, dan audiens (siswa) dan hasil belajar yang diberikan kepada siswa. Data tersebut diolah untuk dianalisis, di interpretasi, dan disimpulkan tingkat kevalidan dan efektivitasnya. Hasil pengembangan media pembelajran interaktif ini dikemukakan sebagai berikut: uji coba ahli media didapat persentase 93% berdasarkan kriteria hasil kelayakan, media pembelajaran interaktif ini termasuk kualifikasi valid, uji coba ahli materi didapat persentase 85% berdasarkan kriteria kelayakan media pembelajaran interaktif ini termasuk kualifikasi valid, uji coba siswa perseorangan didapat persentase 87% kesimpulan berdasarkan kriteria kelayakan media pembelajaran interaktif ini termasuk kualifikasi valid, uji coba siswa kelompok kecil didapat persentase 83% berdasarkan kriteria kelayakan media pembelajaran interaktif ini termasuk kualifikasi valid, uji coba siswa kelompok kecil didapat persentase 84% berdasarkan kriteria kelayakan media pembelajaran interaktif ini termasuk kualifikasi valid. Berdasarkan hasil pengembangan yang telah dilakukan, dapat disimpulkan bahwa Media Pembelajaan Interaktif Pelajaran Bahasa Daerah untuk SD kelas 4 di Sekolah Dasar Penanggungan Kota Malang valid/layak digunakan sebagai media pembelajaran.

Pengembangan permainan tradisional gobak sodor fantasi untuk pembelajaran fisik motorik anak kelompok B di TK Al-Hidayah XI Bendogerit Kota Blitar / Hari Yulianto

 

Kata kunci : Pengembangan, Permainan, Gobak Sodor Fantasi, Fisik Motorik Berdasarkan kenyataan di lapangan dalam penelitian awal ditemukan bahwa pembelajaran fisik motorik yang dilaksanakan di Kelompok B TK Al-Hidayah XI Bendogerit lebih menonjolkan pada fisik motorik halus Sedangkan fisik motorik kasar jarang dilakukan, yang meliputi: berjalan di atas papan titian, senam irama (setiap pagi), bermain jungkat-jungkit, melompat dan meloncat di atas simpai. Media serta alat yang dimiliki sekolah hanya meliputi: 1 (satu) buah bola dunia, 1 (satu) buah jungkat-jungkit, 1 (satu) buah papan prosotan, dan 2 (dua) buah papan titian, halaman untuk beraktivitas kurang luas (7m x 6m), pembelajaran fisik motorik belum mengarah pada aspek kemampuan dasar gerak yang meliputi kelenturan, kekuatan, keseimbangan, kecepatan, dan kelincahan, yang diharapkan dapat meningkatkan kesehatan dan kebugaran anak. Guru di TK Al-Hidayah XI Bendogerit Kota Blitar belum pernah menerapkan pembelajaran permainan tradisional seperti permainan gobak sodor fantasi. Permainan gobak sodor fantasi merupakan bentuk permainan yang diadopsi dari gobak sodor anak kampung yang disesuaikan dengan usia anak 4 - 6 tahun dan mempertimbangkan luas halaman sekolah 7 x 6 m, serta pemberian daya tarik bagi anak-anak kelompok B di TK Al-Hidayah XI Bendogerit Kota Blitar. Inti permainannya sebagai penjaga harus menghadang kelompok penyerang agar tidak bisa lolos melewati garis ke garis terakhir secara bolak-balik, dan untuk meraih keberhasilan seluruh anggota kelompok penyerang harus secara lengkap melakukan proses bolak-balik dalam area lapangan yang telah ditentukan dengan tidak tersentuh/tertangkap penjaga. Tujuan yang ingin dicapai dalam pengembangan permainan tradisional gobak sodor fantasi adalah untuk mengembangkan permainan tradisional gobak sodor fantasi yang dapat menyenangkan anak, dan mudah untuk dilakukan anak sebagai salah satu aternatif pembelajaran yang dilaksanakan di TK Al-Hidayah XI Bendogerit Kota Blitar. Dalam penelitian ini model pengembangan yang digunakan adalah model pengembangan (Research and Development) dari Borg dan Gall (1983: 775) Adapun prosedur pengembangan permainan tradisional gobak sodor fantasi adalah: 1) Melakukan penelitian dan pengumpulan informasi (kajian pustaka, pengamatan kelas, persiapan laporan pokok persoalan), 2) Melakukan perencanaan (pendefinisian keterampilan, perumusan tujuan, penentuan urutan pengajaran, dan uji coba skala kecil), 3) Mengembangkan bentuk produk awal (penyiapan materi pengajaran, penyusunan buku pedoman, dan perlengkapan evaluasi), 4) Melakukan uji lapangan permulaan (dilakukan di TK Al Hidayah XI Bendogerit, menggunakan 8 subyek), 5) Melakukan revisi terhadap produk utama (sesuai dengan saran-saran dari hasil uji lapangan permulaan), 6) Melakukan uji lapangan utama (pada 1 sekolah dengan 44 subyek), 7) Melakukan revisi produk (berdasarkan saran-saran dari hasil uji lapangan utama). Uji coba dilakukan melalui 3 tahap, yaitu evaluasi ahli, uji coba (kelompok kecil), uji lapangan (kelompok besar). Instrumen yang digunakan adalah berisi tentang rancangan produk dan produk yang telah dibuat. Teknis analisis data yang digunakan adalah analisis kualitatif dan deskriptif berupa prosentase. Hasil pengembangan ini berupa model pembelajaran permainan gobak sodor fantasi untuk pembelajaran fisik motorik anak kelompok B Di TK Al-Hidayah XI Bendogerit Kota Blitar. Diharapkan hasil pengembangan ini dapat diujicobakan kepada kelompok yang lebih luas dan dapat disosialisasikan kepada sekolah-sekolah dan lembaga pendidikan yang terkait sehingga dapat digunakan sebagaimana mestinya. Selain hal tersebut karena penelitian ini hanya terbatas pada pengembangan produk, diharapkan ada penelitian selanjutnya, untuk menguji tingkat keefektifitas dari produk yang dikbangkan.

Pengaruh atribut produk terhadap keputusan konsumen dalam membeli steak di The Amsterdam Garden Resto and Steal House Malang / Retno Dwi Anggreni

 

Kata Kunci: Atribut Produk, Keputusan Pembelian Konsumen Tingkat konsumsi masyarakat akan masakan steak semakin meningkat, terlihat dari semakin banyaknya restoran yang menyajikan masakan steak sebagai menu utamanya. Fenomena ini menimbulkan persaingan yang ketat, dan menyebabkan konsumen semakin selektif dalam memilih produk yang sesuai dengan keinginannya. Atribut produk seringkali dijadikan dasar oleh konsumen dalam pembelian sebuah produk, sebab untuk melakukan pembelian konsumen akan bereaksi terhadap produk dengan segala atribut yang melekat didalamnya. Penelitian ini bertujuan untuk mengetahui: (1) Pengaruh atribut produk terhadap keputusan pembelian konsumen masakan steak di Amsterdam Garden Resto and Steak House Malang; (2) Pengaruh atribut produk (harga, merek, pelayanan, dan rasa) secara parsial terhadap keputusan pembelian konsumen masakan steak di Amsterdam Garden Resto and Steak House Malang, (3) Pengaruh atribut produk (harga, merek, pelayanan, dan rasa) secara simultan terhadap keputusan pembelian konsumen masakan steak di Amsterdam Garden Resto and Steak House Malang; (4) Atribut produk yang paling dominan mempengaruhi konsumen dalam melakukan pembelian di Amsterdam Garden Resto and Steak House Malang. Jenis penelitian yang digunakan adalah penelitian survey dengan menggunakan pendekatan kuantitatif dengan angket sebagai alat pengumpul data. Sampel yang digunakan sebanyak 100 orang, teknik sampling yang digunakan adalah accidental sampling. Analisis data yang digunakan adalah statistik deskriptif dan statistik infrensial guna mendapatkan data empirik mengenai pengaruh atribut produk secara parsial dan simultan (harga, merek, pelayanan, dan rasa) terhadap keputusan pembelian konsumen masakan steak di Amsterdam Garden Resto and Steak House Malang. Hasil uji hipotesis membuktikan bahwa terdapat pengaruh secara parsial dan simultan antara variabel harga (X1), Merek (X2), Pelayanan (X3), dan Rasa (X4), terhadap keputusan pembelian konsumen masakan steak di The Amsterdam Garden Resto and Steak House (Y). Berdasarkan analisis data dengan menggunakan regresi linear berganda dan sumbangan efektif dapat diketahui bahwa variabel Rasa (X4) merupakan faktor yang paling dominan mempengaruhi keputusan pembelian konsumen sedangkan variabel Merek (X2) merupakan variabel yang paling kecil pengaruhnya terhadap keputusan pembelian konsumen masakan steak.

Peningkatan kemampuan dan kreativitas untuk operasi perkalian bilangan bulat dengan pendekatan discovery pada siswa kelas V MI Nurul Huda I Pasuruan / Dini Yuniati

 

Kata kunci: Kemampuan dan kreativitas, bilangan bulat, pendekatan discovery. Masalah pendidikan merupakan proses budaya untuk meningkatkan harkat dan martabat manusia dalam kehidupannya. Selain itu pendidikan juga berpengaruh terhadap kelangsungan hidup suatu bangsa. Kemajuan suatu bangsa hanya dapat dicapai jika pendidikannya berjalan dengan baik. Guru sebagai faktor yang dominan dalam pendidikan dituntut profesionalitasnya. Sebagai tenaga yang profesional, guru harus tanggap terhadap perkembangan baru, selalu berinisiatif, inovatif, dan kreatif terhadap pembaharuan dibidang pendidikan. Matematika merupakan salah satu mata pelajaran yang patut diperhitungkan dalam kemajuan peningkatan pendidikan. Penelitian terhadap kemampuan dan kreativitas siswa pada mata pelajaran matematika materi pokok operasi perkalian bilangan bulat bertujuan untuk mengetahui penerapan pendekatan discovery untuk meningkatkan pemahaman konsep perkalian bilangan bulat, meningkatkan kreativitas operasi perkalian bilangan bulat pada siswa kelas V di MI Nurul Huda 1 Gajahrejo Kecamatan Purwodadi Kabupaten Pasuruan. Metode penelitian yan digunakan dalam penelitian ini merupakan metode penelitian tindakan kelas. Instrumen yang digunakan meliputi naska wawancara, hasil observasi, angket, dan hasil dokumentasi. Teknik pengumpulan data yang digunakan dengan melakukan wawancara, menyebarkan angket dan dokumentasi. Permasalahan dalam penelitian ini merupakan cara apa yang digunakan dalam menerapkan pendekatan discovery untuk meningkatkan pemahaman konsep perkalian bilangan bulat, meningkatkan kreativitas operasi perkalian bilangan bulat serta implikasinya dikelas. Dari hasil penelitian ini disarankan agar guru lebih profesional dalam merancang dan melaksanakan kegiatan pembelajaran dan disarankan agar kepala sekolah memperhatikan media pembelajaran yang ada disekolahnya. Supaya kegiatan pembelajaran siswa dapat berlangsung sehingga siswa dapat memperoleh hasil belajar yang maksimal.

Peningkatan kemampuan membilang dengan bermain dakon pada anak kelompok "A" RA Badrul Ulum Simpar Kecamatan Beji Kabupaten Pasuruan / Atika

 

Kata kunci: Kemampuan membilang, Bermain dakon, PAUD Penelitian ini berlatar belakang adanya kemampuan membilang di kelas kelompok A RA Badrul Ulum Simpar Kecamatan Beji Kabupaten Pasuruan yang relatif rendah. Anak didik yang baru masuk sekolah belum mampu menguasai simbol bilangan atau angka, proses pembelajaran yang dapat meningkatkan kemampuan membilang diantaranya dengan bermain dakon, dengan bermain dakon anak melakukan kegiatan secara sukarela, dan kegiatan memadukan antara permainan tradisional dengan proses pembelajaran formal. Penelitian ini bertujuan untuk mendeskripsikan penerapan bermain dakon dalam meningkatkan kemampuan membilang pada anak kelompok A RA Badrul Ulum Simpar Kecamatan Beji Kabupaten Pasuruan. Metode penelitian yang digunakan dalam penelitian ini adalah deskriptif kualitatif dan kuantitatif berbentuk tindakan kelas dan dirancang dalam 2 siklus. Masing-masing siklus terdiri dari 2 tahapan, yaitu perencanaan (planning), pelaksanaan tindakan (action), pengamatan (observation), dan refleksi (reflection). Subyek penelitian adalah anak kelompok A RA Badrul Ulum Simpar Kecamatan Beji Kabupaten Pasuruan yang berjumlah 16 anak. Metode pengumpulan data diperoleh melalui lembar observasi 1 dan lembar observasi 2, lembar observasi anak selama proses pembelajaran dan dokumentasi berupa foto selama pembelajaran. Hasil penelitian menunjukkan bahwa penerapan bermain dakon dapat meningkatkan kemampuan membilang pada anak kelompok A. berdasarkan lembar observasi pada siklus 1 hasil aktifitas pembelajaran pada kemampuan membilang diperoleh nilai rata-rata individu dengan nilai 2 dan nilai rata-rata kelas dengan nilai 2, Pada siklus 2 hasil observasi pada pengembangan kemampuan membilang anak meningkat diperoleh nilai rata-rata individu 4 dan nilai rata-rata kelas dengan nilai 4. Dan pada siklus 1 lembar observasi 1 diperoleh nilai 3.4, lembar observasi 2 diperoleh nilai 3.2, dan pada siklus 2 lembar observasi 1 diperoleh nilai 4.5, lembar observasi 2 diperoleh nilai 4.5. Berdasarkan hasil penelitian tersebut, dapat disimpulkan bahwa penerapan bermain dakon dapat meningkatkan kemampuan membilang anak. Oleh karena itu disarankan bagi guru untuk menggunakan media dalam pembelajaran untuk meningkatkan kemampuan membilang anak.

Peningkatan kemampuan menulis kalimat sederhana melalui media kartu kata pada siswa kelas II SDI Daarul Fikri Dau Malang / Lilik Hidayati

 

Kata Kunci: Kemampuan Menulis , Kalimat Sederhana, Media Kartu Kata Sesuai dengan kompetensi dasar menulis dan kompetensi dasar kalimat, siswa kelas II SD diharapkan sudah mampu membuat kalimat dengan baik dan benar baik secara lisan maupun tulisan. Siswa diharapkan mampu mengungkapkan pikiran dan perasaannya dalam bentuk kalimat sederhana. Namun di SDI Daarul Fikri Dau Malang siswa kelas II seringkali mengalami kesulitan dalam membuat kalimat, terutama dalam bentuk tulisan. Jika diminta menulis kalimat, siswa kesulitan untuk menuangkan gagasan dalam pikirannya menjadi sebuah kalimat. Rumusan masalah dalam penelitian ini adalah: (1) bagaimanakah penggunaan media kartu kata untuk meningkatkan kemampuan menulis kalimat sederhana pada siswa kelas II SDI Daarul Fikri Dau Malang?, dan (2) apakah penggunaan media kartu kata dapat meningkatkan kemampuan menulis kalimat sederhana siswa kelas II SDI Daarul Fikri Dau Malang? Penelitian ini bertujuan untuk: (1) mendeskripsikan penggunaan media kartu kata untuk meningkatkan kemampuan menulis kalimat sederhana pada siswa kelas II SDI Daarul Fikri Dau Malang, dan (2) mendeskripsikan peningkatan kemampuan menulis kalimat sederhana siswa kelas II SDI Daarul Fikri Dau Malang. Data dari penelitian ini diperoleh melalui observasi , wawancara, dokumentasi dan tes. Teknik observasi digunakan untuk mengamati gejala-gejala yang tampak dalam proses pembelajaran tentang keaktifan siswa, keberanian siswa dan kerjasama siswa dalam proses pembelajaran. Teknik wawancara digunakan untuk mengetahui kesan-kesan dan perasaan siswa ketika belajar menulis kalimat sederhana menggunakan media kartu kata. Teknik dokumentasi digunakan untuk mendokumentasikan data tentang proses pembelajaran yang menggambarkan langkah-langkah kongkrit yang dilakukan oleh guru dalam proses pembelajaran. Sedangkan tes digunakan untuk mengumpulkan data tentang kemampuan siswa mengerjakan soal evaluasi yang berhubungan dengan menulis kalimat sederhana. Berdasarkan hasil penelitian, Penggunaan media kartu kata dapat meningkatkan kemampuan menulis kalimat sederhana pada siswa kelas II SDI Daarul Fikri Dau Malang. Hal ini dapat dilihat dari peningkatan yang terjadi setelah diberi tindakan pada siklus I dan siklus II, yaitu peningkatan aktifitas belajar siswa sebesar 15,17 (9,75 %) dan peningkatan hasil belajar siswa sebesar 8,77 (5,56 %). Disarankan pada guru kelas II agar lebih meningkatkan kreatifitasnya dalam melaksanakan pembelajaran bahasa Indonesia, khususnya materi menulis kalimat sederhana. Misalnya dengan memanfaatkan media kartu kata, karena media kartu kata terbukti dapat meningkatkan proses dan hasil belajar siswa dalam menulis kalimat sederhana.

Penerapan think pair share (TPS) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Segaran 03 Kecamatan Gedangan Kabupaten Malang / Luluk Umiatin

 

Kata Kunci: Aktivitas, Hasil Belajar, Think Pair Share , IPS SD Keberhasilan proses pembelajaran di kelas salah satunya ditentukan oleh cara guru menggunakan model pembelajaran. Model pembelajaran digunakan harus sesuai dengan kebutuhan siswa, karena setiap model pembelajaran mempunyai tujuan, prinsip dan penekanan yang berbeda. Namun dalam kenyataannya guru tidak pernah menggunakan model pembelajaran yang bervariasi, akibatnya aktivitas siswa pasif dan hasil belajarnya rendah. Bahkan guru hanya menggunakan satu metode pembelajaran saja dalam setiap mengajar yaitu ceramah. Penelitian ini bertujuan untuk meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Segaran 03 Kecamatan Gedangan Kabupaten Malang melalui model pembelajaran Think Pair Share. Dalam model ini Siswa akan berpikir (Think) secara individu, kemudian siswa secara berpasangan (Pair) saling tukar pendapat untuk melengkapi penemuannya. Selanjutnya tahap berbagi dalam kelompok besar yang dilakukan dengan kelompok besar di kelas (Share). Subyek penelitian ini adalah siswa kelas V SDN Segaran 03 Kecamatan Gedangan Kabupaten Malang dengan jumlah 25 siswa. Rancangan penelitian ini menggunakan pengembangan Kemmis dan Taggart. Teknik pengumpulan data menggunakan observasi, wawancara, dokumentasi dan test. Sedangkan instrumen penelitiannya menggunakan pedoman wawancara, lembar observasi dan soal test. Hasil penelitian menunjukkan adanya peningkatan aktivitas dan hasil belajar siswa kelas V pada mata pelajaran IPS materi keanekaragaman suku bangsa dan budaya di Indonesia. Hasil Pre test siswa rata-rata adalah 48,2 atau 48,2%, siklus I mengalami peningkatan yaitu menjadi 69,8 atau 69,8% dan siklus II terus mengalami peningkatan menjadi 81,8 atau 81,8%. Hasil belajar siswa dikatakan naik 12% persiklus. Sedangkan untuk aktivitas siswa menunjukkan adanya peningkatan dari 11,56 menjadi 12,88 di siklus II. Penerapan model pembelajaran Think Pair Share berhasil diterapkan pada siswa kelas V SDN Segaran 03 Kecamatan Gedangan Kabupaten Malang untuk meningkatkan aktivitas dan hasil belajar. Disarankan bagi peneliti lain, penelitian ini dapat dijadikan sebagai bahan pertimbangan dan acuan dalam penelitian selanjutya, sehingga hasilnya dapat dijadikan pedoman dan pengembangan profesi dan meningkatkan prestasi belajar siswa.

Peningkatan hasil belajar PKn melalui pengalaman (experiential learning) bagi siswa kelas II di SDN Tanggung 2 Kota Blitar / Purwaning

 

Kata kunci: hasil belajar, PKn, ExperientialLearning Experiential Learning merupakan model pembelajaran PKn yang digunakan untuk meningkatkan hasil belajar siswa tentang sikap cinta lingkungan. Untuk mengetahui adanya peningkatan hasil belajar siswa, maka dilakukan pembelajaran melalui pengalaman (Experiential Learning). Penelitian ini bertujuan untuk mengetahui peningkatan hasil belajar PKn melalui pengalaman tentang sikap cinta lingkungan siswa kelas II. Selain itu, penelitian ini juga diharapkan dapat digunakan para guru dalam membantu kegiatan pembelajaran PKn di sekolah, khususnya pada materi pokok cinta lingkungan. Penelitian ini dilakukan di SDN Tanggung 2 Kota Blitar tanggal 8 Oktober 2010 sampai 25 November 2010. Rancangan penelitian yaitu dilakukan melalui penelitian tindakan Kelas. Dimana setiap siklus terdiri dari perencanaan, pelaksanaan, observasi dan refleksi. Sebelum dilakukan tahap siklus, terlebih dahulu dilakukan penelitian pendahuluan yaitu pra tindakan sebagai awal identifikasi masalah. Analisis data penelitian ini adalah teknik analisis data kualitatif. Hasil penelitian ini menunjukkan adanya peningkatan hasil belajar siswa kelas II dalam pembelajaran PKn melalui pengalaman tentang cinta lingkungan. Peningkatan hasil belajar terjadi baik secara individu maupun klasikal. Peningkatan rata-rata hasil belajar secara individu pada siklus I 73,34% menjadi 93,33% pada siklus II. Sedangkan secara klasikal peningkatan rata-rata hasil belajar 47,83% menjadi 96% pada siklus II. Sehingga ada 12 siswa yang tidak tuntas pada siklus I dan satu siswa yang tidak tuntas pada siklus II. Berdasarkan hasil penelitian ini, dapat disarankan yaitu Hasil penelitian ini dapat dijadikan bahan penelitian lebih lanjut dengan judul lainnya. Siswa dihadapkan pada berbagai kegiatan yang dapat memicu kreatifitas siswa dan menumbuhkan pengalaman baru bagi siswa di dalam pembelajaran. Siswa dibimbing dan diarahkan untuk lebih aktif dalam pembelajaran. Guru hendaknya menyusun rencana pelaksanaan pembelajaran yang memacu siswa untuk aktif dalam pembelajaran, guru sebagai fasilitator bertugas membimbing dan mengarahkan siswa selama pembelajaran berlangsung.

Minat belajar siswa RSBI pada mata pelajaran IPS terpadu bidang sejarah di SMPN I Jetis Ponorogo tahun ajaran 2009/2010 / Risdiana Andriani

 

Kata kunci: minat belajar, RSBI, mata pelajaran IPS Terpadu bidang sejarah Dari hasil observasi awal dan data nilai siswa kelas VII di SMPN 1 Jetis Ponorogo selama 1 semester diketahui kelas VII RSBI kelasnya memiliki fasilitas yang lebih lengkap dibandingkan kelas regular serta input siswa yang berkompeten, tetapi rata-rata hasil belajar mata pelajaran IPS Terpadu bidang sejarahnya lebih rendah dibanding kelas reguler. Masalah yang muncul ini dimungkinkan karena minat belajar sejarah siswa kelas VII RSBI yang kurang. Minat tersebut dipengaruhi oleh faktor internal dan ekternal siswa. Rumusan masalah dalam penelitian ini adalah (1) Bagaimana minat belajar siswa RSBI kelas VII SMPN 1 Jetis Ponorogo pada mata pelajaran IPS Terpadu bidang Sejarah?, (2) Faktor internal dan eksternal apa saja yang berpengaruh terhadap minat belajar siswa RSBI kelas VII SMPN 1 Jetis Ponorogo pada mata pelajaran IPS Terpadu bidang Sejarah? Dengan tujuan untuk (1) mendeskripsikan minat belajar siswa RSBI kelas VII SMPN 1 Jetis Ponorogo pada mata pelajaran IPS Terpadu bidang Sejarah, dan (2) mendeskripsikan faktor internal dan eksternal apa saja yang berpengaruh terhadap minat belajar siswa RSBI kelas VII SMPN 1 Jetis Ponorogo pada mata pelajaran IPS Terpadu bidang Sejarah. Penelitian ini menggunakan kuantitatif deskriptif untuk menggambarkan tentang kondisi minat belajar sejarah siswa kelas VII RSBI SMPN 1 Jetis Ponorogo dan faktor-faktor yang mempengaruhinya. Populasi dalam penelitian ini adalah seluruh siswa kelas VII RSBI SMPN 1Jetis Ponorogo tahun ajaran 2009/2010 yang berjumlah 85 siswa yang terbagi dalam 3 kelas yaitu kelas VII A, VII B, dan VII C. Sedangkan dalam menentukan sampel, peneliti menggunakan teknik simple random sampling, yaitu pengambilan anggota sampel yang dilakukan secara acak. Dengan tingkat kesalahan 5%, maka jumlah sampel dalam penelitian ini adalah 69 siswa yang diambil dari 3 kelas RSBI berdasarkan nomor urut absen. Dari hasil penelitian diketahui bahwa minat belajar siswa kelas VII RSBI SMPN 1 Jetis Ponorogo terhadap mata pelajaran sejarah terkategori baik dengan prosentase sebesar 52,2 %. Faktor internal yang mempengaruhi minat belajar sejarah siswa terkategori baik dengan prosentase sebesar 58 %, sedangkan faktor eksternal yang mempengaruhi minat belajar sejarah siswa terkategori kurang baik dengan prosentase sebesar 56,5 %. Berdasarkan hasil penelitian, kesimpulan dari penelitian ini adalah secara umum minat belajar IPS Terpadu bidang sejarah siswa kelas VII RSBI SMPN 1 Jetis Ponorogo sudah baik, dengan faktor internal yang berpengaruh baik terhadap minat belajar sejarah dan faktor eksternal yang berpengaruh kurang baik terhadap minat belajar sejarah. Karena itu disarankan adanya bantuan dan dukungan dari orang-orang disekitar siswa yang antara lain orang tua, guru, teman sekolah agar minat siswa terhadap mata pelajaran sejarah menjadi meningkat. Untuk penelitian selanjutknya disarankan untuk memfokuskan penelitian pada faktor eksternal apa saja yang mempengaruhi minat belajar siswa pada mata pelajaran sejarah.

Implementasi tools of total quality management (TQM) berbasis ISO 9001:2008 dalam penjaminan mutu sekolah (studi kasus di SMA Negeri 3 Malang) / Rochmawati

 

Kata Kunci: TQM, Tools of TQM, ISO 9001:2008, Penjaminan Mutu Konsep kualitas pendidikan memandang bahwa pemberian layanan jasa dan produk merupakan bagian yang tidak bisa dipisahkan dalam sebuah proses dan berlangsung secara berkesinambungan. Kualitas suatu sekolah tentunya tidak lepas dari adanya penjamin mutu (quality assurance). Sebagai bentuk produktivitas peningkatan kualitas penjamin mutu perlu mengimplementasikan manajemen kualitas secara total, yakni TQM. Dimensi-dimensi TQM yang komprehensif memberi ruang gerak dalam setiap segi upaya perbaikan kualitas. Pemanfaatan segenap tools yang berada didalamnya menunjang dalam proses peningkatan kualitas secara berkala. Apabila dipadukan dengan ISO 9001:2008 tentunya hal tersebut merupakan langkah inovatif dan strategis dalam upaya perbaikan dan peningkatan kualitas secara terus-menerus dan berkesinambungan. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal, yang mencakup orientasi dasar implementasi tools of TQM berbasis ISO 9001:2008 dalam penjaminan mutu, proses implementasi, fokus orientasi jenis tools of TQM, faktor penghambat, alternatif cara mengatasi faktor penghambat, faktor pendukung, dan pemberdayaan faktor pendukung implementasi tools of TQM berbasis ISO 9001:2008 di SMA Negeri 3 Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Data penelitian yang berupa paparan profil SMA Negeri 3 Malang yang mengimplementasikan tools of TQM sebagai manajemen total dengan berbasis pada sertifikat ISO 9001:2008 dan adanya Unit Penjamin Mutu (UPM) sebagai unit pengembangan kualitas. Pengumpulan data dilakukan dengan menggunakan teknik wawancara, observasi, dan dokumentasi. Instrumen yang digunakan dalam penelitian ini adalah peneliti sendiri yang bertindak sebagai key instrument. Informan dalam penelitian ini terdiri dari: (a) Kepala Sekolah, (b) Ketua UPM, (c) Waka Kurikulum, (d) Guru, (e) Siswa, dan (f) Orang tua siswa sebagai stakeholder sekolah. Untuk menjaga keabsahan data, dilakukan dengan menggunakan empat kriteria, meliputi: (a) credibility, dengan ketekunan pengamatan, triangulasi, pengecekan anggota, dan kecukupan referensial; (b) tranferbility; (c) dependability; dan (d) comfirmabilitas. Kegiatan analisis data dimulai dari tahap (a) reduksi data, yaitu penelaahan dalam memilah data yang diterima disesuaikan kondisi lapangan yang ada, (b) display data, yaitu hasil dari reduksi yang disusun secara terstruktur, dan (c) verifiksi data, yaitu mengkroscek kecocokan makna data yang diperoleh dari lapangan untuk mencapai kesimpulan yang kuat. Berdasarkan hasil analisis data, diperoleh kesimpulan penelitian sebagai berikut: (1) Profil kualitas SMA Negeri 3 Malang seiring perjalanan pengabdiannya senantiasa berkembang, dengan memiliki strategi unggul dalam proses penjaminan kualitasnya, yaitu melalui implementasi tools of TQM berbasis pada ISO 9001:2008 sebagai upaya peningkatan kualitas secara komprehensif; (2) orientasi implementasi TQM berbasis ISO 9001:2008 dalam penjaminan mutu di SMA Negeri 3 Malang adalah sebagai upaya peningkatan kualitas jasa pendidikan, kualitas lulusan atau produk, dan produktivitas kualitas UPM sebagai quality assurance yang bertujuan guna kepuasan pelanggan (customer satisfaying); (3) implementasi tools of TQM adalah sebagai media dalam mengidentifikasi dan memecahkan persoalan secara kreatif dalam upaya perbaikan dan peningkatan kualitas; (4), fokus orientasi implementasi jenis tools of TQM yang digunakan adalah Diagram Ishikawa dan flowchart; (5) faktor penghambat ditinjau dari segi internal yang meliputi: (a) pelayanan pendidikan tidak sesuai, (b) kondisi lingkungan alam, dan (c) tingkat kompetensi SDM, dan dari segi eksternal meliputi: jalinan link kerjasama Internasional); (6) alternatif cara mengatasi faktor penghambat dari segi internal dengan cara: (a) menjalin link kerjasama dengan pihak pemilik fasilitas atau membeli lahan baru guna memenuhi layanan jasa pendidian, (b) meningkatkan kedisiplinan dengan kesiapsiagaan, dan menumbuhkan jiwa enterpreneurship, dan (c) melalui UPM sebagai quality assurance, diadakannya berbagai pelatihan dan pengembangan kompetensi. Sedang dari segi eksternal caranya dengan menggunakan teknologi informasi dan penguasaan bahasa asing ditunjang komunikasi efektif pada segenap stakeholder; (7) faktor pendukung, ditinjau dari segi internal meliputi: (a) kerja tim yang efektif, (b) beragam metode pembelajaran, dan (c) perolehan standar ISO 9001:2008, sertifikat Cambridge, dan RSBI menuju SBI, dari segi eksternal meliputi: (a) kemudahan sarana transportasi; (b) link Kerjasama alumni, masyarakat, dan dunia Internasional; (8) pemberdayaan faktor pendukung ditinjau dari segi internal, meliputi: (a) mengefektifkan kerja tim secara lebih maksimal, dengan pengelolaan SDM mengacu pada standar ISO 9001:2008 Clausul Nomor 6 poin 2, (b) metode pembelajaran inovatif, dengan implementasi Kurikulum SMA Negeri 3 Malang, berbasis ITI, dan penggunaan English Every Day, (c) ISO 9001:2008, Sertifikat Cambridge, dan RSBI menuju SBI, dengan dijadikannya standar ISO 9001:2008 basis dalam perbaikan dan peningkatan kualitas SMA Negeri 3 Malang, sedangkan apabila ditinjau dari segi eksternal, pemberdayaannya meliputi: (a) penggunaan sarana transportasi dan membuka peluang entrepreneurship ditunjang dengan penyediaan program persewaan bus sekolah untuk travelling, dan (b) Link kerjasama Internasional, dengan pemberdayaan segenap stakeholder. Saran yang dapat direkomendasikan dalam penelitian ini sesuai basis standar yang digunakan yaitu ISO 9001:2008, maka perlu adanya penyesuaian dan pemaksimalan program secara komprehensif dalam perbaikan dan peningkatan kualitas secara continue. Penekanan pada zero defect, yang didukung dengan kompetensi, produktivitas, dan efektifitas kerja tim perlu senantiasa dikedepankan. Pemberdayaan melalui faktor pendukung sebagai asset yang telah ada senantiasa ditingkatkan dan dikembangkan dengan tujuan dapat memenuhi apa yang diinginkan dan apa yang dibutuhkan oleh pelanggan, sehingga dalam implementasinya dapat memberi kepuasan bagi pelanggan.

Penggunaan media kartu bergambar untuk mengembangkan kemampuan bercerita anak kelompok A di TK Muslimat NU 34 Kota Malang / Chustini

 

Kata Kunci : Bercerita, Mengembangkan, Media Kartu Bergambar. Berdasarkan latar belakang penelitian yang dilakukan pada anak kelompok A di TK Muslimat NU 34 Kota Malang terdapat rumusan masalah: 1). Bagaimana penggunaan media kartu bergambar untuk mengembangkan kemampuam bercerita anak kelompok A di TK Muslimat NU 34 Kota Malang? 2) Apakah penggunaan media kartu bergambar dapat mengembangkan kemampuan bercerita anak kelompok A di TK Muslimat NU 34 Kota Malang? Tujuan dari penelitian ini adalah; 1) Mendeskripsikan penggunaan media kartu bergambar untuk mengembangkan kemampuan bercerita anak kelompok A di TK Muslimat NU 34 Kota Malang; 2) Mendeskripsikan penggunaan media kartu bergambar dapat mengembangkan kemampuan bercerita anak kelompok A di TK Muslimat NU 34 Kota Malang. Metode Penelitian yang digunakan dalam penelitian ini adalah deskriptif kualitatif dan kuantitatif berbentuk penelitian tindakan kelas (PTK) dan dirancang dalam 2 (dua ) siklus . Masing-masing siklus terdiri dari 4 tahapan, yaitu: Perencanaan, tindakan, observasi, dan refleksi. Subyek penelitian ini adalah anak kelompok A TK Muslimat NU 34 Kota Malang sebanyak 18 anak. Metode pengumpulan data diperoleh melalui lembar observasi kegiatan anak selama proses pembelajaran dan dokumentasi berupa foto selama proses pembelajaran. Hasil penelitian menunjukkan bahwa penggunaan media kartu bergambar dapat mengembangkan kemampuan bercerita anak. Berdasarkan lembar observasi pada siklus 1, nilai rata-rata kemampuan bercerita mencapai 2.1 dengan nilai prosentase sebesar 51,3%. Pada siklus 2 kemampuan bercerita anak mengalami peningkatan dengan nilai rata-rata 3,1 dengan nilai prosentase 77,95%, artinya rata-rata kemampuan anak mengalami peningkatan sebesar 26,7% pada anak kelompok A di TK Muslimat NU 34 Kota Malang. Oleh karena itu dapat disimpulkan bahwa penggunaan media kartu bergambar dapat mengembangkan kemampuan bercerita anak kelompok A di TK Muslimat NU 34 Kota Malang. Berdasarkan hasil dan kesimpulan dalam penelitian tindakan kelas ini dapat di sarankan: Bagi guru, penelitian ini mampu menjadi inspirasi untuk merancang pembelajaran yang lebih kreatif dan inovatif . Untuk sekolah, penelitian ini dapat memberikan masukan guna meningkatkan kualitas dan kuantitas proses belajar mengajar. Bagi peneliti selanjutnya, peneliti selanjutnya dapat lebih mengembangkan kemampuan bercerita anak melalui media pembelajaran yang lebih kreatif lagi.  

Hubungan antara keaktifan dalam mengikuti musyawarah guru mata pelajaran (MGMP) dan kinerja guru SMP Negeri se-kecamatan Sananwetan Kota Blitar / Nur Atika Purnama Sari

 

Kata Kunci: Keaktifan, MGMP, Kinerja Guru merupakan elemen kunci dalam sistem pendidikan, khususnya di sekolah. Peranan guru juga sangat menentukan dalam usaha peningkatan mutu pendidikan formal. Mengingat tugas guru yang begitu berat, maka seorang guru dituntut untuk memiliki pengetahuan, wawasan, dan keterampilan yang sesuai dengan perkembangan zaman untuk menuju kepada pengembangan profesi yang diharapkan. Kualitas penguasaan pengetahuan, sikap, dan keterampilan menentukan kualitas kinerja guru. Salah satu upaya untuk meningkatkan kinerja guru adalah melalui forum Musyawarah Guru Mata Pelajaran (MGMP). MGMP adalah forum kegiatan profesional guru mata pelajaran yang sejenis.MGMP ini sangat diperlukan dalam memberikan kontribusi pada peningkatan keprofesionalan para anggotanya tidak hanya peningkatan kemampuan guru dalam menyusun perangkat pembelajaran tetapi juga peningkatan kemampuan, wawasan, pengetahuan serta pemahaman guru terhadap materi yang diajarkan dan pengembangannya. Berdasarkan latar belakang tersebut, peneliti tertarik untuk mengkaji lebih lanjut tentang Hubungan antara Keaktifan dalam Mengikuti Musyawarah Guru Mata Pelajaran (MGMP) dan Kinerja Guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar. Tujuan dari penelitian ini adalah: 1) untuk mengetahui tingkat keaktifan guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar dalam mengikuti MGMP; 2) untuk mengetahui tingkat kinerja guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar; dan 3) untuk mengetahui hubungan antara keaktifan dalam mengikuti MGMP dan kinerja guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar. Variabel dalam penelitian ini terdiri dari keaktifan dalam mengikuti MGMP sebagai variabel bebas dan kinerja guru sebagai variabel terikat. Populasi dalam penelitian ini adalah guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar, yang terdiri dari 5 sekolah dan jumlah guru sebanyak 271 orang, Teknik pengambilan sampel yang digunakan dalam penelitian ini adalah proportional random sampling. Untuk menghitung besarnya sampel dalam penelitian ini adalah dengan menggunakan tabel Krejcie, sehingga dapat diambil sampel sebanyak 159 orang. Metode pengumpulan data dalam penelitian ini menggunakan angket. Analisis data yang digunakan adalah analisis deskriptif dan korelasi product moment pearson. Berdasarkan analisis deskriptif menunjukkan bahwa keaktifan guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar dalam mengikuti MGMP termasuk dalam kategori sedang (42,77%). Sedangkan kinerja guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar termasuk dalam kategori sangat tinggi. Hal ini terlihat dari persentase frekuensi yang menunjukkan bahwa sebesar 55,35% responden memiliki kinerja yang sangat tinggi. Dari hasil analisis korelasi product moment pearson, menunjukkan bahwa rhitung lebih besar dari rtabel (0,372 > 0,155), sehingga hipotesis nol (H0) ditolak. Dengan demikian dapat disimpulkan bahwa terdapat hubungan yang signifikan antara keaktifan dalam mengikuti MGMP dan kinerja guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar. Mengingat ada hubungan antara keaktifan dalam mengikuti MGMP dan kinerja guru, maka disarankan kepada para guru SMP Negeri Se-Kecamatan Sananwetan Kota Blitar untuk lebih aktif mengikuti kegiatan-kegiatan yang ada dalam MGMP, sehingga kinerja guru yang sudah baik dapat dipertahankan. Kepada Kepala SMP Negeri Se-Kecamatan Sananwetan Kota Blitar hendaknya selalu memantau kinerja guru, serta memotivasi guru agar selalu meningkatkan kinerjanya melalui kegiatan-kegiatan MGMP.

Penerapan pakem untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS kelas IV SDN Lecari Kecamatan Sukorejo Pasuruan / Ahmad Syairur Rozi

 

Kata Kunci: Penerapan Pakem, Hasil Belajar. Ilmu Pengetahuan Sosial (IPS) merupakan salah satu mata pelajaran yang mengkaji seperangkat peristiwa, fakta, konsep dan kehidupan yang berkaitan dengan isu sosial. Guru sebagai pelaksana dan pengembang pembelajaran harus mampu memilih dan menerapkan pendekatan dan metode untuk meningkatkan hasil belajar siswa. Hasil obsevasi awal yang dilakukan peneliti, pada evaluasi akhir dihasilkan skor rata-rata 6,5 (tes akhir, 16 Juli 2010) ini dibuktikan dengan 9 dari 27 siswa yang mendapat nilai diatas standar ketentuan minimal. Antara kondisi pembelajaran yang dilaksanakan dengan hasil belajar yang dicapai, tampaknya bersinergi, Untuk mengatasi permasalahan ini dicarikan jalan keluarnya yaitu dengan model pembelajaran dan strategi pembelajaran yang digunakan dalam pembelajaran. Salah satu alternatif model yang dapat dikembangkan untuk memenuhi tuntutan tersebut adalah model pembelajaran Pakem, melalui penelitian tindakan kelas (PTK). Tujuan yang ingin dicapai dalam penelitian ini adalah untuk mendeskripsikan penerapan model pembelajaran Pakem dalam pelajaran IPS pada siswa kelas IV SDN Lecari Sukorejo Pasuruan. Mendeskripsikan hasil belajar siswa kelas IV SDN Lecari Sukorejo Pasuruan setelah diajarkan dengan menggunakan model pembelajaran Pakem. Pendekatan penelitian ini menggunakan pendekatan deskriptif kualitatif. Sedangkan jenis penelitiannya adalah penelitian tindakan kelas (PTK). Subjek penelitian adalah peserta didik kelas IV SDN Lecari yang berjumlah 27 peserta didik. Metode penelitian yang digunakan observasi dan tes. Sedangkan intrumen penelitiannya berupa panduan observasi dan soal-soal tes. Dari analisis pra tindakan, dan dari 27 siswa kelas IV terdapat 9 siswa tuntas belajar dan 18 siswa lainnya belum tuntas belajar dengan kriteria ketuntasan kelas 75%. Hasil observasi kemampuan siswa baik secara kelompok maupun individu pada siklus I diketahui bahwa dari jumlah seluruh siswa kelas IV yaitu 27 siswa, pada pre tes terdapat 7 siswa yang tuntas belajar dan 20 siswa yang belum tuntas belajar. Sedangkan pada post tes yang telah dilaksanakan diperoleh data bahwa 21 siswa telah tuntas belajar dan 6 siswa yang belum tuntas belajar. Dari siklus II diperoleh data dari 24 siswa telah tuntas belajar dan 3 siswa yang belum tuntas belajar. Berdasarkan penelitian yang dilakukan oleh guru (peneliti), maka Penerapan model pakem pada mata pelajaran IPS di kelas IV SDN Lecari sudah sesuai dengan langkah-langkah pakem. Penerapan pakem pada mata pelajaran IPS di kelas IV SDN Lecari sudah dapat dikatakan berhasil dengan adanya peningkatan aktivitas, interaksi, dan hasil belajar siswa. Hal itu ditunjukkan dari perolehan hasil belajar siswa dengan rata-rata pre tes 67,7 dengan 7 siswa yang tuntas belajar dan 20 siswa yang belum tuntas belajar. Sedangkan pada post tes siklus I yang telah dilaksanakan diperoleh data bahwa 21 siswa telah tuntas belajar dan 6 siswa yang belum tuntas belajar dengan rata-rata 79,4. Dari siklus II diperoleh data dari 24 siswa telah tuntas belajar dan 3 siswa yang belum tuntas belajar dengan rata-rata 80,3. Selanjutnya peneliti menyarankan bagi guru agar dapat menerapkan dan mengembangkan model pembelajaran pakem pada pembelajaran IPS kedalam kompetensi atau tema-tema yang lain, yang sesuai dengan situasi dan kondisi lingkungan sekolah masing-masing. Pembelajaran hendaknya dilaksanakan dengan selalu memberi kesempatan kepada siswa untuk terlibat langsung dalam proses pembelajaran.

Perbedaan persepsi stakeholders, kepala sekolah, dan guru terhadap ujian nasional di sekolah menengah kejuruan negeri Boyolangu Kabupaten Tulungagung / Ana Ningtyas

 

Kata Kunci: Persepsi, Stakeholders, Ujian Nasional Perkembangan IPTEKS sekarang sudah semakin pesat, oleh karena itu bangsa Indonesia dituntut untuk dapat beradaptasi dan bersaing. Sehingga pemerintah dituntut untuk membuat sebuah Kebijakan pokok pemerintah tentang perluasan akses pendidikan SMK sesuai dengan kebutuhan dan keunggulan lokal (Departemen Pendidikan Nasional, 2010). Kebijakan tersebut sangat menguntungkan bagi siswa lulusan SMK dan tidak melanjutkan ke Perguruan Tinggi (PT) karena mereka dapat bekerja secara langsung, tidak seperti siswa yang lulus dari Sekolah Menengah Atas (SMA). Perubahan tersebut juga terjadi di bidang kurikulum pada proses evaluasi yaitu Ujian Nasional (UN). Setiap kali diselenggarakannya UN pro-kontra masih terjadi diberbagai pihak. Seperti Mahkamah Agung (MA) yang melarang dilaksanakannya UN pada Maret 2010. Hal itu yang menjadi alasan penulis untuk mengadakan penelitian tentang persepsi stakeholders, kepala sekolah dan guru terhadap UN. Serta alasan penulis memilih SMK adalah adanya matapelajaran kejuruan diujikan pada UN. Adapun tujuan penelitian ini adalah untuk mengetahui sejauhmana persepsi stakeholders (DU/DI dan orangtua siswa), kepala sekolah dan guru terhadap UN. Karena selama ini pro-kontra juga terjadi pada Dunia Usaha atau Dunia Industri (DU/DI), orangtua siswa, kepala sekolah dan guru. Selain itu untuk mengetahui sejauhmana adanya perbedaan persepsi antara DU/DI, orangtua siswa, kepala sekolah, dan guru terhadap UN. Rancangan penelitiannya menggunakan rancangan penelitian survei dan deskriptif-komparasi. Untuk penelitiannya dilakukan di tiga sekolah yaitu SMKN 1, 2, dan 3 Boyolangu Kabupaten Tulungagung. Dari jumlah populasi DU/DI, orangtua siswa dan guru diambil 10% sampelnya sedangkan untuk kepala sekolah diambil dari jumlah populasi yaitu tiga orang. Dalam pengumpulan datanya peneliti meggunakan angket atau kuesioner. Hasil penelitian ini menunjukkan bahwa sebesar 94% atau sebanyak 338 orang menyatakan persetujuannya terhadap pelaksanaan UN. Dengan rician sebagai berikut: pertama, sekitar 93% atau 29 DU/DI menyatakan setuju karena melalui UN dapat menciptakan output yang unggul. Kedua, 95% orangtua siswa menilai bahwa melalui UN proses penilaian siswa lebih yang efektif dalam upaya peningkatan mutu. Ketiga, 67% atau 2 orang kepala sekolah menyatakan persetujuannya terhadap UN karena tingkat prestasi siswa dapat diketahui secara murni dapat diketahui tanpa adanya bantuan dari hasil nilai tugas-tugas lain. Sedangkan untuk persepsi guru 100% menyetujui dilaksanakannya UN, persepsi tersebut dimungkinkan memiliki alasan tersendiri yaitu UN merupakan produk kebijakan pemerintah sehingga harus dilaksanakan. Hal ini menunjukkan bahwa posisi UN masih mendapat dukungan dari berbagai pihak terhadap proses penilaian atau penentuan kelulusan yang dipusatkan atau secara nasional. Dengan tidak menyerahkan sepenuhnya kepada para guru di lembaga pendidikan atau sekolah masing-masing. Sehingga secara jelas tergambar bahwa Ujian Nasional layak dijadikan sebagai proses penilaian atau evaluasi hasil belajar pada akhir jenjang pendidikan.Selanjutnya untuk hasil uji hipotesis dengan menggunakan uji statistik analisis varian satu jalur (One Way Analysis of Variance) menunjukkan bahwa “ada perbedaan persepsi antara DU/DI, orangtua siswa, kepala sekolah, dan guru terhadap Ujian Nasional”. Kesimpulan hasil penelitian ini adalah (1) Persepsi DU/DI terhadap Ujian Nasional menunjukkan sebagian besar derajat persepsi menyatakan persetujuannya terhadap dilaksanakannya Ujian Nasional. Karena peranan penting DU/DI terhadap SMK, terhadap siswa SMK yang berkompeten setelah lulus dapat direkrut sebagai karyawannya dan hal ini merupakan upaya DU/DI dalam mengkuti perkembangan IPTEK pesat. (2) Persepsi orangtua siswa terhadap Ujian Nasional menunjukkan persetujuannya dengan adanya Ujian Nasional. Orangtua siswa masih menilai bahwa UN merupakan proses penilaian yang paling efektif. (3) Persepsi kepala sekolah terhadap Ujian Nasional juga menyatakan setuju, dan menganggap melalui UN kualitas sekolah utamanya siswa dapat diukur. (4) Sedangkan untuk persepsi guru terhadap Ujian Nasional sama 100% menyatakan setuju. Dengan alasan UN merupakan suatu kebijakan pemerintah yang secara nyata harus dilaksanakan. (5) Ada perbedaan persepsi DU/DI, orangtua siswa, kepala sekolah, dan guru terhadap pelaksanaan Ujian Nasional. Artinya terdapat perbedaan persepsi yang signifikan antara DU/DI, orangtua siswa, kepala sekolah, dan guru terhadap pelaksanaan Ujian Nasional. Jadi kesimpulannya adalah sebanyak 94% responden atau 338 orang menyatakan persetujuannya terhadap pelaksanaan Ujian Nasional. Alasannya UN masih mendapat perhatian dan perlu dipertimbangkan karena baik persepsi guru maupun orangtua siswa adanya persamaan persepsi yaitu melalui UN proses penilaian dapat berjalan efektif. Jadi disarankan kepada semua pihak agar utamanya pengelola Depertemen Pendidikan Nasional agar lebih intensif dalam mensosialisaikan dampak positif yang diberikan dari adanya pelaksanaan Ujian Nasional. Bagi kepala sekolah peran aktif kepala sekolah terhadap informasi yang akurat utamanya mengenai Ujian Nasional, memberikan arahan atau bimbingan serta selalu mengingatkan kepada para guru untuk memotivasi siswa lebih giat belajar. Bagi guru dalam penyampaian materi pelajaran lebih atraktif agar menarik perhatian siswa untuk lebih rajin belajar serta selalu memberikan penilaian bagi siswa pada tiga aspek (kognitif, afektif, dan psikomotorik). Bagi orangtua siswa sebagai senantiasa selalu memotivasi anaknya untuk selalu belajar dirumah agar ketika Ujian Nasional, anaknya tidak merasa kesulitan dalam mengingat materi yang sudah berlalu sewaktu menempuh pendidikan setingkat dibawahnya. Bagi DU/DI peran serta DU/DI dalam proses pembelajaran dapat membantu siswa setelah lulus memiliki wawasan cara beradaptasi dengan lingkungan kerja atau memberikan kesempatan lowongan untuk dapat bekerja di DU/DI tersebut. Sedangkan bagi siswa sebagai obyek sasaran dalam Ujian Nasional, diharapkan lebih rajin belajar karena selain nilai hasil UN siswa lulusan SMK harus mampu bersaing secara global dan berkarya sesuai bidangnya serta dapat melanjutkan ke jenjang pendidikan yang lebih tinggi.

Peningkatan hasil belajar pengukuran waktu melalui model contextual teaching and learning (CTL) pada siswa kelas II SDN Tanggung 2 Kota Blitar / Riona Mei Wanita Sari

 

Kata kunci: hasil belajar, pengukuran waktu, CTL Ditemukan fakta bahwa siswa kelas II SDN Tanggung 2 Kota Blitar banyak yang mengalami kesulitan ketika belajar tentang materi pengukuran waktu terutama dalam membaca dan menentukan waktu yang ditunjukkan oleh jarum jam. Berdasarkan hasil ulangan harian menunjukkan bahwa tidak seorang siswapun (0%) yang menguasai materi secara tuntas yaitu dengan nilai 100, siswa agak menguasai materi yaitu dengan nilai antara 75 sampai dengan 90 sebanyak 21,74%, dan sebagian besar (78, 26%) siswa kurang menguasai. Hal ini terlihat dari nilai mereka yang di bawah Peniaian Acuan Patokan (PAP) yaitu 75. Rendahnya penguasaan siswa dalam penggunaan alat ukur waktu dengan satuan jam atau dalam memahami konsep pengukuran waktu tersebut diduga karena guru kurang tepat dalam pemilihan cara dalam membelajarkan siswa serta belum mempergunakan media dalam pembelajaran. Untuk mengetahui adanya peningkatan hasil belajar siswa, maka dilakukan sebuah pembelajaran dengan menerapkan model pembelajaran Contextual Teaching and Learning (CTL). Penelitian ini bertujuan untuk mengetahui peningkatan hasil belajar pengukuran waktu melalui model pembelajaran Contextual Teaching and Learning (CTL) dengan media jam pada siswa kelas II SDN Tanggung 2 Kota Blitar. Penelitian ini dilakukan di SDN SDN Tanggung 2 Kota Blitar, tanggal 11 Oktober sampai 22 Nopember 2010. rancangan penelitian yang digunakan adalah melalui tahap siklus. Di mana dalam satu siklus tersebut terdiri dari perencanaan, pelaksanaan, observasi, dan refleksi. Sebelum dilaksanakan tahap siklus, terlebih dahulu dilakukan pra tindakan sebagai awal identifikasi masalah. Analisis data penelitian ini menggunakan teknik analisis data kualitatif. Hasil penelitian ini menunjukkan adanya peningkatan hasil belajar siswa kelas II dalam pembelajaran pengukuran waktu melalui model pembelajaran Contextual Teaching and Learning (CTL) dengan media jam. Peningkatan ketuntasan belajar siswa dari pra tindakan ke siklus I yaitu pada persentase ketuntasan individu dari 60,13% menjadi 82,78% pada siklus I dan 93,33% pada siklus II. Terjadi peningkatan sebesar 9,78% dari pra tindakan ke siklus I dan 10,15% dari siklus I ke siklus II. Pada persentase ketuntasan klasikal juga terjadi peningkatan. Ketuntasan klasikal pada pra tindakan sebesar 21,74% meningkat pada siklus I menjadi 73,91% dan pada siklus II menjadi 95,56%. Peningkatan persentase ketuntasan klasikal ini sebesar 52,17 % dari pra tindakan ke siklus I dan 21,65% dari siklus I ke siklus II. Persentase ketuntasan tersebut di atas sudah memenuhi bahkan melebihi PAP yaitu 75 % untuk ketuntasan individu, dan 80 % untuk ketuntasan klasikal. Berdasarkan hasil penelitian ini, dapat disarankan yaitu bagi peneliti lain agar menerapkan model pembelajaran Contextual Teaching and Learning (CTL) dalam pembelajaran di sekolah dasar, bagi para guru hendaknya menentukan model pembelajaran dan media yang tepat, dan menyusun RPP pada setiap pembelajaran, bagi sekolah untuk lebih bekerja keras dalam meningkatkan mutu pendidikan secara kreatif dan inovatif, bagi pemerintah untuk memberikan motivasi dan sarana prasarana yang mendukung pada sekolah sebagai penyemangat untuk menghasilkan out put (siswa) yang berkualitas.

Upaya meningkatkan pemahaman konsep fisika dengan menerapkan pembelajaran fenomenologis pada pokok bahasan keseimbangan benda tegar siswa kelas XI IPA 2 SMAK Andaluri Waingapu / Martina Elfira Natalinda Malo

 

Kata Kunci : Pemahaman konsep, pembelajaran fenomenologis Berdasarkan hasil observasi dan wawancara dengan guru fisika kelas XI IPA 2 SMAK Andaluri Waingapu diperoleh informasi bahwa selama proses pembelajaran guru memberikan materi fisika dengan metode ceramah dan diskusi kelas, metode praktikum dan diskusi dengan teman sebaya jarang diterapkan. Pemahaman konsep dan kemampuan menerapkan konsep siswa dalam kehidupan sehari-hari kurang, nilai ulangan ke-1 dengan materi gravitasi dan ulangan ke-2 dengan materi usaha dan energi pada semester I untuk pelajaran fisika dengan skor rata-rata 50,00 dan 60,00 dan hanya 6 orang siswa dari 36 siswa yang mencapai nilai di atas KKM yaitu 64,00. Oleh karena itu, perlu dilakukan penelitian yang dapat meningkatkan pemahaman konsep fisika dengan menerapkan konsep fisika dalam kehidupan sehari-hari. Salah satu pembelajaran yang dapat meningkatkan pemahaman konsep fisika adalah pembelajaran fenomenologis. Tujuan penelitian ini untuk mengetahui keterlaksanaan pembelajaran fenomenologis dapat meningkatkan pemahaman konsep fisika dan mengetahui peningkatan pemahaman konsep fisika pada pokok bahasan keseimbangan benda tegar siswa kelas XI IPA 2 SMAK Andaluri Waingapu melalui pembelajaran fenomenologis. Jenis penelitian yang digunakan adalah penelitian tindakan kelas berupa pembelajaran fenomenologis adaptasi dari Kemmis & Mc Taggart yang terdiri dari 2 siklus. Tiap siklus terdiri dari perencanaan, pelaksanaan tindakan, observasi, dan refleksi. Penelitian dilakukan di SMAK Andaluri Waingapu dengan subyek penelitian kelas XI IPA 2 dengan jumlah 36 siswa, terdiri dari 18 siswa perempuan dan 18 siswa laki-laki. Instrumen penelitian yang digunakan yaitu rancangan pelaksanaan pembelajaran (RPP), LKS, lembar observasi keterlaksanaan pembelajaran. Hasil penelitian menunjukkan bahwa Penerapan pembelajaran fenomenologis siswa pada siklus I sebesar 51,96%, sedangkan pada siklus II sebesar 84,37%, sehingga peningkatan penerapan pembelajaran fenomenologis siswa sebesar 32,41% dengan kategori baik. Sedangkan penerapan pembelajaran fenomenologis guru pada siklus I sebesar 83,33%, sedangkan pada siklus II sebesar 100%, sehingga peningkatan penerapan pembelajaran fenomenologis siswa sebesar 16,67% dengan kategori sangat baik. Hasil penelitian menunjukkan peningkatan pemahaman konsep fisika siswa melalui pembelajaran fenomenologis, dapat dilihat dari persentase rata-rata peningkatan pemahaman konsep fisika pada siklus I sebesar 50%, dan persentase rata-rata peningkatan pemahaman konsep fisika pada siklus II sebesar 78,75%. Berdasarkan hasil penelitian ini dapat diperoleh kesimpulan bahwa pembelajaran fenomenologis untuk menjelaskan materi fisika dapat meningkatkan pemahaman konsep fisika siswa. Hal ini ditunjukkan dari skor rata-rata tes pemahaman konsep fisika siswa mengalami peningkatan rata-rata 28,75%.

Hubungan pemahaman siswa tentang K3 dengan implementasinya di bengkel teknik permesinan SMK Muhammadiyah I Kepanjen / Wahyu Bangun Alfian

 

Kata kunci: pemahaman dan implementasi K3 Di semua tempat kerja selalu terdapat sumber bahaya yang dapat mengancam keselamatan maupun kesehatan tenaga kerja. Hampir tak ada tempat kerja yang sama sekali bebas dari sumber bahaya. Potensi bahaya di tempat kerja dapat ditemukan mulai dari bahan baku, proses kerja, produk dan limbah (cair, padat dan gas) yang dihasilkan. Seperti pada bengkel teknik pemesinan SMK Muhammadiyah I Kepanjen terutama bengkel kerja mesin , bengkel tersebut memiliki potensi bahaya kebakaran, keracunan, dan kecelakaan kerja. Potensi bahaya kebakaran di bengkel disebabkan oleh benda padat bukan logam (kertas, kayu, plastik), bahan cair yang mudah terbakar, benda atau barang yang berhubungan dengan listrik, serta benda atau barang logam. Setelah mengetahui dan memahami hal tersebut di atas, maka diperlukan penanganan terhadap semua potensi bahaya. Penelitian ini bertujuan untuk mengetahui pemahaman siswa tentang K3 di dalam melaksanakan praktikum, mengetahui implementasi K3 di Bengkel Teknik Pemesinan, mengetahui ada tidaknya hubungan pemahaman siswa tentang K3 dengan implementasinya di Bengkel Teknik Pemesinan. Penelitian ini dilakukan kepada siswa kelas XI Teknik Pemesinan 3 mengenai pemahaman siswa tentang K3 dengan implementasinya di Bengkel Teknik Pemesinan SMK Muhammadiyah I Kepanjen. Penelitian ini menggunakan metode deskriptif korelasional dengan pendekatan kuantitatif dimana angket digunakan sebagai instrumen pengumpul datanya. Hasil penelitian diperoleh: (1) Tingkat pemahaman siswa tentang K3 di dalam melaksanakan praktikum di Bengkel Teknik Pemesinan SMK Muhammadiyah I Kepanjen dengan katagori sangat tinggi sebesar 33%, kemudian katagori tinggi sebesar 61%, katagori rendah sebesar 5% dan katagori sangat rendah sebesar 0%. (2) Tingkat implementasi K3 di bengkel SMK Muhammadiyah I Kepanjen dengan katagori sangat tinggi sebesar 22%, kemudian katagori tinggi sebesar 69%, katagori rendah sebesar 8% dan katagori sangat rendah sebesar 0%. Berdasarkan penelitian ini, dapat disarankan (1) bagi siswa disarankan untuk mematuhi peraturan dan juga pedoman khususnya mengenai K3 di dalam melaksanakan praktikum di bengkel Teknik Pemesinan agar dalam pelaksanaannya tidak mengalami kecelakaan, (2) bagi guru praktikum disarankan untuk mematuhi peraturan dan juga pedoman khususnya mengenai K3 di dalam melaksanakan pengajaran praktikum di Bengkel Teknik Pemesinan. (3) bagi mahasiswa fakultas teknik Universitas Negeri Malang disarankan agar membekali mahasiswa khususnya program studi pendidikan teknik mesin sebelum praktik mengajar tentang standar K3 pada Bengkel di SMK.

Persepsi guru otomotif tentang tingkat motivasi belajar siswa kelas X Jurusan Teknik Kendaraan Ringan SMKN 1 Pungging, faktor-faktor yang mempengaruhi motivasi belajar dan upaya pengelolaannya / Ahmad Ady Dharmawan

 

Kata-kata kunci: persepsi, motivasi belajar, upaya pengelolaan. Motivasi merupakan salah satu faktor penting dalam suatu pembelajaran. Masalah mengenai motivasi belajar ini sering sekali muncul dalam proses pembelajaran disekolah-sekolah, tidak terkecuali di SMK yang sudah berstandart RSBI (Rintisan Sekolah Berstandart Internasional). Guru sebagai seorang pendidik harus mampu mengetahui bagaimana motivasi yang dimiliki oleh siswanya serta faktor-faktor apa saja yang dapat mempengaruhi motivasi tersebut. Sehingga dengan begitu guru dapat menentukan upaya-upaya yang tepat dalam mengatasi masalah-masalah yang dihadapi siswanya. Oleh karena itu persepsi guru mengenai motivasi siswa, faktor-faktor yang mempengaruhi motivasi belajar dan upaya pengelolaannya ini sangat penting untuk diteliti. Tujuan penelitian ini adalah untuk (1) mendeskripsikan persepsi guru tentang motivasi belajar siswa kelas X Jurusan Teknik Kendaraan Ringan SMKN 1 Pungging, (2) mendeskripsikan faktor-faktor yang mempengaruhi motivasi belajar siswa kelas X menurut guru di SMKN 1 Pungging, dan (3) mengetahui bagaimana upaya yang dilakukan guru dalam mengelola (meningkatkan dan mempertahankan) tingkat motivasi yang dimiliki siswa kelas X dalam mengikuti kegiatan belajar mengajar di SMKN 1 Pungging. Jenis penelitian ini adalah penelitian deskriptif kualitatif. Responden dalam penelitian ini adalah guru SMKN 1 Pungging yang mengajar Teknik Kendaraan Ringan dan guru BK, yang nantinya akan dijaring sebanyak-banyaknya menggunakan teknik sampling bola salju (snowball sampling), dimana peneliti mengambil 15 orang guru TKR dan 3 orang guru BK. Instrumen penelitian yang digunakan berupa teknik wawancara dan beberapa dokumentasi berupa kuisioner dan rekaman suara pada saat melakukan wawancara, serta catatan dari hasil wawancara. Teknik pengumpulan data yang digunakan adalah berupa wawancara, kuisioner dan observasi. Hasil penelitian ini (1) sebagian besar (12 orang) guru dari jurusan Teknik Kendaraan Ringan SMKN 1 Pungging mempersepsikan bahwa siswa kelas X jurusan Teknik Kendaraan Ringan mempunyai tingkat motivasi belajar yang tergolong tinggi, (2) menurut guru SMKN 1 Pungging ada dua faktor utama yang mempengaruhi motivasi belajar siswa yaitu yang berasal dari siswa itu sendiri (faktor internal) meliputi: minat, bakat, tingkat intelegensi dan kesiapan belajar, juga faktor yang berasal dari luar individu (faktor eksternal) yang meliputi: faktor ekonomi, keluarga, lingkungan sekolah, metode pembelajaran yang digunakan serta kelengkapan sarana dan prasarana, (3) menurut guru SMKN 1 Pungging khususnya guru Teknik Kendaraan Ringan dan guru BK untuk meningkatkan motivasi belajar siswa yang sudah bagus atau tinggi, dapat dilakukan dengan upaya-upaya seperti berusaha memfasilitasi apa yang dibutuhkan oleh para siswa untuk belajar lebih giat lagi, perlu diterapkannya sistem pembelajaran akselerasi, perlu diberikan reward atau penghargaan bagi siswa yang berprestasi, dan lain sebagainya sedangkan untuk siswa yang bermotivasi rendah dapat dilakukan dengan upaya-upaya seperti guru selalu keliling melihat apa yang dilakukan oleh siswanya dan menanyakan pemahaman mereka tentang materi yang disampaikan, memberikan peraturan yang tegas, ketika pelaksanaan KBM diselingi dengan hal-hal jenaka sehingga KBM tidak tegang terus menerus (refresh ditengah-tengah pembelajaran), memberikan pengarahan kepada orang tua/wali murid agar memberikan bimbingan dan dorongan kepada anaknya ketika berada di rumah tidak hanya di sekolah, dan lain sebagainya. Kesimpulan penelitian ini adalah (1) sebagian besar atau kebanyakan guru pengajar SMKN 1 Pungging khususnya Jurusan Teknik Kendaraan Ringan mempersepsikan bahwa motivasi belajar yang dimiliki oleh siswa kelas X Teknik Kendaraan Ringan tergolong tinggi, meskipun masih ada sebagian kecil atau beberapa guru yang beranggapan bahwa motivasi belajar siswa kelas X masih rendah, (2) guru-guru Jurusan Teknik Kendaraan Ringan berpandangan bahwa motivasi belajar yang dimiliki oleh siswa kelas X dapat dipengaruhi oleh faktor yang berasal dari diri siswa itu sendiri (faktor internal) dan faktor yang berasal dari luar (faktor eksternal), (3) cukup banyak cara atau upaya-upaya yang dapat dilakukan untuk mengelola motivasi belajar yang dimiliki oleh siswa kelas X menurut guru Jurusan Kendaraan Ringan SMKN 1 Pungging, untuk meningkatkan motivasi siswa yang sudah bagus dapat dilakukan antara lain dengan: memfasilitasi apa yang menjadi kebutuhan siswa untuk lebih giat belajar, perlu diterapkannya sistem pembelajaran akselerasi, memberikan reward atau penghargaan bagi siswa yang berprestasi, menerapkan metode pembelajaran yang lebih menarik dan komunikatif lagi dan lain sebagainya. Sedangkan bagi yang bermotivasi rendah dapat dilakukan dengan jalan seperti: memberikan pengarahan tentang pentingnya belajar dan pengorbanan orang tua dalam biaya sekolah, guru selalu menayakan tentang pemahaman siswa, melatih siswa berpendapat di dalam kelas, memberikan peraturan yang tegas, mengubah sistem atau metode pembelajaran yang lebih menarik dan komunikatif dan lain sebagainya.

Perbedaan pemahaman konsep daur hidup hewan siswa kelas IV MI. se-gugus Kecamatan Beji antara sebelum dan sesudah penerapan model inkuiri / Mohammad Rofik

 

Kata Kunci: Perbedaan Pemahaman Konsep, Daur Hidup Hewan, Sebelum Dan Sesudah Pembelajaran, Penerapan Inkuiri. Penelitian berlatar masalah penyebab rendahnya pemahaman konsep daur hidup hewan siswa kelas IV MI. Se-Gugus Kecamatan Beji diduga disebabkan oleh kegiatan pembelajaran yang bersifat reguler, artinya pemilihan pendekatan, strategi, metode kurang bervariasi. Pembelajaran dilakukan dengan hanya ceramah, tidak memberikan aktivitas yang bermakna, dan tidak memberikan kesempatan pada siswa untuk mengkonstruksi pengetahuan yang dipelajari. Oleh sebab itu adalah sangat rasional apabila model inkuiri ini dapat diterapkan di MI. Se-Gugus Madrasah Kecamatan Beji. Tujuan penelitian ini adalah 1). Mendeskripsikan pemahaman konsep daur hidup hewan siswa kelas IV MI. Se-gugus Kecamatan Beji sebelum menggunakan model inkuiri; 2). Mendeskripsikan pemahaman konsep daur hidup hewan siswa kelas IV MI. Se-gugus Kecamatan Beji sesudah menggunakan model inkuiri; 3). Mendeskripsikan perbedaan pemahaman konsep daur hewan siswa kelas IV MI. Se-gugus Kecamatan Beji antara sebelum dan sesudah pembelajaran dengan menggunakan Model Inkuiri. Dalam penelitian ini menggunakan rancangan penelitian eksperimen dengan pendekatan kuantitatif. Populasi yang diambil adalah MI se-gugus madrasah Kecamatan Beji. Adapun sampel yang diambil MI inti adalah MI Al-Ishlah dan sebagai MI imbas diambil secara random. Teknik pengumpulan data yang digunakan adalah instrumen butir soal tes. Instrument yang dipakai adalah butir-butir soal tes yang betul-betul valid dan Reliabel. Analisa datanya menggunakan rumus t-tes. Hasil pemahaman konsep daur hewan siswa kelas IV MI. Se-gugus Kecamatan Beji sebelum penerapan model inkuiri adalah mencapai rata-rata 39,20. Pemahaman konsep daur hewan siswa kelas IV MI. se-gugus Kecamatan Beji sesudah penerapan model inkuiri adalah mencpai rata-rata 83,95. Hasil perbedaan pemahaman konsep daur hewan siswa kelas IV MI. Se-gugus Kecamatan Beji antara sebelum dan sesudah penerapan model inkuiri setelah diuji dengan t test adalah, t hitung = 13,457, harga t tabel = 2,02. Jadi t hitung > harga t tabel. Berarti signifikan pada taraf kepercayaan 95 %. Disarankan bagi guru hendaknya dalam pembelajaran IPA dengan materi daur hidup hewan pada siswa kelas IV untuk menggunakan model inkuiri karena dapat meningkatkan pemahaman konsep siswa tentang daur hidup hewan.

Peningkatan kemampuan bersosialisasi anak melalui metode sosiodrama pada kelompok A di Taman Kanak-kanak Pelita Hati Sukun Pondok Indah Malang / Nur Ana Fatimah

 

Kata kunci : Metode Sosiodrama, Kemampuan, Bersosialisasi Soiodrama merupakan kegiatan anak untuk berekspresi dan mengungkapkan perasaan dalam bentuk percakapan, ekspresi wajah, penghayatan dan gerakan anggota badan. Dari observasi yang telah dilakukan, diketahui masalah penelitian adalah kemampuan bersosialiasi anak kelompok A TK Pelita Hati Malang masih rendah. Anak kurang memiliki keberanian untuk bercakap-cakap dengan teman lain sedangkan metode yang digunakan oleh guru adalah pemberian tugas. Untuk mengatasi permasalahan tersebut, maka peneliti memilih metode yang tepat untuk meningkatkan kemampuan bersosialisasi anak yaitu menggunakan metode sosiodrama. Dengan menggunakan metode sosiodrama, anak-anak dapat mengungkapkan ekspresinya melalui gerak, perasaan dan ekspresi wajah. Berdasarkan permasalahan tersebut maka dapat dirumuskan tujuan penelitian yaitu 1) untuk mendiskripsikan penerapan aktifitas permainan sosiodrama yang dapat meningkatkan proses kemampuan bersosialisasi siswa kelompok A TK Pelita Hati Malang, 2) untuk mendiskripsikan peningkatan kemampuan bersosialisasi siswa kelompok A TK Pelita Hati Malang. Penelitian ini dilakukan dengan pendekatan kualitatif interaktif dengan rancangan Penelitian Tindakan Kelas dalam dua siklus (siklus 1 dan siklus II). Pada setiap siklus terdiri dari perencanaan, tindakan, observasi dan refleksi. Teknik Pengumpulan datanya melalui observasi dan dokumentasi. Penelitian ini dilakukan pada Bulan Juli 2010 di TK Pelita Hati Malang dengan subyek penelitian sebanyak 20 anak. Hasil penelitian ini menunjukkan bahwa berdasarkan hasil tindakan siklus 1 menunjukkan indikator peningkatan kemampuanbersosialisasi anak sejumlah 17 % dengan skor rata-rata sebesar 65 %, selanjutnya pada tindakan siklus II mengalami peningkatan sejumlah 18 % dengan skor rata-rata sebesar 83 %. Meskipun tidak mencapai hasil 100 % namun bagi peneliti hasil ini sudah sangat memuaskan. Dengan terselesaikannya penelitian ini, dapat disimpulkan bahwa penerapan metode sosiodrama merupakan metode yang tepat untuk meningkatkan kemampuan bersosialisasi anak kelompok A TK Pelita Hati Malang. Ada beberapa saran yang dapat peneliti kemukakan diantaranya agar para guru hendaknya menggunakan metode sosiodrama, bagi kelas yang ingin mengatasi permasalahan sosial, mengubah pembelajaran dari berpusat pada guru menjadi berpusat pada anak, dan pengembangan situasi kearah yang lebih kondusif, maka disarankan untuk menggunakan metode sosiodrama dalam pembelajaran.

Pengembangan media bimbingan pribadi untuk pengenalan dan akomodasi emosi berbasis multimedia kepada siswa kelas VII di SMP Negeri 3 Malang / Indria Syaputri

 

Kata Kunci: Pengembangan Media, Bimbingan Pribadi, Pengenalan dan Akomodasi Emosi, dan Multimedia Pelaksanaan bimbingan dan konseling sangat memperhatikan perkembangan peserta didik diantaranya kematangan emosi siswa. Oleh karena itu peran konselor sangat penting dalam pemberian bimbingan pribadi tentang pengenalan dan akomodasi emosi terutama bagi remaja awal di SMP. Beberapa cara dalam pemberian layanan bimbingan adalah dengan ceramah dan permainan sederhana. Agar pemberian layanan bimbingan menjadi bermakna dan mencapai kompetensi yang diinginkan adalah dengan menggunakan multimedia yaitu Macromedia Flash MX. Olah karena itu, dilakukan penelitian pengembangan dengan rumusan masalah yaitu bagaimanakah bentuk dan isi multimedia yang dapat memberikan informasi bimbingan mengenai pengenalan dan akomodasi emosi yang dapat menarik perhatian siswa dan dapat memberikan siswa pembelajaran mengenai perkembangan emosi. Pengembangan media bimbingan mengikuti tahapan pengembangan 1) analisis kebutuhan dan karakteristik siswa, 2) analisis tujuan, 3) perumusan materi pembelajaran, 4) penyusunan naskah, 5) penyusunan alat evaluasi, 6) produksi media, 7) evaluasi dan revisi media. Uji coba produk dilakukan pada tiga subjek yaitu ahli materi, ahli media, dan responden. Instrumen pengumpulan data yang digunakan dalam pengembangan media bimbingan berupa angket. Data yang diperoleh berupa data kuantitatif dan kualitatif yang dianalisis dengan prosentase. Sedangkan hasil belajar siswa dianalisis dengan mencari skor yang diperoleh dari latihan soal. Berdasarkan teknik analisis rata-rata dari hasil validasi kelayakan pengembangan media bimbingan secara keseluruhan memiliki rata-rata nilai 85,01%. Hal ini menunjukkan bahwa media yang dikembangkan cukup layak digunakan sebagai media bimbingan. Produk yang dihasilkan adalah media bimbingan pribadi dengan materi pengenalan dan akomodasi emosi yang dikemas dalam CD (Compact Disc). Berdasarkan latihan soal untuk mengukur hasil belajar siswa kelas VII SMP Negeri 3 Malang, pada uji coba perseorangan perolehan nilai rata-rata dari 3 siswa adalah 96,97 maka kategorinya adalah A dengan interpretasi “sangat menguasai/ memahami materi”. Sedangkan untuk uji coba lapangan, nilai rata-rata yang diperoleh dari 40 siswa adalah 93. Berdasarkan data tersebut dapat disimpulkan bahwa siswa sangat memahami dan menguasai materi bimbingan yang diberikan melalui pengembangan media bimbingan pribadi untuk pengenalan dan akomodasi emosi.

Peningkatan kemampuan membaca permulaan pelajaran bahasa Inggris dengan model picture-word inductive (PWIM) siswa kelas 4 SDN Gunong Sekar 1 Sampang / Amir Hamzah

 

Kata kunci: kemampuan, membaca permulaan, model PWIM, sekolah dasar. Dalam proses pengajaran membaca agar anak dapat menguasai membaca dengan benar, perlu dilakukan beberapa proses kegiatan dalam membaca. Bum, Roe, dan Elinor(1996) berpendapat bahwa terdapat tujuh proses kegiatan dalam membaca yang harus dilakukan selama proses berlangsung, ketujuh kegiatan tersebut adalah:(1) mengamati simbol-sismbol tulisan, (2) menginterpretasikan apa yang diamati, (3) mengikuti urutan yang bersifat linier baris kata-kata yang tertulis, (4) menghubungkan kata-kata (dan maknanya) dengan pengetahuan, (5) membuat inferensi/sim-pulan dan evaluasi materi yang dibaca, (6) membangun asosiasi, dan (7) menyikapi secara personal kegiatan membaca sesuai dengan interesnya (dalam Syafi’I, 1999:262). Adanya kesalahan dalam menerapkan konsep membaca permulaan akan menyebabkan siswa mengalami kegagalan dalam memahami teks bacaan sehingga kadang-kadang menyebabkan siswa menjadi frustasi apabila dibebani tugas untuk mengerjakan soal-soal yang berkaitan dengan keterampilan membaca. Sebagaimana pendapat Harp (1987) “ children at the praoperational level lack many of the concepts needed to understand reading and writing processes, and they are often frustrated when teachers expect them to perform such beginning reading tasks as memorizing rules.” (dalam Burn, Roe dan Ross, 1996: 41). Penelitian ini bertujuan untuk mendiskripsikan upaya peningkatan keterampilan membaca permulaan pada pelajaran bahasa Inggris dengan menggunakan Picture-Word Inductive Model (PWIM) pada tahap perencanaan, pelaksanaan dan evaluasi. Untuk mengetahui peningkatan kemampuan membaca permulaan, penelitian ini merumuskan masalah sebagai berikut. “Bagaimanakah meningkatkan kemampuan membaca permulaan pelajaran bahasa Inggris dengan dengan model PWIM?” (a) “Bagaimanakah proses meningkatkan kemampuan membaca permulaan pelajaran bahasa Inggris dengan model PWIM?” dan (b) “Bagaimanakah hasil meningkatkan membaca permulaan pelajaran bahasa Inggris dengan model PWIM?” Untuk menjawab pertanyaan di atas, penelitian ini menggunakan pendekatan kualitatif deskriptif dengan rancangan penelitian tindakan kelas. Rancangan penelitian dilaksanakan berdasar tiga siklus tindakan atas kolaborasi antara guru dengan peneliti. Setiap siklus tindakan dilaksakan berdasar alur tindakan yang meliputi kegiatan perencanaan, pelaksanaan, pengamatan dan refleksi. Data penelitian berupa informasi mengenai proses tindakan (hasil pengamatan dari perencanaan dan pelaksanaan), serta hasil tes siswa sebelum pelaksaan kegiatan perbaikan. Hasil tes kegiatan siswa yang dijadikan tindakan di siklus berikutnya apabila taraf penguasaannya kurang dari target pencapaian (70%). Subyek penelitian siswa kelas 4 SDN Gunong Sekar 1 Sampang, sejumlah 38 siswa yang secara aktif mengikuti kegiatan tanpa membedakan gender. Pada tahap awal disusun satuan pembelajaran yang berisi tujuan pembelajaran khusus, materi, metode, media, sumber belajar, serta evaluasi. Materi pembelajaran disesuaikan dengan kurikulum 2006 (Kurikulum Tingkat Satuan Pendidikan), yakni membaca tema-tema yang sesuai dengan kegiatan siswa sehari-hari. Pada tahap pelaksaan membaca, proses pembelajaran berlangsung ditandai adanya interaksi antara guru dan siswa dalam bentuk dialog, tanya-jawab, penjelasan materi, penugasan untuk mengarahkan dan merekontruksi pengalaman sehari-hari. Dalam pembelajaran siswa diharuskan mengidentifikasi, membuat simpulan dan membangun asosiasi tentang bacaan yang dibaca. Tahap pasca membaca dilaksanakan melalui interaksi dan diskusi kelas yang dapat melatih siswa dalam mengembangkan kemampuan identifikasi, menyimpulkan dan membangun asosiasi bacaan dengan pengalaman hidupnya sehingga mampu mengontruksi kandungan makna dari bacaan yang dibaca. Hasil evaluasi yang dilakukan setiap akhir kegiatan perlakuan menunjukkan perkembangan yang baik. Taraf penguasaan rata-rata di siklus I (52,77%), mengalami peningkatan dari pencapaian pretest hanya (0,72%) di siklus II rata-rata (57,08%) dan di siklus III (70,27%) Pada siklus III pencapai hasil sudah memenuhi target (70%). Bertolak dari hasil penelitian tersebut, disarankan agar (1) guru bahasa Inggris kelas 4 SDN Gunong Sekar 1 Sampang dapat menularkan PWIM dalam pembelajaran kemampuan membaca permulaan kepada guru-guru mata pelajaran bahasa Inggris SD, khususnya di lingkungan Kabupaten Sampang, karena terbukti dapat mengontruksi kemampuan pemahaman anak terhadap teks-teks bacaan bahasa Inggris, (2) guru bahasa Inggris kelas 4 SDN Gunong Sekar 1 Sampang perlu meneruskan bimbingan kepada siswa terutama yang berkaitan dengan pembangunan asosiasi antara gambar dan bacaan dengan pengalaman dalam kehidupan sehari-hari, (3) model ini dikembangkan oleh peneliti untuk mempermudah memahami bacaan dalam teks bahasa Inggris kelas rendah yang banyak dibantu oleh gambar-gambar. Untuk itu peneliti berharap agar model PWIM digunakan dalam kegiatan membaca permulaan khususnya dan bisa juga untuk keterampilan membanca lanjutan, baik di SDN Gunong Sekar 1 Sampang maupun di sekolah dasar lainnya.

Peningkatan kualitas pembelajaran IPS kelas V menggunakan model peta konsep di SDN 1 Pisangcandi Kecamatan Sukun Kota Malang / Rachmat Eko Riza S.

 

Kata kunci: kualitas pembelajaran, IPS, model peta konsep Pendidikan Ilmu Pengetahuan Sosial (IPS) memegang peranan penting dalam mengembangkan kemampuan hidup siswa. IPS memuat materi-materi yang mengajarkan kepada para siswa cara berinteraksi dengan lingkungan sosialnya dan cara-cara memecahkan masalah sosial yang dihadapi oleh para siswa. Pembelajaran IPS selama ini menggunakan pendekatan teacher centered dengan metode pembelajaran yang sering digunakan adalah metode direct teaching. Akibatnya adalah pengetahuan siswa tentang lingkungan sosialnya menjadi sempit dan kemampuan memecahkan masalah-masalah sosial yang dihadapi oleh siswa menjadi terbatas. Implikasi dari cara membelajarkan IPS di SD dengan pendekatan teachers centered tampak saat observasi pembelajaran peninggalan sejarah berskala nasio-nal masa Hindu, Budha, dan Islam di kelas V SDN 1 Pisangcandi Kecamatan Sukun Kota Malang. Siswa tampak malas dan kurang antusias karena dominasi guru sangat besar saat pembelajaran. Suasana kelas menjadi tidak kondusif ketika siswa merasa bosan dan merasa tidak dilibatkan. Siswa juga kesulitan untuk memahami materi yang diajarkan oleh guru, karena harus menghapal. Efek secara umum adalah kualitas pembelajaran IPS di kelas V menjadi rendah. Salah satu cara pemecahan masalah rendahnya kualitas pembelajaran IPS kelas V SD adalah dengan menggunakan model pembelajaran peta konsep. Peta konsep berfungsi untuk memvisualisasikan konsep utama dan konsep-konsep pendukung agar mudah dipahami hubungan antar konsep tersebut. Dalam hal ini, konsep utamanya adalah peninggalan sejarah berskala nasional di Indonesia dan konsep-konsep pendukungnya adalah peninggalan sejarah dari kerajaan-kerajaan masa Hindu, Budha, dan Islam. Tujuan dari penelitian tindakan kelas ini adalah untuk mengetahui pene-rapan model pembelajaran peta konsep dalam peningkatan kualitas pembelajaran IPS kelas V SD dan apakah penggunaan model pembelajaran peta konsep dapat meningkatkan kualitas pembelajaran IPS kelas V SD di SDN 1 Pisangcandi Kecamatan Sukun Kota Malang. Penelitian ini tergolong dalam Penelitian Tindakan Kelas (PTK) dengan pendekatan problem solving. Penelitian ini dilaksanakan dalam 2 siklus. Setiap siklus menggunakan model Kemmis dan Taggart meliputi perencanaan tindakan, pelaksanaan tindakan, observasi tindakan, dan refleksi hasil tindakan. Subyek penelitian adalah siswa kelas V tahun pelajaran 2010-2011 SDN 1 Pisangcandi Kecamatan Sukun Kota Malang. Instrumen yang digunakan adalah lembar obser-vasi kemampuan guru dalam merencanakan pembelajaran, kemampuan guru dalam melaksanakan pembelajaran, kemampuan afektif siswa, kemampuan siswa dalam membuat peta konsep, dan interaksi, suasana serta kreativitas belajar. Aspek peta konsep yang diamati adalah penggunaan gambar atau foto sebagai konsep utama, menggunakan garis lengkung untuk menghubungkan antar konsep, menggunakan berbagai warna, dan menggunakan satu kata kunci untuk meng-gambarkan hubungan antar konsep. Hasil penelitian menunjukkan kualitas pembelajaran IPS Kelas V SD meningkat. Kemampuan guru dalam merencanakan pembelajaran pada siklus 1 dengan skor 95 dan siklus 2 dengan skor 95. Kemampuan guru dalam melak-sanakan pembelajaran pada siklus 1 dengan skor 87,5 dan meningkat pada siklus 2 dengan skor 93,75. Kemampuan afektif siswa pada siklus 1 mendapat skor 68 meningkat pada siklus 2 dengan skor 80. Kemampuan siswa dalam membuat peta konsep pada siklus 1 dengan skor 83 meningkat pada siklus 2 dengan skor 89. Dan interaksi, suasana belajar, dan kreativitas pada siklus 1 dengan skor 89 dan meningkat pada siklus 2 dengan skor 94. Terdapat beberapa kendala selama pelaksanaan penelitian tindakan kelas ini, diantaranya adalah penguasaan kelas yang kurang optimal, media pembelaja-ran yang kurang menarik perhatian siswa, luasnya materi pembelajaran, dan kurangnya dukungan dari sekolah untuk menunjang pembelajaran yang efektif dan efisien. Berdasarkan hasil penelitian maka disimpulkan bahwa penggunaan model pembelajaran peta konsep dapat meningkatkan kualitas pembelajaran IPS Kelas V SD, khususnya pada materi peninggalan sejarah berskala nasional masa Hindu, Budha, dan Islam di Indonesia. Saran penelitian adalah mengkombinasikan peta konsep dengan media dan metode pembelajaran yang lain untuk menciptakan suasana belajar yang lebih menyenangkan dan penuh kreativitas. Selain itu perlu memperhatikan syarat pembentukan kelompok yang baik dan penguasaan kelas yang baik agar kondisi kelas tetap kondusif.

Pengaruh jenis batuan sedimen penutup pada bentuk lahan karst terhadap kualitas air tanah di Kecamatan Lengkong Kabupaten Nganjuk / Miftakul Janah

 

Kata kunci: kualitas air tanah, jenis batuan sedimen penutup Penyediaan air selalu dikaitkan dengan kondisi air yang sehat atau air yang tidak berbahaya untuk dikomsumsi. Aspek fenomena bentuk lahan akan memengaruhi kualitas maupun kuantitas dari air tanah. Formasi geologi dari setiap mineral batuan akan membentuk unsur atau senyawa kimia yang berpenga-ruh terhadap air tanah. Di wilayah Kecamatan Lengkong ditemukan kasus bahwa di semua tempat pemasak air ditemukan endapan kapur. Temuan tersebut menim-bulkan dugaan bahwa di daerah ini banyak mengandung kapur sehingga masya-rakat mengasumsikan jika mengonsumsi air tanah di Kecamatan lengkong ini tidak baik untuk kesehatan. Namun dari data Nganjuk Dalam angka tahun 2007 menunjukkan bahwa masyarakat Kecamatan Lengkong tidak banyak yang mengidap penyakit batu ginjal sebagai penyakit yang timbul jika tubuh banyak mengonsumsi zat kapur. Tujuan dari penelitian ini adalah menganalisis perbedaan satuan bentuk lahan karst, menganalisis perbedaan kualitas air tanah berdasarkan jenis batuan sedimen penutup pada bentuklahan karst di Kecamatan Lengkong, dan mengeta-hui kualitas air tanah di Kecamatan Lengkong Kabupaten Nganjuk apakah masih memenuhi standar baku mutu air minum golongan A menurut PERMENKES N0.416/ MENKES/PER/ IX/1990. Metode yang digunakan dalam penelitian ini adalah metode survey. Penentuan satuan bentuklahan dan jenis batu sedimen penutup menggunakan cara overlay peta geologi lembar Surabaya dan peta rupa bumi Indonesia (RBI) Kabupaten Nganjuk. Penentuan kualitas air menggunakan cara pembandingan (comparative) antara kualitas air dengan standar baku mutu air untuk golongan A yang sudah ditetapkan dalam PERMENKES No.416/MENKES/PER/IX/1990. Hasil penelitian menunjukkan bahwa ada perbedaan satuan bentuklahan di Kecamatan Lengkong, yaitu perbukitan karst dan dataran karst. Kualitas kimia air tanah pada bentuklahan karst di Kecamatan Lengkong menunjukkan tidak ada perbedaan, dikarenakan satuan bentuklahan kurang bervariasi dan pengaruh batu-an induk masih mendominasi yaitu batuan sedimen organik (baca: batuan gam-ping/karst). Ditemukan pula penyimpangan teori bahwa batuan akuifer gunung api kuarter memiliki kandungan Fe rendah dan CaCO3 yang tinggi dikarenakan dae-rah ini merupakan daerah imbuhan/ recharge area sehingga banyak mineral terla-rut dengan aliran air tanah yang menuju tempat ini. Air tanah di Kecamatan Leng-kong masih memenuhi kriteria sebagai air minum Golongan A, sehingga masuk dalam kategori aman untuk dikonsumsi secara langsung. Kesimpulan dari penelitian ini adalah pengaruh batuan sedimen pada bentuk lahan karst di Kecamatan Lengkong Kabupaten Nganjuk tidak besar jika dibandingkan dengan fakta di lapangan bahwa terdapat empat macam batuan sedimen penutup dan dua satuan bentuklahan karst, namun hasil uji laboratorium menunjukkan kualitas kimia air tanah tidak ada perbedaan. Hal ini dikarenakan batuan induk yaitu batuan sedimen organik karst lebih mendominasi.

Pemanfaatan sumber belajar lingkungan terdekat siswa melalui observasi untuk meningkatkan hasil belajar materi norma yang berlaku di masyarakat bagi siswa kelas III A SDN Kotalama 5 Malang / Rifa Nurdiana

 

Kata kunci: Pemanfaatan sumber belajar, Melalui Observasi, Hasil Belajar PKn SD Berdasarkan hasil observasi dan evaluasi dalam pembelajaran PKn guru sering menggunakan metode ceramah dan tanya jawab saja. Faktanya, siswa kelas III A SDN Kotalama 5 Malang hanya mencapai nilai rata-rata 50 padahal KKM yang ditetapkan adalah 65. Oleh karena itu untuk meningkatkan hasil belajar PKn, peneliti mencoba menerapkan pemanfaatan sumber belajar melalui observasi. Yaitu pengamatan dan pencatatan secara sistematik terhadap gejala yang tampak pada objek penelitian. Penelitian ini diracang dengan menggunakan Penelitian Tindakan Kelas yang terdiri dari siklus. Subjek yang dikenai tindakan adalah siswa SDN Kotalama 5 Malang. Pemanfaatan sumber belajar melalui observasi dimulai dengan tanya jawab tentang peristiwa-peristiwa di masyarakat. Kemudian siswa diberi kebebasan mengambil permen yang disediakan. Setelah itu, siswa diminta menyebutkan apa saja yang terjadi ketika mengambil permen tanpa peraturan. Kemudian siswa menyebutkan cara yang tepat agar permen tadi dibagi rata dan siswa mempraktekkannya. Hasil penelitian menunjukkan bahwa pemanfaatan sumber belajar melalui observasi mampu meningkatkan hasil belajar dan aktifitas belajar siswa. Siswa jadi lebih antusias, lebih berani bertanya, dan lebih kreatif dalam pembelajaran. Saran dari penelitian adalah penerapan pemanfaatan sumber belajar terdekat siswa melalui observasi perlu diterapkan dan dikembangkan pada mata pelajaran lain pada umumnya dan pada pelajaran PKn pada khususnya.

Peningkatan kecerdasan interpersonal melalui permainan kooperatif di kelompok B TK Dewi Sartika Batu / Fitriyah Wulan Cahyani

 

Keywords: Interpersonal intelligence, cooperative playing. Underlying this research by the condition of children in group B Dewi Sartika Kindergarten Batu is still exists some that has not been smart in interpersonal.16 children only 4 children can interact and work together, as well. Program given by the teachers still tend to be obsolete. Therefore, need for efforts to improve interpersonal intelligence in children B group Dewi Sartika Batu. Improving interpersonal intelligence is done through the application of cooperative playing. Because a cooperative playing is learning strategies that give children the opportunity to interact and collaborate in learning activities. The objective in conducting this research is to improve interpersonal intelligence of children through the implementation of the cooperative playing that gave priority to cooperation activities within the group so that there is interaction, interpersonal communication, and the promotion of mutual assistance and knowledge sharing among friends. This study conducted in Dewi Sartika Kindergarten Batu. Research design that will be used is class action framework. Researchers collaborating with the Mrs. Ukmiati, teacher on group B Dewi Sartika Kindergarten Batu starting from observation, problems identification, action planning, implementation, monitoring and reflection. The results showed that the application of cooperative playing can increase an interpersonal intelligence on children group B Dewi Sartika Kindergarten Batu. Improvement of interpersonal intelligence is marked with: (1) practical implementation of cooperative playing with the theme of plants by the teacher on group B Dewi Sartika kindergarten Batu accordance with the set design collaboratively with both, (2) teachers more creatively to develop learning and fun learning environment for students. Implementation of cooperative playing can improve: (1) ability of student cooperation, (2) ability to maintain friendships, (3) communication skills, (4) willingness to help each other when performing activities, and (5) willingness to share knowledge. Suggest that the improvement in student interpersonal intelligence on group B Dewi Sartika Kindergarten Batu performed by applying cooperative playing. This research can be used for other kindergarten whose state is relatively the same with kindergarten which became the stage.

Peningkatan kemampuan berbicara pada siswa kelompok B melalui metode bercerita di Taman Kanak-kanak Al-Falah Kota Batu / Yayuk Hastining Rahayu

 

Kata kunci : PAUD, Pengembangan bahasa, metode bercerita Penelitian ini berlatar belakang adanya kualitas praktek pembelajaran bercerita di TK Al Falah Batu yang masih belum maksimal.Kegiatan pembelajaran bercerita masih sangat jarang dilakukan anak,masih terpusat pada guru,dan masih belum memanfaatkan lingkungan sebagai sarana belajar yang menyenangkan,disamping itu kemampuan berbicara anak masih relative rendah. Tujuan dari penelitian ini adalah: 1) Penerapan metode bercerita dapat meningkatkan kemampuan berbicara siswa di kelas B TK Al Falah Batu 2) untuk mendeskripsikan kemampuan berbicara siswa di kelas B TK Al Falah Batu. Metode penelitian yang digunakan dalam penelitian ini adalah berbentuk PTK dan dirancang dalam 2 (dua) siklus. Masing-masing terdiri dari 4 tahapan 1) perencanaan 2) tindakan dan observasi 3) refleksi 4) perbaikan rencana . refleksi. Subyek penelitian ini adalah siswa kelompok B Taman Kanak – Kanak Al Falah Kecamatan Batu Kota Batu sebanyak 16 anak. Metode pengumpulan data diperoleh melalui lembar observasi aktivitas anak selama proses pembelajaran dan dokumentasi berupa foto selama pembelajaran. Hasil penelitian menunjukkan bahwa penerapan metode bercerita dapat meningkatkan kemampuan berbicara anak kelompok B TK Al Falah Batu. Peningkatan kualitas pembelajaran tersebut ditandai dengan:(1)diterapkannya metode bercerita anak lebih runtut dan lancar dalam bercerita;(2)ketergantungan guru pada buku teks berkurang ;(3)pembelajaran lebih terpusat pada anak;(4)penilaian hasil belajarnya tidak melalui tes;(5)situasi belajarnya lebih kondusif. Berdasarkan hasil penelitian dan pembahasan sebelumnya, secara umum dapat disimpulkan bahwa penerapan metode bercerita dapat menunjukkan kemampuan berbicara anak kelompok B di TK Al Falah Batu. Secara khusus peningkatan ini ditandai dengan tumbuhnya keberanian anak untuk bercerita secara individu di depan kelas. Selain itu dengan metode bercerita kemampuan berbicara anak menunjukkan peningkatan dari siklus I dan siklus II. Oleh karena itu dari jumlah anak dalam satu kelas hanya ada empat anak saja yang belum maksimal sesuai dengan indikator ketercapaian, maka siklus II ini sudah dinyatakan peneliti untuk diakhiri. Dari kesimpulan tersebut maka dirasakan bagi guru Taman Kanak Kanak untuk menggunakan metode bercerita pada kegiatan pembelajaran, namun berpusat pada anak, sehingga muncul keberanian dan rasa percaya diri dari anak didik kita. Selanjutnya disarankan bagi peneliti di masa mendatang menggunakan penelitian yang serupa dengan cara mengembangkan kearah model yang lebih baik menarik dan sempurna.

Peningkatan kemampuan menceritakan kembali isi cerita secara sederhana dengan media audio visual di TK Plus Al Irsyad Al Islamiyah Batu / Nurdjanah

 

Keywords : simply story retelling, visual audio media, Kindergarten. This research has background of low ability narrate to return the story content simply at group of A in TK Plus Al-Irsyad Al Islamiyyah at Batu. Teacher not yet given the appropriate media in developing ability narrate to return the story content simply. Despitefully also interest, being active, feel to happy, and creativity of child in activity learn still lower. This research aim to increase child ability in narrating to return the story content simply at TK Plus Al Irsyad Al lslamiyyah at Batu which marked with the visual audio media utilization, To Improving of interest, being active, feel to happy, and creativity of child. To reach the target above, this research is conducted with the device of research of class action (PTK) with the model learn as researcher. Researcher assisted by teacher of co-laborers of group of A in TK Plus of Al Irsyad Al Islamiyyah at Batu as collaborator, start from phase process to identify, the problem, planning, the action, action realization, observation, and reflection. For the result, it is indicate that the visual audio media utilization can improve the ability narrate to return the story content simply in TK Plus of Al Irsyad Al-Islamiyyah at Batu. Improving of study quality marked with the utilization of visual audio media in TK Plus Al Irsyad Al-Islamiyyah at Batu according to design compiled by researcher and teacher co-laborers as collaborator. Despitefully visual audio media exploiting can improve: (1) interest, being active, (3) feel to happy, (4) creativity of child in correct reading and narrate to return the story content simply. The suggesting that in improving child ability narrate to return the story content simply teaches the group A exploit the visual audio media. The result of this research is very possible applied in other Kindergarten if its condition relative equal or look like with the school becoming this research background. However, it suggested for further researcher to exploit the visual audio media at effort to improve of other ability.

Kematangan sosial anak yang mengikuti kelompok bermain (playgroup) dengan sistem sekolah sehari penuh (fullday school) (studi kasus di PG/TK Al Huda Bagus Malang) / Endita Alrobby

 

Kata kunci: kematangan sosial anak, playgroup, fullday school, studi kasus, PG/TK Al Huda Bagus Malang Layanan pendidikan anak usia dini sangat berpengaruh terhadap perkembangan anak selanjutnya hingga dewasa. Di samping Taman Kanak-kanak (TK), dewasa ini masyarakat terutama para orang tua mulai mengenal bentuk pendidikan prasekolah yang lain, yaitu kelompok bermain (playgroup). Namun kemudian pendidikan ini berkembang lagi menjadi kelompok bermain dengan sistem sekolah sehari penuh (fullday school), demi menjawab kekhawatiran para orangtua sibuk bekerja yang kesulitan menjaga putra-putrinya. Ketika anak berada di sekolah selama sehari penuh tanpa pendampingan orangtua, maka dibutuhkan kematangan sosial yang cukup pada anak. Melihat fenomena sekolah sehari penuh yang saat ini sedang marak dan menjadi trend di Indonesia, mendorong dilakukannya penelitian ini. Adapun tujuan dari penelitian ini adalah untuk mengungkap kematangan sosial anak yang mengikuti playgroup di fullday school tersebut, terutama setelah kurang lebih 1 bulan bersekolah. Penelitian ini menggunakan jenis pendekatan penelitian kualitatif dengan model penelitian studi kasus. Subjek penelitian dalam penelitian ini berjumlah empat orang dengan kriteria sebagai berikut: (1) Siswa di PG/TK Al Huda Bagus Malang dengan usia 2-4 tahun, (2) Anak dalam kondisi sehat secara fisik dan psikologis, (3) Sudah bersekolah selama minimal 1 bulan, (4) Disetujui oleh orangtua subyek. Alat pengumpul data yang digunakan adalah (1) Observasi, (2) Wawancara mendalam, (3) Dokumentasi. Analisis data menggunakan teknik analisis isi dengan tahapan menggunakan lambang-lambang tertentu, mengklasifikasi data tersebut dengan kriteria-kriteria tertentu, melakukan prediksi, serta menarik kesimpulan. Teknik pengecekan keabsahan data dilakukan dengan triangulasi. Hasil penelitian ini menunjukkan keempat siswa playgroup di fullday school PG/TK Al Huda Bagus Malang sebagai subyek penelitian memiliki self-help general yang baik, self-help dressing yang kurang, self-help eating yang baik, locomotion yang sangat baik, occupation yang sangat baik, communication yang sangat baik, dan socialization yang sangat baik. Berdasarkan hasil penelitian ini, disarankan bagi Fullday school PG/TK Al Huda Bagus Malang untuk dapat meningkatkan aspek kematangan sosial ketrampilan berpakaian (self-help dressing) dan ketrampilan makan (self-help eating) para siswanya dengan memaksimalkan metode Learning by Doing (penyampaian dengan praktek langsung) yang sudah ada dan kemudian dilanjutkan dengan pembiasaan.

Pengembangan kemampuan berbahasa anak melalui metode bercerita di kelompok B Roudhotul Athfal Al Hidayah Grogolan Ngembe Beji Pasuruan / Nusrotin

 

Kata kunci: Metode bercerita, Kreativitas, Roudhotul Athfal. Penelitian ini bertujuan meningkatkan kreativitas siswa dengan metode bercerita di kelompok B RA Al-Hidayah Grogolan Ngembe Kecamatan Beji Kabupaten Pasuruan. Berdasarkan hasil observasi dan wawancara dengan guru kelas diketahui bahwa ada permasalahan dalam pembelajaran di kelompok B. Secara umum permasalahan tersebut dapat diidentifikasi menjadi beberapa masalah, yaitu model pembelajaran yang dilakukan oleh guru kurang tepat, kegiatan pembelajaran pada umumnya dilakukan dengan ceramah, dan penggunaan media pembelajaran yang tersedia di sekolah kurang optimal, sehingga motivasi belajar siswa rendah, yang ditandai oleh kurang aktifnya siswa dalam mencari pengetahuan sendiri dan hanya menunggu pemberian materi dari guru, hal ini berdampak pada perkembangan kreativitas siswa kurang baik. Oleh karena itu penelitian ini bertujuan untuk meningkatkan kreativitas siswa tersebut menggunakan pembelajaran dengan metode bercerita, terutama dalam upaya meningkatkan kreativitas berbahasa siswa melalui penelitian tindakan kelas (PTK). Penelitian ini bertujuan untuk: 1) mendeskripsikan pelaksanaan pembelajaran dengan menggunakan metode bercerita, 2) mendeskripsikan peningkatan kreativitas siswa dalam kemampuan menggunakan kosakata dan berbahasa dikelompok B RA Al-Hidayah Grogolan Beji. Untuk itu peneliti akan membuat rancangan penelitian ini dengan menggunakan 2 siklus, yang tiap siklus terdiri dari perencanaan, pelaksanaan, observasi, refleksi. Subyek dalam penelitian ini adalah siswa kelompok B RA Al Hidayah sebanyak 13 siswa. Data penelitian diperoleh dari hasil observasi dan wawancara. Hasil penelitian pelaksanaan pembelajaran dengan metode bercerita sebagai berikut: 1) bahasa yang sederhana, 2) mudah diterima oleh siswa, 3) menarik bagi siswa. Hal ini menunjukkan bahwa pelaksanaan metode bercerita dapat meningkatkan kreativitas bahasa siswa dalam kemampuan menggunakan kosakata dan bahasa yang sederhana serta kemampuan menceritakan pengalaman secara sederhana, khususnya siswa kelompok B RA Al-Hidayah Grogolan Beji. Untuk itu disarankan bagi guru untuk meng

Pengaruh minat baca literatur akuntansi dan keaktifan belajar siswa terhadap hasil belajar mata pelajaran siklus akuntansi yang dimediasi oleh kemampuan berpikir kritis siswa program keahlian akuntansi kelas X di SMK Negeri 1 Malang / Vanny Andjani

 

Kata Kunci: Minat Baca Literatur Akuntansi, Keaktifan Belajar, Kemampuan Berpikir Kritis, Hasil Belajar Hasil belajar sampai saat ini menjadi indikator untuk menilai tingkat keberhasilan siswa. Salah satu faktor yang mempengaruhi hasil belajar adalah kemampuan berpikir kritis. Kemampuan berpikir kritis ini akan ditujukan sebagai variabel intervening hubungan antara minat baca dengan hasil belajar siswa serta variabel intervening hubungan antara keaktifan belajar siswa dengan hasil belajar siswa. Sehingga dapat terlihat kemampuan berpikir kritis menjadi variabel yang dapat memperkuat atau memperlemah hubungan antara variabel dependen (hasil belajar siswa) dengan variabel independennya (minat baca literatur akuntansi dan keaktifan belajar siswa). Penelitian ini bertujuan untuk mengetahui pengaruh langsung dan tidak langsung antara minat baca dan keaktifan belajar terhadap hasil belajar melalui kemampuan berpikir kritis siswa program keahlian Akuntansi di SMK Negeri 1 Malang. Penelitian ini merupakan penelitian eksplanasi menggunakan analisis regresi dan analisis jalur (path analysis). Teknik pengambilan sampel pada penelitian ini adalah stratified random sampling, populasi penelitian ini adalah siswa kelas X program keahlian Akuntansi SMKN 1 Malang dengan jumlah total 161, sehingga sampel yang digunakan adalah 80 siswa. Data diperoleh dengan menyebarkan angket dan dokumentasi berupa nilai rata-rata ulangan harian siswa. Variabel bebas dalam penelitian ini adalah minat baca literatur akuntansi (X1), keaktifan belajar (X2) dan variabel terikatnya adalah hasil belajar siswa mata pelajaran siklus akuntansi kelas X program keahlian akuntansi di SMK Negeri 1 Malang (Y) dengan variabel kemampuan berpikir kritis siswa sebagai variabel intervening (Z). Hasil penelitian ini menunjukkan bahwa: 1) terdapat pengaruh minat baca literatur akuntansi terhadap hasil belajar, 2) terdapat pengaruh minat baca literatur akuntansi terhadap hasil belajar melalui kemampuan berpikir kritis siswa, 3) terdapat pengaruh kekatifan belajar terhadap hasil belajar, 4) terdapat pengaruh keaktifan belajar terhadap hasil belajar melalui kemampuan berpikir kritis siswa, 5) terdapat pengaruh kemampuan berpikir kritis siswa terhadap hasil belajar. Berdasarkan hasil penelitian tersebut, disarankan agar (a) guru terus memberikan dorongan kepada siswa untuk meningkatkan minat bacanya sehingga pengetahuan siswa bertambah, (b) guru dan siswa bersama-sama meningkatkan keaktifan belajar dalam proses belajar mengajar agar pembelajaran bisa dicapai secara maksimal.

Koordinasi proteksi arus lebih pada jaringan distribusi menggunakan software EDSA 2005 / Andhika Surya Dwinata

 

Kata Kunci : Beban, Arus, Fuse, Recloser Dalam sistem tenaga listrik, jaringan distribusi memegang peranan penting dalam menyalurkan tenaga listrik dari stasiun supply tenaga listrik kepada konsumen. Oleh karena itu diperlukan sistem pengaman yang baik yang mampu mengantisipasi bentuk gangguan yang mungkin terjadi pada saluran distribusi, Peralatan pengaman yang terdiri dari fuse (CO), recloser (PBO) dan relai arus lebih (OCR). Peralatan pengaman tersebut perlu dipasang terkoordinir pada sistem, sehingga setiap pengaman mempunyai peranan yang penting dalam mengatasi gangguan sesuai dengan fungsinya masing-masing. Tujuan utama tugas akhir ini adalah untuk mendapatkan hasil analisis koordinasi proteksi arus listrik pada jaringan distrubusi, sehingga ketika terjadi gangguan letak gangguan akan dapat segera terdeteksi dan peralatan pengaman tersebut akan berkoordinasi sedemikian rupa sehingga tidak menyebabkan terjadinya pemadaman yang lama, dan bila sampai terjadi pemadaman area pemadamannya dapat diperkecil seminimal mungkin. Metode yang digunakan untuk menyelesaikan tugas akhir ini adalah : (1) pengambilan data lapangan; (2) pengolahan data; (3) analisis data; (4) melakukan simulasi menggunakan program Edsa Technical 2005; dan (5) menganalisis data hasil simulasi. Data lapangan tersebut diperoleh dari data hasil pengukuran beban malam pada PLN Unit Pelayanan dan Jaringan (UP&J) Bululawang. Hasil simulasi menunjukan bahwa dapat diketahui hasil analisis nilai arus gangguan 3 fasa, nilai arus gangguan Line – Line, nilai arus gangguan Line – Ground, nilai arus gangguan Line – Line – Ground. Dimana arus gangguan tersebut menurut 0,5 cycle, 5 cycle, dan 30 cycle. Berdasarkan hasil simulasi dan kesimpulan maka koordinasi peralatan sangat penting bagi jaringan distribusi 20 kV untuk mencapai tingkat keandalan sehingga tidak menyebabkan terjadinya pemadaman yang lama, dan bila sampai terjadi pemadaman area pemadamannya dapat diperkecil seminimal mungkin.

Pengaruh penggunaan model pembelajaran kooperatif tipe teams games tournament (TGT) terhadap proses dan hasil belajar iswa kelas X SMAN 1 Lubuk Kabupaten Aceh Besar pada materi reaksi reduksi oksidasi / Bismi Aulia

 

Kata kunci: reaksi redoks, kooperatif model Teams Games Tournament (TGT), proses belajar, hasil belajar. Pendidikan merupakan bagian terpenting demi perkembangan suatu bangsa yang berkualitas. Pembelajaran yang cenderung berpusat pada guru merupakan salah satu faktor yang menyebabkan belum optimalnya kualitas proses dan hasil belajar kimia siswa khususnya pada siswa kelas X di SMA Negeri 1 Lubuk. Penerapan model pembelajaran kooperatif tipe Teams Games Tournament (TGT) diharapkan mampu meningkatkan kualitas proses dan hasil pembelajaran kimia. Penelitian ini bertujuan untuk mengetahui aktivitas belajar, aktivitas mental sains, dan hasil belajar pada materi reaksi redoks. Penelitian ini mengunakan rancangan eksperimen semu dan deskriptif. Subjek penelitian adalah siswa kelas X SMA Negeri 1 Lubuk sebanyak 2 kelas. Kelas X-1 sebagai kelas eksperimen yang dibelajarkan dengan model pembelajaran kooperatif TGT dan kelas X-2 sebagai kelas kontrol yang dibelajarkan dengan model pembelajaran konvensional. Instrumen penelitian yang digunakan terdiri dari instrumen pembelajaran yaitu silabus, RPP, dan instrumen pengukuran yaitu lembar observasi aktivitas belajar, angket aktivitas mental sains, tes hasil belajar dan angket persepsi. Hasil uji coba instrumen menunjukkan bahwa 30 soal valid dengan reliabilitas 0,98. Data penelitian dianalisis dengan menggunakan analisis deskriptif dan analisis inferensial dengan menggunakan t-test pada taraf signifikan α = 0,05. Hasil penelitian menunjukkan bahwa: (1) kualitas aktivitas belajar siswa kelas eksperimen dan kelas kontrol dengan materi reaksi redoks pada umumnya termasuk kategori sangat tinggi dan tinggi dalam keterlaksanaan indikator yang ada. (2) kualitas aktivitas mental sains siswa kelas eksperimen dan kelas kontrol pada materi reaksi redoks menunjukkan siswa telah mampu menerapkan indikator aktivitas mental sains. (3) terdapat perbedaan yang signifikan, antara hasil belajar kognitif siswa kelas eksperimen yang dibelajarkan dengan model pembelajaran kooperatif TGT lebih baik daripada hasil belajar kognitif siswa kelas kontrol yang dibelajarkan dengan model pembelajaran konvensional, dimana skor rerata hasil belajar kognitif siswa kelas eksperimen 76,63 dan kelas kontrol 71,91. (4) hasil belajar afektif siswa kelas eksperimen dan kelas kontrol menunjukkan rerata sangat tinggi dan tinggi dalam keterlaksanaan indikator yang ada. (5) hasil belajar psikomotorik siswa kelas eksperimen dan kelas kontrol menunjukkan rerata sangat tinggi dalam keterlaksanaan indikator yang ada. (6) persepsi siswa menunjukkan model pembelajaran kooperatif TGT dapat diterima siswa dengan baik (setuju) untuk diterapkan pada materi reaksi redoks.

Peningkatan keterampilan menulis narasi melalui media gambar seri kelas V SDN Bacem 03 Kecamatan Sutojayan Kabupaten Blitar / Septie Wahyuning Wulan

 

Kata kunci: keterampilan, menulis, narasi, media gambar seri Keterampilan menulis narasi di kelas V SDN Bacem 03 Kecamatan Sutojayan Kabupaten Blitar masih rendah. Banyak siswa yang masih kesulitan dalam menulis narasi. Pada umumnya karangan siswa mempunyai alur tidak jelas, tidak runtut, unsur-unsur karangan narasi tidak lengkap, dan pengembangan paragraf yang masih kurang. Hal tersebut terjadi karena tidak adanya media pada pembelajaran menulis narasi. Dengan adanya kondisi yang demikian, dibutuhkan penggunaan media dalam pembelajaran yang dapat meningkatkan motivasi dan prestasi siswa, salah satunya adalah penggunaan media gambar seri. Penelitian ini bertujuan untuk mendeskripsikan pelaksanaan pembelajaran dan peningkatan keterampilan menulis narasi melalui media gambar seri pada siswa kelas V SDN Bacem 03, Kecamatan Sutojayan, Kabupaten. Pendekatan yang dilakukan dalam penelitian ini adalah pendekatan kualitatif dan desain penelitiannya adalah Penelitian Tindakan Kelas (PTK). Sasaran penulisan ini difokuskan pada siswa kelas V SDN Bacem 03 Kecamatan Sutojayan, Kabupaten Blitar yang berjumlah 15 siswa terdiri dari 8 siswa perempuan dan 7 siswa laki-laki, guru atau peneliti dan teman sejawat. Sedangkan teknik pengumpulan data yang digunakan adalah observasi, wawancara, study dokumenter, catatan lapangan, dan tes. Berdasarkan hasil pengamatan, diketahui bahwa pengajaran menulis narasi melalui media gambar seri di SDN Bacem 03, Kecamatan Sutojayan, Kabupaten Blitar dilaksanakan dua siklus, dan berlangsung efektif. Selain itu terdapat peningkatan pada setiap siklusnya. Hal ini terbukti dari ketuntasan klasikal pada siklus pertama yaitu 47% dan meningkat pada siklus kedua yang mencapai 87%. Kesimpulan dan saran dari penelitian ini adalah penerapan media gambar seri dalam meningkatkan keterampilan menulis narasi sesuai dengan langkah-langkah penggunaan media gambar seri yang ada, yaitu mengurutkan gambar yang disusun acak, menyusun topik, dan terakhir adalah membuat karangan. Pembelajaran yang dilaksanakan dapat meningkatkan kemampuan menulis narasi siswa kelas V SDN Bacem 03 Kecamatan Sutojayan Kabupaten Blitar. Pada siklus pertama hanya 7 siswa yang mencapai ketuntasan individu, dan meningkat pada siklus kedua yaitu sebanyak 13 siswa. Sedangkan ketuntasan klasikal meningkat dari 47% menjadi 87%. Dari kesimpulan diperoleh fakta bahwa penggunaan media gambar seri sangat efektif dalam pembelajaran menulis narasi, hendaknya guru juga memanfaatkan media gambar seri dalam pembelajaran ataupun untuk meningkatkan keterampilan menulis narasi.

Peningkatan kemampuan membaca permulaan dengan metode Glenn Doman pada anak kelompok B RA 12 Al Ikhlas Kota Batu / Chusnul Cholifah

 

Kata kunci: Peningkatan, Membaca Permulaan, Metode Glenn Doman Penelitian ini berlatar belakang pada kurangnya kemampuan membaca anak. Hal ini disebabkan karena guru belum memberikan media yang tepat dalam mengembangkan kemampuan membaca, disamping itu media pembelajarannya kurang menarik bagi anak. Penelitian ini bertujuan untuk mendiskripsikan penerapan Metode Glenn Doman untuk meningkatkan kemampuan membaca permulaan anak, dan mendiskripsikan peningkatan kemampuan membaca anak dengan metode Glenn Doman pada anak kelompok B di RA 12 Al-Ikhlas Kota Batu. Penelitian ini dilakukan di RA 12 Al-Ikhlas Kota Batu,dengan subyek penelitian sebanyak 27 siswa, terdiri dari 7 anak laki-laki dan 20 anak perempuan. Penelitian dilaksanakan pada tanggal 11, 12 Oktober dan tanggal 25 dan 26 Oktober 2010. Rancangan penelitian menggunakan penelitian tindakan kelas dengan 2 siklus. Dalam setiap siklus terdiri dari beberapa tahapan yaitu: perencanaan, pelaksanaan, observasi, dan refleksi. Dalam penelitian inipeneliti juga berkolaborasi dengan teman sejawat. Hasil penelitian menunjukkan bahwa Metode Glenn Doman dengan menggunakan kartu bergambar terbukti dapat digunakan dalam pembelajaran untuk meningkatkan kemampuan membaca pada anak TK. Proses peningkatan kemampuan membaca anak dengan menggunakan metode Glenn Doman yang menggunakan kartu bergambar dikatakan meningkat apabila kemampuan mencapai 75% atau lebih, dan dikatakan berhasil jika pada siklus II lebih baik dari siklus I. Berdasarkan hasil penelitian pada masing-masing siklus menunjukkan perolehan siklus I yang mencapai rata-rata 50,61%, sedangkan siklus II dengan rata-rata 97,52%. Sehingga dapat dikatakan terjadi peningkatan 46,91%. Keberhasilan ini ditandai dengan: (1) anak mampu membaca kata/ tulisan sesuai dengan gambarnya, (2) anak mampu memasangkan gambar yang sesuai dengan kata, (3) anak mampu membedakan huruf awal dan akhir pada kata. Berdasarkan penelitian ini, dapat disimpulkan bahwa Metode Glenn Doman dengan menggunakan kartu bergambar dapat meningkatkan kemampuan anak dalam membaca secara sederhana. Hal ini dibuktikan dengan peningkatan prosentasi rata-rata dari siklus I mencapai 50,61% dan dari siklus II mencapai 97,52%. Berdasarkan hasil penelitian ini disarankan bagi guru TK atau usia dini hendaknya mampu menciptakan inovasi baru serta memanfaatkan sumber belajar yang ada guna roses pembelajaran yang efektif dan menyenangkan bagi siswa.

Pengaruh kupon, maturitas, yield to maturity obligasi, dan suku bunga SBI terhadap harga pasar obligasi perusahaan manufaktur yang listing di BEI periode 2007-2009 / Dhana Teguh Arfianto

 

Kata kunci: kupon, maturitas, yield to maturity, suku bunga SBIdan harga pasar dan harga pasar obligasi Obligasi merupakan instrumen keuangan jangka yang diperdagangkan di pasar sekunder, jika obligasi diperdagangkan maka tingkat imbal hasil (yield) investor akan terus berubah seiring berjalannya waktu dan mengikuti pergerakan bunga pasar. Perubahan ini terjadi karena obligasi memiliki karakteristik pendapatan berupa bunga. Berdasarkan karakteristik obligasi tersebut maka penelitian ini bertujuan untuk menguji seberapa besar pengaruh kupon, maturitas, yield to maturity obligasi dan suku bunga SBI terhadap harga pasar obligasi perusahaan manufaktur serta mendeskripsikan masing-masing variabel yakni kupon, maturitas, yield to maturity obligasi dan suku bunga SBI terhadap harga pasar obligasi perusahaan periode 2007-2009. Kupon obligasi adalah tingkat bunga yang dibayarkan oleh penerbit obligasi yang umumnya setiap 1, 3, 6 atau tahunan sampai obligasi tersebut jatuh tempo. Maturitas obligasi adalah jangka waktu obligasi. Suku bunga SBI adalah harga atau balas jasa dari peminjam kepada pemberi pinjaman atas pinjaman dalam waktu tertentu. Yield to Maturity adalah hasil yang diperoleh investor sampai dengan jatuh tempo. Harga pasar obligasi adalah nilai arus kas sekarang yang ditawarkan dalam nominal presentase yaitu at par, at premium, dan at discount. Rancangan penelitian ini adalah penelitian asosiatif yang bertujuan untuk mengetahui pengaruh variabel kupon, maturitas, yield to maturity obligasi dan suku bunga SBI terhadap harga pasar obligasi perusahaan manufaktur. Populasi dalam penelitian ini adalah obligasi perusahaan manufaktur yang beredar pada periode 2007-2009. Dengan teknik purposive sampling diperoleh sampel sejumlah 12 obligasi. Data yang digunakan adalah data sekunder, yang dipublikasikan oleh Harian Bisnis Indonesia 2007-2009, Indonesian Bond Market Directory (IBMD) 2008-2009, Bank Indonesia, dan Bursa Efek Indonesia. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi berganda. Hasil penelitian menunjukkan bahwa kupon obligasi memiliki tingkat bunga yang tetap dan fluktuatif, maturitas memiliki waktu jatuh tempo yang bervariasi jangka pendek, menengah dan panjang, juga suku bunga SBI cenderung mengalami penurunan, yield to maturity yang searah dengan pergerakan suku bunga serta harga pasar obligasi bervariasi at par, at premium dan at dicount. Pengaruh secara parsial menunjukan adanya pengaruh positif pada kupon obligasi perusahaan manufaktur sedangkan maturitas, yield to maturity dan suku bunga SBI memiliki pengaruh yang negatif terhadap harga pasar obligasi. Pengaruh negatif yang ditunjukkan oleh variabel yield to maturity dikarenakan harga pasar obligasi merupakan nilai sekarang arus kas. Seiring dengan meningkatnya hasil diinginkan, nilai sekarang dari arus kas akan menurun sehingga harga juga akan turun. Secara simultan variabel kupon, maturitas, yield to maturity obligasi dan suku bunga SBI berpengaruh hterhadap harga pasar obligasi perusahaan manufaktur.

Keanekaragaman arthropoda permukaan tanah pada pertanaman jarak pagar (Jatropha curcas L.) di kebun percobaan Karangploso dan Asembagus / Irma Nurita Rahmawati

 

KataKunci: keanekaragaman, arthropoda permukaan tanah, jarak pagar. Jarakpagar(JatrophacurcasL.)merupakansalahsatutumbuhanpotensialyangsaatinitelahdikembangbiakkankarenabijinyamenghasilkanminyakyangdapatdimanfaatkanuntukbahanbakaralternatifyangbernilaiekonomi.PertumbuhantanamanjarakpagartidaklepasdariperananArthropodapermukaantanahyangbersifatmenguntungkandanmerugikan.HinggasaatiniinformasikeanekaragamanArthropodapermukaantanahyangadapadapertanamanjarakpagarmasihsangatterbatas.AdapuntujuandaripenelitianiniadalahuntukmengetahuikeanekaragamanArthropodapermukaantanahpadapertanamanjarakpagardiKP.KarangplosodanKP.AsembagussertamengetahuiperbedaankeanekaragamanantaraArthropodapermukaantanahpadapertanamanjarakpagardikedualokasi. Jenispenelitianyangdigunakandalampenelitianiniadalahdeskriptif–komparatifdenganpendekatankuantitatif.PenelitiandilakukanpadabulanFebruari-April2010diKebunPercobaanBalittasdiKarangploso¬MalangdanAsembagus-Situbondo.Pengambilandatamenggunakanteknikpitfalltrap.PopulasidalampenelitianadalahArthropodapermukaantanahpadapertanamanjarakpagarsedangkansampelnyaadalahArthropodapermukaantanahyangterjebakpadapitfalltrap.TingkatkeanekaragamanArthropodapermukaantanahdihitungdenganindekskeanekaragamanShanon-WienerdanuntukmembandingkankeanekaragamanArthropodatanahantaraKP.KarangplosodanKP.Asembagusdengananalisisstatistikvariandanujittarafsignifikan5%. KeanekaragamanArthropodapermukaantanahpadapertanamanjarakpagarKP.Karangplosodiperoleh28familidenganfamiliyangmemilikijumlahpopulasitertinggiadalahFormicidae,Isotomidae,Hypogastruraidae,Oncopoduridae,danGryllidae,sedangkandiKP.Asembagusadalah31familidenganfamiliyangmemilikijumlahpopulasitertinggiadalahHypogastruraidaedanFormicidae.KeanekaragamanArthropodapermukaantanahdiKP.Karangplosoadalah2,1danKP.Asembagussebesar2,5keduanyatergolongsedang.BerdasarkanujivariankeanekaragamanArthropodapermukaantanahdikedualokasiP>0,05.KeanekaragamanArthropodapermukantanahKP.KarangplosodanKP.Asembagusmemilikivarianyangsama,sedangkananalisisujitdiperolehhasilP>0,05yangberartitidakterdapatperbedaankeanekaragamanantaraArthropodapermukaantanahpadapertanamanjarakpagardikedualokasi.KeanekaragamanArthropodapermukaantanahdikedualokasiyangtidaklepasdaripengaruhlingkungan,sepertisuhu,kelembaban,curahhujan,ketersediaanmakanan(nutrisi)danpredasi.

Upaya meningkatkan pembelajaran IPA siswa kelas IV MI Darul Ulum Gondangwetan dengan pendekatan kooperatif model STAD / Hidayati

 

Kata Kunci: Student Team Achievement Division (STAD), Hasil Belajar dan IPA Ilmu pengetahuan alam (IPA) merupakan ilmu pengetahuan yamg berkaitan erat dengan cara mencari tahu tentang alam secara sistematis. IPA bukan hanya penguasaan kumpulan pengetahuan saja yang berupa fakta-fakta, konsep-konsep atau prinsip-prinsip saja tetapi juga merupakan suatu proses penemuan. Penggunaan metode ceramah dalam pembelajaran IPA kurang efektif karena pembelajaran masih terpusat pada guru dan siswa cenderung pasif sehingga hasil belajar siswa masih rendah. Untuk meningkatkan hasil belajar siswa dalam pembelajaran IPA pada siswa kelas IV di MI Darul Ulum adalah melalui pembelajaran koopertif (Cooperative Learning) karena penerapan pembelajaran kooperatif ini dalam pembelajaran IPA merupakan satu bentuk perubahan pola pikir dalam kegiatan belajar mengajar IPA di sekolah. Dalam pembelajaran kooperatif terdapat beberapa variasi model yang dapat diterapkan, yaitu diantaranya: Student Team Achievement Division (STAD). Skripsi ini mempelajari tentang: (1) penerapan pendekatan kooperatif model STAD pada mata Pelajaran IPA siswa kelas IV di MI Darul Ulum Gondangwetan; (2) aktivitas siswa kelas IV MI Darul Ulum Gondangwetan dalam pembelajaran IPA dengan menggunakan pendekatan kooperatif model STAD; (3) hasil belajar pada mata pelajaran IPA siswa kelas IV MI Darul Ulum Gondangwetan setelah menggunakan pendekatan kooperatif model STAD Tujuan penelitian ini adalah (1) mendiskripsikan penerapan pendekatan kooperatif model STAD pada mata pelajaran IPA siswa kelas IV MI Darul Ulum Gondang wetan; (2) mendiskripsikan aktivitas siswa MI Darul Ulum Gondangwetan dalam pembelajaran IPA dengan menggunakan pendekatan kooperatif model STAD; (3) mendiskripsikan hasil belajar pada mata pelajaran IPA siswa kelas IV MI Darul UlumGondangwetan setelah menggunakan pendekatan kooperatif model STAD. Penelitian ini menggunakan metode analisis deskriptis kualitatif, yaitu suatu metode penelitian yang bersifat menggambarkan kenyataan atau fakta dengan data yang diperoleh saat penelitian. Secara umum proses analisis data dimulai dengan menelaah seluruh data yang tersedia dari observasi awal, perencanaan, pelaksanaan tindakan, observasi, dan refleksi pada siklus I. Kemudian ditarik kesimpulan untuk selanjutnya dilakukan tindakan pada silkus II, pada siklus II juga diperoleh data dari perencanaan, pelaksanaan, observasi, dan refleksi. Dari hasil penelitian diperoleh data skor hasil observasi aktivitas guru siklus I pertemuan I skor yang diperoleh sebesar 54,6%, pertemuan II sebesar 68%. Sedangkan pada siklus II pertemuan I sebesar 93%, dan pertemuan II 98%. Peningkatan aktivitas siswa dapat dilihat pada prosentase aktivitas siswa yang semakin meningkat.Hasil belajar siswa pada siklus I nilai rata-rata yang diperoleh 62,5 dan pada tahap pelaksanaan siklus II nilai rata-rata mencapai 76,35%. Hal ini menunjukkan adanya peningkatan hasil belajar IPA siswa dengan menggunakan model STAD Dari hasil penelitian dan pembahasan, diperoleh kesimpulan bahwa penerapan model STAD dalam pembelajaran IPA dapat meningkatkan aktivitas dan hasil belajar siswa kelas IV MI Darul Ulum Gondang Wetan Berdasarkan penelitian ini maka disarankan kepada guru untuk selalu menerapkan model-model pembelajaran yang bervariasi dan bagi kepada sekolah hendaknya membantu menyediakan sarana pembelajaran yang tidak memungkinkan siswa untuk membawanya.

Penerapan metode eksperimen untuk meningkatkan kemampuan sains permulaan pada anak didik kelompok A TK Negeri Pembina Kota Blitar / Anis Masriyah

 

Kata kunci : Sains Permulaan, Metode Eksperimen, Anak TK Pemilihan judul tersebut dengan latar belakang adanya penerapan metode yang kurang tepat, yaitu metode pemberian tugas yang tidak melibatkan anak secara langsung, sehingga penguasaan anak tentang sains sangat rendah, untuk itu peneliti mencoba menggunakan metode eksperimen dalam pembelajaran sains permulaan. Tujuan dari penelitian ini adalah untuk meningkatkan kemampuan sains permulaan anak melalui penerapan metode pembelajaran eksperimen. Penelitian yang dilakukankan peneliti hanya meneliti kegiatan sains permulaan pada pembelajaran kognitif di area sains untuk Kelompok A yang dilakukandi TK Negeri Pembina Kota Blitar. Peneliti menggunakan pedoman penilaian Unjuk kerja yang dilakukan anak dan observasi. Penelitian ini dirancang dengan penelitian tindakan kelas (PTK) pada setiap siklusnya terdiri dari planing (perencanaan), acting & observasing (tindakan & pengamatan), reflecting (refleksi) dan revise plan (revisi rencana). Berdasarkan hasil penelitian tindakan yang menunjukkan bahwa terjadi peningkatan kemampuan sains permulaan dengan penerapan metode pembelajaran eksperimen. Pada siklus I peningkatan mencapai 22,342% dan diperoleh rata-rata penilaian anak dalam sains permulaan sebesar 70,353%. Pada siklus II peningkatan mencapai 17,202% dan diperoleh rata-rata penilaian sebesar 87,555%. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa dengan menerapkan metode pembelajaran eksperimen, kemampuan sains anak meningkat. Pembelajaran dari berpusat pada guru menjadi berpusat pada anak, perubahan penilaian ke arah yang komprehensif yang tidak hanya dengan hasil kerja anak, dan pengembangan situasi pembelajaran ke arah yang lebih kondusif, maka disarankan untuk menggunakan metode eksperimen dalam kegiatan pembelajaran sains permulaan pada bidang pengembangan Kognitif.

Peningkatan keterampilan berbicara dengan pendekatan pragmatik pada siswa kelas V MI Miftahul Ulum Bajangan Gondangwetan Pasuruan / Lilis Suryani

 

Kata kunci: Pendekatan pragmatik, keterampilan berbicara, Sekolah Dasar. Bahasa Indonesia berperan sebagai alat untuk mempersatukan keberagaman bahasa, adat istiadat, suku, dan budaya. Bertolak dari hal tersebut, siswa diharapkan memiliki kemampuan berkomunikasi dengan bahasa Indonesia yang baik dan benar. Permasalahan yang terjadi di kelas adalah siswa belum mampu berbicara dengan bahasa Indonesia yang baik dan benar serta tidak sesuai dengan situasi dan konteks, sehingga perlu adanya inovasi dalam pembelajaran yang bertujuan untuk mencapai tujuan pembelajaran, yaitu meningkatkan hasil belajar keterampilan berbicara siswa kelas V MI Miftahul Ulum Bajangan yang mencakup, kelancaran berbicara, intonasi, ketetapan dan ketepatan ucapan, pilihan kata yang tepat, kontak mata yang sesuai dengan situasi dan konteks saat berbicara. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan pragmatik. Rancangan penelitian ini menggunakan jenis penelitian tindakan kelas (PTK) melalui tahap perencanaan, tindakan, pengamatan, dan refleksi. Subjek penelitian berjumlah 16 orang siswa di MI Miftahul Ulum Bajangan kecamatan Gondangwetan kabupaten Pasuruan. Teknik pengumpulan data dengan menggunakan tes, observasi dan wawancara selama proses pembelajaran. Dalam penelitian ini, pendekatan pragmatik diterapkan dalam matapelajaran Bahasa Indonesia di kelas V MI Miftahul Ulum Bajangan. Hasil penelitian yang diperoleh adalah sebagai berikut; hasil belajar siswa berupa pemahaman konsep tentang situasi dan konteks saat berbicara secara klasikal mengalami peningkatan dari 45,4% pada pra tindakan menjadi 58,18% pada siklus I. Selanjutnya menjadi 80,6% pada siklus II. Hasil belajar yang berupa tes secara lisan pada siklus I meningkat dari 46,62% menjadi 76,85% pada siklus II. Secara keseluruhan hasil belajar siswa pada pra tindakan masih dibawah nilai standar minimum yaitu 60% mengalami peningkatan sehingga mencapai di atas standar minimum dan mencapai target yang telah ditetapkan setelah pembelajaran dengan menggunakan pendekatan pragmatik pada siklus I dan II. Hal ini disimpulkan bahwa pendekatan pragmatik telah berhasil meningkatkan keterampilan berbicara siswa. Dari hasil penelitian ini diharapkan agar guru menerapkan pembelajaran dengan pendekatan pragmatik dalam mengajarkan matapelajaran Bahasa Indonesia khususnya keterampilan berbicara.Bagi peneliti lain diharapkan dapat meneliti dengan menggunakan metode atau pendekatan lain dalam rangka meningkatkan mutu pembelajaran di sekolah.

Perbedaan perilaku agresi pada siswa SMA Laboratorium Universitas Negeri Malang yang berasal dari keluarga TNI dan keluarga non-TNI / Ainun Jariyah

 

Kata kunci: perilaku agresi, remaja Agresi merupakan bentuk pencurahan energi yang berlebih pada diri seseorang yang tampak dalam tindakan secara fisik ataupun verbal dan bertujuan untuk menekan, mengalahkan orang lain atau mengalahkan masalah yang sangat sulit. Para pelaku agresi bermacam-macam dari anak kecil hingga orang dewasa dengan latar belakang permasalahan yang beraneka ragam pula. Remaja sebagai salah satu pelaku agresi seringkali membuat resah lingkungan disekitarnya. Itu semua dikarenakan adanya persaingan atau tuntutan untuk memenuhi kebutuhan akan pengetahuan yang semakin bertambah pada remaja. Remaja yang sedang mencari identitas diri cenderung melakukan hal-hal yang menurut orang tua mereka bertentangan dengan apa yang dianggap sesuai. Kondisi semacam ini mengundang perhatian orang tua untuk mengendalikan anak dengan segera. Apabila upaya tidak dapat dilaksanakan, ada kecenderungan orang tua bertindak tidak sabar, melakukan tindakan kekerasan dan menyakiti anak. Bahkan ada pula orang tua yang malu mengakui kesalahan kemudian akan membentuk sistem pertahanan diri dan berusaha lebih keras lagi, akibat bagi anak apabila mendapat perlakuan yang keras dari orang tua dan sering menyaksikan perilaku agresif orang tua maka anak akan berperilaku agresif pula. Penelitian ini adalah penelitian deskriptif dan komparatif. Penelitian ini menggunakan uji terpakai. Penelitian dilakukan di SMA Laboratorium Universitas Negeri Malang dengan subjek penelitian berjumlah 64 remaja sesuai dengan karakteristik yang telah ditentukan dengan reliabitas 0,940. Instrumen yang digunakan dalam penelitian ini berupa skala perilaku agresi yang disusun berdasarkan metode Rating yang Dijumlahkan (Methods of Summated Ratings) dari Likert. Data yang diperoleh dianalisis menggunakan teknik analisis deskriptif dan analisis Uji-t, yaitu Uji Independent Sample Test dengan taraf signifikansi 0,05. Hasil penelitian menunjukkan t hitung sebesar 2, 937 dengan taraf signifikansi Sig.(2-tailed) sebesar 0,005 < 0,05 sehingga dapat disimpulkan bahwa H_0 ditolak, artinya ada perbedaan perilaku agresi pada remaja yang berasal dari keluarga TNI dengan remaja yang berasal dari keluarga non-TNI. Nilai mean-1 lebih besar dari nilai mean-2 atau 118,78 > 101,81 menunjukkan bahwa perilaku agresi remaja yang berasal dari keluarga TNI lebih tinggi dari pada remaja yang berasal dari keluarga non-TNI. Berdasarkan hasil penelitian, disarankan bagi remaja sendiri bersikap lebih terbuka kepada orang tua maupun dari pihak sekolah, sehingga dapat menemukan penyelesaian atau solusi yang terbaik atas masalah yang dihadapi dan menumbuhkan rasa tanggung jawab atas segala resiko yang harus ditanggung karena perilaku agresi yang dilakukan.

Pengaruh karakteristik perusahaan terhadap kelengkapan social disclosure pada laporan tahunan perusahaan high profile yang terdaftar di BEI periode 2006-2008 / Sri Utami

 

Pengaruh relationship marketing terhadap loyalitas nasabah (studi pada nasabah tabungan Britama PT. Bank Rakyat Indonesia Tbk. Cabang Malang Martadinata) / Irul Kurniawan

 

Kata Kunci: Relationship Marketing (Trust, Commitment, Communication, Conflict Handling), Loyalitas Nasabah. Perkembangan dunia bisnis yang pesat dewasa ini, telah mendorong semakin tingginya tingkat persaingan terutama pada sektor jasa. Bisnis jasa sangat berpengaruh dalam dunia modern, hal ini bisa dilihat dalam kehidupan sehari-hari yang tidak bisa terlepas dari berbagai sektor jasa, seperti jasa kesehatan, jasa transportasi, jasa perbankan, jasa asuransi dan lain-lain. Tingginya persaingan antar bank saat ini, memacu bank-bank untuk berlomba menarik nasabah dengan memberikan layanan perbankan yang beraneka ragam. Benteng utama agar nasabah tidak lari kepada pesaing adalah bank harus membuat nasabah menjadi loyal. Oleh sebab itu, kegiatan utama perusahaan pada saat ini adalah menciptakan loyalty, tidak cukup hanya satisfaction. Bank berusaha mendesain relationship marketing yang dimiliki sebaik mungkin untuk menciptakan dan meningkatkan loyalitas nasabah.BRI sebagai Bank Pemerintah pertama di Republik Indonesia yang didirikan sejak tahun 1895 dan mendedikasikan pelayanan pada masyarakat kecil sebagai hal yang utama dianggap sebagai salah satu lembaga keuangan yang memiliki nasabah-nasabah yang loyal. Tujuan penelitian ini adalah untuk mengetahui: pengaruh secara parsial Relationship Marketing (Trust (X1), Commitment (X2), Communication (X3), dan Conflict Handling (X4)), terhadap Loyalitas Nasabah (Y), pengaruh secara simultan Relationship Marketing (Trust (X1), Commitment (X2), Communication (X3), dan Conflict Handling (X4)), terhadap Loyalitas Nasabah (Y), dan variabel yang dominan berpengaruh terhadap Loyalitas Nasabah. Penelitian ini termasuk dalam penelitian deskriptif korelasional. Populasi yang diambil dalam penelitian ini adalah nasabah tabungan Britama PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata per Agustus 2009. Penentuan sampel menggunakan rumus Slovin dengan persen kelonggaran ketidaktelitian yang digunakan adalah 5% sehingga diperoleh sampel sebanyak 330 orang. Teknik penentuan sampel yang digunakan adalah Proportional Random Sampling dengan teknik pengambilan sampel menggunakan Accidental Sampling dengan menggunakan kuesioner sebagai instrumen penelitian. Kuesioner dalam penelitian ini termasuk dalam kuesioner tertutup menggunakan skala Likert dengan 5 alternatif pilihan jawaban. Untuk menguji kelayakan instrumen dilakukan uji validitas dan reliabilitas dengan sampel uji coba berjumlah 40 orang responden. Proses pengolahan data menggunakan software SPSS 16 for Windows. Selain itu diketahui pula Adjusted R Square sebesar 0,505. Artinya bahwa 50,5% loyalitas nasabah pada nasabah tabungan Britama PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata dipengaruhi oleh Relationship Marketing (Trust, Commitment, Communication, dan Conflict Handling), Sedangkan sisanya sebesar 49,5% dipengaruhi oleh faktor-faktor lain yang tidak diteliti dalam penelitian ini. Berdasarkan penelitian ini hasil yang diperoleh adalah: (1) secara parsial ada pengaruh positif yang signifikan Relationship Marketing (Trust, Commitment, Communication, dan Conflict Handling) terhadap loyalitas nasabah, (2) secara simultan terdapat pengaruh positif yang signfikan antara Relationship Marketing (Trust, Commitment, Communication, dan Conflict Handling) terhadap loyalitas nasabah, (3) variabel yang dominan pengaruhnya terhadap loyalitas nasabah dalam penelitian ini adalah variabel commitment. Saran yang dapat diberikan dalam penellitian ini adalah: (1) hendaknya PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata terus memperhatikan dan mempertahankan relationship marketing sebagai salah satu keunggulan kompetitifnya. (2) perusahaan harus lebih inovatif dalam strategi memperoleh nasabah. Salah satu cara yang terbaik adalah dengan menerapkan program member get member yaitu nasabah mengajak orang lain untuk menjadi nasabah PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Malang Martadinata. (3) hendaknya mahasiswa lain yang ingin menulis masalah tersebut lebih lanjut juga menggunakan nasabah lain diluar nasabah tabungan Britama sebagai obyek penelitian, atau mengkaji aspek lain diluar relationship marketing sebagai variabel penelitian. (4) diharapkan pada peneliti selanjutnya untuk mengambil obyek atau tempat penelitian yang berbeda dari penelitian ini untuk lebih mengembangkan penelitian yang sejenis.

Penerapan metode pembelajaran proyek memasak untuk mengembangkan kemampuan kognitif pada kelompok A di TK. Arjuno 2 Kota Batu / Elni Disna Windri

 

Kata kunci: kemampuan kognitif, metode proyek. Kemampuan kognitif setiap anak berbeda, ada anak yang sudah mampu dan ada anak yang belum mampu. Namun pada kenyataannya di TK Arjuno 02 Batu banyak anak yang kurang dalam bidang kognitif, terutama dalam mengenal ukuran berat atau ringan. Seorang anak akan mengalami kesulitan membaca angka pada timbangan yang jarumnya bergoyang-goyang oleh karena itu timbangan yang paling baik untuk anak adalah timbangan tua yang sederhana atau timbangan neraca.Dengan pembelajaran melalui metode proyek memasak bertujuan mengembangkan kemampuan kognitif dalam mengenal ukuran berat. Penelitian ini di lakukan di TK Arjuno 02 Batu, tanggal 21 September 2010 sampai dengan 14 Oktober 2010. Metode penelitian yang di gunakan adalah Penelitian Tindakan Kelas (PTK). Penilaian yang di gunakan adalah lembar observasi. Dengan di terapkannya metode pembelajaran proyek masak ini, terbukti anak lebih mengenal mana yang berat dan yang ringan, anak apat menimbang secara seimbang dengan timbangan neraca, anak tahu satuan, gelas, sendok. Berasar hasil penelitian ini di sarankan agar guru dapat menerapkan metode ini guna meningkatkan kemampuan kognitif anak dalam mengenal ukuran berat ringan, banyak sedikit, menimbang benda dan mengenal satuan wadah. Selain itu juga dapat meningkatkan mutu pembelajaran di sekolah.

Pemanfaatan lingkungan sekolah untuk meningkatkan kemampuan menulis kalimat sederhana kelas II MI Darussalam Rembang Pasuruan / Erna Irawati

 

Kata kunci : Lingkungan Sekolah, Kemampuan Menulis, Kalimat Sederhana, SD. Salah satu keterampilan berbahasa yang cukup komplek adalah menulis, keterampilan menulis di sekolah dasar merupakan sesuatu yang perlu dikuasai oleh setiap siswa sekolah dasar, karena keterampilan ini menjadi sarana untuk mempelajari seluruh mata pelajaran di sekolah. Namun tidak sedikit siswa yang belum menguasai cara-cara menulis, terutama menulis kaliat sederhana khususnya bagi siswa kelas II MI Darussalam Rembang Pasuruan. Hal ini kemungkinan disebabkan oleh teknik meupun metode yang kurang tepat dalam penyampaian materi, sehingga peneliti ingin menciptakan suasana yang baru dalam kegiatan belajar mengajar dengan memanfaatkan lingkungan sekolah sebagai sarana dalam penyampaian materi atau sebagai media dalam pembelajaran menulis kalimat sederhana di kelas II MI Darussalam Rembang Pasuruan. Tujuan dari penelitian ini yaitu: a) mendeskripsikan penerapan pembelajaran dengan memanfaatkan lingkungan sekolah untuk meningkatkan kemampuan menulis kalimat sederhana, dan b) mendeskripsikan pemanfaatan lingkungan dalam pembelajaran dapat meningkatkan kemampuan menulis kalimat sederhana. Obyek sasaran penelitian ini adalah siswa kelas II MI Darussalam Rembang Pasuruan. Adapun metode yang digunakan oleh peneliti dalam pengumpulan data adalah wawancara, observasi , dan tes. Dengan menggunakan instrumen yang berupa pedoman wawancara, pedoman observasi, dan pedoman penilaian. Penelitian ini dilakukan dalam tiga tahap yaitu tahap pra siklus, siklus 1 dan siklus 2. Pada tahap pra siklus dari 11 siswa 3 diantaranya tuntas dalam belajar dengan nilai 80, 75, dan 70. Pada siklus 1 dari 11 siswa 7 diantaranya yang tuntas dalam belajar dengan nilai 90, 75, 70 80,85. Pada siklus 2 dari 11 siswa 9 diantaranya yang tuntas dalam belajar dengan nilai 95, 70, 75, 85. Dari hasil atau data diatas menunjukkan bahwa pemanfaatan lingkungnan sekolah dapat meningkatkan kemampuan menulis kalimat sederhana siswa kelas II MI Darussalam Rembang Pasuruan. Dengan demikian peneliti menyarankan kepada guru-guru yang lain hendaknya menggunakan lingkungan sekolah sebagai sarana dalampenyampaian materi agar kemampuan siswa dapat meningkat khususnya pada pembelajaran menulis kalimat sederhana.

Developing the honey comb challenge multimedia game courseware to improve the fourth graders' speaking skill at SDN Purwantoro II Malang / Ridhia Rizki Anugraini

 

Keywords: speaking, EYL, multimedia/media, courseware. This study focused on developing The Honey Comb Challenge multimedia game courseware to improve the fourth graders’ speaking skill especially in answering the teacher’s questions dealing with location (preposition of place) at SDN Purwantoro II Malang. Multimedia game courseware that is used for foreign language teaching and learning will make young learners actively participate to speak, in addition, the children would learn to communicate and express their creativity by using multimedia (Lee, 2009). This research and development (R&D) adopts the framework of Taba cited in Dubin and Olhstain (1986: 2). The materials were developed based on the basic competence of teaching speaking for the fourth graders in the syllabus used at SDN Purwantoro II Malang. The courseware consists of two themes which contains pictures dealing with location (preposition of place), music, and a music video. The courseware was assembled in the form of CD-ROM which was completed with autorun CD-ROM. The researcher also developed a guidance book of the courseware which covers the ways to navigate the courseware, the rules of the game, questions and answers for each theme in the game, and speaking scoring rubric to assess the students’ speaking skill. In courseware try-out, the students liked and enjoyed the activities in the courseware. They were really attracted and interested in the multimedia application which consists of animation and audio so that they could perform their ability in speaking skill well. Therefore the use of The Honey Comb Challenge multimedia game courseware is expected to meet the needs of media in teaching and learning speaking skill for the fourth graders at SDN Purwantoro II Malang, with the hope that it can improve their speaking skill.

Pengembangan paket bimbingan pengendalian emosi bagi siswa sekolah menengah pertama / Elok Nur Khoirisami

 

Katakunci:paketbimbingan,pengendalianemosi,siswaSMP. SiswaSMPsebagaikelompokusiaremaja,tidaklepasdarifenomenayangterjadipadasetiapremaja.SiswaSMPtermasukdalamkategoriremajaawalataumasatransisi,yangterkadangintensitasmunculnyaproblememosiseringdibandingkandenganremajaakhir.Selamamasatransisiini,remajamengalamikrisisidentitas.Krisisidentitaspadasaat-saattertentuseringkalimenimbulkanketidakstabilanemosicemas,bingung,danmerasatidakbahagia.Problememosiyangdialamiremaja,bilatidaksegeradipecahkanakanmenghambatremajadalammelakukanpenyesuaiandenganlingkungansosialdanjugadengandirinyasendiri.Konselorperlumemberikanbimbingankarenapengendalianemosibukanlahsesuatuyangdimilikisecaraalamiolehindividu,melainkanmerupakansesuatuyangdipelajari. TujuanseperangkatpengembanganpaketbimbinganpengendalianemosiadalahuntukmenghasilkanPaketBimbinganPengendalianEmosibagiSiswaSMPyanglayak,tepat,berguna,danmenarikbagisiswaSMP.ProdukyangdihasilkandaripengembanganiniadalahPaketBimbinganPengendalianEmosiyangterdiriatas(1)panduanPaketBimbinganPengendalianEmosiuntukkonselor,(2)materiPaketBimbinganPengendalianEmosiuntuksiswa,dan(3)bukukerjapengendalianemosiuntuksiswa;yangterdiriatastigapenggalan,yaitu:(I)HakikatEmosi,yangterdiriatas(a)PengertiandanJenis-jenisEmosidan (b) PerkembanganEmosipadaRemaja,(II)PengaruhEmosi,dan(III)CaraPengendalianEmosi,yangterdiriatas(a)PengaturanDiri(selfregulation)dan(b)PengaturanEmosi(emotionalregulation).Paketinidisusundenganmenggunakanmodelpembelajaranexperientiallearning. Penelitianinimerupakanpenelitianpengembanganyangmenggunakanlangkah-langkahpengembangandariBorg&Gall(1983)yangterdiriatastahapperencanaan,tahappengembanganproduk,dantahapujicoba.Subyekujicobaadalahahli,yaituahlibimbingandankonselingdanahlibahasa;ujicalonpenggunaproduk,yaitukonselor;danujikelompokkecil,yaitusatukelassiswaSMP.Datadikumpulkanmelaluiformatujiahlidanujicalonpenggunaberupaskalapenilaian,datayangdiperolehadalahdatakuantitatifdankualitatif.Sedangkanujikelompokkecilberupadatakualitatif.Datakuantitatifdianalisisdenganmenggunakananalisisreratadandatakualitatifdianalisisdenganmenggunakananalisisdeskriptif. BerdasarkanpenilaianahliBK,PaketBimbinganPengendalianEmosibagiSiswaSMPinisangatbergunauntuksiswadankonselordalammemberikanbimbingantentangpengendalianemosidenganrerata3,9.Dilihatdariaspekkelayakan,paketinisangatlayakdiberikankepadasiswadenganrerata3,56.Dariaspekketepatan,paketinitepatuntukdigunakanolehsiswadankonselordalam i memberianbimbinganpengendalianemosidenganrerata3.Adapunaspekkemenarikan,paketinimenarikdenganrerata3,sedangkanmenurutahliBahasa,PaketBimbinganPengendalianEmosibagiSiswaSMPsangattepat,dilihatdarikejelasan,kesesuaian,hubungankalimatsatudenganyanglain,danbahasayangdigunakanuntuksiswadenganrerata3,8.Berdasarkanujicalonpengguna(konselor);dilihatdariaspekkegunaan,paketinisangatbergunadenganrerata3,67;aspekkelayakan,paketinisangatlayakdenganrerata3,63;aspekketepatan,paketinisangattepatdenganreratata3,52;danaspekkemenarikan,paketinisangatmenarikdenganrerata3,75.Berdasarkanujikelompokkecil(siswa),PaketBimbinganPengendalianEmosimenarikdanpenjelasannyacukupjelas. Berdasarkanhasilpenelitiantersebut,saranyangdiberikanadalah:(1)konselorharusmemahamiprosedurbimbingandanmateribimbinganagarsiswadapatmencapaitujuanbimbinganyangdikehendaki,(2)konselorharuskreatifdalammengaturwaktukarenamengingatminimnyajamtatapmuka,(3)bagipenelitiselanjutnya,dapatmelakukanujiefektivitaspaketbimbinganpengendalianemosiuntukmengetahuikeefektivitasandankelayakanpenerapanpaketpengendalianemosidenganmenggunakanekperimensemu,dan(4)paketpengendalianemosiinidikembangkandenganmelakukanpenelitihandiSMPNegeri1PucukLamongan,sehinggaapabiladilakukanuntukSMPlain,makaperludilakukanpenyesuaian-penyesuaiandenganmenganalisiskembalikebutuhansiswaterhadappaketpengendalianemosi.

Prediksi kebangkrutan industri rokok di Indonesia yang listing di BEI periode 2005-2008 dengan menggunakan metode Z-score / Agus Subagiyo

 

Kata Kunci: Kebangkrutan, Industri Rokok, Analisis Altman (Z-Score) Kebangkrutan dapat diartikan sebagai kegagalan perusahaan dalam menjalankan kegiatan usahanya untuk menghasilkan laba. Kegagalan dapat dilihat dari dua segi, yaitu segi ekonomi dan segi keuangan. Dari segi ekonomi, perusahaan dianggap gagal apabila mempunyai return yang negative. Sedangkan dari segi keuangan, perusahaan dianggap gagal atau tidak mampu membayar utangnya pada tanggal jatuh tempo. Penelitian ini menggunakan metode Altman (Z-Score) untuk memprediksi kebangkrutan industri rokok. Rasio yang digunakan dalam metode ini terdiri dari modal kerja (X1), laba ditahan (X2), EBIT (X3), nilai pasar dari modal (X4), dan penjualan (X5). Dari hasil Z-Score kemudian perusahaan dapat dikategorikan apakah perusahaan tersebut berada pada kondisi sehat, rawan bangkrut, dan bangkrut berdasarkan titik cut off. Tujuan penelitian ini untuk menggambarkan kinerja keuangan, memprediksikan kebangkrutan dan melihat potensi kebangkrutan pada industri rokok yang dijadikan sampel penelitian dengan menggunakan metode Z-Score. Penelitian ini merupakan penelitian deskriptif yaitu penelitian yang tidak terdapat variabel bebas maupun terikat. Akan tetapi ada satu variabel utama yang menjadi fokus penelitian adalah tingkat kebangkrutan perusahaan yang diukur dengan indikator rasio-rasio Z-Score. Hasil penelitian menunjukkan bahwa perkembangan rasio pada PT BAT Indonesia Tbk mengalami penurunan dibandingkan dengan tiga perusahaan sampel yang lain. Selain itu PT BAT Indonesia Tbk pada tahun 2005 samapai dengan tahun 2008 dalam kondisi bangkrut, dan berdasarkan trend Z-Score tahun 2009 dua perusahaan dalam kondisi sehat, satu perusahaan dalam kondisi rawan bangkrut, dan satu perusahaan dalam kondisi bangkrut. Berdasarkan hasil penelitian tersebut, peneliti dapat menyarankan bagi perusahaan memperbaiki manajemen dan memperbaiki kinerja keuangannya masing-masing supaya perusahaan tetap berada dalam kondisi sehat dan tidak berada dalam kondisi rawan bangkrut maupun kondisi bangkrut.

Persepsi siswa kelas VI SD Negeri se Kecamatan Klojen Malang terhadap seks / Mila Husnatin Nihaya

 

Kata Kunci: Persepsi, Siswa kelas VI SD, Seks. Saat ini banyak dijumpai siswa kelas VI SD yang sudah mulai datang bulan (bagi anak perempuan) dan mengalami mimpi basah (bagi anak laki-laki). Hal ini tidak terlepas dari semakin berkembangannya teknologi informasi misalnya banyaknya acara TV yang memperlihatkan pergaulan bebas dan banyaknya situs porno atau majalah porno yang mudah didapat oleh anak. Perkembangan teknologi itulah yang menyebabkan banyak anak cepat matang. Anak yang mengalami cepat matang, kematangan seksualnya berkembang lebih cepat dari pada rata-rata anak yang lain. Perubahan yang begitu cepat ini menimbulkan anak penasaran atas apa yang terjadi pada dirinya. Mereka akan mencari informasi tentang seks dari mana saja, misal dari guru, teman, orangtua, media masa, dll. Informasi yang tepat akan memberikan dampak yang baik bagi anak sedangkan informasi yang tidak tepat akan memberikan dampak yang buruk bagi anak. Untuk mengetahui bagaimana pengetahuan siswa tentang seks, dilaksanakan penelitian mengenai persepsi siswa kelas VI SD Negeri Se Kecamatan Klojen Malang terhadap seks. Tujuan penelitian ini adalah untuk mengetahui persepsi siswa kelas VI SD Negeri Se Kecamatan Klojen Malang terhadap seks. Tujuan persepsi siswa kelas VI terhadap seks dapat dijabarkan sebagai berikut: (1) mengetahui persepsi siswa tentang pengertian seks, (2) mengetahui persepsi siswa tentang perkembangan seksual, (3) mengetahui persepsi siswa tentang sumber belajar seks, (4) mengetahui persepsi siswa tentang etika bergaul. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif kuantitatif. Populasi penelitian adalah siswa kelas VI SD Negeri Se Kecamatan Klojen Malang. Sampel penelitian sebanyak 117 orang siswa kelas VI SD Negeri Se Kecamatan Klojen Malang. Teknik pengambilan sampel yang digunakan adalah multiple stage sample yaitu dengan menggunakan area probability sampel dan simple random sampling. Data dikumpulkan dengan angket yang dianalisis dengan teknik persentase. Hasil penelitian mengenai persepsi siswa kelas VI SD Negeri Se Kecamatan Klojen Malang Terhadap Seks, menunjukkan bahwa banyak siswa cukup paham tentang pengertian seks. Banyak siswa yang sangat paham tentang perkembangan seksual. Cukup banyak siswa yang sangat paham tentang sumber belajar seks. Cukup banyak siswa yang cukup paham tentang etika bergaul. Secara umum dapat disimpulkan bahwa banyak siswa yang sangat paham tentang seks, sedikit siswa yang cukup paham tentang seks, dan tidak ada siswa yang tidak paham tentang seks. Penelitian ini hendaknya dapat digunakan oleh guru kelas sebagai acuan dalam menyusun program bimbingan dan konseling. Penelitian ini hendaknya juga dapat dijadikan masukan peneliti lanjut untuk lebih memperluas populasinya dan mengembangkan instrumentnya sehingga diketahui hasil penelitian di lain populasi yang lebih dalam.

Penggunaan media domino bilangan untuk meningkatkan kemampuan berhitung perkalian dengan teknik permainan pada siswa kelas III SDN Percobaan 2 Malang / Titik Wijiastutik

 

Kata Kunci: domino bilangan, berhitung perkalian, permainan. Bermain merupakan kebutuhan yang utama bagi siswa pada usia SD. Untuk itu guru perlu memfasilitasi pembelajaran matematika yang sesuai dengan karakteristik siswa SD. Salah satu strategi yang digunakan dalam pembelajaran matematika adalah belajar melalui permainan. Dengan permainan diharapkan siswa tidak jenuh dan termotivasi untuk menyelesaikan masalah matematika khususnya perkalian. Penelitian ini bertujuan untuk mendeskripsikan: (1) proses pembelajaran matematika siswa kelas III SDN Percobaan 2 Malang dengan menggunakan domino bilangan, (2) kemampuan berhitung perkalian siswa kelas III SDN Percobaan 2 Malang setelah menggunakan media domino bilangan. Penelitian ini menggunakan pendekatan kualitatif. Jenis penelitiannya menggunakan PTK dengan model siklus yang dikembangkan oleh Kemmis dan Mc Taggart. Penelitian ini dilaksanakan dalam 2 siklus. Subjek penelitiannya adalah siswa kelas III SDN percobaan 2 Malang yang berjumlah 27 siswa. Adapun instrumen yang digunakan dalam penelitian ini adalah observasi, wawancara dan tes. Penelitian ini menggunakan standar ketuntasan belajar untuk individu yang ditetapkan 65 dan untuk ketuntasan klasikal 80%. Hasil penelitian menunjukkan bahwa aktivitas siswa pada saat proses pembelajaran matematika meningkat, ditandai dengan siswa yang aktif berdiskusi dengan kelompoknya, banyak siswa yang ingin maju menyampaikan hasil diskusinya. Kemampuan siswa memahami konsep perkalian setelah menggunakan media kartu bilangan juga mengalami peningkatan. Hal ini dapat dilihat dari nilai rata-rata siswa sebelum menggunakan kartu bilangan hanya mencapai 61,3. Setelah menerapkan permainan dengan kartu bilangan, nilai rata-rata siswa pada siklus I mencapai 72,4. Pada siklus II mengalami peningkatan lagi yaitu nilai rata-rata mencapai 84,6. Kesimpulan dari penelitian ini adalah (a) Penggunaan media kartu bilangan perkalian dalam proses pembelajaran matematika di SDN Percobaan 2 Malang telah memberikan kesempatan pada siswa untuk menemukan sendiri sebuah konsep perkalian, bekerja kelompok sehingga melatih sikap saling bekerjasama dengan teman, melatih keberanian siswa untuk mengungkapkan pendapatnya; (b) pembelajaran dengan menerapkan media kartu bilangan perkalian pada siswa SDN Percobaan 2 Malang dapat meningkatkan kemampuan siswa dalam berhitung perkalian. Saran yang dapat disampaikan antara lain: (a) guru hendaknya memberi pengarahan pada siswa agar dalam membuat kelompok tidak memilih-milih teman; (b) memberi penjelasan sampai siswa paham sebelum permainan dilaksanakan; (c) guru hendaknya selalu memberi motivasi (d) Guru hendaknya selalu mengingatkan siswa yang tidak mau bekerja dengan kelompok.

Penggunaan media kartu gambar untuk meningkatkan kemampuan berbahasa pada anak kelompok B di RA Miftahul Khoir / Indrarti Yhuaningsih

 

Kata kunci: media kartu gambar, kemampuan berbahasa, Roudhatul Athfal. Kemampuan bahasa sangat penting bagi anak usia dini, karena merupakan kemampuan dasar yang harus dimiliki anak sebagai persiapan membaca dan menulis untuk memasuki jenjang Sekolah Dasar. Untuk meningkatkan kemampuan bahasa anak, perlu adanya media pembelajaran yang dapat menarik dan menyenangkan pada saat pelaksanaan pelajaran membaca. Hasil observasi awal ditemukan bahwa anak RA Miftahul Khoir Grati Pasuruan masih rendah sebelum menggunakan kartu gambar. Sebagian anak belum mampu mencapai kriteria ketuntasan yang ditentukan oleh sekolah yaitu 60% dari ketuntasan individu. Berdasarkan hal ini, penggunaan media kartu gambar sangat tepat digunakan sebagai alternatif dalam proses pembelajaran. Tujuan penelitian ini adalah: 1) mendeskripsikan penggunaan media kartu gambar yang dapat meningkatkan kemampuan membaca anak kelompok B di RA Miftahul Khoir, 2) mendeskripsikan peningkatan kemampuan membaca anak kelompok B di RA Miftahul Khoir setelah diterapkan atau dibelajarkan dengan media kartu gambar. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan 2(dua) siklus. Masing-masing siklus terdiri atas 4 tahapan: perencanaan, pelaksanaan , observasi, dan refleksi. Subyek penelitian ini adalah anak kelompok B di RA Miftahul Khoir sebanyak 20 anak. Teknik pengumpulan data yang digunakan adalah observasi secara langsung terhadap kegiatan anak. Hasil penelitian ini menunjukkan menggunaan media kartu gambar dapat meningkatkan kemampuan berbahasa anak kelompok B di RA Miftahul Khoir, terbukti dari hasil yang diperoleh anak dapat dilihat dari rata-rata hasil observasi anak mulai dari pratindakan (46) dengan prosentase (10%), meningkat pada siklus I (66) dengan prosentase (45%), dan meningkat lagi pada siklus II (84,15) dengan prosentase (90%) yang terus mengalami peningkatan. Dari penggunaan media kartu gambar ini dapat meningkatkan kemampuan berbahasa pada kegiatan membaca dan nilai ketuntasan belajar anak. Saran yang disampaikan yaitu penggunaan media kartu gambar dengan cara menunjukkan obyek/bendanya akan memudahkan, memotivasi dan menarik minat anak dalam pelaksanaan kegiatan membaca, sehingga dapat meningkatkan kemampuan berbahasa pada saat pembelajaran.

Penerapan pendekatan kooperatif model jigsaw untuk meningkatkan hasil belajar IPA siswa kelas V di SDN Pakisaji 02 Kabupaten Malang / Zainal Abdi

 

Kata Kunci: Model Jigsaw, Hasil Belajar, IPA Pengamatan yang telah dilaksanakan di SDN Pakisaji 02 Kabupaten Malang dapat diketahui beberapa permasalahan yang timbul pada mata pelajaran IPA. Adapun rincian dari permasalahan yang timbul: (1) nilai rata-rata siswa berdasarkan ulangan harian dan formatif mencapai 35%. Nilai rata-rata tersebut masih di bawah Standar Ketuntasan Minimal yang ditentukan oleh sekolah tersebut, yaitu 75%; (2) guru cenderung masih mendominasi dalam proses pembelajaran; (3) siswa kurang diberi kesempatan untuk memperoleh sendiri pengetahuan yang didapat, sehingga siswa cenderung pasif dalam proses belajar mengajar. Adapun penelitian ini bertujuan untuk meningkatkan kompetensi yang dimiliki siswa dengan jalan meningkatkan hasil belajar siswa dengan menerapkan model Jigsaw Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) dengan model Kemmis Taggart yang terdiri dari 2 siklus dan 4 tahapan, yaitu: tahap perencanaan, tahap pelaksanaan tindakan, tahap observasi, dan tahap refleksi. Subyek penelitian ini adalah siswa kelas V SDNPakisaji 02 Kabupaten Malang yang terdiri dari 31 siswa dengan rincian 14 siswa laki-laki dan 17 siswa perempuan. Penelitian ini menunjukkan adanya peningkatan hasil belajar siswa. Indikasi adanya dampak yang baik terhadap hasil belajar adalah adanya kenaikan rata-rata skor dari nilai siswa yang sebelumnya mencapai 66,6 dan terus meningkat menjadi 80,3. selain itu dampak tersebut dapat dilihat dari hasil nilai tes evaluasi pada siklus I pertemuan I mencapai 58%, meningkat pada pertemuan II menjadi 68%, meningkat pada siklus II pertemuan 1 menjadi 77%, dan pada pertemuan II meningkat menjadi 84%.Serta semakin berkurangnya domiasi guru dalam proses relajar mengajar, hal tersebut dapat dibuktikan dari pencapaian guru dalam menerapkan model Jigsaw, yaitu pada siklus I pertemuan I mencapai 64% meningkat pada pertemuan II menjadi 73%, meningkat pada siklus II pertemuan I menjadi 82%, dan meningkat pada pertemuan II menjadi 96%. Berdasarkan hasil penelitian di atas disarankan agar guru senantiasa dapat menerapkan model Jigsaw yang terbukti dapat meningkatkan hasil belajar IPA siswa kelas V di SDN Pakisaji 02 Kabupaten Malang.

Pemahaman mahasiswa Fakultas Ilmu Pendidikan Universitas Negeri Malang tentang kehidupan berkeluarga / Deka Wahyu K.

 

Key Word: Comprehension, student, family life. Family life is a fact which is very complex, where the family life starts by way a marriage. Marriage is a formal bound between women and men as a husband or wife spouse, which can unite both of personal adult in a comprehensive manner. Family life is something which bound state, in the bound state consists in responsible and commitment toward the couple, which if it collide, the consequences family will not harmonious. The Student’s comprehend about family life is a think how the student understand, know, conmprehend and recognize a family life. The purpose of this research to know the level of student’s comprehend Faculty Of Training Education University Of Malang About Family Life. The design of this research uses descriptive quantitative method. The population of the reasearch is the students of Faculty Training Education University Of Malang, The sample of research is 10% from totality the students of Faculty of Training Education with the total 410 people. Technique which get the sample use Stratified Random Sampling. The collect data uses measurer inventory the sudent’s comprehend about family life with very appropriate, appropriate, less appropriate, and not appropriate classify. Technique of analysis which used descriptive percentage. The result of research shows that the student’s comprehend Faculty Training Education University Of Malang about family life had known from the percentage result and description as from BKP,TEP,AP,PLS,PAUD, and PGSD 2007 forces ascertainable that the student’s Faculty of training education more comprehend about family life is in PGSD department, but to 2008 forces from Faculty of training education the student’s comprehend about family life more in the student’s PGSD department. To 2009 forces the comprehension about family life more understand by the student BK department and PLS. And to 2010 forces which most comprehend about family life is in BKP department and Education Technology Department. According the result of this research, so the researcher advised to various party :1) BK UPT party to give guidance about readiness in choose endure family life. This case need given either in information form either guidance directly to the students. 2) For the students ought to more prepare their self to endure family life will their endure in the next future. So it need get information about family life to personal ripeness will determine the selection to marriage early or delay their want to marriage, 3) For the researcher to further researcher hopeable continue this research becomes a research which more deep again.

Peningkatan kemampuan membaca pemahaman isi teks bacaan melalui metode pembelajaran penemuan (discovery) siswa kelas IV SDN Ngadirejo 2 Kota Blitar / Heri Wijayanto

 

Kata kunci: membaca pemahaman, metode penemuan (discovery). Pada kenyataan di lapangan, siswa kelas IV SDN Ngadirejo 2 Kecamatan Kepanjenkidul Kota Blitar memiliki kemampuan membaca pemahaman yang rendah. Maka, perlu diadakan penelitian untuk mengatasi masalah tersebut. Rumusan masalah penelitian ini adalah 1) Bagaimanakah penerapan metode pembelajaran penemuan (discovery) untuk meningkatkan kemampuan membaca pemahaman isi teks bacaan siswa kelas IV SDN Ngadirejo 2 Kota Blitar, 2) Bagaimanakah hasil peningkatan kemampuan membaca pemahaman isi teks bacaan melalui metode pembelajaran penemuan (discovery) siswa kelas IV SDN Ngadirejo 2 Kota Blitar. Penelitian ini bertujuan (1) mendeskripsikan penerapan metode pembelajaran penemuan (discovery) dalam pembelajaran Bahasa Indonesia untuk meningkatkan kemampuan membaca pemahaman isi teks bacaan siswa kelas IV SDN Ngadirejo 2 Kota Blitar, dan (2) mendeskripsikan hasil peningkatan kemampuan membaca pemahaman isi teks bacaan melalui metode pembelajaran penemuan (discovery) siswa kelas IV SDN Ngadirejo 2 Kota Blitar. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Jenis penelitian yang dipergunakan dalam penulisan skripsi ini adalah Penelitian Tindakan Kelas (PTK). Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Sedangkan teknik pengumpulan data yang digunakan adalah observasi dan tes. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan metode discovery dapat meningkatkan aktivitas siswa dalam pembelajaran kemampuan membaca pemahaman siswa antara lain, pemahaman harfiah yaitu, prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 69,7 dan pada pertemuan kedua yaitu 78,8. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 77,3 dan pada pertemuan kedua yaitu 81,8. Pemahaman inferensial yaitu prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 69,7 dan pada pertemuan kedua yaitu 72,7. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 71,2 dan pada pertemuan kedua yaitu 77,3. Pemahaman evaluasi yaitu prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 69,7 dan pada pertemuan kedua yaitu 71,2. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 80,3 dan pada pertemuan kedua yaitu 80,3. Pemahaman apresiasi yaitu prosentase nilai rata-rata pada siklus I pertemuan pertama yaitu 72,7 dan pada pertemuan kedua yaitu 69,7. Prosentase nilai rata-rata pada siklus II pertemuan pertama yaitu 72,7 dan pada pertemuan kedua yaitu 80,3. Ketuntasan klasikal pada akhir siklus II yaitu 91% lebih besar dari standar ketuntasan kalsikal yang ditentukan 80%. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa penerapan metode penemuan (discovery) dapat meningkatkan kemampuan membaca pemahaman siswa kelas IV SDN Ngadirejo 2 Kota Blitar, oleh karena itu guru disarankan untuk menerapkan metode penemuan (discovery) pada mata pelajaran bahasa Indonesia khususnya membaca pemahaman.

Penelitian motif pada industri kerajinan batik ayu gestar Kelurahan Gedog Kecamatan Senanwetan Kota Blitar / Cindy Lovina

 

ABSTRAK Lovina, Cindy. 2015. Penelitian MotifpadaIndustriKerajinan Batik AyuGestarKelurahanGedogKecamatanSananwetanKota Blitar.Skripsi, JurusanSenidanDesain, FakultasSastra, UnivesitasNegeri Malang.Pembimbing: (I) Drs. Sumarwahyudi, M.Sn, (II) Ike Ratnawati, S.Pd, M.Pd. Kata Kunci:motif batik, AyuGestar, kotaBlitar Di kotaBlitarindustrikreatifdipandangsemakinpentingdalammendukungkesejahteraandalamperekonomian. Sebagaiwujudpandangantersebut, sebagianbesarmasyarakatsetempatmenggelutiaktivitasindustrikecildankerajinanrumahtangga, mulaidarianak-anak di luarkegiatanmengikuti proses belajarmengajar, remajahingga orang tua, baikwanitamaupunpria,salahsatunyaadalahindustrikerajinan batik. Selamaobservasi, penelitimenemukanberbagaimacamindustrikerajinan batik baikbesarmaupunkecil yangadadalamwilayahkotaBlitar. Secaraumumpenelitianinidilaksanakanuntukmendeskripsikandesain motif batik yang dibuatolehAyuGestar di kelurahanGedogkecamatanSananwetankotaBlitar.Alasanpenelitiankualitatifinidilakukan di industrikerajinan batik AyuGestaradalahindustrikerajinaninimengangkattemaunggulankotaBlitarsebagaisumberinspirasidalammembuatdesain motif, misalnya 1) ikan koi, 2) kendangjimbe, 3) belimbingKarangsari, dan lain-lain.Data yang diperolehdengancarawawancaradanobservasidariberbagaimacamsumber, denganmanusia yangdigunakansebagaiinstrumendalampengumpulan data. Kemudianpenelitimenelaah data, mengidentifikasi data sertamengklasifikasikannyasebelummelakukanevaluasiterhadap data tersebut. Batik-batik hasilkaryaAyuGestertergolongdalamjenis batik kreasi, yaknipengembangan ide-ide baru yang sebagianbesarberasaldarilingkungansekitar.Berdasarkanhasilpenelitian yang telahdiperoleh, data yang didapatpenelitiadalahdesainkain batik AyuGestarterdiridariberbagaimacam motif, misalnya motif binatang, tumbuhan, makhlukhidup, imajinatif, dangabungan, sehinggapenelitimembatasiruanglingkupbahasanyaitu motif 1) binatang air, 2) alambenda yang berupakendangjimbe,dan 3)gabungan yang merupakan motif JagadBlitar. Motifbinatang yang penelitimaksudadalahjenisbinatang air, yakniikan koi yang merupakanprodukunggulankotaBlitar.Jenis motif ikan koi adalah motif yang selaludiusahakanuntuktampilpadasetiapkaryaperajin batik AyuGestar, sehinggamasyarakatakanlebihmengenalkotaBlitarlewat motif-motif ikan koi. Motif alambendalebihcenderungpadadesain yang menggunakangambarkendangjimbesebagai motif utamanya.Kendangjimbeadalahjenisalatmusiktradisionalkhaskotaini yang banyakditemukan di daerahpasarmakam Bung Karno, bahkanada yang dibuatsebagaiminiaturuntuksekedarhiasanatauaksesoris.Sedangkanpada motif gabungan, penelitimaksudkanpadadesain batik dengan motif JagadBlitar.Motif JagadBlitaradalah motif originalmilikAyuGestar yang barudikembangkanpadatahun 2011, bersamadenganberdirinyakelompokini.Kemudianpada motif tumbuhanterdapatberbagaimacamjenisdesain, karena motif tumbuhanlah yang banyakpenelititemukandalamsebagaianbesardesain-desain batik AyuGestar.

Peningkatan hasil belajar IPA melalui connected model berbasis pakem siswa kelas V SDN Penaggungan Malang / Imam Hambali

 

Kata Kunci: Hasil Belajar, IPA, Pembelajaran Terpadu Connected Model. Pembelajaran terpadu connected model merupakan model integrasi inter bidang studi. Penelitian ini bertujuan untuk mengetahui penerapan Pembelajaran terpadu connected model, peningkatan aktivitas dan hasil belajar siswa.Hasil observasi awal telah ditemukan: (a) nilai ulangan tengah semester kurang dari standar ketuntasan secara klasikal.(b) pembelajaran cendrung tex book.(c) pembelajaran masih bersifat informatif. Penelitian ini dilaksanakan di kelas V-B SDN Penanggungan Malang.waktu pelaksanaan mulai tanggal 18 Agustus sampai 22 November 2010. Pendekatan dalam penelitian ini adalah pendekatan kualitatif jenis penelitian tindakan kelas (PTK) collaborative. Dengan tujuan 1)Bagaimanakah penerapan connected model berbasis PAKEM siswa kelas V SDN Penanggungan Malang pada pembelajaran IPA konsep sistem peredaran darah manusia? 2)Apakah penerapan connected model berbasis PAKEM dapat meningkatkan keaktifan siswa kelas V SDN Penanggungan Malang? 3)Apakah penerapan connected model berbasis PAKEM dapat meningkatkan hasil belajar siswa kelas V SDN Penanggungan Malang? Penerapan pembelajaran terpadu connected model adalah pembelajara yang yang mengintegrasikan satu konsep, keterampilan yang dikaitkan dengan konsep, keterampilan lain dalam satu bidang studi. Aktivitas belajar berpusat pada siswa sehingga pembelajaran lebih bermakna dan efektif. Hasil yang diperoleh dari pelaksanaan siklus I dan siklus II, menunjukkan adanya peningkatan hasil belajar siswa. Dilihat dari proses pembelajaran pada pra tindakan, tindakan siklus I dan tindakan pada siklus II dengan skor rata-rata kelas sebagai berikut: (1) pra tindakan 68,4% dengan 14 orang siswa yang tuntas dan 21 siswa tidak tuntas, dengan skor tertinggi 99 dan skor terendah 32; (2) tindakan siklus I 71,4% dengan siswa yang tuntas dan 17 orang dan yang tidak tuntas 18 orang dengan skor tertinggi 100 dan skor terendah 60; (3) tindakan siklus II 79,1% dengan siswa yang tuntas 24 dan yang tidak tuntas 11 dengan skor tertinggi 100 dan skor terendah 60. Kesimpulan: (1) penerapan pembelajaran terpadu connected model adalah pembelajaran yang dilakukan dengan mengaitkan satu konsep dengan konsep berikutnya dalam satu bidang studi; (2) aktivitas belajar siswa meningkat melalui pembelajaran terpadu connected model; (3) hasil belajar siswa pada pembelajaran IPA juga mengalami peningkatan.

Meningkatkan ketrampilan berhitung melalui bermain bilangan dengan menggunakan media gambar untuk kelompok A TK Katholik Indriyasana VIIIB Mojorejo Kecamatan Wates Kabupaten Blitar / Diyah Candra Mayang Wulan

 

Keywords: playing numbers and media images. This research background at low numeracy skills of children in the count, classifying objects, the symbol pair numbers, showing two sets of objects. This is because the learning activities do not involve children and the use of media that is still less so the child is less interested in learning activities. Based on observations made in group A Catholic kindergarten Indriyasana Mojorejo VIIIB contained formulation of the problem: (1) How is the application of play numbers by using media images can improve the numeracy skills of children in group A Catholic kindergarten Indriyasana VIII B Mojorejo? (2) Is the application of playing numbers by using media images can improve the numeracy skills of children in group A Catholic kindergarten Indriyasana VIII B Mojorejo. The research design used in this research is the study design and class actions are designed in two cycles. Each - each consisting of 4 phases, (1) planning, (2) Implementation, (3) Observations, (4) Reflection. The subject of this research is the son of group A Catholic kindergarten Indriyasana VIII B Mojorejo as many as 27 children. Methods of data collection obtained through observation sheet child's activity during the learning process and documentation in the form of photographs during the learning. The results showed that play using media images to improve numeracy skills of children. In the first cycle counting capabilities of children reached 72.3%, while in the second cycle increased to 89.8%. Improving numeracy skills of children characterized by increasing the skill to count, classify objects, pair the symbol number, appointed two sets of objects. Based on the results of these studies concluded that the application of playing numbers by using media images to improve numeracy skills for children in group A Catholic kindergarten Indriyasana VIII B Mojorejo. Based on research results and conclusions in this class action can be suggested: for schools to disseminate the results of this research is to improve the quality of learning, especially numeracy skills. For teachers to implement play numbers by using media images in learning activities in the field of numeracy skills

Penerapan model mind mapping untuk meningkatkan hasil belajar PKn siswa kelas IV SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang / Tri Indah Mariana

 

Kata kunci : Mind mapping, hasil belajar, PKn SD Penggunaan model pembelajaran berpengaruh terhadap hasil belajar siswa.Terbukti dari hasil observasi yang dilakukan menunjukkan bahwa pembelajaran dengan model konvensional mengakibatkan hasil dan ketuntasan belajar siswa menjadi rendah. Sebagai upaya untuk meningkatkan hasil belajar siswa tersebut, diperlukan adanya penerapan pembelajaran model mind mapping. Dengan model mind mapping ini siswa dapat melakukan belajar bermakna. Penelitian ini bertujuan untuk (1) mendeskripsikan penerapan model mind mapping untuk meningkatkan hasil belajar siswa dalam pembelajaran PKn. (2) Mendeskripsikan hasil belajar dengan menggunakan model mind mapping dalam pembelajaran PKn. Jenis penelitian ini adalah penelitian tindakan kelas yang dilaksanakan pada semester genaptahun ajaran 2010/2011,. Subjek penelitian ini adalah siswa kelas IV SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang dengan jumlah siswa 24. Rancangan penelitian ini mengacu pada model Kemmis dan Taggart. Dilaksanakan dalam 2 siklus. Di setiap siklus terdapat 4 tahap yaitu perencanaan, pelaksanaan, observasi, refleksi. Teknik pengumpulan data menggunakan tes dan observasi, dokumentasi,wawancara. Analisis data secara deskriptif. Hasil penelitian dan pembahasan yang diperoleh adalah sebagai berikut: (1) penerapan model mind map dilaksanakan 2 siklus. Kegiatan inti meliputi pemberian rangkuman materi, Tanya jawab tentang materi yang telah dibaca, siswa dibagi menjadi beberapa kelompok dan diberikan LKK, siswa memperhatikan contoh mind map yang dibuat guru seperti contoh tapi lebih dikembangkan lagi, pembahasan hasil kerja kelompok. Kegiatan akhir meliputi menyimpulkan materi dan mengerjakan soal evaluasi. (2) Hasil belajar siklus I dan II menunjukkan bahwa pembelajaran dengan menggunakan model mind mapping mampu meningkatan hasil belajar siswa. Pada siklus I Ketuntasan hasil belajar mencapai 50% dengan rata-rata kelas 61,62. Hasil belajar meningkat lagi pada siklus II menjadi 80,3 % dengan rata-rata kelas 76,79. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa penerapan pembelajaran model mind mapping dalam pembelajaran PKn materi pemerintahan desa dapat meningkatkan hasil belajar, khususnya di SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang. Dari hasil penelitian ini disarankan bahwa guru PKn hendaknya menerapkan model mind mapping dalam pembelajaran PKn khususnya materi pemerintahan desa sebagai salah satu alternatif pembelajaran untuk meningkatkan aktivitas dan hasil belajar siswa di kelas.

Penggunaan media buku cerita bergambar untuk mengembangkan kemampuan bahasa anak kelompok B di TK Al Hidayah Gedog I Kota Blitar / Septarini Dwi Lestari

 

Keywords: language skills, media picture-books, TK This research background at the lack of language skills of children. This is because in learning activities using the media picture books children often joking and not paying attention when the teacher explained in front of the class. This study aimed to describe the media use picture books that can develop language skills and describe the results of the use of picture-book media in TK Al Hidayah Gedog I Blitar city. This study used descriptive qualitative research design. class action with 2 cycles. In each cycle consists of several stages, namely planning, execution, observation, and reflection, also using data analysis. The results showed that media use picture books in learning activities proved to be utilized in the learning activities to develop children's language skills Ability TK.Pada first cycle average child reaches the 73.95% increase to 88.54% in cycle II. Marked improvement with increased language ability through the use of reading picture books to answer the question the content of picture books, fluency in reading picture books, fluency in telling the content of picture books. It is suggested that in learning to develop children's language use picture books for the media to conduct further research with other problems that can be utilized in the field of development in addition to the field of learning language skills, namely art, cognitive and physical motor.

Penerapan teknik dictogloss dalam meningkatkan menyimak pada siswa kelas V SDN Blabak 1 Kota Kediri / Andi Rubiyantoro

 

Kata Kunci: Teknik dictogloss, meningkatkan, menyimak. Kemampuan menyimak siswa kelas V SDN Blabak 1 Kota Kediri masih rendah. Maka teknik dictogloss dipilih sebagai jalan keluar permasalahan tersebut. Teknik ini dipilih karena menonjolkan kerjasama dalam merekonstruksi bahan simakan sehingga siswa yang mempunyai kemampuan lebih bisa membantu siswa yang kemampuannya kurang. Selain alasan itu, juga didasarkan atas keunggulan yang dimiliki teknik dictogloss. Skripsi ini didasarkan atas pemasalahan: a) Bagaimana penerapan teknik dictogloss dalam meningkatkan kemampuan menyimak pelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri? Dan b) Apakah ada peningkatan kemampuan siswa menyimak pelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri setelah menggunakan teknik dictogloss? Berdasarkan permasalahan yang telah ada, Skripsi ini memiliki tujuan: a) Mendiskripsikan penerapan teknik dictogloss dalam meningkatkan kemampuan menyimak pembelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri. Dan b) Mendiskripsikan peningkatan kemampuan siswa menyimak pembelajaran bahasa Indonesia kelas V SDN Blabak 1 Kota Kediri setelah menggunakan teknik dictogloss. Penelitian ini menggunakan penelitian tindakan kelas model Kemmis dan Tagart yang terdiri dari empat tahap yaitu perencanaan, pelaksanaan, obsertavasi, serta reflkesi. Sasaran penelitian ini adalah siswa kelas V SDN Blabak 1 Kota Kediri semester ganjil tahun pelajaran 2010/2011. Dari data hasil penelitian yang dilaksanakan, diperoleh data tentang penerapan teknik dictogloss dan kemampuan menyimak siswa setelah menggunakan teknik dictogloss. Pembelajaran menyimak dengan teknik dictogloss dilaksanakan dengan empat tahap yaitu persiapan, dikte, rekonstruksi, serta analisis dan koreksi. Penerapan teknik dictogloss diterapkan dengan baik oleh guru. Ini didasarkan pada APKG I, APKG II, dan lembar observasi. APKG I siklus I sebesar 79,3 dan siklus II 90,3. APKG II siklus I 91,7 dan siklus II 91,1. Lembar observasi kemampuan guru mempersiapkan pembelajaran dictogloss siklus I 85 dan siklus II 89. Lembar observasi melaksanakan pembelajaran dictogloss siklus I 82 dan siklus II 92,5. Kemampuan menyimak siswa didasarkan pada nilai akhir dan ketuntasan secara klasikal. Rata-rata nilai akhir pada pratindakan sebesar 60,9 siklus I sebesar 69 dan siklus II sebesar 78. Ketuntasan secara klasikal pra tindakan 22%, siklus I 65%, dan siklus II 91%. Berdasarkan hasil penelitian di atas diperoleh kesimpulan bahwa penerapan pembelajaran menyimak menggunakan teknik dictogloss yang benar, bisa membantu meningkatkan kemampuan menyimak siswa.

Penerapan metode role playing untuk meningkatkan hasil belajar siswa pada matapelajaran PKn kelas III SDN Kersikan I Bangil Kabupaten Pasuruan / Zurinal Qurana Firdaus

 

Keyword: Application, Role- Playing method, Learning achievement, PKn, SD. PKn is a very important lesson because it is related with students mental outlook in the future time learning method used in learning of PKn must be able to include cognitive, affective, and pshycomotor aspects. The firt observation result is found that the students of SDN Kersikan I at Bangil Pasuruan regence found the problem faced to PKn learning in the third year, such as : 1) There is not communication double ways between teachers and students, students and students, 2) Learning activity is generally done by traditional learning group, 3) The students leanrning is very low. Learning activity must be improved immediatelly by the teachers by choosing learning method that can make the students more actively, creatively and happily in learning process. The aim, we want to get in this research is : 1) To describe application of Role-Playing learning method in PKn learning for the students in the third class III SDN Kersikan I, 2) Describing the students learning activity in PKn learning in application Role-Playing method for PKn to the student class III SDN Kersikan I, 3) describe the increasing of students learning achievement via Role-Playing learning method in class III SDN Kersikan I. This research used Class Action Research (CAR) with 2 (two) siclus. Every siclus consist of phases : Planning, observation and reflection action implementation. The minimal completeness value standart is 75 % by learning achievement class 80 % from the number of research subject. This research subject is teacher and 26 students class III SDN Kersikan I. The data collection technique in yhis research is observation, interview, and test. Instrument of data collection used such as interview pattern, APKG II, the students learning activity assesment equipment and post test. This research resuslt shows the implementation of Role-Playing learning method to the students in the class III SDN Kersikan I can increase the students result. This is Proved from the result that is obtained by the students before applicating of Role- Playing learning method from rate score 69,23 become 71,53 at the post test siclus I and post test siclus II becomes 89,92. The advice presented to the teachers that is so that can implement and use Role-Playing leaning method for PKn lesson by other competence or other lesson. Based on the conclusion above can give to: the teacher that conclude in the competence or other themes that appropiate with condition and situation of school environment each. The learning must be done by giving chance for the students involved directly in learning process.

Penerapan metode bercerita dengan menggunakan media boneka tangan untuk mengembangkan kemampuan bahasa anak kelompok BI di TKN Pembina Kecamatan Kepanjenkidul Kota Blitar / Arif Fatkhur Rohman

 

Keywords: language skills, media, hand puppets, story method, TK This research background in the low language ability children in terms of simply telling penglaman in group B in TKN coach Kepanjenkidul Blitar District. Teachers have not used the correct media in developing the ability to tell a simple experience, in addition to telling the courage in front of class, language fluency of children in story telling and imagination of children in story telling is also relatively low. This study aims to describe the application of media to tell by using hand puppets in the development of the ability to tell a simple experience in the BI group of children in TKN coach Kepanjenkidul Blitar district and describe the increasing ability to tell a simple experience in children in the BI group TKN Kepanjenkidul Blitar District Pembina marked with courage in front of the classroom telling kids, language fluency of children in story telling and imagination in children's ability to tell stories. This research was conducted in TKN Kec.Kepanjenkidul coach with the study design used was a class action design (TOD) model cycle. In each cycle consists of several stages, namely planning, execution, observation, and reflection. In this study, researchers collaborate with classroom teachers. The results showed that the application simply share the experience with the media hand puppets to enhance the ability to tell a simple experience in the BI group of children in TKN coach Kepanjenkidul Blitar District. The study lasted two (2) cycles by using the observation. Prosespeningkatan ability to tell a simple experience is said to increase when the percentage reaches 75% or more and the cycle is successful jia two (2) better than the previous cycle. The success of this study are marked demgam: (1) Children dare talk in front of the class, (2) Children fluent in story telling, (3) Children capable of imagination in story telling. Based on this research, listening to stories and retelling stories heard a new, simply share the experience and to tell by using the pronouns I, me you, they, him using hand puppets media can increase children's language ability in story telling. This is evidenced by the average percentage of children in story telling ability in pre-action is still low with a percentage of 38.75% and the average percentage of children in story telling ability at the time the study reach 82.63%

Penerapan metode karya wisata melalui menggambar bebas untuk mengembangkan kemampuan seni anak kelompok B di TK Al Hidayah Dawuhan Kecamatan Kepanjenkidul Kota Blitar / Nurwiyanti

 

Kata kunci : Metode Karya Wisata, Menggambar Bebas, Kemampuan Seni, TK Al-Hidayah Dawuhan Kota Blitar. Anak usia 4-6 tahun merupakan bagian dari anak usia dini yang secara terminologi disebut sebagai anak usia prasekolah atau taman kanak-kanak. Sejumlah riset membuktikan bahwa perkembangan kecerdasan anak pada masa ini mengalami peningkatan dari 50% menjadi 80%. Hal ini menunjukan pentingnya upaya pengembangan seluruh potensi anak diusia pra sekolah karena pada usia tersebut anak mengalami masa peka, yaitu masa terjadinya pematangan fungsi-fungsi fisik dan psikis yang siap merespon stimulus yang diberikan oleh lingkungan. Masa peka merupakan masa untuk meletakan dasar pertama dalam mengembangkan seluruh potensi anak termasuk pula minat dan bakat dalam bidang seni. Dari hasil pengamatan penulis pada kegiatan pembelajaran bidang pengembangan pengembangan seni di TK Al – Hidayah Dawuhan, khususnya kelompok B pada bulan Agustus 2010, penulis menemukan beberapa masalah, diantaranya minat anak terhadap pembelajaran seni, untuk menggambar bebas masih sangat rendah, terbukti dengan hasil yang yang dicapai anak masih belum memenuhi target yang telah ditentukan. Tujuan dari penelitian ini adalah untuk mendeskripsikan penerapan metode karya wisata melalui menggambar bebas dapat meningkatkan kemampuan seni anak kelompok B di TK Al - Hidayah Dawuham Kota Blitar, dan mendeskripsikan peningkatan kemampuan seni anak kelompok B TK Al-Hidayah Dawuhan Kota Blitar, dengan metode karya wisata melalui menggambar bebas. Metode pelaksanaan menggunakan model guru sebagai peneliti , yaitu mulai dari persiapan, pelaksanaan , pelaporan hasil penelitian dilaksanakan oleh guru yang melakukan penelitian. Namun karena pengumpulan data sambil mengajar bukan suatu pekerjaan mudah , maka untuk membantu dalam mengumpulkan data peneliti meminta bantuan pada teman sejawat sebagai co- observer (Sa’dun Akbar, 2009: 22). Dalam pelaksanaan observasi dapat membantu dalam proses pengumpulan daata dan analisis data. Penelitian tindakan kelas ini menggunakan siklus model Kemmis dan Taggart (1988). Dengan menerapkan siklus yang dilakukan secara berulang dan berkelanjutan (siklus spiral) diharapkan dapat meningkatkan kemampuan anak dalam menggambar bebas artinya daslam apbila pada satu siklus ada indek kegagalan dan keberhasilan yang kemudian direfleksikan untuk perencanaan siklus berikutnya yang diharapkan bisa semakin meningkatkan pencapaian hasilnya pada siklus-siklus berikutnya. Dari hasil perolehan nilai anak sebelum tindakan, siklus I dan II diketahui bahwa peningkatan pada setiap tes yang diberikan sangat baik pada pra tes rata-rata nilai siswa dalam menggambar bebas adalah 41,25, rata-rata ini kemudian meningkat menjadi 55 pada tes siklus I yang menggunakan penerapan metode karya wisata, peningkatan yang signifikan kemudian diperoleh pada tes siklus II yaitu dengan rata-rata 78,75. Pada siklus II ini, karena rata-rata nilai siswa dalam menggambar bebas sudah baik sehingga diputuskan untuk mengakhiri penelitian karena kemampuan seni anak kelompok B TK Al-Hidayah Kota Blitar telah terbukti meningkat. Dari hasil yang didapat, penelitian ini diharapkan dapat membantu meningkatkan kualitas proses belajar da mengajar dan memotivasi guru dalam melakukan peningkatan kualitas pembelajaran yang aktif, kreatif, dan menyenangkan.

Peningkatan kemampuan sains melalui permainan warna di TK Dharma Wanita II Srengat / Tina Devi Prihantini

 

Kata kunci: Kemampuan Sains, Permainan Warna, TK Dharma Wanita Usia 4-6 tahun dipahami sebagai masa keemasan dan masa peka bagi anak. Pada masa ini anak sensitive untuk menerima upaya pengembangan terhadap seluruh potensinya. Mengingat dalam kemampuan kognitif juga meliputi kemampuan sains, maka peneliti mencoba meningkatkan kemampuan sains melalui permainan warna. Dalam kegiatan ini peneliti mengharapakan agar anak dapat mengenal konsep sains dan meningkatkan daya pikir anak. Tujuan yang ingin dicapai ialah (1) Mendeskripsikan permainan warna yang dapat meningkatkan kemampuan sains anak (2) Mendeskripsikan peningkatan kemampuan sains anak melalui permainan warna (3) mendeskripsikan kelebihan dan kelemahan permainan warna dalam meningkatkan kemampuan sains anak Penelitian ini menggunakan rancangan penelitian tindakan kelas yang dilaksanakan dalam dua siklus dan metode yang digunakan untuk pengumpulan data dalam penelitian ini adalah observasi, dokumentasi dan tes, sedangkan instrument penilaian ini berupa lembar observasi anak dan format penilaian. Hasil penelitian ini menunjukkan peningkatan kemampuan sains anak melalui permainan warna, permainan warna dapat meningkatkan kemampuan sains anak, terdapat kelebihan dan kelemahan dalam permainan warna yang dapat meningkatkan kemampuan sains anak. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa dengan penerapan permainan warna dapat meningkatkan kemampuan sains anak di TK Dharma wanita II Srengat, peningkatkan kemampuan sains dapat dilakukan melalui permainan warna, terdapat kelebihan dan kelemahan dalam permainan warna untuk meningkatkan kemampuan sains anak kelompok B di TK Dharma wanita II Srengat. Dalam pembelajaran permainan warna ini tampak ada kecenderungan anak untuk bercerita tetapi ini tidak diteliti sehingga disarankan kepada peneliti untuk meneliti kegiatan permainan warna ini untuk mengembangkan kemampuan bahasa anak.

Peningkatan kemampuan membaca melalui membaca pemahaman pada siswa kelas V SDN Gledug 01 Kecamatan Sanankulon Kabupaten Blitar / Zakiyah Rokhmahwati

 

Kata kunci: membaca, membaca pemahaman Pengambilan judul penelitian di atas berdasarkan permasalahan dalam pelaksanaan pembelajaran membaca di SDN Gledug 01 Kecamatan Sanankulon Kabupaten Blitar yang masih menggunakan metode ceramah dan pembelajaran yang monoton. Berdasarkan hasil observasi, guru menyuruh siswa membaca buku paket, kemudian disuruh menjawab pertanyaan tanpa tahapan kegiatan membaca yang runtut. Akibatnya siswa kurang memahami isi bacaan dan siswa mudah bosan sehingga nilai hasil belajar menjadi rendah. Penelitian ini bertujuan untuk: (1) Mendeskripsikan pelaksanaan pembelajaran membaca melalui membaca pemahaman, dan (2) mendeskripsikan peningkatan kemampuan membaca melalui membaca pemahaman. Pendekatan yang digunakan adalah penelitian kualitatif dengan jenis penelitian tindakan kelas (PTK). Lokasi penelitian di SDN Gledug 01, subjek penelitian siswa kelas V dengan jumlah siswa 13 laki-laki dan 10 perempuan. Teknik pengumpulan data adalah observasi, tes, dan angket. Teknik analisis data berupa teknik analisis data kualitatif dan kuantitatif. Hasil penelitian yang telah dilakukan diperoleh data adanya peningkatan pemahaman siswa dari tiap siklusnya. Pelaksanaan pembelajaran membaca melalui membaca pemahaman dilaksanakan dalam 3 siklus. Untuk mengetahui tingkat kemamapuan dasar siswa dalam pembelajaran dilakukan pra tindakan. Pada pra tindakan hasil belajar siswa mencapai 26.08%, hal ini disebabkan guru menggunakan metode ceramah saja, dan kegiatan belajar yang kurang menarik. Pada siklus I perolehan hasil belajar mencapai 30,4%, siklus II mendapat 47.82%. Dan pada siklus III siswa yang mendapat nilai di atas 65 menjadi 95.65%. Berdasarkan pembahasan dapat disimpulkan bahwa pelaksanaan membaca melalui metode membaca pemahaman dapat dilakukan dengan kegiatan membaca bacaan, mengadakan tanya jawab, melanjutkan bacaan atau cerita yang rumpang, memerankan lakon dalam isi bacaan, dan mencari permasalahan dalam bacaan, sehingga hasil belajar siswa dapat meningkat. Semula dari pra tindakan perolehan nilai sebesar 60.43 meningkat menjadi 62.60 pada siklus I. Pada siklus II perolehan nilai meningkat menjadi 64.78, serta pada siklus III nilai meningkat drastis menjadi 81.30. Berdasarkan penelitian ini, guru disarankan untuk memilih dan menerapkan metode yang tepat disesuaikan dengan materi yang diajarkan agar tercapai hasil belajar yang optimal.

Peningkatan kemampuan kognitif melalui bermain puzzle kreatif pada anak kelompok B di RA Mamba'ul Huda Mlaten Nguling Pasuruan / Saudah

 

Kata kunci : peningkatan kemampuan kognitif, bermain Puzzle Kreatif Kemampuan kognitif bertujuan untuk mengembangan kemampuan berfikir anak yang dapat mengolah perolehan belajarnya dengan memecahkan masalah untuk meningkatkan kemampuan kognitif melalui bermain Puzzle Kreatif, perlu adanya kegiatan pembelajaran yang sesuai dengan persiapan bermain Puzzle Kreatif untuk meningkat dan lebih baik. Hasil observasi ditemukan bahwa siswa RA Manba’ul Huda belum menerapkan metode bermain Puzzle Kreatif, sebagaian siswa belum mampu mencapai kriteria ketuntasn belajar siswa yang ditemukan oleh siswa yaitu 75 ketuntasan individu. Berdasarkan hal ini, metode bermain Puzzle Kreatif sangat tepat digunakan sebagai alternative dalam pembelajaran. Tujuan yang ingin dicapai dalam penelitian ini adalah : 1). Mendeskripsikan pelaksanaan metode bermain Puzzle Kreatif yang dapat meningkatkan kemampuan kognitif anak RA Manba’ul Huda Mlaten. 2) Mendeskripsikan peningkatan kemampuan kognitif melalui metode bermain Puzzle Kreatif di RA Manba’ul Huda Mlaten. 3) Mendeskripsikan peningkatan kemampuan kognitif melalui bermain Puzzel Kreatif yang dapat meningkatkan kognitif anak kelompok B RA Mamba’ul Huda Mlaten Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan dalam 2 (dua) siklus, masing-masing siklus terdiri dari 4 tahapan : perencanaan, pelaksanaan, observasi, dan refleksi, subyek penelitian ini adalah siswa kelompok B RA Manba’ul Huda Mlaten sebanyak 20 siswa. Tehnik pengumpulan data yang diggunakan adalah observasi. Hasil analisis data setelah pelaksanaan metode bermain Puzzle Kreatif menunjukkan bahwa : hasil pengamatan observasi siswa dalam melaksanakan kegiatan bermain Puzzle Kreatif mencapai nilai 80,00 dengan kategori A, ketuntasan belajar 100 %. Hasil penelitian ini menunjukkan pelaksanaan metode bermain Puzzle Kreatif kelompok B RA Manba’ul Huda Mlaten dapat meningkatkan kemampuan kognitif siswa, terbukti dari hasil yang diperoleh siswa dapat dilihat dari rata-rata hasil tes mulai dari pra tindakan (53,50) dengan presentase (15 %), meningkat siklus I (65,00) dengan presentase (45 %), dan meningkat lagi siklus ke II (80,00) dengan presentase (100 %) yang terus mengalami peningkatan. Untuk meningkatkan kualitas pembelajaran, kemampuan kognitif melalui bermain puzzel kreatif anak harus bisa mengatasi masalah ketergantungan guru pada buku paket, mengubah pembelajaran dari panduan guru menuju ke permainan, sehingga perubahan penilaian ke arah yang lebih kondusif dan menyenangkan, maka disarankan mensosialisasikan ke guru-guru untuk menggunakan metode bermain sambil belajar.

Meningkatkan kemampuan membacakan dongeng kelas 2 melalui pendekatan komunikatif di MI Roudlotul Hikmah Kecamatan Nguling Kabupaten Pasuruan / Unaizah

 

Kata kunci : Kemampuan membaca, dongeng, pendekatan komunikatif, MI Hasil observasi ditemukan siswa Kelas 2 di MI Roudlotul Hikmah Kecamatan Nguling belum pernah menggunakan pembelajaran dengan menggunakan pendekatan komunikatif. Sebagian besar siswa merasa bosan dan kurang bergairah dalam pembelajaran sehingga siswa belum mampu mencapai kriteria ketuntasan. Masalahnya adalah pembelajaran yang digunakan hanya biasa-biasa saja. Metode yang digunakan adalah ceramah. Tujuan yang ingin di capai dalam penelitian ini adalah : Menerapkan pendekatan komunikatif dapat meningkatkan kemampuan siswa dalam membaca di kelas 2 MI Roudlotul Hikmah Kecamatan Nguling. Penelitian ini terdiri dari 2 (dua) siklus. Subyek penelitian ini adalah siswa kelas II MI Roudloutl Hikmah yang berjumlah 18 orang siswa. Metode pengumpulan data dengan menggunakan observasi, wawancara dan hasil evaluasi / tes serta refleksi. Penelitian ini dilaksanakan selama 2 siklus melalui tahap perencanaan, pelaksanaan tindakan, observasi, evaluasi serta refleksi. Instrumen yang digunakan adalah pedoman observasi, pedoman wawancara dan soal tes. Hasil penelitian yang diperolah adalah sebagai berikut : rata-rata prestasi belajar siswa dalam pembelajaran bahasa mengalami peningkatan dari 62 pada pra tindakan menjadi 72,66 pada siklus I kemudian menjadi 89,11 pada siklus II. Tetapi pembelajaran secara individu terdapat dua anak yang belum tuntas masalahnya adalah anak tersebut belum bisa membaca. Adapun cara penangananya guru memberikan remedial khusus. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa dengan menggunakan pendekatan komunikatif dapat meningkatkan prestasi belajar bahasa, aktivitas siswa MI Roudlotul Hikmah lebih aktif daripada sebelumnya. Berdasarkan penelitian ini hendaknya guru memperhatikan karakteristik siswa serta menerapkan pendekatan komunikatif dalam pembelajaran bahasa. Adapun saran yang dilakukan oleh guru, siswa, maupun peneliti harus memperhatikan karakteristik dan dapat menindaklanjuti pendekatan komunikatif tersebut.

Penerapan metode bermain tebak angka untuk peningkatan kemampuan kognitif kelompok A di RA Mamba'ul Huda Mlaten Nguling Pasuruan / Iin Sulinah

 

Kata kunci: Peningkatan kemampuan kognitif, bermain tebak angka Kemampuan kognitif bertujuan untuk mengembangkan kemampuan berfikir anak melalui bermain tebak angka. Bermain tebak angka dapat meningkatkan kemampuan mengenal konsep bilangan 1 sampai 10. Hasil observasi awal ditemukan bahwa siswa RA Manba’ul Huda belum mampu mencapai kriteria ketuntasan belajar siswa yang ditentukan sekolah yaitu 70 ketuntasan individu. Tujuan yang ingin dicapai dalam penelitian ini adalah: 1) mendeskripsikan penerapan metode bermain tebak angka untuk meningkatkan kemampuan kognitif anak kelompok A RA Manba’ul Huda Mlaten Nguling Pasuruan, 2) mendeskripsikan peningkatan kemampuan kognitif Kelompok A di RA. Manba’ul Huda Mlaten Nguling Pasuruan dengan diterapkan metode bermain tebak angka. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan dalam dua siklus yang masing-masing siklus terdiri atas empat tahapan, yaitu perencanaan, pelaksanaan, pengamatan dan refleksi. Yang menjadi subyek penelitian adalah siswa kelompok A RA Manba’ul Huda Mlaten Nguling Pasuruan sebanyak 20 siswa dengan observasi sebagai tekhnik pengumpulan datanya. Hasil analisis data setelah pelaksanaan metode bermain tebak angka menunjukkan bahwa hasil pengamatan observasi siswa dalam melaksanakan kegiatan mencapai nilai 79,75 dengan kategori A, ketuntasan belajar 100%. Hasil penelitian ini menunjukkan pelaksanaan metode bermain tebak angka kelompok A RA Manba’ul Huda dapat meningkatkan kemampuan kognitif siswa, terbukti dari hasil yang diperoleh siswa dengan rata-rata hasil tes mulai dari pra tindakan (50,75) dengan persentase (15%0) meningkat siklus I (62,25) dengan persentase (45%) dan meningkat lagi siklus II (79,75) dengan persentase 100% yang terus mengalami peningkatan. Saran yang disampaikan kepada guru yaitu agar dapat menerapkan metode bermain tebak angka dalam meningkatkan kemampuan kognitif dengan pengaembangan lain. Metode pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian lain sebagai bahan bandingan sehingga dikemudian hari menjadi lebih baik.

Pengaruh metode pembelajaran kooperatif model STAD vs konvensional dan motivasi berprestasi terhadap hasil belajar bahasa Arab siswa kelas X SMAN I Malang / Umi Machmudah

 

Kata kunci: Metode Pembelajaran Kooperatif, motivasi berprestasi, hasil belajar bahasa Arab Pebelajar bahasa Arab di SMAN 1 kemampuannya sangat beragam. Dalam belajar bahasa asing dibutuhkan suasana belajar atau lingkungan yang dapat mendukung tercapainya hasil belajar yang maksimal. Sementara metode pembelajaran kooperatif model STAD belum banyak diterapkan di SMAN yang mengajarkan bahasa Arab, padahal metode ini dapat meningkatkan hasil belajar bahasa termasuk bahasa arab, karena dengan metode ini siswa yang memiliki kemampuan rendah akan terdorong untuk aktif belajar, dan siswa yang berkemampuan tinggi semakin meningkat kemampuannya. Penelitian ini bertujuan untuk: 1) menguji efektifitas dua metode pembelajaran koperatif model STAD dan pembelajaran konvensional yang berbeda dalam pembelajaran bahasa Arab yang digunakan di SMAN I Malang, 2) menguji perbedaan hasil belajar bahasa Arab siswa SMAN I Malang antara siswa yang memiliki motoivasi berprestasi tinggi dan siswa yang memiliki motivasi berprestasi rendah, 3) menguji pengaruh interaksi antara penerapan metode pembelajaran kooperatif model STAD dengan tingkat motivasi berprestasi terhadap hasil belajar bahasa Arab siswa SMAN I Malang Untuk mencapai tujuan penelitian tersebut, dilakukan penelitian kuasi eksperimen pada pebelajar kelas X SMAN I Malang tahun pelajaran 2009/ 2010. Eksperimen menggunakan rancangan dua faktor dengan versi desain faktorial non-ekuivalen control group. Dengan teknik random, terpilih X2 dan X4 sebagai kelompok eksperimen yang diberi perlakuan metode pembelajaran kooperatif model STAD dan kelas X3 dan X5 sebagai kelompok kontrol yang difasilitasi dengan metode konvensional. Data hasil belajar bahasa Arab dikumpulkan dengan menggunakan tes hasil belajar bahasa Arab dalam berbagai macam tes, yakni bentuk menjodohkan, pilihan ganda, isian, menyusun kalimat yang terdiri dari 40 item. sepuluh item pertama berbentuk tes pilihan asosiatif dengan indeks relabilitas alpha cronbach = 0, 891; lima item kedua berbentuk tes pilihan ganda dengan indeks relabilitas alpha cronbach = 0,773; sepuluh item ketiga berbentuk tes melengkapi dengan indeks relabilitas alpha cronbach = 0,947; lima item keempat berbentuk tes membuat kalimat dengan indeks alpha cronbach = 0,774; lima item kelima berbentuk tes menyusun kata-kata dengan indeks alpha cronbach = 0,775; lima item keenam berbentuk tes isian dengan indeks alpha cronach = 0,819;Data motivasi berprestasi diukur dengan menggunakan kuesioner motivasi berprestasi yang dikembangkan oleh Robinson (1961) yang telah diadaptasi oleh Degeng (1991). Data dianalisis dengan menggunakan statistik deskriptif dan analisis varians faktorial 2 x 2 dengan bantuan program SPSS 13,0 for windows. Pengujian hipotesis dilakukan pada taraf signifikansi 0,05. Berdasarkan analisis data, ditemukan hasil-hasil penelitian sebagai berikut. Pertama, terdapat perbedaan hasil belajar bahasa Arab antara kelompok siswa yang belajar dengan metode pembelajaran kooperatif model STAD (PKs) dengan kelompok siswa yang belajar dengan metode pembelajaran konvensional (PKv) ( F = 76,130; p = 0,000 ). Kedua, terdapat perbedaan hasil belajar bahasa Arab antara kelompok siswa yang memiliki motivasi berprestasi tinggi (MBt) dengan siswa yang memiliki motivasi berprestasi rendah (MBr) ( F = 107,576; p = 0,000 ). Ketiga, terdapat pengaruh interaksi antara metode pembelajaran kooperatif model STAD dan konvensional dan tingkat motivasi berprestasi (tinggi dan rendah) terhadap perolehan hasil belajar bahasa Arab ( F = 10,100; p = 0,002 ) Berdasarkan temuan-temuan penelitian, diajukan saran-saran sebagai berikut: (1) perbaikan mutu pembelajaran bahasa Arab khususnya pada siswa SMAN dengan menerapkan metode pembelajaran kooperatif di kelas, (2) metode pembelajaran yang diteliti dalam penelitian ini hanya terbatas pada keberadaan bahasa Arab yang sifatnya sebagai materi integrated artinya keempat ketrampilan bahasanya diajarkan secara terintegrasi, tidak berdiri sendiri-sendiri sebagai mata pelajaran yang terpisah. Karena itu untuk mendapat hasil penelitian yang akurat disarankan untuk meneliti dan membandingkan beberapa metode yang dikenal selama ini pada masing-masing ketrampilan bahasa, sehingga guru dapat memilih metode pembelajaran yang tepat, yang dapat meningkatkan hasil belajar, (3) variabel-variabel moderator (selain motivasi berprestasi) yang diduga juga berpengaruh terhadap hasil belajar bahasa arab, disarankan untuk diadakan penelitian lebih lanjut dan dikombinasikan dengan metode pembelajaran kooperatif, sehingga akan diperoleh suatu strategi pembelajaran yang tepat dalam meningkatkan mutu pembelajaran bahasa Arab, khususnya untuk siswa SMAN, (4) untuk menguji keefektifan metode pembelajaran kooperatif model STAD dan konvensional, perlu dilakukan penelitian dengan: a) melibatkan variable –variabel kemampuan yang lain, misalnya kemampuan berpikir kritis, kemampuan awal, kemampuan pengambilan keputusan, kemampuan berkolaborasi, kemampuan memecahkan masalah, dan yang lainnya, b) memperpanjang durasi perlakuan untuk melihat lebih cermat proses peningkatan kemampuan dalam rentang waktu yang lebih lama, dan jika mungkin dipertimbangkan untuk dilakukan juga penelitian kualitatif atau penelitian tindakan kelas

Pengaruh aktivitas pengembangan diri Paskibra terhadap prestasi belajar sejarah siswa kelas XII Jurusan IPS SMA Negeri 10 Malang / Nica Meilinda Dwi P.

 

Kata Kunci : pengembangan diri, prestasi belajar Pendidikan merupakan hal penting dalam kemajuan suatu negara dan individu, sudah hampir dipastikan bahwa semakin maju seseorang maka ia akan membutuhkan pendidikan.Di era yang maju seperti sekarang ini dibutuhkan keterampilan yang benar-benar dapat menunjang suatu jenis pekerjaan. Tidak hanya pendidikan akademik saja tetapi pendidikan non-akademik juga diperlukan, sehingga pada saat peserta didik lulus telah memiliki keterampilan atau setidaknya pengetahuan bermasyarakat. Pendidikan non-akademik yang dimaksud adalah melalui kegiatan Pengembangan diri. Dalam pendidikan umum dijelaskan bahwa pengembangan diri bertujuan memberikan kesempatan kepada peserta didik untuk mengembangkan dan mengekspresikan diri sesuai dengan kebutuhan, bakat, dan minat setiap peserta didik sesuai dengan kondisi sekolah. Kegiatan pengembangn diri difasilitasi dan atau dibimbing oleh konselor, guru, atau tenaga kependidikan yang dapat dilakukan dalam bentuk kegiatan ekstrakurikuler. Banyak faktor yang mempengaruhi prestasi belajar yaitu faktor intern adalah faktor dari dalam anak yaitu secara umum dan keseluruhan yang ada pada anak atau bersumber dari dalam diri subjek belajar, sedangkan disini faktor ekstern yaitu keaktifan dalam kegiatan pengembangan diri yang dianggap mempengaruhi prestasi belajar siswa. Untuk itu penelitian ini merumuskan masalah sebagai berikut.(1) Bagaimana tingkat keaktifan siswa kelas XII jurusan IPS di SMA Negeri 10 Malang dalam mengikuti kegiatan pengembangan diri paskibra?;(2) Bagaimana prestasi belajar mata pelajaran sejarah siswa kelas XII jurusan IPS yang mengikuti kegiatan pengembangan diri paskibra di SMA Negeri 10 Malang?;(3) Bagaimana pengaruh aktivitas pengembangan diri paskibra terhadap prestasi belajar mata pelajaran sejarah siswa kelas XII jurusan IPS SMA Negeri 10 Malang? Penelitian ini dilakukan di SMA Negeri 10 Malang. Rancangan penelitian yang digunakan adalah rancangan deskriptif korelasional. Populasi dam penelitian ini adalah seluruh siswa kelas XII jurusan IPS yang mengikuti kegiatan pengembangan diri paskibra. Sampel penelitian ini diambil melalui purposive sampling. Teknik pengumpulan data dengan menggunakan angket dan dokumentasi, penelitian ini menggunakan analisis deskriptif untuk menggambarkan tentang kondisi keaktifan kegiatan pengembangan diri dan prestasi belajar siswa pada mata pelajaran sejarah. Hasil penelitian menunjukan bahwa aktivitas pengembangan diri paskibra (X) memiliki nilai signifikansi sebesar 0.000 lebih kecil dari alpha : 0.05 dan nilai Thitung 6.708 lebih besar dari Ttabel sebesar 1.310 yang berarti bahwa Ho ditolak dan Ha diterima. Sehingga dapat disimpulkan bahwa aktivitas pengembangan diri paskibra (X) memberikan hasil sumbangan efektif (SE) terhadap prestasi belajar mata pelajaran sejarah (Y) sebesar 4,8% sedangkan 95,2% dipengaruhi oleh variable lain diluar penelitian yang dilakukan oleh peneliti. Kegiatan pengembangan diri paskibra merupakan faktor lingkungan (ekstern) dan kegiatan diluar proses kegiatan belajar mengajar dikelas yang tidak mempengaruhi pencapaian prestasi belajar siswa. Untuk penelitian selanjutnya, jika menggunakan variabel yang sama seperti dalam penelitian ini. Diharapkan dapat mengambil sampel yang lebih luas dan banyak sehingga hasilnya dapat bermanfaat bagi banyak pihak

Penerapan model pembelajaran talking stick untuk meningkatkan hasil belajar IPS pada siswa kelas V SDN Blitar Kecamatan Sukorejo Kota Blitar / Tatik Darlia

 

Kata kunci: IPS, hasil belajar, model talking stick. Selama ini pelajaran IPS dianggap sebagai pelajaran yang kurang penting, membosankan dan kurang menarik. Hal ini disebabkan karena mata pelajaran IPS tidak termasuk pelajaran UAN dan sebagian besar materi IPS menuntut siswa untuk menghafal. Selain berasal dari faktor siswa, peran guru juga mendukung ketidak menarikan pembelajaran IPS. Guru lebih banyak mendominasi kegiatan pembelajaran di kelas, dengan kata lain guru sebagai pusat pembelajaran. Guru cenderung hanya menyampaikan materi apa adanya tanpa berusaha bagaimana agar siswanya tidak pasif dalam pembelajaran. Kadang guru tidak menyadari bahwa hal ini akan berdampak pada hasil belajar siswa yang kurang memuaskan. Penelitian ini bertujuan (1) Mendeskripsikan tentang pelaksanaan pembelajaran IPS Kelas V di SDN Blitar Kecamatan Sukorejo Kota Blitar dengan model pembelajaran talking stick. (2) Mendeskripsikan peningkatan hasil belajar siswa pada mata pelajaran IPS Kelas V dengan penggunaan model pembelajaran talking stick di SDN Blitar Kecamatan Sukorejo Kota Blitar. Tujuan penelitian pelaksanaan pembelajaran mata pelajaran IPS di kelas V SDN Blitar Kecamatan Sukorejo Kota Blitar adalah mendeskripsikan tentang pelaksanaan pembelajaran IPS Kelas V di SDN Blitar Kecamatan Sukorejo Kota Blitar dengan model pembelajaran talking stick dan mendeskripsikan peningkatan hasil belajar siswa pada mata pelajaran IPS Kelas V dengan penggunaan model pembelajaran talking stick di SDN Blitar Kecamatan Sukorejo Kota Blitar. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan model talking stick dapat meningkatkan hasil belajar IPS siswa. Dalam setiap siklus ketuntasan hasil belajar pada proses belajar siswa mengalami peningkatan yaitu pra siklus (27,7%), siklus I (50%) dan siklus II (100%). Dalam setiap siklus ketuntasan hasil belajar pada tes akhir siswa mengalami peningkatan yaitu pra siklus (30,6%), siklus I (63,9%) dan siklus II (100%). Kesimpulan yang dapat diambil dari penelitian ini yaitu dengan menggunaan model talking stick dalam pembelajaran terbukti dapat meningkatkan hasil belajar IPS siswa. Maka disarankan menggunakan model talking stick dalam pembelajaran untuk meningkatkan hasil belajar IPS siswa.

Penerapan pembelajaran inkuiri terbimbing untuk meningkatkan keterampilan proses dan prestasi belajar materi sistem indera siswa kelas XI IPA SMA Negeri 11 Malang / Yohana Hariyono

 

Kata kunci: keterampilan proses, pembelajaran inkuiri terbimbing, prestasi belajar Observasi awal yang dilakukan di kelas XI-IPA SMA Negeri 11 Malang pada saat pembelajaran Biologi, peneliti menemukan beberapa fakta antara lain: (a) pengajaran berbasis keterampilan proses belum pernah dilakukan, (b) prestasi siswa belum mencapai target yang diinginkan berdasarkan Standar Ketuntasan Belajar Mengajar (SKBM) dengan nilai 70. Masalah yang dapat diidentifikasi berdasarkan fakta dan permasalahan tersebut adalah rendahnya keterampilan proses dan prestasi belajar siswa, sehubungan dengan hal tersebut maka tujuan penelitian ini adalah untuk: 1) meningkatkan keterampilan proses siswa, 2) meningkatkan prestasi belajar siswa. Jenis penelitian yang dilakukan adalah penelitian tindakan kelas yang dirancang dalam 2 siklus pembelajaran inkuiri terbimbing. Dalam setiap siklus terdiri dari 4 tahap yaitu: perencanaan, pelaksanaan, observasi dan refleksi. Setiap siklus melibatkan tahapan inkuiri terbimbing yang meliputi observasi, bertanya, perumusan masalah, pengamatan dan pengumpulan data, kesimpulan, dan refleksi. Sedangkan untuk keterampilan proses meliputi: 1) melakukan observasi, 2) mengajukan hipotesis atau dugaan sementara, 3) memprediksi, 4) menemukan pola atau hubungan, 5) melakukan komunikasi secara efektif, 6) merencanakan investigasi, dan 7) melakukan pengukuran dan penghitungan. Subjek penelitian tindakan ini adalah siswa kelas XI-IPA SMA Negeri 11 Malang yang berjumlah 40 siswa. Penelitian ini dilaksanakan pada bulan April-Mei 2008. Jenis data dalam penelitian ini berupa data 1) keterampilan proses siswa dan 2) prestasi belajar siswa Hasil dari penelitian ini adalah (1) Penerapan pembelajaran inkuiri terbimbing meliputi beberapa tahapan yaitu kegiatan awal, kegiatan inti, dan kegiatan akhir. Pada kegiatan awal diberikan pengajaran berupa pemberian pertanyaan pengarah agar siswa mampu menemukan sendiri arah dan tindakan yang harus dilakukan untuk memecahkan permasalahan yang disodorkan oleh guru. Penerapan inkuiri terbimbing yang benar dapat digunakan dalam meningkatkan keterampilan proses siswa untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera siswa kelas XI IPA SMA Negeri 11 Malang, (2) Penerapan pembelajaran inkuiri terbimbing meliputi beberapa tahapan yaitu kegiatan awal, kegiatan inti, dan kegiatan akhir. Pada kegiatan awal diberikan pengajaran berupa pemberian pertanyaan pengarah agar siswa mampu menemukan sendiri arah dan tindakan yang harus dilakukan untuk memecahkan permasalahan yang disodorkan oleh guru. Penerapan inkuiri terbimbing yang bebar dapat digunakan dalam meningkatkan prestasi belajar siswa untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera siswa kelas XI IPA SMA Negeri 11 Malang, (3) Penerapan pembelajaran inkuiri terbimbing untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera sehubungan dengan keterampilan proses siswa kelas XI IPA SMA Negeri 11 Malang mengalami peningkatan dari 54.62% pada siklus I menjadi 71.43% pada siklus II, (4) penerapan pembelajaran inkuiri terbimbing untuk pencapaian kompetensi dasar 3.6 pada materi sistem indera sehubungan dengan prestasi belajar siswa kelas XI IPA SMA Negeri 11 Malang mengalami peningkatan dari nilai rata-rata 73 pada siklus I menjadi 89 pada siklus II, (5) Penerapan pembelajaran inkuiri terbimbing pada pokok bahasan sistem indera dapat digunakan untuk meningkatan keterampilan proses dan prestasi belajar siswa kelas XI IPA SMA Negeri 11 Malang. Untuk mengetahui lebih baik lagi penerapan pembelajaran inkuiri di kelas, maka dapat dilakukan pada materi lain. Untuk mengetahui keberhasilan setiap siswa hendaknya waktu yang

Pengaruh paparan berulang formalin melalui inhalasi terhadap kerusakan sel hati dan sel ginkal mencit betina (Mus musculus) galur Balb C / Yohana Hariyono

 

Kata kunci: formalin, kariolisis, karioreksis, piknosis, sel ginjal, sel hati Formalin merupakan larutan 30-50% formaldehida yang sangat toksik dengan bau yang sangat iritatif meskipun dengan kadar yang rendah (< 1 ppm). Meskipun banyak laporan penelitian tentang formalin yang menyebabkan kerusakan sel hati dan sel ginjal mencit, namun belum ditemukan pengaruh formalin terhadap kerusakan sel hati dan sel ginjal yang meliputi kariolisis, karioreksis dan piknosis dengan paparan yang sangat rendah. Penelitian ini bertujuan untuk: (1) mengetahui apakah paparan berulang formalin melalui inhalasi dengan tingkat konsentrasi yang berbeda dapat menyebabkan kerusakan sel hati, (2) mengetahui apakah paparan berulang formalin melalui inhalasi dengan tingkat konsentrasi yang berbeda dapat menyebabkan kerusakan sel ginjal. Penelitian ini adalah penelitian eksperimen dengan rancangan penelitian faktorial dengan rancangan dasar Rancangan Acak Kelompok (RAK). Subjek penelitian adalah mencit betina (Mus musculus) yang berumur 30 hari, jenis kelamin betina dengan berat badan 18-20 gram. Konsentrasi formalin yang diberikan yaitu 0 ppm sebagai kontrol, 2 ppm, dan 4 ppm yang dipaparkan setiap hari selama 6 jam dan 8 jam selama 7 hari 8 minggu. Efek dari paparan yang diamati adalah kerusakan sel hati dan sel ginjal yang meliputi kariolisis, karioreksis, dan piknosis. Kerusakan sel diamati secara histopatologi menggunakan pewarnaan Hematoxilin Eosin Hasil penelitian ini menunjukkan: (1) paparan berulang formalin melalui inhalasi dengan konsentrasi yang berbeda dapat menyebabkan kerusakan sel hati dan sel ginjal, (2) paparan dengan konsentrasi 2 ppm menyebabkan karioreksis sel hati, paparan dengan konsentrasi 4 ppm menyebabkan piknosis dan kariolisis sel hati. Sedangkan paparan dengan konsentrasi 4 ppm menyebabkan karioreksis, piknosis dan kariolisis sel ginjal, (3) paparan berulang formalin melalui inhalasi dengan lama paparan 8 jam berpengaruh terhadap kerusakan sel hati dan sel ginjal, (4) kombinasi antara paparan dan 4 ppm 8 jam berpengaruh menyebabkan kerusakan hati dan ginjal mencit betina (Mus musculus) Galur Balb C. Pada penelitian ini disarankan untuk dilakukan penelitian lanjutan kerusakan struktur sel hati dan sel ginjal dengan lebih teliti lagi.

Pengembangan paket bimbingan pribadi sosial untuk meningkatkan penyesuaian diri siswa SMA / Evi Fitriah

 

Key words: guidance packet, social personal, adaptation Students in Senior High have been center age adolescence and start to find out self identify. In this teen age happen change of physical or psychological. The change of physical sometimes make disadvantage at partly adolescent so this disadvantage make adolescent become less could to adaptation. Adolescent who have low acclimatization will do the thing which can disadvantages for their self, like imitate, played truant and collide with the rule of school. Concerned with acclimatization, conselor has duty to guidance the students in make their positive acclimatization ability. One of effort which can do with give guidance servive about acclimatization. The purpose of this development is produce social personal packet development to improve the acclimatization the students in Senior High School Class X which in theoritical and practical manner can used by conselor in Senior High School as a media which give information about acclimatization. Development packet of social personal guidance to improve acclimatization adapt the steps of model development instructional Dick and Carey which consists of step (1) do need assesment, (2) arrange of guidance packet of acclimatization,(3) Experiment expert of BK and media expert, (4) revision from experiment expert of BK and media expert, (5)experiment candidat of consumer, (6) revision from the experiment result of consumer that is conselor. The assessment do by expert of counseling guidance and expert media of learning. Data which get from qualitativeand quantitative data. Technique of collect data in this research is interview and questionnaire to assessment of experiment expert and candidat consumer. Technique of analysis data which used is technique of descriptive analysis mode central mainstream. Product which developed is Social Personal Packet Guidance To Improve Acclimatization The Student In Senior High School which consists of (1) hand book of acclimatization packet guidance to conselor, and (2) the material of social personal guidance for students, which consists of three cut-off that is: (1) basic concept of acclimatization, (2) acclimatization of adolescent, (3) adjusment in daily life. The result of development shows valid level packet guidance of acclimatization at function aspect get 4 score (expert experiment and candidat of consumer) with the criteria is very useful. In practical aspoect get 3 score (expert experiment and candidat of consumer) with practical aspect.In accuracy aspect get 3 score ( expert experiment and candidat of consumer) with accuracy criteria. In conspicuousness aspect get 4 score (expert experiment and candidat of consumer) with interest criteria. The result of data analysis qualitative shows that there are some of packet components which must revision : (1) physical screen (size/ book dimension, colouring, lay-out for too formal), (2) cover design and icons in text book BPS had better refer to audience segment that is students, (3) colour screen which not too strong in acclimatization packet had better make more soft (4) text font in hand book cover to conselor had better formal (font calibri, arial or times new roman), (5) instruction to answer the quistionnaire must more clear so answer refer to questionnaire directly, (6) the wrong process of writing and language must refer to orthographic not contamination with javanese. According the experiment result, so advise which given : (1) conselor as lecture must understand guidance of procedur and material to the students can get the purpose of guidance what they want, (2) conselor can add the other media to can make students interest in comprehend the material of acclimatization, (3) further to this research so need experiment the product to the target that is the student in order to know product earnings effectively.

Penerapan permainan susun kata untuk mengembangkan kemampuan berbahasa anak kelompok B Taman Kanak-kanak PKK Kelurahan Klampok Kecamatan Sananwetan Kota Blitar / Winarsih

 

Kata kunci : Permainan Susun Kata, Kemampuan Berbahasa, TK PKK Klampok Kota Blitar. Pendidikan anak usia dini adalah suatu upaya pembinaan yang ditujukan kepada anak sejak lahir sampai dengan usia enam tahun, yang dilakukan melalui rangsangan pendidikan untuk membantu partumbuhan baik jasmani dan rohani, agar anak memiliki kesiapan dalam memasuki jenjang pendidikan selanjutnya (Wijana, dkk, 1989:25). Dari hasil pengamatan yang dilakukan di TK PKK Kelurahan Klampok di temukan bahwa anak kelompok B masih kesulitan dalam berbahasa, hal ini di tandai adanya lima anak yang diam saja, anak yang sulit menemukan kata-kata yang tepat untuk menjawab pertanyaan dari guru, anak kurang mengerti setiap kata dalam hal ini mengartikan dan menyampaikan secara utuh kepada orang lain, anak yang sering keluar masuk kelas, anak yang tidak pernah selesai dalam mengerjakan kegiatan. Hal ini disebabkan karena belum ditemukannya kegiatan yang tepat untuk meningkatkan kemampuan berbahasa, kemampuan dalam berkomunikasi dengan guru, teman dan orang lain. Tujuan kenapa penelitian tindakan kelas ini dilakukan adalah untuk mendeskripsikan penerapan permainan susun kata dalam mengembangkan kemampuan berbahasa pada anak kelompok B TKK PKK Klampok dan mendeskripsikan peningkatan kemampuan berbahasa anak kelompok B TK PKK Klampok setelah diberi permainan susun kata. Desain penelitian ini adalah menggunakan desain Penelitian Tindakan Kelas (PTK). Elliot (1992:69) menyatakan bahwa penelitian tindakan dapat didefinisikan sebagai penelitian situasi sosial dengan pandangan untuk meningkatkan kulaitas aksi yang ada dalam penelitian tersebut. PTK untuk pembelajaran bahasa ditujukan pada penemuan strategi belajar dan mengajar yang cocok dengan gaya pembelajar dan strategi dalam belajar bahasa (Latief, 2003:99). Berdasarkan Kemmis and McTaggart (1988:6), istilah aksi dan penelitian menggarisbawahi fitur penting dari sebuah pendekatan: uji coba ide dalam melatih sebagai alat peningkatan dan sebagai alat perbaikan pengetahuan tentang kurikulum, pengajaran, dan pengajaran. Desain penelitian tindakan kelas pada penelitian ini ditujukan untuk mengembangkan sebuah strategi untuk memecahkan masalah dan meningkatkan kemampuan anak berbahasa. Kemampuan berbahasa yang ada dalam penelitian tindakan kelas yang memiliki fungsi sebagai alat komunikasi menurut Nelson Francis (1957:12) didiskusikan peningkatannya sehingga dapat diketahui bahwa pada kemampuan awal anak berbahasa 51,67 rata-rata nilai kelompok B TK PKK Klampok Kota Blitar kemudian meningkat dengan diterapkannya metode permainan susun kata menggunakan kartu huruf dan kartu suku kata. Peningkatan pada siklus I penelitian tindakan kelas ini meningkat dengan rata-rata 73,33 dengan tidak adanya anak yang beerkemampuan bahasa sedang. Dalam pembuktian peningkatan kemampuan bahasa anak, peneliti dan kolaborator melaksanakan siklus II untuk melakukan upaya peningkatan yang lebih dari penerapan metode permainan susun kata yang mana kemudia hasil nilai rat-rata anak menjadi 88, 33. Deskrisi peningkatan kemampuan tersebut diatas dikombinasikan dengan deskripsi penerapan metode permainan susun kata yang meningkatkan komponen bahasa anak dalam hal penguasaan perbendaharaan kata. Dari hasil yang didapat, penelitian ini diharapkan dapat membantu meningkatkan kualitas proses belajar da mengajar dan memotivasi guru dalam melakukan peningkatan kualitas pembelajran yang aktif, kreatif, dan menyenangkan.

Peningkatan kemampuan kognitif melalui permainan kotak angka dan gambar pada anak kelompok B TK Dharma Wanita Kerjen Srengat / Septi Wahyu Yudhaningsih

 

Keywords: Cognitive Ability, Play, Box Score And Pictures This is because the learning activities do not involve children and not giving freedom to children to express and try fun activities for children. The research aims to describe the application of game box numbers and images that can improve the cognitive abilities of children and described the increase in cognitive abilities of children in group B TK Dharma Wanita Kerjen after through the game box numbers and images. The research design used was the design of classroom action research with process II cycles.. In each cycle consisting of the stages of planning, execution, observation, and reflection. The results showed that the application of game box numbers and pictures shown to be utilized in the learning activities to enhance cognitive abilities of children. In the first cycle of cognitive ability of children to 70%, increased to 93.3% in cycle II. Improving cognitive abilities of children marked by increasing the ability of color grouping, sort the numbers 1-10 with the object, the symbol pair numbers with pictures and sort the colors fit the pattern. It is suggested that cognitive learning should be implemented in the game box numbers and pictures and it is suggested that further research with other problems that can be utilized in the learning field of development in addition to the field of cognitive abilities, namely language, art, physical and motor.

Peningkatan kemampuan sosial emosional anak melalui metode permainan mencari teman di kelompok A TK Dharma Wanita II Tapakrejo Kabupaten Blitar / Siti Nuryatin

 

Kata Kunci : Kemampuan Sosial Emosional, Permainan Mencari Teman, Taman Kanak-kanak. Penelitian ini berlatarbelakang kurangnya kemampuan sosial emosional anak, hal ini disebabkan karena strategi yang digunakan guru kurang menarik minat anak, dan kurangnya guru dalam memberikan stimulasi dengan berbagai macam permainan. Peningkatan kemampuan sosial emosinal anak melalui permainan mencari teman ini bertujuan : (1) mendeskripsikan penerapan permainan mencari teman dalam pengembangan kemampuan sosial emosional anak di kelompok A TK Dharma Wanita II Tapakrejo. (2) mendeskripsikan peningkatan kemampuan sosial emosional anak melalui kegiatan permainan mencari teman di kelompok A TK Dharma Wanita II Tapakrejo. Metode penelitian yang digunakan dalam penelitian ini adalah penelitian deskriptif dengan rancangan PTK yang terdiri atas 2 siklus. Masing – masing siklus memiliki 4 tahapan: perencaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian ini adalah 12 anak kelompok A TK Dharma Wanita II Tapakrejo Kabupaten Blitar. Instrumen yang digunakan adalah Lembar Penialian dan Observasi. Tehnik analisis yang digunakan adalah deskriptif. Dalam penelitian ini peneliti juga berkolaborasi dengan teman sejawat. Hasil analisis data dari pembelajaran kemampuan sosial emosional melalui permainan mencari teman dapat dideskripsikan sebagai berikut: dari hasil pengamatan siklus I memperoleh prosentase sebesar 53,1%, dan dari hasil pengamatan siklus II memperoleh prosentase sebesar 75,7%, terdapat peningkatan sebesar 22,6%. Kesimpulan melalui permainan mencari teman dapat meningkatkan kemampuan sosial emosional anak di kelompok A TK Dharma Wanita II Tapakrejo, dari 12 anak yang mendapat bintang 3 ada 5 anak sedangkan anak yang mendapat bintang 4 ada7 Berdasarkan kesimpulan maka dapat diberikan saran sebagai berikut: (1) Guru TK diharapkan dapat menggunakan permainan mencari teman untuk mengembangkan kemampuan sosial emosional. (2) Sekolah agar terus memantau para guru untuk terus bekerja sama dan meningkatkan kreativitas dalam pengembangan pembelajaran.

Kegagalan inovasi pertanian desa Pule 1968-1984 / Heti Fitarida

 

Kata Kunci : Petani Padi, Modernisasi Desa, Inovasi Pertanian, Revolusi Hijau. Padi mempunyai peranan yang sangat penting dalam bidang perekonomian, karena perekonomian merupakan bagian dari kegiatan yang harus dilakukan untuk menentukan berhasil tidaknya sebuah negara mensejahterakan rakyatnya. Indonesia adalah negara berkembang yang mencoba menerapkan program Revolusi Hijau. Revolusi Hijau tersebut bertujuan untuk dapat meningkatkan produksi padi guna menghindari impor beras yang pernah terjadi pada tahun 1971. Desa Pule merupakan desa agraris yang juga melaksanakan program Revolusi Hijau mulai tahun 1974. Pertanian Desa Pule sebelum Revolusi Hijau tahun 1968 bercirikan sebuah pertanian tradisional yang sangat bergantung dengan alam, sampai dilaksanakannya Bimas tahun 1974 pertanian berubah menjadi sebuah pertanian semi modern. Rendahnya tingkat pendidikan petani Desa Pule telah menyebabkan kegagalan proses Revolusi Hijau. Pada saat Indonesia berswasembada beras tahun 1984, Desa Pule tidak banyak mengalami perubahan dan menempati posisi terendah sekabupaten Trenggalek. Pada tahun 1984 hasil produksi padinya hanya mencapai rata-rata 4,7 ton/ha. Berdasarkan hasil paparan latar belakang di atas, penulis merumuskan masalah, yaitu, (1) bagaimana kondisi pertanian sebelum penerapan inovasi pertanian di Desa Pule 1968-1984, (2) bagaimana kondisi pertanian selama penerapan inovasi pertanian di Desa Pule 1968-1984, dan (3) apa yang menyebabkan inovasi pertanian di Desa Pule 1968-1984 mengalami kegagalan. Tujuan diadakan penelitian ini, antara lain sebagai berikut: (1) mendeskripsikan kondisi pertanian sebelum penerapan inovasi pertanian di Desa Pule 1968-1984, (2) mendeskripsikan kondisi pertanian selama penerapan inovasi pertanian di Desa Pule 1968-1984, dan (3) mendeskripsikan penyebab inovasi pertanian di Desa Pule 1968-1984 mengalami kegagalan. Pada penelitian ini peneliti menggunakan metode sejarah, yaitu pemilihan topik (memilih topik yang layak untuk tema penelitian), heuristik (pengumpulan sumber-sumber sejarah), verifikasi (melakukan kritik sumber, melalui kritik eksternal/pengujian terhadap aspek luar sumber sejarah dan kritik intern/ pengujian terhadap aspek dalam sumber sejarah), interpretasi (melakukan penafsiran terhadap fakta satu dengan fakta yang lain), dan historiografi (penulisan sejarah). Hasil penelitian ini sebagai berikut (1) kondisi pertanian Desa Pule sebelum Revolusi Hijau tahun 1968 merupakan sebuah desa dengan pertanian yang masih tradisional karena bergantung pada alam. Teknik bertani dan peralatan pertaniannya pun masih sangat sederhana sesuai dengan kondisi dan cara fikir petani awam yang masih berorientasi pada kebiasaan adat. (2) Pertanian Desa Pule mulai berubah pada tahun 1974 ketika petani Desa Pule mulai mengadopsi teknik bertani dan peralatan pertanian. Proses adopsi tersebut

Peningkatan kemampuan membaca permulaan melalui metode pemberian tugas pada anak kelompok B di TK Al-Hidayah 2 Jeblog Talun Kabupaten Blitar / Nanik Wijiatiningsih

 

Kemampuan Membaca Permulaan Metode Pemberian Tugas, TK Penelitian ini berlatar belakang pada rendahnya kemampuan membaca permulaan anak. Hal ini disebabkan karena kegiatan pembelajaran belum melibatkan anak dan anak belum hafal dengan huruf-huruf abjad serta 75% anak di TK Al-Hidayah 2 Jeblog Talun Blitar berasal dari keluarga yang tidak mampu dan perhatian orang tua terhadap pendidikan anak kurang. Penelitian bertujuan untuk (1) Mendeskripsikan penerapan Metode Pemberian Tugas dalam meningkatkan kemampuan membaca permulaan melalui Anak Usia Dini Kelompok B di TK Al-Hidayah 2 Jeblog Talun Blitar; (2) Mendeskripsikan hasil penerapan Metode Pemberian Tugas untuk Anak Usia Dini kelompok B di TK Al-Hidayah 2 Jeblog Talun Blitar. Rancangan penelitian yang digunakan adalah Rancangan Penelitian Tindakan Kelas dengan dua siklus. Setiap siklus terdiri dari tahap perencanaan, pelaksanaan, observasi dan refleksi. Instrumen yang digunakan adalah pedoman observasi, dan dokumentasi. Penelitian ini dilakukan di Kelompok B TK Al-Hidayah Jeblog Talun Blitar dengan subyek sebanyak 17 anak, terdiri dari 9 anak perempuan dan 8 anak laki-laki. Hasil penelitian menunjukkan bahwa penerapan tugas memasangkan huruf-huruf pada gambar dengan metode Pemberian Tugas dapat meningkatkan kemampuan membaca permulaan pada Siklus I dari 76,5% meningkat menjadi 94,1% pada Siklus II. Peningkatan Bahasa anak ditandai dengan mengelompokkan kata-kata yang sejenis pada siklus I mencapai 76,5% meningkat menjadi 88,2% pada siklus II. Peningkatan menghubungkan dan menyebutkan tulisan sederhana dengan simbol yang melambangkannya pada Siklus I mencapai 70,6% meningkat menjadi 88,2% pada Siklus II. Berdasarkan hasil analisa penelitian tersebut di atas dapat disimpulkan : (1) penerapan metode Pemberian Tugas dapat dimanfaatkan untuk Anak TK; (2) penerapan metode Pemberian Tugas dapat meningkatkan kemampuan membaca permulaan anak TK. Disarankan pada pendidik untuk menerapkan kegiatan memasangkan huruf pada gambar untuk mengembangkan kemampuan membaca permulaan anak TK.

Meningkatkan kemampuan membaca cerita berbahasa Indonesia melalui buku cerita bergambar Big Book di kelas I MI Al Islamiyah Kauman-Bangil / Zainab

 

Kata Kunci: Kemampuan membaca, Media, Big Book. Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik dan merupakan penunjang keberhasilan dalam mempelajari semua bidang studi. Pembelajaran diarahkan untuk meningkatkan kemampuan peserta didik untuk berkomunikasi dalam Bahasa Indonesia dengan baik dan benar, baik secara lisan maupun tulisa. Tujuan penulisan skripsi ini adalah: (1) Mendeskripsikan penggunaan media buku cerita bergambar big book dalam meningkatkan kemampuan membaca cerita pendek dalam pembelajaran bahasa Indonesia siswa kelas I MI Al Islamiyah. (2) Mendeskripsikan peningkatan kemampuan siswa dalam membaca cerita pendek dengan menggunakan media buku cerita bergambar big book pada pembelajaran Bahasa Indonesia kelas I Semester I MI Al Islamiyah. Penelitian ini menggunakan jenis Penelitian Tindakan Kelas (PTK) yang terdiri dari dua siklus. Masing-masing siklus memerlukan waktu 4 x 30 menit. Tehnik pengumpulan data yang digunakan antara lain: observasi, Wawancara, dokumentasi, dan tes. Hasil penelitian menunjukkan adanya peningkatan kemampuan mendeskripsikan secara tertulis melalui pemanfaatan media gambar dengan peningkatan 27,3% pada siklus I dibandingkan dengan nilai pratindakan, dan peningkatan 13,6% pada siklus II. Dengan identifikasi gambar secara teliti didukung kemampuan siswa membaca cerita pendek dan bimbingan guru selama kegiatan berlangsung maka terjadi peningkatan pada hasil belajar siswa kelas I MI Al Islamiyah. Untuk membantu siswa membaca cerita pendek sebaiknya guru memanfaatkan buku cerita bergambar big book dalam pembelajaran membaca cerita pendek agar kemampuan siswa dapat meningkat.

Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA pada siswa kelas IV SDN Sundil Kecamatan Praya Kabupaten Lombok Tengah / Muh. Syukri Ghazali

 

Kata Kunci: Model Pembelajaran Inkuiri, Hasil Belajar SDN Sundil terletak di Desa Montong Terep, Praya, Kabupaten Lombok Tengah. Berdasarkan hasil observasi di kelas IV SDN Sundil dalam pembelajaran IPA, guru lebih banyak menggunakan metode ceramah dan siswa mendengarkan kemudian mencatat materi yang ditulis dipapan tulis. Kondisi ini membuat siswa menjadi pasif untuk belajar IPA sehingga hasil belajar IPA siswa kelas IV SDN Sundil masih banyak yang memperoleh nilai dibawah standar ketuntasan minimal yang ditetapkan oleh sekolah yaitu 70,00. Masalah yang ditemukan di kelas IV SDN Sundil antara lain rendahnya hasil belajar dan aktivitas belajar siswa. Oleh karena itu, penelitian ini bertujuan untuk mendeskripsikan proses dan hasil pembelajaran inkuiri dalam upaya meningkatkan hasil belajar IPA siswa kelas IV SDN Sundil. Selain itu juga untuk mendeskripsikan proses dan hasil pembelajaran inkuiri dalam upaya meningkatkan aktivitas belajar siswa kelas IV SDN Sundil. Penelitian ini dilaksanakan di kelas IV SDN Sundil yang berjumlah 37 siswa. Pelaksanaan tindakan mulai bulan Juni sampai Juli 2010. Penelitian ini dilaksanakan secara bersiklus dengan mengacu pada model Kemmis dan Mc Taggart yang terdiri dari empat fase, yaitu perencanaan, pelaksanaan, tindakan dan observasi, refleksi dan revisi. Data yang dikumpulkan dalam penelitian ini meliputi, hasil belajar dan aktifitas belajar siswa. Data hasil belajar diperoleh melalui hasil tes yang dilakukan di akhir siklus, sedangkan nilai aktivitas belajar siswa diperoleh melalui observasi selama melakukan kegiatan pembelajaran melalui penerapan model pembelajaran inkuiri. Hasil penelitian menggunakan model pembelajaran inkuiri menunjukkan bahwa hasil belajar IPA siswa kelas IV SDN Sundil meningkat, sebelum tindakan rata-rata hasil belajara siswa 59,6, pada siklus I pertemuan 1 meningkat menjadi 61,35, siklus I pertemuan 2 sebesar 65, kemudian pada siklus II pertemuan 1 sebesar 70 dan meningkat pada pertemuan ke 2 menjadi 72,2. Aktivitas belajar siswa juga mengalami peningkatan, pada siklus I pertemuan I sebesar 7,7 pada pertemuan ke 2 sebesar 7,9. Selanjutnya pada siklus II pertemuan 1 mengalami peningkatan sebesar 8,6 dan pertemuan ke 2 sebesar 9,5. Hasil penelitian tersebut menunjukkan bahwa penerapan model pembelajaran inkuiri dapat meningkatkan hasil belajar IPA siswa kelas IV SDN Sundil, Praya, Lombok Tengah. Namun demikian masih perlu upaya-upaya lebih lanjut untuk meningkatkan hasil belajar dan aktivitas belajar siswa di SDN Sundil.

Kecenderungan pola asuh orang tua dan status sosial ekonomi terhadap keterampilan asertif siswa SMA se Kota Malang / Diah Titi Palupi

 

Key Words: Parenting Methods, Economics Social Status, Students’ Asertif Competence The faster the development of information and technology, the more effects brought. They could be both good and bad effects. Teenagers are easily influenced by those effects, particularly senior high students who are unstable. To avoid the bad effects come into the teenagers, they must have an asertive behaviour. The asertive behaviour can be learnt and taught by their parents or a conselor. Based on those problems, a research was held to know the tendency of parenting methods and social economics status toward the students’ asertive competence. The objective of this study was to identify the students’ asertive competence coming from families who apply democracy, authoritative, and permisive parenting and also the students’ asertive competence coming from high, middle, and poor economics level. The design of this study was descriptive quantitative. The subjects of this study were senior high students of Malang which were 170 students. The technique used in this study was cluster sampling. The instruments used to collect the data were parenting methods questionnaire, asertive competence questionnaire, and economics social status. Meanwhile, the technique used to analyze the data was descriptive quantitative using percentage. The resulst of this study were the senior high students of Malang are inclined to have the asertive behaviour. The students who are both educated by using democracy, authoritative, and permisive parenting and come from high, middle, and poor economics level are able to behave asertively. Furthermore, most of senior high students of Malang are educated by using democracy parenting. There are onlly few of them educated by using authoritative and permisive parenting. Most of the students also come from middle economics level. Based on the result of this study, it is suggested: (1) the conselor should do an approach and guide the students in order that they can behave asertively for those who still cannot do and for those who are able to behave asertively, the conselor should motivate them to maintain it. (2) for the further researchers, ths study can be a reference to hold the next research related to parenting methods, social economics status, and students’ asertive competence.

Penggunaan metode bercerita melalui media gambar seri untuk meningkatkan kemampuan berbahasa anak TK kelompok B di TK Dharma Wanita 01 Binangun Kabupaten Blitar / Indrawan Danaviah

 

Keywords: language skills, story telling, media. This research background in the low language skills of children. This is because the learning activities have not given the child to freedom of expression, to express ideas orally and activities that are less fun for children. This study aims to: (1) Describe the application of the method through media images tell the series to improve the language skills of children in group B TK TK Dharma Wanita 01 Binangun, District of Blitar Binangun. (2) Describe the child's increasing proficiency in Group B at TK TK Dharma Wanita 01 Binangun, Binangun district, Blitar regency. This research was carried out in TK Dharma Wanita 01 Binangun, kecamatam Binangun, Blitar regency, on 1 and December 6, 2010. The design of the study design used was a class action with the process cycle. In each cycle consists of several stages, namely planning, execution, observation and reflection. In this study, researchers collaborate with B-grade teacher, Sri Indahwati, A.Ma.Pd. The results showed that the application method of telling through the medium of serial images to increase the ability bebahasa children. In the first cycle of children reach proficiency increased 69.3% to 90.6% in cycle II. Improving the ability of children is marked by the increasing ability to listen to stories, share the experience, telling stories about pictures that are available, as well as sort and telling picture series. It is recommended to educators to apply the method of telling the field of learning language development. In the implementation should consider telling the spatial concept of class and comfort the child during the activity

Penerapan metode bercerita untuk mengembangkan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Pasuruan / Mariatul Qibtiah

 

Kata Kunci : Penerapan metode bercerita, kemampuan berbahasa, anak usia dini. Berdasarkan hasil penelitian yang dilakukan di kelompok A yang berlatar belakang rendahnya kemampuan bahasa dalam menceritakan kembali isi cerita, keberanian tampil di depan kelas, bercerita tentang gambar disediakan, dan kelancaran bahasa dalam bercerita menunjukkan pembelajaran kurang optimal. Untuk mengembangkan kemampuan berbahasa anak, perlu adanya pembelajaran yang sesuai dengan pembelajaran yang diharapkan. Berdasarkan hal ini, metode bercerita sangat tepat digunakan sebagai alternatif dalam pembelajaran. Tujuan yang ingin dicapai dalam penelitian ini adalah : 1) Mendeskripsikan penerapan metode bererita dalam mengembangkan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Rejoso Pasuruan. 2) Mendeskripsikan pengembangan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Pasuruan. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dua siklus. Masing-masing siklus terdiri dari empat kegiatan yaitu : perencanaan, , pelaksanaan, pengamatan, dan refleksi. Subjek penelitian ini adalah anak kelompok A sebanyak 20 anak. Teknik pengumpulan data adalah pengamatan langsung terhadap kegiatan anak. Hasil kesimpulan menunjukkan penggunaan metode bercerita dapat meningkatkan kemampuan berbahasa anak kelompok A di RA Al Rohim Kerandon Rejoso Pasuruan, terbukti dari hasil yang diperoleh anak dilihat dari rata-rata hasil pengamatan anak siklus I mendapatkan bintang 2 dan meningkat lagi siklus II mendapat bintang 3 yang terus mengalami peningkatan. Berdasarkan kesimpulan ini, dapat disarankan kepada guru yaitu agar dapat menggunakan metode bercerita untuk mengembangkan kemampuan berbahasa maupun kemampuan yang lain. Metode bercerita juga dapat digunakan dalam penelitian-penelitian lain sebagai bahan perbandingan, sehingga dikemudian hari menjadi lebih baik.

Peningkatan kemampuan membaca pemahaman melalui pembelajaran tematik pada siswa kelas III SDN Plumbangan 04 Kecamatan Doko Kabupaten Blitar / Bima Suhardianto

 

Kata kunci : membaca, pembelajaran tematik, siswa. Penelitian ini bertujuan untuk meningkatkan kemampuan membaca pemahaman siswa yang meliputi aspek pemahaman isi bacaan, dan mengungkapkan isi bacaan. Serta mendeskripsikan pelaksanaan pembelajaran tematik dapat meningkatkan kemampuan membaca pemahaman pada pelajaran bahasa Indonesia di kelas III SDN Plumbangan 04. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Penelitian ini terdiri dari dua siklus yang sebelumnya diawali observasi pada pratindakan. Tiap siklus dilaksanakan dengan tahapan sebagai berikut. (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Metode penelitian yang digunakan adalah metode penelitian deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa pelaksanaan pembelajaran dengan menggunakan pembelajaran tematik dapat meningkatkan kemampuan membaca pemahaman siswa, yaitu pada aspek pemahaman isi bacaan hasil yang diperoleh pada pratindakan persentase ketuntasan siswa 27,27%, pada siklus I persentase ketuntasan siswa 69,70%, dan pada siklus II naik menjadi 96,97%. Pada aspek mengungkapkan isi bacaan hasil yang diperoleh pada pra tindakan nilai rata-rata siswa 63,64, pada siklus I nilai rata-rata siswa 69,70, dan pada siklus II naik menjadi 96,97. Dari data tersebut dapat disimpulkan bahwa penerapan pembelajaran dengan menggunakan pembelajaran tematik dapat meningkatkan kemampuan membaca pemahaman siswa. Dari hasil penelitian tersebut diharapkan agar guru memilih strategi yang tepat dengan menerapkan pembelajaran tematik untuk membantu meningkatkan pemahaman siswa pada pembelajaran membaca, sedangkan untuk peneliti lain diharapkan dapat menyempurnakan penelitian ini dengan menerapkannya pada ruang lingkup yang lebih luas.

Penerapan permainan fantastic card untuk mengembangkan kemampuan berbahasa di RA. Miftahul Ulum Gempol / Nurul Aziza

 

Kata Kunci : Pengembangan Bahasa dengan Media Fatastic Card Penelitian ini berlatar belakang dalam praktek pembelajaran di kelompok B memiliki perbendaharaan kata yang terbatas, kosakata dalam komunikasi melalui suara huruf yang belum berkembang, media pembelajaran yang belum optimal, pembelajaran dilakukan secara metode tanya jawab dan pemberian tugas sehingga kegiatan pembelajaran cenderung membosankan. Adapun ketrampilan dasar pengembangan berbahasa anak usia dini yang terdapat diuraian indikator yang dicapai yaitu berbicara, menyimak, pramembaca, membaca dan pramenulis. Penelitian ini bertujuan untuk mengetahui peningkatan bahasa anak melalui penerapan permainan fantastic card. Rancangan permainan melalui media, memberikan kebebasan dalam bereksplorasi melalui lingkungan, terjadi peningkatan pembelajaran dalam proses belajar yang menyenangkan, pemahaman jalannya pembelajaran, menimbulkan pengetahuan yang melekat pada benak anak. Metode yang digunakan dalam penelitian melalui rancangan Penelitian Tindakan Kelas (PTK) dengan model kolaboratif. Penelitian melakukan kolaborasi dengan guru kelas B di RA. Miftahul Ulum mulai dari tahap proses identifikasi masalah, perencanaan tindakan, pelaksanaan tindakan, observasi dan refleksi. Hasil penelitian menunjukkan bahwa peningkatan pengembangan bahasa, dapat meningkatan pengembangan bahasa di RA. Miftahul Ulum Kejapanan, peningkatan pengembangan bahasa tersebut ditandai dengan : 1) Diterapkannya metode pembelajaran belajar sambil bermain, bermain seraya belajar melalui permainan fantastic card di RA. Miftahul Ulum sesuai dasar yang disusun secara kolaboratif dengan baik, 2) Metode ceramah, guru lebih berkurang karena guru dalam membelajarkan anak, lebih banyak anak langsung praktek, melalui permainan dengan menggunakann media pembelajaran, 3) Pembelajaran lebih terpusat pada anak dan lebih bersifat konstruktif, 4) Penilaian hasil belajar anak lebih komprehensif dan tak hanya melalui pemberian tugas secara tertulis saja, 5) Situasi pembelajaran terasa lebih kondusif. Penerapan permainan fantastic card dapat meningkatkan; aktifitas belajar anak, kreatifitas anak, menciptakan suasana belajar yang menyenangkan, peningkatan interaksi dalam proses pembelajaran, dan pemahaman konsep dalam pembelajaran mudah diingat dan melekat pada benak anak. Berdasarkan hasil penelitian ini, dapat disarankan bahwa pembelajaran dalam peningkatan pengembangan bahasa hendaknya menggunakan permainan fantastic card. Hasil penelitian ini sangat dimungkinkan dapat diterapkan di kelompok B sekolah lain, jika kondisinya relatif sama atau mirip dengan sekolah yang menjadi latar penelitian ini.

Efektivitas dry bed training untuk mengatasi enuresis nokturnal anak usia sekolah dasar / Nur Hidayati

 

Kata kunci: dry bed training, enuresis nokturnal Dry bed training adalah suatu pelatihan yang digunakan sebagai terapi pada anak yang mengalami enuresis nokturnal, yang dalam prosedurnya menggunakan detektor kencing, latihan kencing sebagaimana mestinya, serta pemberian reinforcement ketika perilaku yang diharapkan muncul. Enuresis nokturnal (enuresis nocturnal) merupakan peristiwa seorang anak kencing dalam keadaan tidur ketika anak seusianya seharusnya mampu menahan kencing dan ke toilet sendiri. Tujuan penelitian adalah untuk mengetahui efektivitas dry bed training untuk mengatasi enuresis nokturnal anak usia Sekolah Dasar. Penelitian ini merupakan penelitian eksperimen. Desain penelitian yang digunakan adalah one-group pre test post test design. Subjek yang digunakan dalam penelitian berjumlah 5 orang (N=5). Analisis data keseluruhan subjek menggunakan uji wilcoxon. Uji wilcoxon memperoleh hasil sign < α (0,041 < 0,05), maka hipotesis diterima, dry bed training efektif untuk mengatasi enuresis nokturnal anak usia Sekolah Dasar. Hasil eksperimen menunjukkan bahwa tatalaksana dry bed training sudah sesuai dengan teori dengan modifikasi pemberian kepingan bintang apabila perilaku yang diharapkan muncul. Dari lima subjek yang diberikan terapi, dua subjek dinyatakan sembuh dan yang lainnya mengalami penurunan frekuensi mengompol. Dua orang hanya mengalami satu kali mengompol saat posttest dan satu orang mengalami tiga kali mengompol. Berdasarkan hasil penelitian dapat diberikan saran pada beberapa pihak diantaranya: (1) subjek yang mengalami enuresis nokturnal dan memiliki keinginan kuat untuk sembuh serta bersedia menjalani terapi dengan teratur, maka dry bed training dapat digunakan sebagai terapi untuk mengurangi bahkan menyembuhkan perilaku mengompol, (2) orangtua diharapkan untuk lebih telaten membimbing anak dalam menjalani terapi, sehingga subjek dapat berangsur-angsur sembuh dari kebiasaan mengompol, (3) peneliti selanjutnya, diharapkan penelitian yang akan dilakukan selanjutnya lebih dipersiapkan. Persiapan-persiapan tersebut diantaranya mengenai jumlah sampel yang lebih besar, kontrol lingkungan yang lebih ketat, pembuatan detektor kencing yang lebih fleksibel, sehingga hasil dari dry bed training dapat lebih baik.

Perbedaan penggunaan stimulus unmeaningful (tidak bermakna) dan meaningful (bermakna) terhadap sikap konformitas rema awal / Fauziyah

 

Kata Kunci: stimulus unmeaningful (tidak bermakna), stimulus meaningful (bermakna), konformitas Stimulus Unmeaningful (tidak bermakna) adalah stimulus yang digunakan dalam Eksperimen Asch untuk mengukur konformitas. Stimulus meaningful (bermakna) pada penelitian ini digunakan untuk melengkapi Eksperimen Asch, di mana keputusan yang diambil akan memanfaatkan data informasi yang tersimpan dalam ingatan. Penelitian ini bertujuan untuk mengetahui apakah ada perbedaan sikap konformitas remaja awal pada pemberian stimulus Unmeaningful dengan sikap konformitas remaja awal pada pemberian stimulus Meaningful dan untuk mengetahui adanya perbedaan pilihan jawaban pribadi subjek dibawah pengaruh kelompok dengan pilihan jawaban pribadi subjek tanpa pengaruh kelompok. Penelitian dilakukan di Sekolah Menengah Pertama Negeri (SMPN) 1 Malang, tanggal 25 November sampai 1 Desember 2010. Digunakan desain penelitian One Group Repeated Trials Design. Variabel bebas penelitian ini ialah stimulus Ambiguity (stimulus unmeaningful dan meaningful) dan variabel terikatnya ialah sikap konformitas. Sampel penelitian ialah 34 siswa (19 laki-laki dan 15 perempuan) kelas VII. Setiap subjek diberikan 2 jenis stimulus yaitu stimulus unmeaningful dan meaningful. Urutan penyajian stimulus dikontrol dengan teknik counterbalance. Hasil penelitian menunjukkan bahwa ada perbedaan sikap konformitas (pilihan jawaban pribadi subjek dibawah pengaruh kelompok) dan pilihan jawaban pribadi subjek tanpa pengaruh kelompok (F = 28.746. Nilai Sig. 0.000 < 0,05). Tidak terdapat perbedaan yang signifikan antara sikap konformitas subjek terhadap pemberian stimulus unmeaningful dan stimulus meaningful (t = 0.673 Nilai Sig.503 > 0,05). Kepada praktisi psikologi yang tertarik melanjutkan penelitian eksperimen mengenai tingkat konformitas pada remaja disarankan untuk memperluas wilayah pengukuran pada remaja tengah, remaja akhir atau dewasa awal karena subjek dalam penelitian terbatas pada masa remaja awal saja, dan disarankan untuk memperkaya hasil penelitian dengan memperluas atau memperbanyak jenis masalah untuk dijadikan stimuli penelitian serta menggunakan jumlah sampel yang lebih besar yang berasal dari tingkat pendidikan yang berbeda dan rentang usia yang lebih luas guna memperdalam fokus penelitian mengenai konformitas.

Pelaksanaan pembelajaran nilai karakter di pesantren putri Al-Mawaddah 2 Desa Jiwut Kecamatan Nglegok Kabupaten Blitar / Dita Ayu Kusuma

 

Kusuma, Dita Ayu. 2013. Pelaksanaan Pembelajaran Nilai Karakter di Pesantren Putri Al-Mawaddah 2 Desa Jiwut Kecamatan Nglegok Kabupatern Blitar. Skripsi, Jurusan Hukum dan Kewarganegaraan Fakultas Ilmu Sosial Universitas Negeri Malang. Prodi S1- Pendidikan Pancasila dan Kewarganegaraan. Pembimbing: (1) Dra. Arbaiyah Prantiasih, M.Si. (II) Drs. H. Edi Suhartono, S.H. M.Pd. Kata Kunci: Nilai Karakter, Pesantren Era Globalisasi yang ditandai perkembangan teknologi komunikasi informasi dan gaya hidup mendunia memberikan dampak positif dan dampak negatif. Salah satu dampak positif yaitu adanya kemajuan teknologi yang semakin canggih, dan salah satu dampak negatifnya adalah masuknya budaya barat yang tidak sesuai dengan budaya Indonesia sehingga dapat melemahkan nilai moral bangsa Indonesia. Untuk itu diperlukan pendidikan karakter dengan membelajarkan nilai-nilai karakter kepada anak didik guna membentuk kepribadian dan bertanggung jawab dalam menjalani kehidupan sehari-hari. Selain dalam pendidikan formal nilai-nilai karakter ini perlu dikembangkan dalam dunia pesantren. Pesantren adalah sebuah lembaga pendidikan dan pengembangan agama Islam. Lembaga pesantren merupakan wadah untuk mentransformasikan nilai bagi para santri, dengan adanya pesantren sebagai lembaga pendidikan, diharapkan dapat menunjang peningkatan kualitas manusia Indonesia yang tidak hanya handal dalam menguasai ilmu pengetahuan dan teknologi, melainkan juga mendidik sikap dan kepribadian serta moralitas yang luhur sesuai dengan ajaran agama Islam. Penelitian ini dilakukan untuk mengetahui: (1) landasan pembelajaran nilai karakter di pesantren, (2) pelaksaan pembelajaran nilai karakter di Pesantren, (3) metode yang digunakan dalam membelajarkan nilai karakter, (4) kendala yang dihadapi dalam membelajaran nilai karakter, (5) upaya yang dilakukan untuk mengatasi kendala dalam membelajarkan nilai karakter. Penelitian ini menggunakan pendekatan deskritif kualitatif. Disebut pendekatan deskriptif kualitatif karena data yang dihasilkan bukan dalam bentuk angka-angka tetapi berupa kata-kata lisan atau tertulis. Teknik pengumpulan data dilakukan dengan teknik observasi, wawancara, serta dokumentasi. Analisis data hasil penelitian dilakukan dengan reduksi data, penyajian data, dan penarikan kesimpulan (verivikasi).     Hasil penelitian ini adalah: (1) Landasan dalam membelajarkan nilai karakter di pesantren ini diambil dari kurikulum yang sudah ditentukan oleh Kemenag dan juga menggunakan beberapa kitab kuning yang mendukung pembelajaran yaitu kitab Akhlakul Lilbanat dan Tanbihul Muta’alim, (2) Pelaksanaan pembelajaran nilai karakter di pesantren ini dilakukan melalui pembelajaran di dalam kelas secara klasikal yaitu dengan mengintregasikan nilai karakter pada setiap mata pelajaran yang di sampaikan oleh ustadzah dan juga dilakukan dengan penerapan nilai-nilai karakter yang sudah ada di pesantren dalam kehidupan sehari-hari, (3) Strategi dan metode dalam membelajarkan nilai karakter di pesantren ini adalah dengan melakukan pemantauan kepada santri yang dilakukan selama 24 jam. Selain itu, juga dilakukan dengan memberikan keteladan dan contoh nyata dari pengasuh dan ustadzah, (4) Kendala yang dihadapi dalam membelajarkan nilai karakter di Pesantren ini adalah latar belakang santri yang berbeda dan karakter santri yang berbeda, (5) Upaya mengatasi kendala dalam membelajarkan nilai karakter di pesantren adalah memberi nasehat kepada santri melalui kegiatan pengarahan mingguan setiap hari jumat, memberi bimbingan kepada santri melalui teladan yang diberikan langsung oleh ustadzah, memantau santri melalui organisasi OSWAH (organisasi santriwati Al-Mawaddah) Berdasarkan hasil penelitian di atas maka saran yang dapat disampaikan adalah bagi pengasuh dan ustadzah diharapkan mempertahankan nilai-nilai karakter yang sudah diterapkan di pesantren seperti nilai karakter disiplin, yang berupa dan mempertahankan ketelatenan dalam membimbing dan menasehati santri. Bagi peneliti selanjutnya diharapkan hasil penelitian ini dapat dijadikan sebagai referensi untuk mengadakan penelitian lebih lanjut.

Perbedaan motivasi berprestasi antara siswa MTs dengan siswa SMP negeri / Dwi Sulistyoningrum

 

Kata kunci: Siswa MTs dan siswa SMPN, Motivasi berprestasi Motivasi berprestasi merupakan usaha untuk mencapai keberhasilan dan kesuksesan. Motivasi pada siswa menjadi penting sebagai faktor yang memberi energi dan arah pada suatu perilaku. Siswa yang mempunyai motivasi berprestasi yang tinggi akan mengarahkan tingkah lakunya pada usaha pencapaian prestasi tertentu yang diukur berdasarkan standar kesempurnaan dalam dirinya. Penelitian ini bertujuan (1) Mengetahui gambaran motivasi berprestasi siswa MTs, (2) Mengetahui gambaran motivasi berprestasi siswa SMP Negeri, (3) Mengetahui apakah ada perbedaan motivasi berprestasi antara siswa MTs dengan siswa SMP Negeri. Subyek penelitian adalah siswa MTs Muhammadiyah dan siswa SMPN 4. Rancangan penelitian yang digunakan adalah Deskripstif Komparatif. Instrumen pengumpulan data EPPS digunakan untuk mengungkap motivasi berprestasi siswa. Data yang diperoleh dianalisis menggunakan teknik Analisis Deskriptif dan analisis Uji-t, yaitu Uji Independent Sample Test dengan taraf signifikansi 0,05. Hasil penelitian menunjukkan bahwa siswa MTs Muhammadiyah 2 terdapat 3,5% siswa memiliki motivasi berprestasi yang tinggi atau sebanyak 2 orang siswa, 28,1% atau 16 orang siswa memiliki motivasi berprestasi sedang, 8,8% atau sebanyak 5 orang siswa memiliki motivasi rendah, dan 3,5% lagi atau 2 orang siswa memiliki motivasi berprestasi yang sangat rendah. Siswa SMP Negeri 4 terdapat 1,8% siswa yang memiliki motivasi berprestasi tinggi sekali atau 1 orang siswa, 12,3% siswa yang memiliki motivasi berprestasi tinggi atau 7 orang siswa, 36,8% siswa yang memiliki motivasi berprestasi sedang atau 21 siswa dan 5,3% siswa yang memiliki motivasi berprestasi rendah atau sebanyak 3 orang siswa. Ada perbedaan motivasi berprestasi antara siswa MTs Muhammadiyah dengan siswa SMPN 4, dengan hasil uji t = 2,685, sig 0,010 < 0,05. Berdasarkan hasil penelitian siswa SMPN 4 memiliki motivasi lebih tinggi dengan mean 16,94 dan MTs memiliki motivasi lebih rendah dengan mean 15,00, ini dikarenakan siswa merasa jenuh dengan rutinitas yang ada selain itu lingkungan tempat tinggal siswa tidak dapat membuat siswa belajar dengan nyaman. Saran bagi pihak sekolah MTs sebagai pihak pendidik, hendaknya lebih dapat memotivasi siswanya dengan memberikan insentif eksternal seperti pujian atau memberikan evaluasi berkala terhadap siswa di sekolah agar lebih dapat bersaing. Serta memberikan fasilitas tempat tinggal yang mendukung belajar siswa. Bagi subyek penelitian khususnya siswa MTs harus lebih berusaha meningkatkan motivasi berprestasi yang lebih baik, siswa dapat membuat rencana kegiatan belajar yang dapat berupa jadwal belajar dan penyelesaian tugas sekolah yang dilakukan setiap hari secara teratur dan dapat disesuaikan dengan situasi kondisi. Bagi peneliti selanjutnya hendaknya lebih memperhatikan faktor-faktor lain seperti pola asuh, kebiasaan belajar, harapan orang tua dan lain-lain.

Penggunaan metode demonstrasi untuk meningkatkan kemampuan fisik motorik dengan teknik finger painting siswa kelompok A di RA Nurul Iman Karangrejo Kecamatan Gempol / Mutrofin

 

Kata kunci : Metode Demonstrasi, Fisik Motorik, Finger Painting, RA Sebagai guru berupaya agar anak didik dapat mengembangkan berbagai macam bakat dan kemampuan secara optimal dalan melakukan kegiatan. Semua itu akan berhasil dengan baik apabila kita selalu berusaha menciptakan suasana pembelajaran secara efektif, kreatif, dan menyenangkan. Sebaikya pendidik tidak melulu mencontohkan lalu anak mengikuti.tapi biarkan anak mencoba-mencoba, sehingga anak dapat menyelesaikan tugas secara mandiri. Yang dihadapi sekarang di RA Nurul Iman Karangrejo Kecamatan Gempol, misalnya pada pengembangan fisik motorik anak belum mampu menggerakkan jari tangan untuk kelenturan otot dan koordinasi untuk menerapkan melukis dengan jari yang sesuai dengan harapan guru. Penelitian ini bertujuan untuk mendiskrepsikan (1) langkah-langkah penggunaan metode demonstrasi untuk meningkatkan kemampuan fisik motorik dalam pembelajaran finger painting pada anak kelompok A RA Nurul Iman Karangrejo Kecamatan Gempol, (2) peningkatan kemampuan fisik motorik dan seni anak kelomok A RA Nuurul Iman Karangrejo Kecamatan Gempol dengan menggunakan metode demonstrasi dalam pembelajaran finger painting. Untuk meningkatkan kemampuan fisik motorik mengguanakan metodologi penelitian yaitu menggunakan rancangan PTK yang bertujuan untuk mengatasi masalah pembelajaran yang terjadi pada latar penelitian (kelas). Subyek penelitian adalah anak kelompok A dengan jumlah 20 anak. Lokasi penelitian adalah RA Nurul Iman Karangrejo Kecamatan Gempol Kabupaten Pasuruan. Teknik pengumpulan datanya dengan observasi dan portofolio. Kesimpulan dari penelitian adalah (1) langkah-langkah penggunaan metode demonstrasi telah berhasil meningkatkan kemampuan fisik motorik dengan teknik finger painting di kelompok A RA Nurul Iman Karangrejo Kecamatan Gempol Kabupaten Pasuruan, (2) peningkatan fisik motorik dari pra tindakan nilai rata-rata mendapat bintang 1 meningkat bintang 2 pada siklus I tatapi belum tuntas. Pada siklus II terjadi ketuntasan dengan nilai rata-rata bintang 3. Saran yang bisa diberikan dalam penelitian ini adalah (1) bagi pendidik hendaknya metode demonstrasi dengan teknik finger painting bisa menjadi salah satu alternatif peningkatan kualitas dalam pembelajaran fisik motorik, (2) bagi penelitian lain, penggunaan metode demonstrasi bisa dikembangkan pada penelitian lain, penelitian lain dengan metode pembelajaran yang lebih inovatif dan kreatif yang berkembang.

Studi pelaksanaan pembangunan jalan Widang - Gresik - Surabaya / Kamarissaw Septivana Eka Yeniwati

 

Kata kunci: pelaksanaan, konstruksi jalan, tebal perkerasan Salah satu tujuan dibangunnya jalan adalah untuk mengatasi daerah yang masih terisolasi, disamping itu dengan dibukanya daerah tersebut akan memberikan peluang pada masyarakatnya untuk melihat perkembangan daerah lain dengan harapan akan mendorong pertumbuhan dalam bidang ekonomi, sosial budaya dan politik. Pada umumnya hampir semua truk berat di Indonesia mengangkut beban melebihi batas beban normal tersebut. Truk pengangkut sirtu rata-rata memuat antara 2,5 s/d 3 kali lipat muatan ijinnya. Akibat beban yang melebihi batas ini jalan di Indonesia jadi cepat rusak sebelum waktunya. Berdasarkan uraian tersebut, maka proyek akhir ini akan mengkaji tentang pelaksanaan pekerjaan jalan serta mengkaji perhitungan tebal perkerasan jalan pada proyek pembangunan jalan Widang – Gresik – Surabaya. Metode pengumpulan data pada Proyek Akhir ini dengan melakukan pengamatan, wawancara, dan dokumentasi. Analisis data dilakukan dengan menelaah seluruh data yang tersedia dari berbagai sumber, kemudian dikelompokkan sesuai dengan konteks studi lapangan ini. Hasil yang diperoleh dari Proyek Akhir ini adalah (1) Pelaksanaan proyek pembangunan jalan Widang – Gresik – Surabaya terdiri dari pekerjaan pengukuran, pekerjaan pemasangan geotekstile, pekerjaan selected material, pekerjaan lapis pondasi bawah agregat kelas B, pekerjaan lapis pondasi atas agregat kelas A dan pekerjaan laston. Dari job mix formula didapatkan bahwa bahan yang digunakan untuk selected material harus mempunyai gradasi dibawah 50 cm, untuk lapis pondasi bawah agregat kelas B gradasinya harus lebih kecil dibanding selected material, untuk lapis pondasi atas agregat kelas A gradasinya harus lebih kecil dibandingkan lapis pondasi bawah agregat kelas B. Untuk bahan lapisan AC dari job mix formula baik AC-base, AC-BC, maupun AC-WC memiliki kadar aspal dan kombinasi gradasi butiran yang berbeda. Berdasarkan hasil di atas, dapat disimpulkan bahwa pelaksanaan dan bahan yang digunakan pada proyek pembangunan jalan Widang-Gresik-Surabaya sudah sesuai dengan Spesifikasi Teknik yang disyaratkan oleh Bina Marga. (2) Perhitungan ketebalan lapis perkerasan dengan menggunakan Metode Analisa Komponen didapatkan hasil sebagai berikut: lapis AC = 12 cm, lapis pondasi atas = 30 cm dan lapis pondasi bawah = 34 cm.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 |