Variasi genetik kerbau (Bubalus bubalis) Rawa Kalimantan Selatan berbasis mikrosa telit sebagai pengembangan bahan ajar biodiversitas di SMA) / Tjatur Imbang Sasono

 

Tesis Program Studi Pendidikan Biologi. Program Pasca Sarjana, Universitas Negeri Malang .Pembimbing (I) Dr. agr. Mohamad Amin S.Pd. M.Si. dan Pembimbing (II) Dr. Abdul Gofur, M.Si. Kata kunci :Variasi genetik, kerbau rawa Kalimantan Selatan, mikrosatelit, bahan ajar Kerbau rawa Kalimantan Selatan merupakan salah satu ternak endemik sebagai kekayaan hayati Indonesia. Populasi kerbau rawa Kalimantan Selatan terus mengalami penurunan. Penurunan populasi disebabkan oleh pengurasan ternak kerbau rawa karena permintaan masyarakat untuk konsumsi daging kerbau terus meningkat. Faktor lain adalah tingkat reproduksi kerbau rawa yang rendah pembibitan dengan seleksi negatif dan usaha ekstensif oleh peternak, hal ini menjadi ancaman punahnya kerbau rawa, maka perlu perhatian dan penanganan melalui sistem berternak, pengembangbiakan, konservasi dan pelestari kerbau rawa. Usaha yang ditempuh antara lain dengan penelitian variasi genetik kerbau rawa Kalimantan Selatan. Penelitian ini bertujuan untuk memberikan pemetaani mengenai pertumbuhan populasi, akibat pengurasan ternak serta upaya konservasi dan pelestarian kerbau rawa Kalimantan sebagi sumber plasma nutfah endemik serta aplikasinya dalam pengembangan bahan ajar biodiversitas di SMA. Penelitian ini dilakukan secara deskriptif eksploratif dengan Simple Random Sampling terhadap kerbau rawa dari tiga populasi yaitu Awayan, Telaga Selaba dan Sungai Buluh. Pengumpulan data menggunakan teknik penelitian lapangan meneliti sifat fenotip melalui pengamatan dan pengukuran tubuh kerbau rawa, dan teknik penelitian laboratorium untuk meneliti variasi genetik yang menggunakan marker mikrosatelit (dua lokus yaitu HEL 009 dan INRA 037) melalui tahapan isolasi DNA, elektroforesis agarosa, PCR, elektroforesis poliakrilamid dan diakhiri pewarnaan silver staining. Hasilnya pita DNA ditabulasi kedalam program analisis data molekuler dengan software GENEPOP versi 4.0.10 untuk menentukan jumlah alel, frekuensi alel, nilai heterozigositas, nilai informasi polimorfisme dan tingkat variasi populasi serta tingkat keseimbangan populasi kerbau rawa Kalimantan Selatan. Hasil analisis menunjukkan bahwa variasi genetik polulasi kerbau Sungai Buluh lebih tinggi daripada populasi Awayan dan Telaga Selaba, sedangkan populasi Awayan lebih tinggi daripada Telaga Selaba, hal ini dapat dilihat dari nilai frekuensi alel dengan dua lokus Sungai Buluh berkisar antara 0,143 sampai 0,643, Awayan berkisar antara 0,50 sampai 1,00 dan Telaga Selaba homozigot. Rata-rata nilai PIC atau nilai informasi polimorfik populasi Sungai Buluh, Awayan dan Telaga Selaba masing-masing 56,9%, 31,25% dan 0%. Tetapi berdasarkan nilai rata-rata heterozigositas alel pengamatan kedua lokus diperoleh hanya populasi Sungai Buluh saja yang bisa dianalisis yaitu 32,15%. Hasil temuan penelitian dapat disimpulkan variasi kerbau rawa populasi Awayan, Telaga Selaba dan Sungai Buluh hasil pengukuran dan pengamatan fenotip menunjukkan perkerabatan tidak terlalu jauh, kerbau rawa Awayan dan Telaga selaba secara kebetulan menunjukkan monorfik karena baik frekuensi alel dan nilai heterozigositas serta nilai polimorfiknya rendah atau variasi genetik rendah berarti perkerabatan sangat dekat, sedangkan kerbau rawa populasi Sungai Buluh frekuensi alel, nilai heterozigositas dan nilai polimorfiknya tinggi variasi genetiknya tinggi. Hal berarti perkerabatan kerbau rawa populasi Sungai Buluh dengan Awayan dan Telaga selaba jauh. Selain itu lokus INRA 037 dapat dipakai sebagai sarana mendeteksi atau penanda variasi genetik DNA kerbau rawa Kalimantan Selatan. Jadi berdasarkan hasil penelitian ini dapat digunakan pemetaan yang diikuti upaya konservasi kerbau rawa Kalimantan Selatan terutama kerbau rawa Awayan dan Telaga Selaba. Selain itu untuk pengembangan bahan ajar dalam bentuk handout dengan model 4-D. pokok bahasan Biodiversitas bidang studi Biologi di SMA. Hal ini berdasarkan hasil nilai uji validasi oleh Ahli Pengembangan Bahan ajar (Validator) melalui pengisian angket sebesar 83,93%. Akhirnya peneliti menyarankan agar penelitian variasi genetik kerbau rawa dengan penanda mikrosatelit lokus INRA 037 lebih efektif dan efisien dibandingkan dengan HEL 009, selain dapat digunakan upaya pemetaan dan konservasi oleh masyarakat dan pihak pemerintah, terutama wilayah Kalimantan Selatan, serta di dunia pendidikan untuk mengembangkan bahan ajar dengan model 4-D dalam bentuk handout pokok bahasan Biodiversitas bidang studi Biologi di SMA dapat direspon oleh guru dan siswa diaplikasikan pada pembelajaran dalam rangka peningkatan prestasi siswa dan mencerdaskan bangsa.

Studi pengembangan variasi resep masakan ayam bakar khas lumajang dengan bumbu daun sebagai penambahan rasa dan aroma / I'is Afrianti

 

Kata kunci : Pengembangan, Ayam Bakar, Bumbu Daun Ayam Bakar adalah Masakan yang dibuat dari bahan utama ayam yang dimasak bersamaan dengan kaldu ayam dan rempah-rempah seperti: jahe, serai, dan lengkuas . Ayam Bakar memiliki aroma sangat gurih dan rasa pedas dan gurih yang sangat khas. Tujuan penelitian ini adalah menemukan apakah dengan penambahan bumbu daun pada Ayam bakar khas Lumajang akan meningkatkan aroma dan rasa, komposisi bahan dan bumbu daun dalam ayam bakar Khas Lumajang yang disukai masyarakat sebagai penambah rasa dan aroma. Pengujian terhadap aroma, rasa, warna, dan kesukaan dengan menggunakan format penilaian terhadap subjek uji coba, kemudian hasil uji coba dianalisis menggunakan persentase dan dijabarkan secara deskriptif. Hasil penelitian menunjukkan adanya peningkatan aroma dan rasa pada ayam bakar. Penilaian aroma bumbu daun tertinggi adalah produk C sangat beraroma sebesar 56%, penilaian rasa bumbu daun tertinggi dengan pernyataan sangat berasa pada produk C sebesar 66%, penilaian warna merah coklat tertinggi pada produk B sebesar 34%, sedangkan penilaian terhadap kesukaan tertinggi pada produk C sebesar 86% responden menyatakan sangat suka. Komposisi bumbu daun yang banyak untuk penambahan bahan baku ayam bakar tidak menjamin disukai oleh konsumen. Diantara 2 jenis bumbu daun yang digunakan pada penelitian, daun kemangi adalah yang paling disukai sebagai penambah rasa dan aroma. Berdasarkan hasil tersebut dapat disimpulkan bahwa dengan penambahan bumbu daun pada Ayam bakar khas Lumajang meningkatkan aroma dan rasa pada produk variasi C. Komposisi bumbu daun dalam ayam bakar yang disukai masyarakat adalah dengan penambahan 5 gr daun kemangi. Jenis bumbu daun yang paling disukai masyarakat pada ayam bakar khas Lumajang sebagai penambah rasa dan aroma adalah daun kemangi. Pemerintah kota Lumajang dan masyarakat wirausaha dapat menjadikan variasi ayam bakar sebagai prospek untuk peluang usaha makanan yang bergerak dibidang boga sebagai penambah penghasilan. Peneliti selanjutnya yang tertarik untuk melakukan pengembangan produk ayam bakar khas Lumajang dapat menambahkan kajian untuk mengembangkan bauran pemasaran.

Faktor-faktor yang mempengaruhi transformasi mata pencaharian petani di Kecamatan Ngasem Kabupaten Bojonegoro (Suatu kajian geografi ekonomi terhadap alih fungsi lahan) / Nia Putri Novitasari

 

Kata Kunci: Transformasi Mata Pencaharian, Petani, alih fungsi lahan Sektor pertanian memberikan kontribusi terbesar dalam menyumbang PDRB Kabupaten Bojonegoro, kini peranannya semakin berkurang disebabkan menyusutnya lahan pertanian. Hal ini dapat dilihat dari RPJM Kabupaten Bojonegoro tahun 2009-2013 yang mengalami penurunan rata-rata 7,94% per tahun. Sektor lain yang dipandang mempunyai potensi untuk dikembangkan adalah sektor pertambangan minyak dan gas bumi, khususnya di Kecamatan Ngasem dimana enam desa yang sebagian lahan pertaniannya dialih fungsikan. Dengan adanya tambang minyak, membawa perubahan, seperti transformasi (perubahan) mata pencaharian petani dan pendapatan masyarakat Kecamatan Ngasem. Penelitian ini bertujuan untuk mendeskripsikan: (1) kondisi geografi Ke-camatan Ngasem Kabupaten Bojonegoro, (2) karakteristik petani di Kecamatan Ngasem Kabupaten Bojonegoro, (3) transformasi mata pencaharian petani di Ke-camatan Ngasem Kabupaten Bojonegoro, (4) faktor-faktor yang mempengaruhi transormasi mata pencaharian petani di Kecamatan Ngasem Kabupaten Bojonego-ro, (5) besarnya rata-rata pendapatan petani sebelum dan sesudah transformasi mata pencaharian di Kecamatan Ngasem Kabupaten Bojonegoro. Penelitian ini merupakan penelitian deskriptif yang menggunakan metode survey. Sampel dalam penelitian ini diambil dua teknik pengambilan sampel, yaitu sampel daerah dan sampel responden. Teknik pengambilan sampel daerah menggunakan purposive sampling yang diperoleh dua sampel yaitu Desa Gayam dan Desa Mojodelik. Teknik pengambilan sampel responden menggunakan pro-porsional random sampling yang diperoleh 58 responden. Pengumpulan data yang digunakan adalah observasi, dokumentasi, kuesioner. Analisis yang digunakan adalah deskriptif dengan persentase tabulasi tunggal. Hasil penelitian ini menunjukkan bahwa: (1) karakteristik responden dari segi umur tergolong produktif, yang memiliki beban tanggungan 5-6 orang, dan pendidikannya tamat SD, (2) sebagian besar bentuk transformasi mata pencaharian petani di Kecamatan Ngasem adalah berdagang, (3) faktor-faktor yang mem-pengaruhi transformasi mata pencaharian petani adalah lahan pertanian yang dimi-liki petani sempit, (4) perubahan pendapatan sebelum dan sesudah trasnsformasi mata pencaharian mengalami penurunan, hal ini terkait juga dengan pendapatan setelah transformasi mata pencaharian dan biaya konsumsi. Berdasarkan hasil tersebut dapat disimpulkan sebagian besar petani yang melakukan transformasi mata pencaharian disebabkan lahan pertanian yang dimi-liki sempit. Adapun saran yang diberikan yaitu: (1) pemerintah supaya lebih mempertimbangkan kebijakan yang ada, (2) pihak Exxon Mobil selaku pengelola hendaknya lebih mengutamakan masyarakat sekitar untuk bekerja di pertambangan minyak, (3) pemerintah bersama pengelola hendaknya mengadakan pelatihan terhadap mantan petani yang telah kehilangan lahannya, (4) pemerintah lebih menunjang bidang pendidikan di sekitar Kecamatan Ngasem untuk generasi kedepannya.

Pengaruh lingkungan keluarga terhadap perkembangan bahasa anak sebelum usia sekolah / oleh Surjatiningsih

 

Analisis surat-surat resmi siswa kelas VIII SMP Negeri 4 malang / Dewi Khalimatus Sa'diyah

 

Kata Kunci: analisis, surat resmi Dalam pembelajaran menulis surat di sekolah, siswa diarahkan, dibimbing dan dibantu agar mampu berkomunikasi melalui surat sehingga siswa dapat menulis surat dengan benar. Akan tetapi banyak dijumpai permasalahan yang ada dalam menulis surat. Siswa mengalami hambatan seperti kesulitan dalam menulis surat yang benar sesuai dengan jenis surat. Hal ini tentu menjadi alasan mengapa mereka kurang semangat dalam menulis surat. Kemampuan menulis surat dianggap sulit oleh para siswa, oleh karena itu penting untuk dipahami. Penelitian ini dilaksanakan untuk mengetahui bagaimanakah surat-surat resmi yang ditulis oleh siswa SMP Negeri 4 Malang. Secara khusus tujuan penelitian ini adalah mendeskripsikan format surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang, karakteristik diksi surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang, struktur isi surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang, dan kalimat surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang. Penelitian ini menggunakan metode analisis dan bersifat deskriptif. Penelitian ini mendeskripsikan karakteriksik format surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang, karakteristik diksi surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang, struktur isi surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang, dan kalimat surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang. Berdasarkan hasil analisis data, format penulisan surat resmi siswa kelas VIII SMP Negeri 4 Malang bermacam-macam. Ada yang menggunakan format surat resmi yang lazim digunakan, ada pula yang tidak lazim. Format yang digunakan oleh siswa kelas VIII SMP Negeri 4 Malang yaitu format lekuk, lurus, setengah lurus, lurus penuh, dan resmi Indonesia lama. Sebagian besar siswa menggunakan format penulisan yang tidak sesuai dengan format penulisan surat pada umumnya. Karakteristik diksi penulisan surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang ada yang baku dan tidak baku. Sebagian besar siswa menggunakan diksi yang terpengaruh oleh bahasa sehari-hari atau bahasa daerah. Pengembangan struktur isi surat-surat resmi yang ditulis oleh siswa kelas VIII SMP Negeri 4 Malang ada yang sederhana dan ada yang kompleks. Struktur isi yang ada pada penulisan surat-surat resmi siswa kelas VIII SMP Negeri 4 Malang juga ada yang kurang lazim. Pada bagian pembuka surat, tidak terdapat salam pembuka. Kalimat yang dituliskan oleh siswa SMP Negeri 4 Malang ada yang kurang efektif, kurang logis dan banyak kata yang ambigu.

Study tentang pelaksanaan pengajaran Bahasa Arab di Mu'allimat Malang / oleh Lilik Zuhriyah

 

Pembinaan ketjakapan chusus di sekolah dasar / oleh Anwar Rozaq

 

Usaha-usaha peningkatan tugas seorang guru sekolah dasar / oleh Achmad Husaifi Sakrani

 

Pengaruh urbanisasi terhadap beberapa segi kehidupan masyarakat kota / oleh Tulik Maria Sulcha

 

Peranan tradisi dalam pembangunan masyarakat desa / oleh Endang Heri Rahayu

 

Fungsi alat peraga dalam pengajaran di sekolah dasar / Nunuk Suyatimah

 

Arti gambaran kanak-kanak bagi pendidikan / oleh Kasijanto

 

Studi tentang sumbangan jang sebenarnja dari pada pendidikan kedjuruan dalam rangka program pembangunan semesta di Indonesia / oleh Prijanto Somodihardjo

 

Hubungan keluarga berencana dengan pendidikan / oleh Wan Sulaiman

 

Pengaruh pariwisata terhadap kehidupan sosial ekonomi di Denpasar/Bali / oleh I. Njoman Gunadi

 

Study tentang usaha-usaha pendidikan di luar sekolah di Panti Asuhan Kristen Jatim Malang / oleh Mariane Mayhani Nawawi

 

Penerapan model pembelajaran Think-Talk-Write untuk meningkatkan hasil belajar mata pelajaran IPS siswa kelas IX A SMP Negri 7 Malang / Findra Siswanti Dwi Puspitasari

 

Prediksi nisbah pelepasan sedimen (NPS) sub das junggo bagian hilir dengan menggunakan model suripin di kecamatan Bumiaji kota Batu / Edwin Maulana

 

Kata Kunci: erosi, sedimen, intensitas hujan, RUSLE, NPS Model Suripin Erosi merupakan peristiwa pemindahan atau pengangkutan bagian dari tanah dari suatu tempat ke tempat yang lain melalui media alami yaitu air maupun angin. Perhitungan Nisbah Pelepasan Sedimen (Soil Delivery Ratio) atau cukup dikenal dengan SDR adalah perhitungan untuk memperkirakan besarnya erosi kotor dari suatu daerah tangkapan air. Penelitian ini merupakan penelitian survey dimana pengumpulan data dilakukan dengan cara pengamatan secara sistematis terhadap gejala atau fenomena yang ada pada obyek penelitian. Penelitian ini bertujuan untuk (1) mengidentifikasi besar intensitas hujan yang menyebabkan run off di sub DAS Junggo bagian hilir (2) mengetahui analisa hubungan intensitas hujan dengan Nisbah Pelepasan Sedimen di Sub DAS Junggo bagian hilir (3) mengetahui luas DAS yang cocok untuk aplikasi Nisbah Pelepasan Sedimen Model Suripin di sub DAS Junggo bagian hilir. Pengambilan sampel dilakukan dengan metode purposive sampling. Analisis data untuk mengetahui besarnya laju erosi potensial dengan menggunakan model RUSLE, sedangkan besarnya erosi aktual diperoleh dengan pengukuran langsung sedimen pada outlet dengan cara mengambil sampel air yang bercampur dengan sedimen pada saat run off terjadi dan kemudian dianalisis pada laboratorium tanah untuk mendapatkan besaran sedimen terangkut pada tiaptiap liter air. Hasil analisa laboratorium tanah diplotkan ke dalam hidrograf untuk mengetahui besaran sedimen terangkut pada kejadian run off. SDR dihitung berdasarkan perbandingan antara laju erosi potensial dengan laju erosi aktual. Hasil penelitian menunjukkan bahwa berdasarkan analisis regresi antara intensitas hujan dengan volume run off dapat dilihat bahwa intensitas hujan minimum yang dapat menyebabkan terjadinya run off di sub DAS Junggo bagian hilir adalah 3,75 mm/jam. Hasil analisis hubungan intensitas hujan dengan Nisbah Pelepasan Sedimen di Sub DAS Junggo bagian hilir menunjukkan hasil yang sangat signifikan, diketahui berdasarkan analisis R yang menunjukkan nilai 0,707. Empat sampel Nisbah Pelepasan Sedimen yang diregresikan dengan luas DAS dapat diketahui bahwa (1) intensitas hujan sebesar 28,26 mm/jam dan curah hujan 49,46 mm tidak cocok untuk NPS Model Suripin, (2) intensitas hujan sebesar 21,9 mm/jam dan curah hujan sebesar 18,18 mm cocok untuk NPS Model Suripin pada luas DAS 3,35 hektar, (3) intensitas hujan sebesar 7,20 dan curah hujan sebesar 25,79 mm cocok untuk NPS Model Suripin pada luas DAS 4,78 hektar, (4) intensitas hujan sebesar 18,28 mm/jam dan curah hujan sebesar 33,11 mm cocok untuk NPS Model Suripin pada luas DAS 7,18 hektar.

Using comic strips to improve the VII grade students' skill of writing a descriptive paragraph in SMP Negeri 10 Malang / Khoharudin Nugroho Aji

 

Kata Kunci: comic strips, kemampuan menulis siswa, paragraf descriptif Menulis adalah sebuah kemampuan yang harus dikuasai siswa. Paragraf deskriptif adalah salah satu dari lima gaya penulisan yang diajarkan dalam proses pengajaran dan pembelajaran menulis bagi siswa kelas VII Sekolah Menengah Pertama (SMP). Penelitian ini telah dilaksanakan di SMP Negeri 10 Malang. Di sekolah tersebut, banyak siswa kelas VII yang memiliki masalah dalam menulis sebuah paragraf terutama deskriptif. Ketika mereka diminta untuk menyusun sebuah paragraf deskriptif tentang satu tempat umum, nilai hasil tulisan mereka di bawah KKM (Kriteria Ketuntasan Minimal) berdasarkan isi, penggunaan bahasa, dan pengaturan. Berdasarkan daftar pertanyaan dan diskusi dengan guru kelas, hal tersebut terjadi dikarenakan kegiatan pengajaran dan pembelajaran yang dilaksanakan kurang begitu menarik bagi siswa dan kurang berfariasi. Peneliti bermaksud untuk menemukan solusi masalah tersebut dengan menggunakan Comic Strips dalam proses pengajaran dan pembelajaran. Peneliti yakin bahwa Comic Strips dapat efektif karena dapat membuat siswa menikmati proses pengajaran dan pembelajaran. Comic Strips juga memiliki beberapa kegunaan lain untuk membantu siswa meningkatkan kemampuannya dalam menulis sebuah paragraf deskriptif dan membantu guru dalam mengajar supaya efektif. Comic Strips ini terdiri dari beberapa gambar yang menarik dan lucu yang dapat membantu siswa menemukan ide dalam proses menulis khususnya paragraf deskriptif. Bagian-bagian dari Comic Strips telah disusun sesuai urutan untuk membantu siswa dalam mengatur paragraf mereka. Setiap bagian dari Comik Strips memberi informasi yang rinci tentang gambaran sebuah tempat dan situasinya. Terdapat beberapa kata kunci dalam kalimat yang belum lengkap pada Comic Strips tersebut yang dapat membantu siswa memfariasi kata-kata yang digunakan dalam menulis sebuah paragraf deskriptif. Comic Strips tersebut juga dapat digunakan oleh guru untuk mengarahkan siswa selama proses pengajaran dan pembelajaran menulis. Comic Strips memiliki beberapa ciri khas yang hamper sama dengan picture sequence. Menurut Brown (2004:226) “picture sequence dapat memberikan sebuah rangsangan yang pas untuk menghasilkan tulisan”. Model penelitian yang digunakan dalam penelitian ini adalah PTK (Penelitian Tindakan Kelas) Kolaborasi. Penelitian ini dilaksanakan dalam dua kali putaran. Setiap putaran terdiri dari empat tahap, yaitu, perencanaan, pelaksanaan, pengamatan, dan pencerminan. Hasil pengamatan dalam penelitian ini dianalisa berdasarkan proses dan hasil karya. Berdasarkan proses, hasil pengamatan diperoleh dari menganalisa daftar pengamatan kegiatan siswa dan guru, catatan lapangan, daftar pertanyaan untuk siswa, dan wawancara dengan guru kelas dan siswa. Berdasarkan proses, hasil pengamatan diperoleh dari menganalisa nilai hasil tulisan siswa. Dilihat dari prosesnya, hasil pengamatan menunjukkan bahwa Comic Strips dapat membantu siswa dalam menemukan ide menulis. Beberapa kata kunci pada kalimat-kalimat yang belum lengkap membantu siswa dalam memfariasi kata-kata yang digunakan dan menyusun tata bahasa kalimat. Comic Strips juga memiliki gambar-gambar berwarna-warni yang dapat membuat siswa menikmati proses pengajaran dan pembelajaran. Gambar-gambar bentuk nyata yang ditunjukkan tersebut memberi siswa inspirasi untuk menemukan dan menyusun ide mereka. Berdasarkan bagian-bagian dari Comic Strips, siswa dapat memetak-metakkan apa yang ingin ditulis dalam susunan sebuah paragraf. Guru juga dapat menggunakan Comic Strips tersebut untuk membimbing siswa mengembangkan ide dalam tulisannya dengan cara memberi beberapa pertanyaan. Comic Strips tersebut berguna sekali untuk membuat siswa aktif dan kreatif dalam belajar menulis. Dalam hasil karya, peneliti menemukan bahwa jumlah keseluruhan hasil karya siswa yang mendapatkan nilai di atas 75 (KKM) dihitung dalam bentuk persentase meningkat pada setiap putaran penelitian. Lebih dari 50% siswa memperoleh nilai lebih tinggi dari KKM (75). Nilai rata-rata hasil karya siswa pada putaran ke 2 adalah 79,55. Itu berarti nilai kemampuan keseluruhan siswa telah lebih dari KKM. Dapat disimpulkan bahwa Comic Strips dapat meningkatkan kemampuan siswa dalam menulis sebuah paragraf deskriptif. Berdasarkan hasil penelitian ini, peneliti merekomendasikan kegunaan Comic Strips dalam proses pengajaran dan pembelajaran menulis sebuah paragraf deskriptif. Para peneliti selanjutnya disarankan untuk meneliti lebih lanjut kegunaan Comic Strips pada kelas yang berbeda, tingkat pendidikan yang berbeda, dan/atau jenis paragraf yang berbeda

Desain dan implementasi E-commerce pada UMKM produksi kerajinan rotan di Malang / Moh Thobroni M

 

Peningkatan pembelajaran IPA dengan model contextual teaching learning pada kelas V SDN Pisangcandi 3 kecamatan Sukun kota Malang / Sujono

 

Kata Kunci. model Contextual Teaching Learning , Pembelajaran IPA, SD. Pembelajaran IPA adalah suatu kegiatan membelajarkan siswa tentang ilmu pengetahuan yang tersusun secara sistematis dari hasil kegiatan siswa berupa fakta, konsep, prinsip dan teori tentang peristiwa alam sekirtar yang diperoleh melalui metode ilmiah. Berdasarkan pengamatan dilapangan kurang berhasilnya pembelajaran IPA disebabkan guru kurang melibatkan siswa dalam pembelajaran, sehingga siswa kurang aktif dan tidak termotivikasi untuk belajar.Terbukti dari hasil tes yang dilakukan diperoleh rata-rata nilai kelas 66,9 ada 7 siswa nilainya tidak sesuai SKKM serta 6 siswa yang sudah sesuai SKKM. Untuk mengatasi hal tersebut salah satunya dengan menggunakan model pembelajaran yang melibatkan siswa secara langsung. Model Contextual Teaching Learning merupakan model pembelajaran yang membuat siswa menghubungkan antara pengetahuan yang dimilikinya dengan kehidupan nyata, sehingga apa yang didapat siswa lebih bertahan lama dan siswa dapat menerapkannya dalam kehidupan sehari-hari. Penelitian ini bertujuan untuk mendeskripsikan (1) penerapan model Contextual Teaching Learning dalam pembelajaran IPA kelas V, (2) aktifitas belajar siswa, (3) peningkatan hasil belajar siswa.Subyek pemnelitian ini adalah guru dan siswa kelas V SDN Pisangcandi 3 Kecamatan Sukun Kota Malang sebanyak 13 siswa. Sedang intrumen yang digunakan adalah dokumentasi, lembar observasi, dan tes. Hasil penelitian ini menunjukkan bahwa model Contextual Teaching Learning dapat meningkatkan pembelajaran IPA kelas V SDN Pisangcandi 3 Kecamatan Sukun Kota Malang. Hal ini terjadi karena guru telah melakukan langkah-langkah Contextual Teaching Learning dengan baik . Untuk aktifitas siswa pada siklus I menunjukkan nilai 46,1. Sedangkan pada siklus II meningkat menjadi 58,2. Nilai rata-rata hasil belajar siswa meningkat mulai pada pra tindakan 66,9, siklus I 74,7 dan pada siklus II meningkat menjadi 75,0 Kesimpulan yang dapat diperoleh dari penelitian ini adalah: (1) penerapan model Contextual Teaching Learning telah dilaksanakan dengan baik, (2) meningkatkan aktifitas siswa, dan (3) meningkatkan hasil belajar siswa. Berdasarkan hasil penelitian disarankan: (1) guru dapat mengembangkan model pembelajaran Contextual Teaching Learning dalam pembelajaran IPA khususnya di kelas V, (2) Peneliti lainnya agar dapat mengembangkan penelitian ini di sekolah atau tempat yang lain agar mendapatkan temuan yang lebih komprehensif

Usaha-usaha lembaga sosial desa dalam pembangunan masyarakat desa di Desa Bakalan Kecamatan Bululawang Malang / oleh Aminah H. Abdullah

 

Pendidikan koperasi di SMEPN II Malang melatih ketrampilan bekerja / oleh Wahyuningwati R.

 

Pelaksanaan program pendidikan dasar kemasyarakatan di Desa Turirejo Kecamatan Lawang Kabupaten Malang / oleh Titin Sundari

 

Kegiatan penyuluhan koperasi desa dalam rangka pembangunan masyarakat desa di Desa Karangsari Kotamadya Daerah Tingkat II Blitar / oleh Mamiek Soeparmi

 

Study tentang pelaksanaan pendidikan kepramukaan di Lembaga Pemasyarakatan Khusus Anak Negara Blitar / oleh Irawati Retnaning Diyah

 

Pentingnya penggunaan alat peraga dalam pengajaran berhitung pecahan di sekolah dasar / oleh Ratna Shofiya Heryati

 

Peranan Pusat Koperasi Pegawai Negeri dalam meningkatkan kesejahteraan anggota di Kabupaten Blitar / oleh Endang Prasetyaningsih

 

Peranan PT. Bank Desa Selat di Kabupaten Buleleng Bali bagi masyarakat Desa Selat dan sekitarnya / oleh I. Made Nada

 

Peranan pendidikan moral dalam mengatasi kenakalan anak pada masa adolesence / oleh Jusuf Abdullah

 

The effectiveness of stand-up comedy on college students' speaking achievement / Joko Adi Saputro

 

ABSTRAK Saputro, Joko Adi. 2015. The Effectiveness of Stand-up Comedy on College Students’ Speaking Achievement. Tesis S2. Program Studi Pendidikan Bahasa Inggris, Pasca Sarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Arwijati W. Murdibjono, Dip.TESL, M.Pd. (II) Prof. A. Effendi Kadarisman, M.A., Ph.D. Kata kunci:Stand-up Comedy,Kemampuan berbicara mahasiswa Penelitian ini dilakukan guna menginvestigasi keefektifan stand-up comedy dalam meningkatkan kemampuan berbicara mahasiswa dalam pengajaran kelas public speaking pada mahasiswa semester empat jurusan Bahasa dan Sastra Inggris di Universitas Kanjuruhan Malang. Stand-up comedy ditawarkan untuk mengajar speaking khususnya untuk bisa berbicara di depan umum (Monolog) karena pada semester akhir mereka dituntut untuk mempresentasikan skripsi mereka. Pada akhirnya, hasil dari penelitian ini diharapkan bisa menjawab rumusan masalah yaitu apakah mahasisiwa bisa mendapatkan kemampuan berbicara lebih bagus setelah diajar dengan menggunakan stand-up comedy. Penelitian ini menggunakan model pre-experimental research design dengan pra-tes dan pasca-tes. Subjek penelitian adalah kelas reguler semester empat jurusan Bahasa dan Sastra Inggris. Terdapat dua puluh siswa pada kelas ini. Ada dua instrumen yang digunakan dalam penelitian ini. Siswa diberikan perlakuan dengan melalui beberapa prosedur antara lain persiapan (menulis jokes), pra-pertunjukan (menerima umpan balik), pertunjukan (berpengalaman pertunjukan langsung). Instrumen yang pertama adalah pra-tes dan pasca-tes yang digunakan untuk mengukur kemampuan berbicara mahasiswa sebelum dan sesudah perlakuan dan instrumen yang kedua adalah kuesioner yang digunakan untuk mengetahui pendapat mahasiswa tentang stand-up comedy agar menguatkan penghitungan statistik. Data dianalisis dengan menggunakan paired-sample t-testyang terdapat pada aplikasi SPSS 16.00 untuk menolak Nul Hypothesis dan menggunakan aplikasi Microsoft Excel untuk menghitung prosentase persepsi mahasiswa terhadap stand-up comedy. Hasil temuan menunjukkan bahwa kemampuan berbicara mahasiswa lebih bagus setelah diajar selama delapan pertemuan dengan stand-up comedy. Rata-rata dari nilai pra-tes adalah 49.91 sedangkan rata-rata dari pasca test adalah 64.35. Ini menunjukkan bahwa nilai dari pasca tes lebih tinggi dari pada nilai pra-tes. Hasil dari paired-sample t-test adalah -16.281. Ini berarti bahwa di bawah 0.05 (95%) yang berarti terdapat perbedaan significan antara nilai pra-tes dan pasca-tes. Selanjutnya, Prosentase kesuksesan berdasarkan kuesioner adalah 92%. Ini berarti bahwa mahasiswa senang menggunakan stand-up comedy dalam meningkatkan kemampuan berbicara mereka. Kesimpulannya adalah stand-up comedy efektif untuk mengajar kemampuan berbicara mahasiswa. Terakhir, penelitian ini bermanfaat untuk guru atau dosen dan peneliti berikutnya. Namun, untuk membuat stand-up comedy lebih memungkinkan dalam pelaksanaannya, ada beberapa saran yang disediakan. Untuk guru atau dosen, siapkan seluruh materi dengan hati-hati termasuk topik, video, dan materi untuk membuat lawakan; pastikan bahwa anda mengerti setiap langkah-langkah dalam mengajar speaking; dan motivasi mahasiswa untuk aktif dalam kegiatan. Untuk peneliti berikutnya, disarankan untuk menggunakan desain quasi-experiemental reserach untuk membandingkan stand-up comedy dengan teknik lainnya. Peneliti berikutnya juga bisa memberi tambahan variabel dalam penelitian mereka karena mahasiswa memiliki karakter yang berbeda-beda yang mungkin mempengaruhi kemampuan berbicara mereka.

Perbedaan tingkat self regulated learning antara kelas akselerasi dan kelas reguler siswa SMA Negeri di Kota Malang / Artiyan Dwiyana

 

ABSTRAK Dwiyana, Artiyan. 2015. Perbedaan Tingkat Self-Regulated Learning Antara Siswa Kelas Akselerasi Dan Siswa Kelas Reguler Siswa Sekolah Menengah Atas Di Kota Malang. Tesis. Bimbingan dan Konseling, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Muslihati, S.Ag, M.Pd. (II) Dr. Imanuel Hitipeuw, M.A. Kata kunci: Self-Regulated Learning, Kelas Akselerasi, Kelas Reguler Perbedaankemampuanbelajar siswapadaSekolahMenengahAtasmenghasilkanbentukpengelompokkankelas-kelasberdasarkanberbagaiaspek yang mendasarinya. Dalamhalini, kelasakselerasi di dominasiolehasumsi yang menyatakanbahwasiswa yang terdapatpadakelastersebutmerupakansiswa yang memilikikeunggulandalampengembanganregulasidirimerekadalambelajar, Kemampuan siswa dalammengatur diri padaaktivitas belajarnya (self-regulated learning)merupakanfaktorpenting yang mempengaruhi prestasi siswa. Penelitian ini bertujuan untuk mengetahui perbedaan tingkat self-regulated learningantara kelas akselerasi dan kelas reguler. Penelitian ini merupakan penelitian kausal komparatif/ex post factopada (6) enam Sekolah Menegah Atas di Kota Malang yang menyelenggarakan kelas Akselerasi.Jumlah populasi dan sampel siswa akselerasi adalah 85 orang dan siswa reguler adalah 181 orang. Teknik pengumpulan data menggunakan inventori self-regulated learning dan jurnal kegiatan siswa. Analisis data dilakukan dengan menggunakan metode Kruskal-Wallis dengan bantuan SPSS 20 for windows. Perhitungan diperoleh dengan membandingkan antara statistik hitung (1,713) lebih kecil daripada statistik tabel (3,841) dengan df = 1 dan signifikansi 5%dan berdasarkanasymptoticsignificance adalah 0,191 lebih besar dari probabilitas 0,05 maka diambil keputusan bahwa H0 diterima dan H1 ditolak. Disimpulkan bahwa tidak terdapat perbedaan self-regulated learning yang signifikan antara kelas akselerasi dan kelas reguler, atau dengan kata lain self-regulated learningantara kedua kelas tersebutdapat dikatakan sama. Hal ini dapat menjadi perhatian bagi sekolah dan guru bimbingan dan konseling dalampemberian layanan bimbingan belajar terhadap siswa, khususnya self-regulated learning. Sistem kredit semester dan metode pembelajaran blended learning pada jenjang SMA merupakan kesempatan untuk mendorong keberhasilan studi dengan waktu yang relatif singkat sesuai kemampuan, bakat dan minatnya

Planning pada bidang management personalia Biro Perencana Perum Perhutani Unit II di Malang / oleh Sulichatin

 

Pengembangan media gambar materi pelestarian lingkungan hidup untuk SMA/MA kelas XI / Farkhatul Layli

 

ABSTRAK Layli, Farkhatul. 2015. Pengembangan Media Gambar Materi Pelestarian Lingkungan Hidup untuk SMA/MA kelas XI. Tesis. Program Studi Pendidikan Geografi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Achmad Amirudin, M.Pd., (II) Prof. Dr. Budijanto, M.Sos. Kata kunci: pengembangan, media gambar, pelestarian lingkungan hidup Pelestarian lingkungan hidup merupakan materi yang harus dikuasai oleh siswa SMA/MA kelas XI. Materi tersebut memuat konsep-konsep abstrak dan konkrit yang akan lebih mudah dipahami oleh siswa jika menggunakan media gambar. Berdasarkan analisis yang dilakukan oleh peneliti, materi pelestarian lingkungan hidup memerlukan media gambar. Media gambar belum banyak digunakan oleh guru dan siswa dalam pembelajaran. Media gambar berfungsi sebagai alat bantu atau perantara untuk mempermudah penyampaian pesan, sehingga siswa dapat memahami materi dengan mudah. Kelebihan media gambar dalam pembelajaran yaitu, siswa mengingat materi lebih banyak dan dalam jangka waktu lama, menarik perhatian, menghubungkan siswa dengan dunia nyata tanpa harus mengunjungi lokasi sebenarnya, dan mampu mengatasi kesalahan konsep. Tujuan utama penelitian dan pengembangan ini yaitu untuk menghasilkan produk berupa media gambar pada Mata Pelajaran Geografi SMA Kelas XI Materi Pelestarian Lingkungan Hidup. Produk media gambar dikembangkan dengan mengadaptasi model Borg dan Gall menjadi delapan tahap, yaitu: (1) studi pendahuluan, (2) rencana desain pengembangan produk, (3) pengembangan produk awal, (4) validasi oleh ahli materi dan media, (5) revisi produk utama, (6) uji coba produk di lapangan, (7) revisi, dan (8) diseminasi. Hasil validasi menunjukkan bahwa dari aspek materi termasuk kategori ”baik” dan aspek media ”cukup baik”. Berdasarkan hasil validasi tersebut, produk ini layak untuk diuji coba setelah melakukan beberapa revisi. Hasil uji coba di lapangan menunjukkan bahwa tingkat kelayakan produk secara keseluruhan mencapai 87,59% (baik) dan tidak perlu dilakukan revisi. Persentase berdasarkan masing-masing aspek yaitu: gambar (87,45%), bahasa (87,24%), materi (87,59%), desain (88,05%). Nilai persentase tersebut termasuk dalam kategori baik sehingga media gambar yang telah dikembangkan ini layak digunakan sebagai media pembelajaran dan sumber belajar. Produk ini hanya berisi teks dan gambar, selain itu uji coba yang dilakukan hanya sebatas untuk mengetahui kelayakan produk. Beberapa saran yang dikemukakan untuk pengembangan dan penelitian lebih lanjut yang meliputi: (1) mengembangkan media dengan aplikasi lain yang mendukung tampilan full screen, audio dan animasi yang lebih baik, dan (2) melakukan penelitian eksperimen.

Metafora dalam puisi Gus Mus / Indah Permatahati

 

ABSTRAK Permatahati, Indah. 2015. MetaforadalamPuisi Gus Mus. Tesis. JurusanPendidikanBahasa Indonesia, Program PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. Hj. YuniPratiwi, M.Pd., (II) Dr. Roekhan, M.Pd. Kata kunci: metafora, puisi, penggunaan, fungsi Puisi-puisi Gus Musacapkalimengangkatfenomenakehidupan di pesantren.Budayawandancendekiawanmusliminimenuturkanpuisidenganmetafora yang menarikuntukditeliti.Fokuspenelitianmeliputiduahalyakni (1) penggunaanmetaforadalampuisi Gus Musdan (2) fungsipuisi Gus Mus. Penelitianinimenggunakanrancangankualitatif.Jenispenelitianiniadalahpenelitiananalisisdokumen.Data penelitianberupa unit-unit tekspuisi yang mengandungmetafora.Data penelitianinibersumberdaritekspuisi Gus Mus yang kemudiandianalisisberdasarkanteorimetafora.Sumber data dalampenelitianiniberupasepuluhpuisi Gus Mus, tigapuisidaribukukumpulanpuisi Gus MusberjudulPahlawandanTikus, tujuhpuisiyang diunduhdari internet.Kesepuluhjudulpuisitersebutadalah: Sujud, Cintamu, Ibu, Di NegeriAmplop, DalamKereta,TekaTeki,Akhirnya, KinilahSaatnyaBerterusTerang, GelombangGelapdanTahta.Kriteria yang digunakanuntukmenentukanpuisi yang dijadikansumber data yaitu (1) isipuisisesuaidenganfokuspenelitian, (2) puisimengandungmetafora yang dominan, dan (3) isipuisimemilikikorelasidenganfenomenasosialpadasaatpuisitersebutditulis. Hasilpenelitianmenunjukkanbahwametaforadalampuisi Gus Musdidominasiolehmetaforaimplisit.Unsur tenor dan vehicle yang tidakdisertakansecarasekaligusmenunjukkanbahwahal yang dibandingkandan yang digunakanuntukmembandingkandidapatkanolehpembaca di luartekspuisi.Hal inimendorongpembacauntukmenghubungkankaitanantara kata yang digunakanpenyairdenganunsur di luartekspuisi, sehinggaisipuisisangateratberhubungandenganaspek di luarpuisi.Unsur di luarpuisi yang dimaksudkanadalahlatarbelakangpenulispuisi, fenomena yang terjadisaatpenulisanpuisisertakondisimasyarakat yang adapadasaatitu.Hasilkeduadaripenelitianiniadalahtemuanbahwafungsipuisi Gus Musyakniuntuk: (1) menyatakankritik, (2) mengungkapkanperasaan, (3) menyatakanhujatan, (4) menyatakannasihat, (5) melakukanintrospeksi. Fungsipuisiuntukmenyatakankritikdiklasifikasikanmenjaditigasudutpandangyaknisudutpandang agama, psikologi, dansosial.Ketigasudutpandanginimemilikititiktekan yang berbeda. Berdasarkanhasilpenelitian, saran pertamaditujukankepadadosenpengampumatakuliahApresiasiPuisi agar menggunakanpuisi-puisi yang mengandungmetaforadenganjenismetafora yang beragam.Puisi Gus MusjugasangatdisarankanuntukdigunakandalampembelajaranmatakuliahApresiasiPuisi.Metaforaimplisit yang dominanpadapuisi-puisi Gus Musmendorongpembacauntuksenantiasamencarikorelasimaknatekstualdengankondisidanfaktordariluarteks. Hal iniakanmeningkatkandayakritisdankreativitasmahasiswa. Tekstidaksemata-matadipahamisecaraharfiah, tetapijugamemperhitungkanhubungan-hubungan lain di luartekstersebut; dan saran keduaditujukankepadapenelitisastrauntukmengembangkanpenelitianlebihlanjuttentangmetafora yang terkandungdalampuisipenyair yang lain. Karyasastra Gus Mus yang lain, misalnyapadacerpen-cerpen Gus Mus.

Motivasi belajar anak-anak di Petilasan Joyoboyo Desang Menang Kabupaten Kediri / Heny Wahyusi Pustanto

 

Abstrak Pustanto, Heny Wahyusi. 2015. Motivasi Belajar Anak-anak di Petilasan Joyoboyo Desa Menang Kabupaten Kediri. Tesis, Program Studi S2 Pendidikan Dasar Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof Dr. Hariyono, M.Pd., (II) Dr. Ach.Amirudin,M.Pd kata kunci : Motivasi Belajar, Petilasan Joyoboyo Penelitian ini bertujuan mendiskripsikan motivasi belajar anak-anak di Petilasan Joyoboyo Desa Menang Kabupaten Kediri. Penelitian ini menjelaskan tentang motivasi belajar anak-anak yang tinggal di sekitar petilasan Joyoboyo. Tepatnya di Desa Menang Kecamatan Pagu sekitar 12 km dari Kabupaten Kediri ada satu tempat yang dianggap sakral dan begitu diyakini penduduk sekitar sebagai tempat untuk berdoa dan meminta berkah atau pengharapan. Tempat itu dikenal dengan sebutan ”Petilasan Joyoboyo”. Anak-anak yang tinggal di sekitar petilasan melakukan kegiatan yang menurut peneliti tidak biasa dilakukan bila mereka mekakukan aktivitas belajar. Anak-anak lebih suka belajar di dalam lokasi Petilasan, daripada belajar di rumah. Anak-anak mempunyai keyakinan bahwa lokasi Petilasan Joyoboyo bisa memberi motivasi belajar bagi mereka. Penelitian ini menggunakan penelitian kualitatif mendiskripsikan tentang motivasi belajar anak-anak di petilasan Joyoboyo. Posisi peneliti sebagai peneliti sepenuhnya. Pertimbangan ini bertujuan untuk mendapatkan data penelitian yang murni dari objek data. Penelitian ini dilaksanakan di lokasi petilasan Joyoboyo, tepatnya Desa Menang kecamatan Pagu Kabupaten Kediri. Sekitar 12 km dari pusat kota Kediri. Data yang diperoleh dari penelitian berupa data fisik, data tertulis dan data lisan. Sumber data berupa semua komponen yang ada di lokasi petilasan Joyoboyo, dalam hal ini terdiri dari pengunjung lokasi petilasan Joyoboyo, yaitu anak anak yang belajar di lokasi Joyoboyo, beserta juru kunci sebagai orang yang bertanggungjawab terhadap petilasan Joyoboyo.Teknik pengumpulan data dengan menggunakan wawancara mendalam, dokumentasi, dan observasi. Analisis data diperoleh dari hasil wawancara, catatan lapangan, dan dokumentasi. Kesimpulan yang dapat diambil adalah sebagai berikut : Anak-anak yang tinggal di sekitar Petilasan Joyoboyo bisa berinteraksi dengan lingkungan sekitarnya dalam hal ini berinteraksi dengan lingkungan di Petilasan Joyoboyo. Dari hasil interaksi tersebut anak-anak termotifasi belajarnya. Sosok Joyoboyo adalah sumber inspirasi bagi anak-anak. Ia mampu mensugesti mereka untuk menjadi lebih baik lagi terutama tentang hasil belajar mereka. Menurut peneliti Lingkungan belajar yang kondusif di lokasi Petilasan Joyoboyo adalah faktor utama yang mendukung kegiatan belajar anak-anak yang ada di sekitar Petilasan Joyoboyo yaitu berupa sebuah lokasi religi yang nyaman, bersih dan sejuk sehingga mampu mendukung usaha belajar anak-anak di sekitar Petilasan Joyoboyo tersebut. Kegiatan belajar itu menjadi kebiasaan yang dilakukan anak-anak bahkan bisa mememotivasi belajar mereka menjadi lebih baik. Di samping pembiasaan dan anjuran dari Orang Tua tentang keyakinan dan kepercayaan kepada Eyang Joyoboyo tidak harus disalahartikan dengan hal yang negative. Hanya pelaksanaanya saja yang kadang kurang pas atau cenderung ke hal kemusrikan. Hal ini yang harus dirubah untuk tidak begitu mendasarkan sosok Joyoboyo sebagai penentu keputusan tetapi beliau ( Joyoboyo ) adalah hanya orang yang dianggap suci dan hanya sebagai perantara doa manusia kepada Tuhan. Bukan sebagai penentu nasib mnusia. Sebab hanya Tuhan yang bisa menjawab dan mengabulkan doa manusia. Penelitian ini hanya terbatas di sekitar lokasi Petilasan Joyoboyo saja. Oleh karena itu, bagi peneliti selanjutnya agar dapat mengembangkan hasil penelitian ini dengan sumber data yang berbeda guna memperkaya kajian ilmu di bidang pendidikan dasar ,khususnya mengenai motivasi belajar. Bagi anak-anak di sekitar Petilasan diharapkan untuk tetap melaksanakan kegiatan pembelajaran ini. Ternyata pembelajaran yang mereka lakukan sangat menarik dan bisa dikembangkan di dunia ilmu pendidikan. Bagi Guru bisa memahami bahwa lingkungan sekitar kita bisa memotivasi belajar anak-anak. .

Modelling of selected factors affecting students' listening comprehension / Yoga Purnama

 

ABSTRAK Purnama,Yoga. 2015. Modelling of Selected Factors Affecting Students’ Listening Comprehension. Thesis. English Language Teaching, Graduate Program of State University of Malang. Advisors: (I) Dr. Sri Rachmajanti, M.Pd., DipTESL., (II) Dr. Arwijati Wahjudi, M.Pd., DipTESL. Kata kunci: pola hubungan, kosa kata, schemata, strategi mendengarkan, EFL listening comprehension Secara umum penelitian ini bertujuan untuk mencari pola hubungan yang terbaik antara faktor-faktor yang terpilih seperti pengetahuan kosakata, latar belakang pengetahuan tentang topik wacana dan strategi mendengarkan, terhadap EFL listening comprehension. Selain itu, penelitian ini juga bertujuan untuk mencari kontribusi dari masing masing variabel. Penelitian ini mengguankan metode kuantitatif. Sumber data dalam penelitian ini adalah 106 mahasiswa jurusan Pendidikan Bahasa Inggris, Fakultas Keguruan dan Ilmu Pendidikan Universitas Muhammadiyah Surakarta. Ada dua instrument yang digunakan di dalam penelitian ini, yaitu dalam bentuk tes dan kuesioner. Tes digunakan untuk mengambil data dari variabel-variabel seperti pengetahuan kosakata, latar belakang pengetahuan tentang topik wacana, dan EFL listening comprehension. Sementara kuesioner digunakan untuk mengambil data tentang strategi mendengarkan. Semua data dalam penelitian ini dianalisis dengan menggunakan teknik regresi berganda melibatkan desain korelasi yang dikenal sebagai Analisis Jalur. Hasil penelitian menunjukkan bahwa (1) pola hubungan antara pengetahuan kosakata, latar belakang pengetahuan tentang topik wacana dan strategi mendengarkan terhadap EFL listening comprehension menyatakan bahwa pengetahuan kosakata menjadi satu-satunya variabel yang memiliki kontribusi signifikan terhadap EFL listening comprehension; (2) latar belakang pengetahuan tentang topik wacana dan strategi mendengarkan ditemukan tidak berkorelasi secara signifikan dengan EFL listening comprehension; (3) kontribusi total semua variabel dalam diagram jalur di dalam penelitian ini adalah 34,5% sedangkan residu dari diagram jalur adalah 65,5%; (4) dalam pola hubungan jalur, pengetahuan kosakata berkontribusi 46,9% untuk EFL listening comprehension, pengetahuan latar belakang tentang topik wacana 12,8%, dan strategi mendengarkan 13,9%; (5) kontribusi terbesar dalam diagram jalur berasal dari pengetahuan kosakata dimediasi oleh strategi mendengarkan yang berkontribusi 49,4% dari total nilai keseluruhan dan diikuti oleh jalur dari kontribusi langsung pengetahuan kosakata terhadap EFL listening comprehension yang berkontribusi 46,9% dari seluruh nilai total di dalam diagram jalur. Berdasarkan hasil yang diperoleh dalam penelitian ini,dapat disimpulkan bahwa satu satunya variabel yang memiliki kontribusi signifikan terhadap EFL listening comprehension adalah pengetahuan kosakata. Untuk penelitian di masa yang akan datang, disarankan bahwa variabel yang akan diteliti melibatkan variabel - variabel lain yang mungkin memiliki kontribusi lebih terhadap EFL listening comprehension termasuk faktor-faktor kognitif yang lain (seperti IQ dan language aptitude) dan faktor afektif (seperti emosi, self-esteem, empati, kecemasan, sikap, dan motivasi), karena residual yang ditemukan masih cukup tinggi dalam penelitian ini.

Developing an English speaking course syllabus for the non-English teachers of Pamerdi Christian School Malang / Mutiara Via Dolorosa

 

ABSTRAK Dolorosa, Mutiara Via. 2015. Pengembangan Silabus Kelas Speaking Bahasa Inggris untuk Guru Non-Bahasa Inggris di Sekolah Kristen Pamerdi Malang. Tesis. Program Pascasarjana, Program Studi Pendidikan Bahasa Inggris. Universitas Negeri Malang. Pembimbing: (I) Dr. Johannes A. Prayogo, M.Pd. M.Ed. (II) Dr. Arwijati Wahjudi, Dip. TESL, M.Pd. Kata kunci: pengembangan, kelas speaking, silabus, guru non-Bahasa Inggris Penelitian ini bertujuan untuk mengembangkan sebuah silabus bagi guru-guru non-Bahasa Inggris di Sekolah Kristen Pamerdi. Penelitian ini dilakukan untuk menyelesaikan permasalahan yang terjadi di Sekolah Kristen Pamerdi, yaitu tidak-adanya silabus di kelas English Speaking Course. Penelitian ini menerapkan prosedur Penelitian dan Pengembangan. Model pengembangan silabus yang digunakan untuk melaksanakan penelitian ini adalah Pengembangan Program Bahasa oleh Yalden (1987). Model ini mencakup beberapa tahap, yaitu: (1) analisis kebutuhan, (2) deskripsi tujuan, (3) pemilihan pengembangan tipe silabus, (4) pembuatan proto silabus, (5) pembuatan silabus pedagogi, dan (6) evaluasi yang mencakup validasi dari ahli dan tahap uji coba. Silabus dalam penelitian ini dikembangkan berdasarkan analisis kebutuhan yang dilaksanakan di Sekolah Kristen Pamerdi, melibatkan para guru anggota English Speaking Course, manajer sekolah, para kepala sekolah, bidang ahli, serta tutor pengajar kelas tersebut. Hal ini dilakukan dengan tujuan untuk memenuhi kebutuhan para pembelajar (anggota kelas English Speaking Course). Silabus ini merupakan silabus fungsional-situasional yang dikembangkan dengan pertimbangan bahwa tipe silabus ini sesuai dengan kebutuhan para pembelajar. Dalam penelitian ini, seorang ahli ditunjuk untuk membantu meningkatkan kualitas silabus. Silabus tersebut divalidasi dan diperbaiki kembali sehingga terjamin kualitasnya. Silabus ini memiliki beberapa detail, yakni: topik, kompetensi dasar, indikator, materi, aktivitas kelas, alokasi waktu, dan sistem penilaian yang dapat digunakan sebagai panduan bagi pengajar kelas dalam membuat rencana pembelajaran English Speaking Course. Silabus ini juga menawarkan sumber pembelajaran dan media untuk masing-masing topik. Silabus ini juga dilengkapi dengan contoh rencana pembelajaran. Tutor yang bersangkutan sangat disarankan menggunakan silabus ini sebagai panduan dalam proses mengajar kelas English Speaking Course. Silabus ini dapat diterapkan pula pada sekolah maupun institusi lain yang memberikan kelas speaking Bahasa Inggris bagi guru-gurunya. Untuk peneliti selanjutnya, yang membuat silabus dalam studi mereka, direkomendasikan untuk menggunakan tahap-tahap pengembangan silabus dari Yalden, sebab langkah pengembangannya cukup sistematis dan efektif, serta dapat menggunakan hasil penelitian sebagai bahan referensi.

Tinjauan tentang pembinaan jiwa Pancasila di sekolah dasar Sisir Kecamatan Batu Malang
oleh Diana Farida Is

 

Faktor-faktor yang mempengaruhi keputusan konsumen bergabung dengan jaringan multi level marketing (Studi kasus pada PT Network Bhakti Persada Cabang Malang) / oleh Ari Irawan

 

Fungsi pertunjukan "Purnama Seruling Penataran (PSP)" sebagai salah satu potensi wisata budaya Kabupaten Blitar dan esensi pendidikannya / Putri Wahyuningtias

 

Wahyuningtias,Putri. 2014. Fungsi Seni Pertunjukan “Purnama Seruling Penataran (PSP)” Sebagai Salah Satu Potensi Wisata Budaya Kabupaten Blitar dan Esensi Pendidikannya. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. Nur Hadi, M.Pd.,M.Si. (II) Drs. Marsudi, M.Hum Kata Kunci: seni pertunjukan, PSP, wisata budaya Purnama Seruling Penataran merupakan sebuah seni pertunjukan yang dilaksanakan di kompleks Candi Panataran di Desa Penataran Kecamatan Nglegok Kabupaten Blitar. Purnama Seruling Penataran berarti seni pertunjukan yang dilaksanakan di Candi Panataran dan pada malam bulan purnama. Seni pertunjukan ini merupakan wadah bagi berbagai macam kesenian, karena berbagai macam bentuk kesenian dimungkinkan bisa tampil dalam seni pertunjukan tersebut. Purnama Seruling Penataran merupakan agenda rutin yang dilaksanakan oleh Dewan Kesenian Kabupaten Blitar (DKKB). Permasalahan yang dikaji dalam penelitian ini adalah: 1) bagaimana sejarah seni pertunjukan Purnama Seruling Penataran; 2) bagaimana potensi seni pertunjukan Purnama Seruling Penataran sebagai salah satu wisata budaya Kabupaten Blitar; serta 3) bagaimana fungsi seni pertunjukan Purnama Seruling Penataran dalam kegiatan pelestarian Candi Panataran. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif untuk menjawab pertanyaan di atas. Dalam penelitian ini, peneliti bertindak sebagai instrumen utama. Pengumpulan data dilakukan dengan cara wawancara, observasi, dan dokumentasi. Untuk menentukan informan, peneliti menggunakan teknik snowball sampling. Dalam proses analisis data, peneliti menggunakan analisis data model Milles dan Hubberman, meliputi: pengumpulan data, reduksi data, penyajian data, serta verifikasi atau penarikan kesimpulan. Hasil penelitian dapat dikemukakan sebagai berikut : 1) Seni pertunjukan Purnama Seruling Penataran bermula dari percakapan Bapak Wima Brahmantya (Ketua Dewan Kesenian Kabupaten Blitar) dengan sahabatnya yang berasal dari Jakarta (Ray Sahetapi) pada saat mereka berada di Candi Panataran. Sahabat Bapak Wima Brahmantya yang merupakan seorang seniman itu menyarankan untuk mengadakan sebuah pertunjukan yang bisa membangkitkan spirit keNusantaraan. Bulan Oktober 2010 terlaksana pertunjukan malam 1000 seruling yang merupakan cikal bakal seni pertunjukan Purnama Seruling Penataran; 2) potensi dari seni pertunjukan Purnama Seruling Penataran antara lain: kemenarikan, karena dilaksanakan di Candi Panataran pada waktu bulan purnama; keunikan, karena dalam satu kali pelaksanaan menampilkan berbagai bentuk kesenian; kemudahan akses, seniman sudah disiapkan sejak satu bulan sebelum pertunjukan berlangsung; 3) fungsi seni pertunjukan Purnama Seruling Penataran dalam kegiatan pelestarian Candi Panataran adalah ikut berperan serta dalam kegiatan promosi wisata budaya yang terdapat di Kabupaten Blitar

Pembahasan metode berhitung pecahan di kelas III sekolah dasar / oleh Marsini

 

Peranan membaca dalam mengembangkan otodidak pada anak-anak SD
oleh Frater Yakobus Da Cunha

 

Pasar Kotamadya Malang ditinjau dari fungsinya sebagai sumber pendapatan Kotamadya Malang
oleh Bambang Sulistya

 

Pelaksanaan kerukunan sebagai sistim pendidikan dalam gerakan kepanduan Pramuka
oleh A. Manaf

 

Masalah Kredit Candak Kulak di Kecamatan Kandangan / oleh Giri Retnasih

 

Defragmenting struktur berpikir siswa melalui pemetaan kognitif berdasarkan gaya belajar untuk memperbaiki kesalahan siswa pada permasalahan lingkaran / A. Ali Syihabuddin

 

ABSTRAK Syihabuddin, A. Ali. 2015. Defragmenting StrukturBerpikirSiswaMelaluiPemetaanKognitifBerdasarkan Gaya BelajaruntukMemperbaikiKesalahanSiswapadaPermasalahanLingkaran. Tesis Program Studi Pendidikan Matematika, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Toto Nusantara, M.Si. dan(II) Dr. Abdul Qohar, MT. Kata Kunci : defragmenting, stuktur berpikir, pemetaankognitif, gayabelajar Penelitianinibertujuanuntukmemperbaikikesalahansiswadalammenyelesaikanpermasalahanlingkarandengancaradefragmentingstrukturberpikirsiswamelaluipemetaankognitif. Selainitu, mendeskripsikandefragmentingstrukturberpikirberdasarkangayabelajar yang dimilikiolehsiswadanmemperbaikikesalahansiswa. Kesalahansiswa yang dimaksudkanmerupakanjawabansalahsiswaketikamenyelesaikanmasalah yang diberikan, namundalamjawabansiswatersebutsudahmenuliskansebagianlangkah-langkahpenyelesaianmasalahdenganbenar. Defragmentingstrukturberpikirsiswamenggunakanstrategispatialyaitupenggunaanpetakognitif. Penelitianinimenggunakanpendekatankualitatifdeskriptifeksploratifdengansubyek yang diambildarisiswaMTs. Al IslahiyahSukobenduMantupLamongan. Cara mengukurgayabelajarsiswadenganVAK Learning-Style Self-Assessment Questionnaire proposed by Chislett and Chapman (2005). S1 dan S2 adalahsiswadengangayabelajar visual, siswacenderungmudahmemvisualkangambar yang adadalampemikirannya, namunkesalahan yang dilakukannyaadalahkesalahankonsepsegitigasehinggadefragmenting yang diberikanyaitu proses memberikan stimulus dengankomunikasiataulangkahsetiaptahapannya. Dan S3 dan S4 adalahsiswadengangayabelajarauditori, siswacenderungmembacasoaldantidakmudahdalammenvisualkangambar yang dipikirkannyasehingga proses defragmenting yang diberikanadalah proses untukmembantumenyelesaikanpermasalahandengancaramenggambarsecaraperlahansetiaptahapan. Sehinggasubyek visual memilikiciri, lebihmudahmenangkapbentukgambar, sulitmemahamisoalteksdankesalahancenderungpadapemahamansoal, makacaradefragmenting yang digunakanadalahmengulangmembacatekssoaldanmenuliskanlangkah-langkahdenganjelasdalammenyelesaikansoal. Sedangkansubyekauditorimemilikicirilebihmudahmembacasoalteksdansulitmemahamidanmegartikansoaldalamgambar, makacara defragmenting yang digunakanadalahmenuntunsiswamemahamisoaldenganmenyelesaikantahapandenganbantuangambar.

Ajaran moral dalam cerita anak-anak dan manfaatnya bagi pengajaran apresiasi sastra siswa Sekolah Dasar (SD)
oleh Alfiah Nurul Aini

 

Analisis muatan bahasa Indonesia dalam buku pelajaran kelas IV edisi revisi 2014 / Dina Ferisa

 

ABSTRAK Ferisa, Dina, 2015. Analisis Muatan Bahasa Indonesia dalam Buku Pelajaran Kelas IV Edisi Revisi 2014. Tesis. Program Studi Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang, Pembimbing (I) Prof. Dr. Sa’dun Akbar, M. Pd.; (II) Dr. Muakibatul Hasanah, M.Pd. Kata kunci : muatan Bahasa Indonesia, proporsi muatan, buku pelajaran Penelitian ini dilatarbelakangi permasalahan yang ditemukan pada buku pelajaran kelas IV. Permasalahan tersebut teridentifikasi setelah dilakukan studi awal terhadap buku pelajaran tema satu Indahnya Kebersamaan yang telah mendapat penilaian dari para ahli. Berdasarkan hasil identifikasi, permasalahan-permasalahan yang terdapat pada buku tersebut, khususnya dalam aspek kebahasaan, meliputi: pengabaian terhadap pencantuman tanda baca, nama pengarang dan sumber kutipan; ketidakseimbangan jumlah kalimat dalam wacana; dan penyajian bacaan yang berupa penggalan-penggalan. Berdasarkan latar belakang tersebut, penelitian berjudul Analisis Muatan Bahasa Indonesia (BI) dalam Buku Pelajaran Kelas IV Edisi Revisi 2014 ini dilaksanakan. Penelitian ini difokuskan pada buku pelajaran tema satu, yakni Indahnya Kebersamaan. Informasi yang ditelaah pada bagian tersebut mencakup: (1) aspek kebahasaan meliputi kata, kalimat, paragraf, dan wacana; (2) pengorganisasian bahan pembelajaran; (3) fungsi teks; (4) keterkaitan muatan BI dengan muatan lain; dan (5) proporsi muatan BI. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian noninteraktif berdasarkan kajian dokumen. Data penelitian yang menjadi bahan kajian adalah teks dalam buku pelajaran, tema satu. Prosedur pengumpulan data menggunakan kajian dokumentasi. Kegiatan analisis dan interpretasi dilakukan dengan memanfaatkan buku pelajaran dengan pertimbangan bahwa objek penelitian akan lebih dipahami dan dimaknai secara naratif. Pengecekan keabsahan data temuan dilakukan dengan pengecekan teman sejawat. Temuan penelitian ini meliputi: (1) aspek kebahasaan, (2) pengorganisasian bahan, (3) fungsi teks, (4) keterkaitan muatan BI dengan muatan lain, dan (5) proporsi muatan BI. Ciri aspek kebahasaan yang ditemukan meliputi: kata tunggal muncul secara dominan dibanding kata kompleks; kalimat tanya, perintah, dan berita juga muncul dalam jumlah cukup banyak; paragraf eksposisi lebih banyak ditemukan dan tidak ditemukan jenis paragraf deskripsi; jumlah kalimat dalam setiap paragraf dan jumlah kata dalam setiap kalimat yang tersaji tidak seimbang; ketersediaan teks nonsastra lebih banyak dibanding teks sastra; terdapat pengabaian pencantuman sumber, keengganan penulis mencari tulisan-tulisan para ahli; dan kecenderungan wacana yang ditampilkan berupa penggalan-penggalan. Pengorganisasian bahan belum memperlihatkan ketersajian pendekatan saintifik yang bertahap dengan lima pengalaman belajar pokok. Pengabaian ditemukan pencantuman tanda seru dalam pengorganisasian bahan yang tersaji. Dari segi fungsi, teks kurang memperlihatkan kegiatan pembelajaran berbasis teks sesuai tahap-tahap pembangunan teks mandiri. Keterkaitan muatan BI dengan muatan lain belum menyajikan panduan yang jelas dalam memperlihatkan tahap-tahap untuk melatih empat keterampilan berbahasa. Proporsi muatan BI melalui penghitungan porsi ideal dengan kemunculan muatan BI dalam buku sudah berlebih. Akan tetapi jika dilihat berdasarkan konten muatan, kedalaman materi BI yang disajikan dalam melatih empat keterampilan berbahasa masih belum proporsional. Secara keseluruhan, dari aspek kebahasaan, dapat dikatakan bahwa buku pelajaran kelas IV tema satu memiliki kualitas cukup baik. Dari segi pengorganisasian bahan pembelajaran, perlu pembenahan dan penekanan dalam mewujudkan proses pembelajaran yang tersaji atas lima pengalaman belajar pokok yang dirangkai mengikuti kegiatan secara bertahap dalam pendekatan pembelajaran saintifik. Penggunaan pembelajaran berbasis teks yang relevan dengan tahap-tahap yang jelas akan mewujudkan proses pembelajaran dengan menggunakan teks sesuai tujuan dalam berkomunikasi. Muatan BI berfungsi mendistribusikan pengetahuan yang didasari oleh upaya melatihkan empat keterampilan berbahasa. Panduan yang relevan dalam melatihkan empat keterampilan berbahasa tersebut akan mewujudkan pembelajaran tematik. Pembahasan mengenai proporsi muatan BI masih perlu ditinjau ulang, khususnya pada aspek kebahasaan, pengorganisasian bahan pembelajaran, fungsi teks, dan keterkaitan muatan BI dengan muatan lain. Muatan BI yang menjadi muatan utama perlu dikaitkan dengan keberhasilan muatan lain dalam mendorong siswa untuk melatih keterampilan berbahasa. Penulis buku dan penyusun kurikulum hendaknya mencermati hasil perumusan muatan BI yang tersaji dalam buku pelajaran kelas IV tema satu secara berulang. Hal tersebut akan meminimalisasi tingkat kesalahan substansial atau teknis. Selain itu, penyediaan wacana yang lebih variatif dan penggunaan media audio untuk melatihkan keterampilan membaca dan menyimak sangat dibutuhkan. Pencantuman sumber kutipan secara taat asas juga sangat dibutuhkan sebagai rambu kedisiplinan dalam menghindari tindak plagiat.

Pengembangan buku ajar materi Human Genom Project (HGP) pada mata kuliah Bioteknologi dalam rangka meningkatkan hasil belajar mahasiswa Prodi Pendidikan Biologi Universitas Negeri Malang / Hijrah Sudrajat

 

ABSTRAK Sudrajat, Hijrah. 2015. Pengembangan Bukun Ajar Materi Human Genom Project (HGP) pada Mata Kuliah Bioteknologi dalam Rangka Meningkatkan Hasil Belajar Mahasiswa Prodi Pendidikan Biologi Universitas Negeri Malang. Tesis. Program Studi Pendidikan Biologi, Pascasarjana, Universitas Negeri Malang. Pembimbing (1) Pembimbing: (1) Dr. H. Istamar Syamsuri, M.Pd, dan, (2) Prof. Dr. Siti Zubaidah, M.Pd. Kata Kunci: pengembangan, buku ajar, human genome project (HGP), hasil belajar. Human Genom Project (HGP) merupakan proyek yang dikoordinasikan oleh Departemen of Energy (DOE) and the National Institutes of Health USA (NIH). HGP dimulai pada tahun 1990 dan selesai pada tahun 2003. Tujuannya adalah untuk menentukan urutan lengkap dari 3 miliar subunit DNA, mengidentifikasi seluruh gen manusia, membuatnya dapat diakses lebih jauh untuk kepentingan penelitian Biologi, dan mempelajari berbagai dampak sosial, etis, bahkan dampak politis yang timbul dari pemetaan yang dilakukan. Hasil angket mahasiswa dan wawancara yang dilakukan pada dosen Universitas Negeri Malang menyatakan kekurangan sumber belajar yang memuat materi HGP. Hal tersebut diperlukan adanya pengembangan bahan ajar HGP yang mampu menunjang pekuliahan dan sesuai dengan karakteristik mahasiswa. Tujuan penelitian pengembangan ini adalah untuk menghasilkan produk berupa buku ajar Human Genom Project (HGP) pada matakuliah Bioteknologi yang layak dan efektif untuk mahasiswa Prodi Pendidikan Biologi Universitas Negeri Malang. Buku ajar disusun dan dikembangkan dengan mengadaptasi 4 langkah model pengembanganThiagarajan (1974). Langkah pertama dengan melakukan (1) define, dengan menganalisis kebutuhan di lapangan dilihat dari SK-KD, mahasiswa, tugas dan konsep, (2) design, dengan membuat prototipe buku ajar yang dibagi menjadi 3 bagian utama meliputi bagian awal, bagian inti, dan bagian penutup, (3) develop, dengan melakukan validasi buku ajar oleh ahli materi, ahli media dan ahli bahasa, serta (4) disseminate, dengan melakukan kegiatan uji coba kelompok kecil dan uji lapangan. Tahapan uji coba kelompok kecil dilakukan pada 9 orang mahasiswa semester VIII dan uji lapangan dilakukan pada 25 orang mahasiswa semester VI, yang semuanya dilakukan di Universitas Negeri Malang. Hasil uji validasi ahli materi menunjukkan rata-rata persentase keseluruhan produk yaitu sebesar 83,7% termasuk kriteria sangat layak dan tidak perlu direvisi. Hasil uji validasi ahli media menunjukkan rata-rata persentase keseluruhan produk sebesar 71% termasuk kriteria layak dan tidak perlu direvisi. Hasil uji validasi ahli bahasa menunjukkan rata-rata persentase keseluruhan produk sebesar 79,19% termasuk kriteria layak dan tidak perlu direvisi. Hasil uji coba kelompok kecil rata-rata 78,2% termasuk kriteria layak dan tidak perlu direvisi. Hasil uji validasi digunakan sebagai dasar tindakan revisi sebelum pelaksanaan uji lapangan. Uji lapangan dilakukan dengan melakukan pembelajaran dikelas yang diakhiri dengan tes uji kompetensi. Hasil belajar dari 25 orang mahasiswa memiliki nilai rata-rata kelas sebesar 74,84 dan persentase perolehan nilai ≥70 sebesar 76 %. Uji coba produk dianggap berhasil jika lebih dari 75% mahasiswa memperoleh nilai minimal 70. Berdasarkan hasil penelitian tersebut, dapat dikemukakan saran sebagai berikut (1) Buku ajar matakuliah Bioteknologi materi HGP dapat digunakan sebagai sumber belajar selama pelaksanaan perkuliahan Bioteknologi. (2)Buku ajar matakuliah Bioteknologi materi HGP dapat digunakan dalam proses pembelajaran untuk meningkatkan hasil belajar berupa kognitif, afektif, dan psikomotor karena dilengkapi dengan kegiatan mahasiswa berupa praktikum. (3) Aspek kebahasaan harus diperhatikan karena merupakan salah satu elemen penting yang dapat memberikan kemudahan bagi pengguna buku ajar untuk memahami materi yang disampaikan.

Pengembangan media pembelajaran berbasis E-Learning pokok bahasan budidaya jamur tiram pada siswa SMK Negeri 1 Tulungagung Program Keahlian Pertanian / Qurrotul Fuaddiyah

 

Kata kunci: perkembangan TIK, web, e-learning, budidaya jamur tiram Perkembangan TIK beberapa tahun belakangan ini berkembang pesat, sehingga dengan perkembangan ini telah mengubah paradigma masyarakat dalam mendapatkan informasi. Perkembangan TIK juga berdampak ke segala bidang kehidupan, termasuk dalam dunia pendidikan. Selaras dengan perkembangan ilmu pengetahuan dan teknologi, maka lembaga pendidikan harus mampu mengembangkan media pembelajaran secara bervariasi. Sebuah media pembelajaran mempunyai peranan yang sangat penting dalam proses pembelajaran, karena media pembelajaran merupakan wahana penyalur atau wadah pembelajaran. Di samping dapat menarik perhatian siswa, media pembelajaran juga dapat memudahkan siswa dalam memahami suatu penyampaian pesan. Salah satu media pembelajaran yang berkembang pesat saat ini adalah teknologi internet yang wujudnya berupa web. Informasi yang disimpan di web senantiasa dapat diperbaharui, web page mengandung bahan yang bersifat rangsangan yang tampil pada parameter fisik suatu media, dan merupakan kemampuan web page itu sendiri untuk mempertunjukkan suatu objek dalam gerak, objek dalam warna dan visualisasi yang memungkinkan terjadinya rangsangan penglihatan dan rangsangan pendengaran. Seiring dengan teknologi yang berkembang saat ini, maka peneliti mengembangkan media pembelajaran berbasis e-learning pokok bahasan budidaya jamur tiram pada siswa SMK Jurusan Pertanian. Model pengembangan yang digunakan dalam penelitian ini adalah model pengembangan yang dilakukan oleh Abidin dan Sadiman, karena sesuai dengan tahapan pengembangan media pembelajaran budidaya jamur tiram dan kemudahan dalam kegiatan validasi (konsultasi ahli media, ahli materi dan peserta didik). Model pengembangan ini terdiri dari: analisis kebutuhan, analisis tujuan, mengembangkan materi, menyusun naskah, produksi, menyusun petunjuk pemanfaatan, validasi dan revisi. Media pembelajaran yang dihasilkan memiliki fasilitas-fasilitas antara lain: modul yang berupa teks berbentuk portable document format (PDF), foto, audio-video dengan ekstensi FLV, forum diskusi, chat dan lain-lain. Sumber belajar ini dapat diakses secara online melalui internet dan modul yang disediakan dapat di-download secara langsung. Pengambilan data validasi dalam sumber belajar ini digali dengan menggunakan instrumen berupa angket yang dilakukan terhadap 3 subjek yaitu: ahli media, ahli materi dan peserta didik dari siswa SMK Jurusan Pertanian. Hasil uji coba produk yang dilakukan terhadap 3 subjek tersebut adalah sebagai berikut: ahli media menyatakan produk ini layak dengan persentase 89%, ahli materi menyatakan produk ini layak dengan persentase 80,63%, dan peserta didik menyatakan produk ini layak dengan persentase 83,06%.

Penerapan model pembelajaran laboratori untuk meningkatkan hasil belajar menjahit pengembvangan diri SMP Islam 02 Pujon / Yuliani

 

Kata Kunci : Laboratori, Sistem kelompok, Hasil belajar menjahit Pendidikan adalah usaha sadar dan terencana untuk mewujutkan suasana belajar dan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan spiritual, keagamaan, pengendalian diri, kepribadian, kecerdasan, akhlak mulia, serta keterampilan yang diperlukan dirinya, masyarakat, bangsa dan Negara. Untuk mencapai itu semua, guru mempunyai peran yang sangat penting terhadap keberhasilan peserta didiknya. Berdasarkan observasi yang dilakukan peneliti dengan guru pembimbing ekstrakurikuler menjahit di SMP Islam 02 Pujon, diperoleh informasi bahwa pembelajaran yang dilaksanakan di kelas pengembangan diri menjahit masih belum maksimal. Hal ini dapat dilihat dari hasil menjahit siswa pengembangan diri menjahit pada semester pertama yang rata-rata masih dibawah SKBM (Standar Ketuntasan Belajar Minimum). Melihat kondisi ini, maka diperlukan suatu metode pembelajaran yang tepat, sehingga dapat meningkatkan hasil belajar siswa. Metode pembelajaran laboratori sistem kelompok dapat dijadikan sebagai salah satu alternatif pembelajaran yang dapat digunakan untuk meningkatkan hasil menjahit siswa. Model pembelajaran ini mengajak siswa untuk berhadapan langsung dengan material bahan dan praktik. Kegiatan ini juga menuntut siswa untuk melakukan latihan dan bekerja sama dengan sistem kelompok. Penelitian ini bertujuan untuk mendiskripsikan penerapan metode pembelajaran laboratori sistem kelompok dalam upaya untuk meningkatkan hasil belajar menjahit siswa pengembangan diri menjahit SMP Islan 02 Pujon tahun pelajaran 2010-2011 Penelitian ini menggunakan pendekatan deskriptif, karena peneliti lebih banyak mengumpulkan data baik dalam bentuk data kualitatif maupun data kuantitatif. Jenis penelitian yang peneliti lakukan adalah penelitian tindakan kelas, dengan subyek siswa kelas pengembangan diri menjahit SMP Islam 02 Pujon. Teknik pengumpulan data yang dilakukan peneliti adalah: (1). Observasi, digunakan untuk mengamati aktivitas guru dan siswa selam proses pembelajaran berlangsung, (2). Catatan lapangan, digunakan untuk melengkapi data yang tidak tercantum dalam lembar observasi, (3). Hasil tes praktik, untuk mengetahui tes siklus akhir siswa. Data dalam penelitian ini terbagi menjadi dua jenis, yaitu data kualitatif dan data kuantitatif. Data kuantitatif dianalisis dengan mencari nilai rata- rata dan presentasinya. Data kualitatif dianalisis menggunakan teknik analisis data yang terdiri dari mereduksi data, menyajikan data dan penarikan kesimpulan. Hasil penelitian pada siklus I, antara lain adalah : (1). Presentase keberhasilan aktivitas kegiatan kelompok pertemuan pertama mencapai 73,2 %, sedangkan pada pertemuan kedua 79,7 %. (2). Presentase keberhasilan Pengelolaan pembelajaran guru pada pertemuan pertama 83,3% sedangkan pada pertemuan kedua 89%. (3). Nilai rata-rata kelas 73,39. Hasil analisis data pada siklus I ini menunjukkan bahwa hasil pelaksanaan siklus I masih banyak kekurangan. Adapun hasil penelitian pada siklus II, antara lain adalah (1). Presentase keberhasilan aktivitas kegiatan kelompok mencapai 89.28 %, (2). Presentase keberhasilan pengelolaan pembelajaran guru 96,87% . (3). Nilai rata- rata kelas 80,17. Hasil analisis data pada siklus II sudah mencapai SKBM (standar Ketuntasan Belajar Minimum) ini berarti pelaksanaan pada tindakan II telah cukup baik. Hasil analisis siklus III memperoleh jasil antara lain adalah, (1). Presentase keberhasilan aktivitas kegiatan kelompok 91,66 %, (2). Presentase keberhasilan pengelolaan pembelajaran guru 98,95%.(3). Nilai rata-rata kelas 90.28. Hal ini berarti pelaksanaan pada tindakan III telah sangat baik. Berdasarkan hasil analisis data ketiga siklus tersebut, terlihat bahwa hasil pelaksanaan tindakan pada siklus II dan III mengalami peningkatan biladibandingkan pada siklus I. Hal ini menunjukkan bahwa penerapan motode laboratori sistim kelompok dapat meningkatkan hasil belajar menjahit siswa pengembangan diri menjahit SMP Islam 02 Pujon Tahun ajaran 2010-2011.

Penerapan model pembelajaran TGT (Teams Games Tournament) pada materi menganalisis pemanfaatan dan pelestarian lingkungan hidup untuk meningkatkan hasil belajar siswa kelas XI IPS 2 SMA "Islam" Malang / Ike Dwi Agustina

 

Kata Kunci: Hasil belajar siswa, TGT (Teams Games Tournament) Pembelajaran di kelas XI IPS 2 SMA “ISLAM” Malang cenderung didominasi oleh guru (pembelajaran konvensional). Siswa kurang antusias dalam pembelajaran, siswa asik bermain sendiri ketika pembelajaran berlangsung. Hal itu menyebabkan proses belajar belum tercapai secara optimal. Hal itu terlihat dari hasil belajar siswa dengan nilai rata-rata ulangan harian yang dicapai siswa sebelum tindakan kelas, yaitu 74 dengan jumlah siswa yang tuntas sebanyak 44%. Jumlah ketuntasan belajar siswa itu kurang dari standar SKM untuk mata pelajaran Geografi sebesar > 75 dan ketuntasan belajar klasikalnya sebesar > 85%. Hasil belajar tersebut perlu diperbaiki dengan menerapkan model pembelajaran TGT, karena model ini mengajak siswa untuk lebih aktif dan model ini tidak hanya mengajak siswa belajar tetapi juga bermain, diharapkan siswa bisa memahami materi lebih mendalam, dan hasil belajarnya meningkat. Penelitian ini bertujuan untuk mengetahui peningkatan hasil belajar siswa pada mata pelajaran geografi kelas XI IPS 2 SMA “ISLAM” Malang dengan menerapkan model pembelajaran TGT dengan tipe model pembelajaran Talking Stick. Rancangan penelitian yang digunakan adalah penelitian tindakan kelas yang dilakukan sebanyak 2 siklus yang dilaksanakan pada bulan Pebruari. Subjek penelitian ini yaitu siswa kelas XI IPS 2 sebanyak 34 siswa. Instrumen pengumpulan data melalui tes tiap akhir siklus. Hasil penelitian menunjukkan adanya peningkatan hasil belajar siswa setelah menerapkan model pembelaran TGT. Peningkatan hasil belajar siswa sebesar 20.59% dari jumlah keseluruhan siswa, dengan rata-rata nilai hasil belajar sebesar 7.2.

Pelaksanaan pembelajaran di Pondok Pesantren Salafiyah Bahrul Muhtadin Kota Batu dalam membentuk kepribadian santri / Zefri Prasetyo

 

Kata Kunci: Pembelajaran Pesantren, Kepribadian Pesantren merupakan lembaga non formal yang tumbuh dari dan dalam masyarakat untuk melayani berbagai kebutuhan masyarakat. Pesantren tidak hanya dijadikan sebagai lembaga ilmu keagamaan belaka, akan tetapi pesantren adalah satu kesatuan integral yang tidak dapat lepas dari realitas obyektif agar mampu menjawab tantangan zaman. Kepribadian santri merupakan tujuan utama dari pesantren. Para ulama’ sepakat bahwa moralitas seorang santri menduduki ranking teratas mengungguli kompetensi keilmuannya. Dalam hal ini kepribadian/akhlak dikedepankan sampai-sampai mengalahkan kedalaman ilmu. Tujuan dilaksanakan penelitian ini adalah untuk medeskripsikan bentuk-bentuk pembelajaran pondok pesantren salafiyah Bahrul Muhtadin, pelaksanaan pembelajaran pondok pesantren salafiyah Bahrul Muhtadin, serta mendeskripsikan pelaksanaan pembelajaran pondok pesantren salafiyah Bahrul Muhtadin dalam membentuk kepribadian santri. Rancangan penelitian ini menggunakan metode penelitian deskriptif kualitatif. Pengumpulan data dilakukan melalui teknik wawancara, observasi, dan studi dokumen. Penelitian pelaksanaan pembelajaran di pondok pesantren salafiyah bahrul muhtadin kota batu dalam membentuk kepribadian santri. Penelitian dilakukan di pondok pesantren salafiyah Bahrul Muhtadin Kota Batu. Sumber data dalam penelitian ini adalah masyarakat pesantren Bahrul Muhtadin Kota Batu. Analisis data hasil penelitian dilakukan dengan reduksi data, penyajian data dan penarikan kesimpulan (verivikasi). Hasil Penelitian menunjukkan: (1) Bentuk-bentuk pembelajaran di Pondok Pesantren Salafiyah Bahrul Muhtadin dibagi menjadi beberapa macam diantaranya Madrasah Diniyah, Pengkajian kitab kuning, dan Toriqoh Qodiriyah wanaqsyabandiyah. Pembelajaran Pondok Pesantren Bahrul Muhtadin menggunakan sistem belajar mengajar tradisional dengan pengajian kitab secara bandongan atau sorogan kepada bapak Kyai dan ustadz dan menggunakan paduan kitab-kitab kuning salaf karya para ulama' terdahulu, baik dalam bidang tauhid, fiqih, bahasa, maupun tasawuf. (2). Pelaksanaan pembelajaran di pondok pesantren Bahrul Muhtadin dimulai sejak subuh hingga malam hari. secara garis besar Kegiatan tersebut dilaksanakan berdasarkan programnya. Unsur-unsur Pelaksanaan Pembelajaran Pondok Pesantren Salafiyah Bahrul Muhtadin meliputi beberapa aspek antara lain : waktu pelaksanaan, kurikulum pembelajaran, metode pembelajaran, dan evaluasi. (3).Dalam rangka membentuk kepribadian santri Pesantren Bahrul Muhtadin menerapkan beberapa hal antara lain pemahaman santri terhadap materi yang diajarkan, pembiasaan hidup bermoral, dan penerapan disiplin melalui tata tertib. Berdasarkan hasil penelitian di atas maka saran yang dapat disampaikan adalah: (1) Pengasuh Pesantren hendaknya memberikan program ketrampilan agar santri mempunyai bekal lebih. (2) Dalam kurikulum pembelajaran sebaiknya dimasukkan pengetahuan umum. (3) Dalam pelaksanaan pembelajaran hendaknya ustadz lebih variatif lagi dalam menggunakan metode pembelajaran. (4)Hendaknya dalam proses pembelajaran ustadz menambah media pembelajaran. (5)Hendaknya santri selalu fokus dalam menempuh pembelajaran dan selalu menaati tata tertib pesantren.

Keefektifan bibliokonseling untuk meningkatkan kesadaran menghargai orang lain bagi siswa SMP / Iswarianti

 

Kata kunci: keefektifan, bibliokonseling, kesadaran menghargai orang lain Bimbingan dan konseling memiliki peranan penting dalam perkembangan siswa. Guru BK atau konselor merupakan salah satu tenaga kependidikan di sekolah yang mempunyai tugas untuk memperhatikan perkembangan psikologi siswa. Salah satu perkembangan psikologi siswa yang harus dikembangkan adalah yang berkaitan dengan pendidikan karakter. Salah satu karakter yang harus dikembangkan dalam diri siswa adalah menghargai orang lain dengan cara menumbuhkan kesadarannya. Teknik bimbingan yang dapat dilakukan untuk meningkatkan kesadaran menghargai orang lain untuk siswa SMP adalah dengan teknik Bibliokonseling. Dari pengamatan yang dilakukan pada siswa SMP, menunjukkan bahwa siswa SMP memiliki kesadaran menghargai orang lain pada tingkat yang rendah dan sedang. Hal ini ditunjukkan dengan adanya perkelahian antar pelajar, tidak menghormati guru, atau kurang memahami orang yang ada di sekelilingnya, dan masih banyak peristiwa yang lainnya. Tujuan penelitian ini untuk melihat keefektifan bibliokonseling untuk meningkatkan kesadaran menghargai orang lain bagi siswa SMP. Penelitian ini dilakukan di salah satu SMP yang berada di kabupaten Malang.Jenis penelitian yang digunakan adalah eksperimen semu dengan one group pretest posttest design dengan rancangan satu kelompok subyek yang berjumlah 12 siswa tanpa kelompok kontrol. Pengukuran dilakukan pada saat sebelum dan sesudah pemberian treatmen. Instrumen yang digunakan adalah skala kesadaran menghargai orang lain. Treatmen dilakukan dengan teknik bibliokonseling dengan menggunakan media cerpen. Analisis data dalam penelitian ini menggunakan uji wilcoxon. Hasil penelitian setelah dilakukan treatmen sebanyak delapan kali dan pengukuran pretest dan posttest, siswa menunjukkan adanya perubahan skor dari kategori sedang menjadi tinggi. Hal ini dapat disimpulkan bahwa bibliokonseling efektif untuk meningkatkan kesadaran menghargai orang lain yang dapat dilihat dari Zhitung > Ztabel atau –Zhitung < -Ztabel sebesar -3.066>-1,96 atau dapat dilihat dari nilai probabilitas dibawah 0.05 (0.001<0.05). Atas dasar temuan penelitian ini, disarankan bagi konselor dalam melaksanakan kegiatan bimbingan dapat menggunakan media ini dalam meningkatkan kesadaran menghargai orang lain pada siswa SMP.Bagi peneliti selanjutnya, bilamana memandang perlu melakukan penelitian sejenis maka disarankan untuk menambah jenis media yang diberikan dalam bibliokonseling, dan juga disarankan untuk menggunakan kelompok kontrol yang tidak diberikan perlakuan agar teknik bibliokonseling lebih dapat diketahui keefektifannya.

Perbedaan perpaduan model pembelajaran kooperatif tipe Teams Games Tournament (TGT) dan strategi problem posing dengan model pembelajaran konvensional terhadap hasil belajar siswa kelas VII pada mata pelajaran IPS terpadu (ekonomi) di SMP Negeri 13 Malang / Eko Arif Wib

 

Kata Kunci: Model Pembelajaran Teams Games Tournament (TGT) dengan Problem Posing, Hasil Belajar Ekonomi Metode pembelajaran yang diterapkan di SMPN 13 Malang adalah metode konvensional. Dalam menggunakan metode konvensional guru lebih mendominasi kegiatan pembelajaran sehingga siswa cenderung pasif dan kurang termotivasi. Hal ini mengakibatkan hasil belajar siswa kurang memuaskan. Salah satu metode pembelajaran yang bisa digunakan guru dalam upaya meningkatkan hasil belajar siswa adalah metode pembelajaran kooperatif model Teams Games Tournament (TGT) dengan problem posing. Tujuan dari penelitian ini adalah untuk mengetahui perbedaan hasil belajar siswa yang menggunakan perpaduan model pembelajaran kooperatif tipe Teams Games Tournament (TGT) dan strategi problem posing dengan yang menggunakan model pembelajaran konvensional pada mata pelajaran ekonomi di SMP Negeri 13 malang. Penelitian ini merupakan penelitian kuasi eksperimen. Penelitian ini dilakukan di SMPN 13 Malang, yang berlangsung selama dua kali pertemuan dengan pokok bahasan Gagasan Kreatif Dalam Tindakan Ekonomi. Subjek penelitian ini adalah siswa kelas VII A sebagai kelas eksperimen yang di ajar menggunakan model TGT dengan problem posing, dan siswa kelas VII B sebagai kelas kontrol yang diajar dengan model konvensional. Teknik pengumpulan data melalui tes (pre-test dan post-test). Data yang dianalisis dalam penelitian ini adalah data hasil belajar. Analisis data hasil belajar dilakukan dengan menggunakan uji normalitas, uji homogenitas varian, uji kesamaan rata-rata, dan uji hipotesis. Hasil penelitian menunjukkan terdapat perbedaan yang signifikan antara hasil belajar siswa kelas VII yang diajar menggunakan model pembelajaran TGT dengan problem posing dan model pembelajaran konvensional pada materi Gagasan Kreatif Dalam Tindakan Ekonomi. Berdasarkan hasil penelitian disimpulkan terdapat perbedaan hasil belajar siswa untuk mata pelajaran ekonomi pada pembelajaran model TGT (Teams Games Tournament) dengan problem posing dan konvensional. Di mana penggunaan metode pembelajaran kooperatif model TGT (Teams Games Tournament) dengan problem posing di SMPN 13 Malang lebih baik dalam meningkatkan hasil belajar siswa kelas VII pada mata pelajaran ekonomi dibandingkan dengan penggunaan model konvensional. Saran sebagai berikut: 1) Guru mata pelajaran ekonomi diharapkan dapat menerapkan model pembelajaran Teams Games Tournament (TGT) dengan strategi problem posing sebagai salah satu alternatif pilihan dalam praktik pembelajaran untuk meningkatkan hasil belajar siswa, serta dapat mengalokasikan waktu dengan sebaik mungkin agar iii tujuan pembelajaran dapat tercapai, 2) Sekolah SMPN 13 Malang diharapkan dapat menyediakan sarana dan prasarana yang lengkap untuk mendukung efektifitas pembelajaran model Teams Games Tournament (TGT) dengan strategi problem posing, seperti bahan ajar, sebagai buku pegangan siswa agar mereka dapat belajar dengan baik, tidak hanya mengandalkan catatan yang setiap kali pertemuan ditulis di papan tulis, 3) Bagi peneliti selanjutnya diharapkan lebih mampu mengembangkan hasil penelitian ini, dengan materi yang berbeda dan sebaiknya dilakukan dengan waktu yang cukup sehingga diperoleh hasil yang maksimal, serta penelitian ini digunakan sebagai acuan, landasan atau bahan literatur untuk penelitian lebih lanjut.

Efektivitas permainan outbond untuk meningkatkan keterampilan sosial siswa sekolah menengah pertama / Rezha Mukti Prabowo

 

Kata Kunci: permainan outbound, keterampilan sosial, siswa Sekolah Menengah Pertama Keterampilan sosial adalah kemampuan individu untuk berkomunikasi efektif dengan orang lain, baik secara verbal maupun nonverbal sesuai dengan situasi dan kondisi yang ada pada saat itu. Keterampilan tersebut merupakan keterampilan yang dipelajari. Salah satu upaya untuk meningkatkan keterampilan sosial pada siswa Sekolah Menengah Pertama ( SMP) ialah outbound training yaitu sebuah pelatihan di tempat terbuka (outdoor) yang menggunakan metode belajar dari pengalaman secara terstruktur (experience learning cycle method). Tujuan dari permainan outbound ialah untuk melatih keterampilan sosial siswa diantaranya melatih pengenalan dan membangun kepercayaan dengan individu lain, komunikasi secara tepat dan jelas dengan individu lain, mampu menerima dan membantu individu lain serta pengatasan konflik dan masalah-masalah dalam hubungan sosial. Penelitian ini bertujuan untuk mengetahui efektivitas permainan outbound untuk meningkatkan keterampilan sosial. Penelitian ini berpijak pada penelitian sebelumnya yang dilakukan oleh Wahid (2010) mengenai “Pengembangan Permainan outbound untuk Melatih Keterampilan Sosial Siswa SMP”. Penelitian tersebut hanya berterima secara teoritik, belum melalui uji lapangan untuk mengetahui efektivitas permainan outbound dalam meningkatkan keterampilan sosial. Untuk itu diperlukan sebuah eksperimen dalam mengetahui efektivitas permainan outbound untuk meningkatkan keterampilan sosial. Penelitian ini menggunakan rancangan penelitian pre-eksperimental one group pretest and posttest design. Subjek dalam penelitian ini terdiri dari 40 orang siswa SMP yang merupakan anggota OSIS dari beberapa sekolah. Alat ukur dalam penelitian ini menggunakan skala keterampilan sosial. Skala keterampilan sosial disusun berdasarkan 4 bidang keterampilan sosial Johnson. Data dianalisis dengan menggunakan t Test. Hasil eksperimen menunjukkan bahwa permainan outbound efektif untuk meningkatkan keterampilan sosial. Hal tersebut didukung fakta bahwa p=0,00 (p<0,05), sehingga dapat disimpulkan ada peningkatan keterampilan sosial sebelum dan setelah perlakuan outbound. Berdasarkan hasil penelitian, maka disarankan: 1) Konselor sekolah menggunakan permainan outbound untuk membantu siswa dalam meningkatkan keterampilan sosial mereka, dan 2) karena penelitian ini hanya menggunakan kelompok eksperimen, maka untuk peneliti selanjutnya diharapkan menggunakan kelompok kontrol selain kelompok eksperimen.

Kereta api jalur Madiun-Ponorogo tahun 1907-1984 dan nilai pendidikannya / Gilang Eka Damayanti

 

Kata Kunci: Kebijakan Kereta Api Indonesia, Kereta Api Jalur Madiun-Ponorogo, Dampak Kebijakan Transportasi Penelitian tentang sejarah transportasi merupakan sebuah kajian yang sangat menarik. Dari berbagai jalur kereta api yang ada di Pulau Jawa, salah satu jalur tersebut adalah jalur Madiun-Ponorogo. Penelitian terhadap sejarah jalur ini penting karena menyangkut aspek-aspek sosial-ekonomi penduduk kawasan ini, dalam hal ini distribusi barang, manusia dan juga pengembangan ekonomi sebuah wilayah. Kedua, penelitian ini juga memiliki arti penting karena berkaitan dengan efek kebijakan transportasi di tingkat pusat terhadap keberadaan jalur transportasi di kawasan ini. Berdasar latar belakang tersebut di atas, maka penelitian ini bertujuan mendeskripsikan pembukaan jalur kereta api Madiun-Ponorogo. Kedua mendeskripsikan bentuk kebijakan transportasi dari periode Kolonial hingga Orde Baru. Ketiga, mengetahui dampak dan nilai pendidikan dari pembangunan kereta api jalur Madiun-Ponorogo 1984. Penelitian skripsi menggunakan metode penelitian sejarah. Penelitan ini diawali dengan pemilihan topik, pengumpulan sumber, kritik sumber, interpretasi dan diakhir dengan penulisan. Penelitian ini dibatasi dengan cakupan waktu dari tahun 1907 hingga tahun 1984. Tahun 1907 diambil sebagai batas awal, karena pada tahun ini merupakan awal pembangunan jalur kereta api Madiun-Ponorogo. Tahun 1984 diambil sebagai batas akhir karena pada tahun tersebut pemerintah membekukan operasional kereta api jalur Madiun-Ponorogo. Berdasar penelitian ini dapat diambil kesimpulan sebagai berikut. Pertama, Sejarah pembangunan jaringan rel kereta api jalur Madiun-Ponorogo ini dilatarbelakangi oleh kebutuhan manusia dalam hal pengangkutan bahan produksi yang memiliki nilai ekonomis tinggi yang tumbuh subur di daerah tersebut. Kedua, belum adanya jalan darat yang memungkinkan untuk pengangkutan massal. Hal ini dikarenakan, jalan rusak dan berlubang dan hanya bisa dilalui pada musim kemarau. Ini ditambah dengan belum adanya moda transportasi modern lain selain kereta api di kawasan Madiun-Ponorogo. Disisi lain, adanya dua pabrik gula yang menghubungkan daerah di sekitar kawasan tersebut, yaitu Pabrik Gula Pagotan dan Kanigoro. Hasil produksi kedua industri gula ini harus diimbangi dengan pembukaan akses dan modernisasi transportasi. Ketiga, Pemberhentian operasional ini juga disebabkan ketidakmampuan perusahaan dalam menrespon tren penurunan animo masyarakat terhadap kereta api jalur Madiun-Ponorogo. Tidak ada strategi khusus yang diambil dalam mengatasi permasalahan. Kebijakan penambahan armada bus tidak dianggap sebagai ancaman terhadap kelanjutan operasional kereta api. Kolusi yang terjadi diantara petugas kondektur dengan penumpang yang pembawa banyak barang tidak dicegah sehingga kebocoran itu tidak dapat diatasi. Dari penerapan kebijakan-kebijakan yang telah ditetapkan oleh pihak perusahaan ini secara tidak langsung juga berdampak pada kehidupan masyarakat di sekitar jalur yang dilalui kereta api khususnya jalur Madiun-Ponorogo. Dampak tersebut antara lain terlihat (1) pada penduduk yang telah menggunakan jasa kereta api jalur ini, hal ini menyangkut dalam hal menunjang kegiatan perdagangan masyarakat, (2) pada wilayah bekas stasiun yang dilalui kereta api jalur ini berdampak pada para pedagang kaki lima atau pedagang asongan yang secara berlahan memindahkan lapaknya guna mempertahankan kesejahteraan hidupnya, bahkan beberapa stasiun-stasiun bekas tempat pemberhentian dialihfungsikan menjadi kios daging, gudang rempah-rempah dan radio daerah dan (3) pada jalur lalu lintas darat, setelah kereta api jalur Madiun-Ponorogo tidak beroperasi kembali, jalur lalu lintas darat semakin rame. Hal ini dikarenakan, semakin padatnya jasa transportasi lain yang beroperasi disekitar rel kereta api jalur Madiun-Ponorogo, seperti bus, truk, pick up, motor dan mobil. Sedangkan, nilai-nilai kependidikan yang cantum dalam tulisan ini antara lain nilai sportifitas menghadapi persaingan, nilai toleransi dan nilai kejujuran. Hal ini dipertegas lagi karena adanya inefisiensi terhadap transportasi yang selama ini digunakan masyarakat, kalah persaingan dengan jasa transportasi lain dan tidak adanya inovasi di bidang layanan jasa khususnya perbaikan gerbong kereta api.

Pengaruh efisiensi sektor publik, stabilitas makro dan kelembagaan terhadap pertumbuhan ekonomi daerah (studi pada Kabupaten dan Kota di Jawa Timur) / Rizky Dwi Putri

 

Kata Kunci : efisiensi sektor publik, stabilitas ekonomi, kelembagaan, pertumbuhan ekonomi Otonomi daerah diharapkan dapat menciptakan efisiensi dan efektifitas pengelolaan sumber daya daerah, meningkatkan kualitas pelayanan umum dan kesejahteraan masyarakat, dan membudayakan dan menciptakan ruang bagi masyarakat untuk ikut berpartisipasi dalam proses pembangunan serta dapat meningkatkan pertumbuhan ekonomi melalui penggalian dan pengelolaan potensi daerah dengan baik. Penelitian ini berkaitan dengan pertumbuhan ekonomi Jawa Timur tahun 2004–2008 yang dilihat dari efisiensi sektor publik, stabilitas makro dan kelembagaan. Penelitian ini merupakan penelitian deskriptif kuantitatif yang termasuk pada penelitian causal comparative research. Jenis data yang digunakan dalam penelitian ini merupakan data panel, dan termasuk data sekunder yang diperoleh dari Badan Pusat Statistik Kota Malang, Badan Pusat Statistik Jawa Timur, Departemen Keuangan dan penelitian kepustakaan yang berhubungan dengan masalah yang diteliti. Metode analisis dalam penelitian ini menggunakan software ekonometrika yaitu Eviews untuk melakukan uji asumsi klasik serta uji regresi terhadap variabel bebas yang ada. Hasil dari penelitian ini menerangkan bahwa ada pengaruh yang signifikan dari efisiensi sektor publik, stabilitas makro dan kelembagaan terhadap pertumbuhan ekonomi. nilai positif dari hasil analisis data menunjukkan pengaruh yang searah. Kesimpulan dari penelitian ini adalah pertumbuhan ekonomi Jawa Timur ditentukan baik oleh stabilitas makro, maupun kelembagaan yang berpengaruh positif dengan nilai yang signifikan serta efisiensi sektor publik walaupun nilainya tidak signifikan. Inflasi yang mempunyai hubungan positif dengan pertumbuhan ekonomi dalam penelitian ini disebut sebagai strukturalis inflation yaitu inflasi yang terjadi karena permintaan yang tidak dapat dipenuhi oleh penawaran, dan deliberate inflation yang ditunjukkan dengan campur tangan pemerintah dalam perekonomian melalui subsidi. Oleh karena itu, pemerintah daerah diharapkan dapat menciptakan suatu lembaga yang baik yaitu lembaga yang mampu mengalokasikan anggaran dengan baik sehingga dapat menciptakan stabilitas makro ekonomi dan efisiensi terhadap sektor publik.

Penerapan metode permainan kartu persegi untuk meningkatkan hasil belajar matematika materi bangun kubus siswa kelas IV SDN Batu Ampar Pelaihari / Dahliana

 

ABSTRAK Dahliana, 2015. Penerapan Metode Permainan Kartu Persegi untuk Meningkatkan Hasil Belajar Matematika materi Bangun Kubus Siswa Kelas IV SDN Batu Ampar Pelaihari. Tesis. Program Studi Pendidikan Dasar, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M.Pd., (II) Dr. Subanji, M.Si. Kata Kunci: metode permainan kartu persegi, hasil belajar, bangun kubus. Bangun kubus merupakan salah satu bangun ruang sederhana untuk materi Matematika di Sekolah Dasar. Studi pendahuluan di SDN Batu Ampar Pelaihari menunjukkan bahwa prestasi belajar siswa pada bangun datar belum memenuhi Kriteria Ketuntasan Minimal (KKM). Oleh karena itu, perlu upaya menerapkan pembelajaran yang dapat meningkatkan prestasi siswa. Desain penelitian yang digunakan dalam penelitian ini adalah Penelitian Tindakan Kelas (PTK) dengan langkah-langkah perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian Tindakan Kelas ini dilaksanakan dalam dua siklus; setiap siklus terdiri dari 3 kali pertemuan pembelajaran dan 1 kali pertemuan evaluasi pembelajaran. Analisis data menunjukkan bahwa pemahaman siswa terhadap konsep bangun kubus meningkat setelah diterapkannya metode permainan kartu persegi. Peningkatan hasil belajar kognitif ditandai dengan peningkatan ketuntasan klasikal 88.24 dan skor rata-rata tes akhir 83,24 pada Siklus II yang mampu melampaui KKM yang ditentukan yakni 70. Berdasarkan hasil temuan tersebut, disarankan kepada guru Matematika di SD untuk menerapkan metode permainan kartu persegi dalam upaya meningkatkan keaktifan dan hasil belajar siswa.

Pengembangan modul larutan buffer berdasarkan persepsi konsep sukar dan kesalahan konsep dengan model daur belajar 3 fase untuk mata kuliah kimia dasar II / Yusrotul Nisa Ansori

 

ABSTRAK Ansori, Yusrotul Nisa. 2015. Pengembangan Modul Larutan Buffer Berdasarkan Persepsi Konsep Sukar dan Kesalahan Konsep dengan Model Daur Belajar 3 Fase untuk Mata Kuliah Kimia Dasar II. Tesis, Program Studi Pendidikan Kimia, Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. H. Suhadi Ibnu, M.A., Ph.D., (2) Dr. Fariati, M.Sc. Kata kunci: pengembangan modul, persepsi konsep sukar, kesalahan konsep, larutan buffer, daur belajar 3 fase Hasil tes diagnostik oleh Arofah dan Ansori yang diberikan kepada peserta didik kelas XI SMA Negeri 5 Malang dan MAN Malang II Batu mengungkapkan data persepsi konsep sukar dan kesalahan konsep pada materi larutan buffer. Tes diagnostik yang sama juga diujikan kepada mahasiswa Kimia Dasar II jurusan Kimia FMIPA UB Malang. Hasil tes menunjukkan kemiripan data persepsi konsep sukar dan kesalahan konsep dengan hasil penelitian sebelumnya. Persepsi konsep sukar dan kesalahan konsep mahasiswa pada materi larutan buffer perlu dicegah agar tidak terulang kembali. Perkuliahan Kimia Dasar II perlu difokuskan untuk menolong mahasiswa mendapatkan pemahaman larutan buffer yang runut, tuntas, dan benar. Salah satu alternatif pemecahan masalah yang dapat digunakan adalah mengembangkan modul menggunakan pendekatan konstruktivistik, dengan model daur belajar 3 fase. Model daur belajar 3 fase terdiri dari fase eksplorasi, pengenalan konsep, dan aplikasi konsep. Penelitian bertujuan untuk (1) menghasilkan modul larutan buffer berdasarkan persepsi konsep sukar dan kesalahan konsep dengan model daur belajar 3 fase untuk mata kuliah Kimia Dasar II; (2) mengetahui kelayakan modul berdasarkan hasil validasi isi dan uji keterbacaan; (3) mengetahui keefektifan modul berdasarkan hasil validasi empiris. Model pengembangan mengadaptasi model 4D dari Thiagarajan dkk. Model 4D terdiri dari empat tahap, yaitu pendefinisian (define), perancangan (design), pengembangan (develop), dan penyebarluasan (disseminate). Dalam penelitian ini pengembangan modul hanya mengadaptasi model 4D hingga langkah validasi empiris. Validasi isi dilakukan oleh dua orang dosen kimia FMIPA UM. Uji keterbacaan dilakukan oleh 9 orang mahasiswa kimia FMIPA UM. Validasi empiris menggunakan rancangan satu-kelompok pretes-postes dan dilakukan kepada 32 orang mahasiswa Kimia Dasar II FMIPA Universitas Brawijaya (UB) yang belum mendapatkan materi larutan buffer. Instrumen pengumpulan data berupa angket dan soal tes diagnostik. Jumlah soal tes diagnostik sebanyak 29 butir soal pilihan ganda dengan validitas isi sebesar 92% dan reliabilitas sebesar 0,87. Data hasil penelitian berupa data kuantitatif dan kualitatifyang terkait dengan pengujian kelayakan dan keefektifan modul. Analisis deskriptif dan statistik digunakan untuk menganalisis data yang telah dikumpulkan. Data persepsi konsep sukar dan kesalahan konsep hasil penelitian Arofah dan Ansori, serta data persepsi konsep sukar dan kesalahan konsep yang baru ditemukan pada mahasiswa menjadi dasar penyusunan peta pikiran (mind map). Dari peta pikiran dibuat kisi-kisi dan dikembangkan modul larutan buffer dengan model daur belajar 3 fase. Persepsi konsep sukar dan kesalahan konsep mahasiswa diharapkan dapat diperbaiki melalui modul larutan buffer. Hasil validasi isi sebesar 92% dengan kriteria sangat valid. Hasil uji keterbacaan adalah 75% dengan kriteria valid. Hasil validasi isi dan uji keterbacaan menunjukkan bahwa modul larutan buffer layak digunakan untuk pembelajaran larutan buffer pada matakuliah Kimia Dasar II. Uji awal terhadap hasil pretes dan postes memberikan informasi bahwa terdapat perbedaan signifikan antara hasil pretes dan postes mahasiswa, dan peningkatan penguasaan konsep mahasiswa termasuk kategori sedang (N-gain score sebesar 0,32). Analisis lebih lanjut dari hasil validasi empiris menghasilkan persentase keefektifan modul larutan buffer dalam memperbaiki persepsi konsep sukar dan kesalahan konsep mahasiswa berturut-turut sebesar 33% dan 83%. Hasil validasi empiris menginformasikan bahwa modul larutan buffer efektif dalam memperbaiki persepsi konsep sukar dan kesalahan konsep mahasiswa.

Keefektifan synectics model untuk meningkatkan keterampilan berpikir kreatif siswa SMP / Widya Tioria Bisli Gultom

 

ABSTRAK TioriaBisliGultom, Widya. 2015. KeefektifanSynectics ModeluntukMeningkatkanKeterampilanBerpikirKreatifSiswa SMP. PascasarjanaUniversitasNegeri Malang. Pembimbing: (1) Dr. Dany M. Handarini, M.A., (2) Dr. AdiAtmoko, M.Si. Kata Kunci:berpikirkreatif, siswa SMP, synectics model Berpikirkreatifmerupakansalahsatuketerampilan yang pentingbagisetiapsiswauntukmembantudalammeningkatkankemandirian. Peningkatanketerampilanberpikirkreatifsiswa SMP perludiurusiuntukmenghasilkangenerasikreatifdanmandiri. Keterampilanberpikirkreatifmenggunakansynectics modelbelumdiujikeefektifannyadalamranahBimbingandanKonseling. Tujuanpenelitianiniadalahmengujiefektivitassynectics modeldalammeningkatkanketerampilanberpikirkreatifsiswa SMP. Penelitianinimenggunakanrancanganeksperimenequivalent time series designterhadap 8 (delapan)siswa SMP kelas VII yang memilikiketerampilanberpikirkategorirendah.Metode yang digunakanuntukmeningkatkanketerampilanberpikirkreatifsiswaadalahsynectics model. Ada beberapatahappadapelatihanketerampilanberpikirkreatifmenggunakansynectics modelyaitu (a) tahapmendeskripsikansituasisaatini, (b) tahapanalogilangsung, (c) tahapanalogi personal, (d) tahapanalogilangsung II, dan (e) tahapkembaliketugasawal. Instrumen yang digunakanuntukmengukurketerampilanberpikirkreatifmenggunakanrubrikketerampilanberpikirkreatif yang dikembangkanolehpeneliti. Analisis data dilakukansecaraindividudankelompok. UjihipotesismenggunakanWilcoxon signed rank testdengan z tabel 0, 05. Jika z hitung< z tabelmakasynectics modelterbuktiefektif. Dari ujihipotesiskeseluruhandidapat z hitungsebesar 0,017. Hasilpenelitianmenunjukkanbahwasynectics modeldapatmeningkatkanketerampilanberpikirkreatifsiswa SMP secaraefektif.Keterampilanberpikirkreatifsiswameningkatdarisesikesetiapsesi.Saranpenelitianadalahpertama, secarateoritis, synectics modelperludikajilebihmendalamdandiujicobapadakonteks yang lebihluasdengansubjekpenelitian yang lebihbervariasi. Kedua, secarapraksis, saran ditujukankepada: 1) Konselor yang inginmenggunakansynectics model untukmeningkatkanketerampilanberpikirkreatifsiswa SMP diharapkanuntuk: (a) memastikanterlebihdahulubahwasiswa yang ditetapkansebagaisubjekpelatihanmemangmembutuhkanpelatihantersebut, (b) memerlukanwaktu yang relatif lama, dan (c) mengikutipedomanaplikasisynectics modeldengancermat. 2) Siswa yang menjadisubjekpelatihandiharapkanuntuk: (a) dapatmelakukananalogilangsung, (b) dapatmelakukananalogi personal, (c) dapatmenemukan ide-ide baru, dan (d) dapatmengembangkan ide-ide tersebut. 3) Penelitilanjutdisarankanuntukmemilihmateriintervensi yang lebihbervariasidanlebihluas di bidangbimbinganpribadi-sosial, belajardankarir.

Teacher's and students' questioning and teacher's feedback in EFL classroom / Widia Rizah Hidayati

 

ABSTRAK Hidayanti, Widia Rizah. 2015. Perilaku Bertanya Guru dan Siswa dan Tanggapan Guru di Kelas Bahasa Inggris sebagai Bahasa Asing. Tesis. Jurusan Pendidikan Bahasa Inggris, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Mirjam Anugerahwati M.A., (II) Dr. Arwijati Wahjudi Murdibjono, Dip. TESL, M.Pd. Kata kunci: pertanyaan guru, siswa pertanyaan, tanggapan, EFL kelas Penelitian ini bertujuan untuk mengeksplorasi informasi mengenai instruksi guru yang berfokus pada perilaku bertanya guru dan siswa, dan tanggapan yang digunakan oleh guru di kelas EFL, khususnya di SMA. Secara spesifik, penelitian ini dimaksudkan untuk meneliti 1) jenis-jenis pertanyaan yang diajukan oleh guru di kelas EFL, 2) jenis-jenis pertanyaan yang diajukan oleh siswa di kelas EFL, dan 3) tanggapan yang digunakan oleh guru di kelas EFL. Untuk menjawab masalah-masalah penelitian tersebut, sebuah studi kasus deskriptif dengan pendekatan kualitatif telah dilakukan. Subyek penelitian ini adalah seorang guru bahasa Inggris dan siswa-siswa kelas XI di tujuh kelas Bahasa Inggris di SMAN 1 Sumenep. Data penelitian ini berupa pertanyaan- pertanyaan lisan yang diajukan oleh guru dan siswa dan tanggapan guru yang diperoleh melalui observasi kelas tanpa campur tangan peneliti. Selain itu, data pendukung seperti pendapat dan pemahaman subyek dikumpulkan melalui wawancara semi-terstruktur. Hasil penelitian menunjukkan bahwa jumlah pertanyaan yang diajukan oleh guru di empat belas sesi observasi kelas adalah 366 pertanyaan. Mayoritas pertanyaan yang diajukan adalah pertanyaan referensial atau divergen. Terdapat sekitar 268 pertanyaan atau 73% dari total jumlah pertanyaan yang diajukan di semua kelas. Banyakna jenis pertanyaan referensial tertutup dan pertanyaan referensial terbuka adalah 41% dan 32%. Sebaliknya, guru jarang menanyakan pertanyaan display atau konvergen. Hanya terdapat sekitar 98 pertanyaan atau 27% dari total pertanyaan yang diajukan oleh guru. Jenis pertanyaan yang ditanyakan adalah dalam bentuk pertanyaan display tertutup dan terbuka dengan total jumlah 20% dan 7%. Selanjutnya, penelitian ini menunjukkan bahwa penggunaan pertanyaan referensial terbukti dapat menciptakan interaksi kelas yang lebih baik dan menaikkan tingkat berpikir siswa dari pada penggunaan pertanyaan display. Mengenai pertanyaan yang diajukan oleh siswa, siswa di bawah pengamatan bertanya sedikit pertanyaan di kelas. Terdapat hanya sekitar 45 pertanyaan atau sekitar 11% jika dibandingkan dengan pertanyaan guru yang mendominasi sebagian besar perilaku bertanya di dalam kelas, yaitu sekitar sebesar 89%. Pertanyaan yang diajukan oleh siswa kepada guru hanya sekitar 7% dari total jumlah pertanyaan siswa, 75% untuk salah seorang teman kelas mereka, dan 18% untuk seluruh teman di dalam kelas. Pertanyaan siswa dikelompokkan menjadi pertanyaan tertutup (tingkat rendah) dan pertanyaan terbuka (tingkat tinggi) dengan jumlah total 45% dan 55%. Hal ini menunjukkan bahwa siswa lebih banyak mengajukan pertanyaan dengan jenis kognitif tingkat tinggi dari seluruh jumlah pertanyaan yang diajukan. Mengenai tanggapan guru, penelitian ini mengungkapkan bahwa guru yang diteliti secara spontan menggunakan tanggapan atau umpan balik positif ketika siswa menjawab seperti yang diharapkan oleh guru, dan sebaliknya, memberikan umpan balik negatif untuk menanggapi jawaban siswa yang salah. Guru tersebut menggunakan sekitar 75% tanggapan positif sedangkan 25% untuk tanggapan negatif. Guru menerapkan beberapa strategi dalam memberikan tanggapan negatif, seperti: memberikan arahan, mengkritik respon siswa, melempar pertanyaan kepada siswa lain, dan memperbaiki jawaban siswa secara langsung tanpa penolakan. Sementara itu, ketika memberikan umpan balik positif, guru biasanya menggunakan strategi, seperti: mengelaborasi ide siswa, mengulang jawaban siswa, dan memberikan kata-kata dorongan atau pujian. Berdasarkan temuan penelitian ini, beberapa saran diusulkan untuk guru EFL dan peneliti selanjutnya. Bagi para guru EFL, diharapkan untuk meningkatkan pengetahuan mereka tentang jenis dan peran pertanyaan dalam komunikasi dan interaksi kelas yang akan merangsang tingkat keterampilan berpikir siswa menjadi lebih tinggi dan membimbing mereka untuk berdiskusi lebih lanjut dan pemahaman yang lebih dalam. Selain itu, penting bagi guru EFL agar mendorong siswa untuk mengajukan pertanyaan dengan menyediakan strategi pengajaran dan kegiatan kelas yang sesuai. Selain itu, guru EFL juga disarankan berusaha untuk memiliki pengetahuan tentang pemberian umpan balik yang sesuai dalam menanggapi jawaban siswa. Bagi peneliti selanjutnya, disarankan untuk melakukan penelitian yang menyelidiki hubungan antara perilaku bertanya guru dan siswa dan tanggapan guru terhadap output berbahasa dan prestasi siswa dalam bahasa inggris. Selain itu, akan lebih menarik bagi para peneliti selanjutnya untuk melakukan penelitian dengan melibatkan lebih banyak guru dengan kemampuan siswa yang berbeda.

Pengembangan project-based learning untuk mata pelajaran prakarya dan kewirausahaan / Meirena Ayu Permatasari

 

ABSTRAK Ayu Permatasari,Meirena. 2015. PengembanganProject-based Learninguntuk Mata Pelajaran Prakarya dan Kewirausahaan.Tesis. Prodi S2 Pendidikan Ekonomi, Jenjang Magister, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I)Dr.AgungHaryono, SE.,M.P., Ak; (II) Dr. MitWitjaksono, MS.Ed. Kata kunci:Project -based Learning, Prakarya dan Kewirausahaan. Hasil observasi awalmenunjukkan bahwa pembelajaran prakarya dan kewirausahaan selama ini kurang menggunakan kegiatan pembelajaran yang dapat meningkatkan kreatifitas siswa. Ditemukan fakta bahwa siswa telah memiliki pengalaman membuat suatu prakarya sebelumnya. Hal tersebut membentuk suatu pola tahapan kemampuan siswa, yaitu tingkat pemula, menengah dan lanjut sehingga diperlukan pengembangan pembelajaran diharapkanmampu membangun potensi kewirausahaan melalui prakarya dalam setting real yang dapat mencapai tujuan instruksional pembelajaran sesuai dalam kurikulum 13 (harapan formal) dan tujuan akhir pembelajaran (harapan ideal). Penelitian ini menggunakan pendekatan model Design Based Research (DBR)dalam pengembangan pembelajaran kewirausahaan melalui prakarya. Teknik analisis data yang digunakan adalah deskriptifkualitatifdandeskriptifkuantitatif. Berdasarkandari hasil penelitian menghasilkan temuan empirik yaitu pembelajaran yang selama ini diterjadikan di kelas belum memuat tujuan instruksional pembelajaran sesuai kurikulum 2013 dan hanya terpaku pada buku paket pembelajaran prakarya dan kewirausahaan serta pembelajaran hanya bersifat teoritis. Dengan adanya pengembangan pembelajaran kewirausahaan melalui prakarya menggunakan Project-based learningmenunjukkanhasiltanggapan peserta didik yang baik. Hal ini didukung dengan hasil pengembangan pembelajaran menggunakan Project -based Learning dapat mencapai tujuan akhir pembelajaran (harapan ideal) yaitu menumbuhkan kesadaran dan semangat kewiausahaan, meningkatkan ketrampilan ekonomis dan membelajarkan siswa dalam melakukan ekonomi produktif. Berdasarkan hasilpenelitian,disarankan agar (1) Guru mengembangkan skenario pembelajaran yang dirancang untuk memudahkan dalam menciptakan variasi kegiatan pembelajaranbaik materi yang bersifat teoritis maupun praktikum untuk meningkatkan kemampuan berpikir siswa dalam analisis dan evaluasi serta memperoleh pengalaman belajar yang utuh (2) Melalui pengembangan pembelajaran kewirausahaan melalui prakarya menggunakan Project-based Learning dapat memberikan pembelajaran yang dekat dengan prespektif siswa agar dapat mengaitkan peluang kreatifitas siswa melalui prakarya.

Penerapan pembelajaran problem solving pada mata pelajaran pendidikan kewarganegaraan untuk meningkatkan keterampilan berfikir dan aktivitas belajar siswa / Indria Kristiawan

 

ABSTRAK Kristiawan, Indria. 2015. Penerapan Pembelajaran Problem Solving Pada Mata Pelajaran Pendidikan Kewarganegaraan Untuk Meningkatkan Keterampilan Berfikir dan Aktivitas Belajar Siswa. Tesis, Teknologi Pembelajaran, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Anselmus.J. E Toenlioe, M.Pd., (II) Dr. Sulthoni, M.Pd. Kata Kunci: problem solving, keterampilan berfikir, aktivitas belajar Problem solving merupakan model pembelajaran dengan melatih siswa menghadapi masalah baik masalah pribadi ataupun masalah kelompok untuk dapat dipecahkan sendiri atau bersama-sama. Penelitian ini dilaksanakan untuk memperbaiki kualitas belajar siswa dalam cara berfikir dan aktivitas belajar. Tujuan penelitian ini adalah untuk meningkatkan keterampilan berfikir dan aktifitas belajar siswa kelas VIII G SMP Negeri 1 Jabung. Penelitian ini merupakan penelitian tindakan kelas (PTK), terdiri dari dua siklus, setiap siklus terdapat empat tahap yaitu perencanaan, tindakan, observasi, dan refleksi. Pengumpulan data melalui observasi, catatan lapangan, lembar kerjasiswa, lembar observasi kemampuan berfikir, dan lembar observasi aktivitas siswa. Berdasarkan paparan data prosentase kemampuan berfikir secara klasikal dari setiap pertemuan dapat dijabarkan bahwa siklus I pertemuan ke- 1 diperoleh 59% dan pertemuan ke- 2 diperoleh 68% terjadi peningkatan sebesar 9%; dalam kemampuan berpikir siswa khususnya pada indikator penyajian masalah, dan penyelesaian masalah. Siklus II secara keseluruhan kemampuan berfikir kritis dalam aspek pengkajian, intepretasi, penyelesaian dan pengambilan keputusan diperoleh 71 % meningkat 3% dari siklus I. Aktivitas siswa dalam pembelajara memnggunakan model problem solving dapat membuat siswa lebih aktif dan kritis dalam hal memperhatikan, menjawab pertanyaan, bekerjasama, mempresentasikan jawaban, merespon jawaban siswa lainnya. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa model pembelajaran problem solving dapat meningkatkan kemampuan berfikir dan aktivitas belajar siswa. Berdasarkan hasil penelitian ini dapat diajukan beberapa saran yaitu: (1) bagi peneliti selanjutnya model problem solving dapat digunakan untuk mengetahui variabel lain misalnya motivasi berprestasi dan hasil belajar; (2) model pembelajaran problem solving selain dapat digunakan pada mata pelajaran PKn bisa diterapkan pada mata pelajaran lain misalnya mata pelajaran matematika, IPS, dan biologi.

Pengembangan bahan ajar geografi pada nateri penelitian geografi melalui e-learning / Lilis Hargiani Adi

 

ABSTRAK Adi, Lilis Hargiani. 2015. Pengembangan Bahan Ajar Geografi pada Materi Penelitian Geografi melalui E-Learning. Tesis. Program Studi Pendidikan Geografi, Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Sumarmi, M.Pd., (II) Dr. Ach. Amirudin, M.Pd. Kata kunci: pengembangan, bahan ajar, geografi, e-learning. Penelitian geografi merupakan materi yang baru diterapkan dalam pelajaran geografi. Pada saat pembelajaran ditemukan beberapa masalah, masalah-masalah tersebut adalah (1) bahan ajar belum memadai, dan (2) keterbatasan waktu yang tersedia. Kedua komponen tersebut secara tidak langsung akan berpengaruh terhadap kualitas pembelajaran. Permasalahan-permasalahan yang tersebut perlu segera mendapat perhatian dan pemecahan. Masalah-masalah penting yang perlu ditangani adalah pengembangan bahan ajar yang sesuai dengan karakteristik dan kebutuhan peserta didik. Tujuan penelitian pengembangan ini adalah untuk mewujudkan bahan ajar berupa e-learning yang sesuai dengan karakteristik Kurikulum 2013 SMAN 1 Kebomas Gresik. Bahan ajar berupa e-learning ini diharapkan dapat meningkatkan kesiapan peserta didik, khususnya untuk materi penelitian geografi Model pengembangan yang digunakan dalam pengembangan bahan ajar ini adalah Model Dick and Carey. Produk pengembangan materi penelitian geografi, selanjutnya mengalami beberapa tahapan uji coba untuk mendapatkan data-data sebagai bahan penyempurnaan produk pengembangan. Tahapan-tahapan uji coba yang dilakukan adalah (1) validasi oleh ahli materi, (2) validasi ahli desain dan media pembelajaran, (3) uji coba kelompok kecil, dan (4) uji coba lapangan. Bahan ajar berupa e-learning yang dihasilkan dalam pengembangan memiliki komponen-komponen (1) judul atau topik, (2) petunjuk penggunaan e-learning, (3) pengantar atau prakata, (4) kompetensi inti/kompetensi dasar, (5) tujuan kegiatan pembelajaran, (6) pretes (cek kemampuan), (7) kegiatan pembelajaran (materi), (8) rangkuman, (9) soal latihan/tugas, (10) tes formatif, , (11) kunci jawaban, dan (12) daftar rujukan. Setelah melalui uji coba, menunjukkan bahan ajar yang dikembangkan, layak digunakan dalam mata pelajaran penelitian geografi. Hal ini diperkuat dengan hasil penilaian angket, berdasarkan uji coba lapangan berada di atas kriteria yang ditetapkan, yakni di atas 71% sehingga layak digunakan. Berdasarkan temuan penelitian, beberapa saran yang diperkirakan dapat meningkatkan pengembangan e-learning adalah kajian-kajian pada pemanfaatannya sebagai komplemen pembelajaran. Kajian tersebut meliputi evaluasi dalam hal: (1) karakteristik mahasiswa, sampai sejauhmana kesiapan peserta didik dalam mengikuti pembelajaran berbasis e-learning, (2) kesiapan guru pengampu dan pengelola web (admin), (3)ketersediaan perangkat penunjang.

Fungsi packaging didalam melancarkan pemasaran barang-barang produksi PT Faroka SA Malang / oleh Yupri Andri

 

Strategi pelayanan untuk menciptakan kepuasan konsumen pada toko buku diskon Toga Mas Malang / oleh Teguh Prasetiyo

 

Penerapan pembelajaran kooperatif Think Pair Share untuk meningkatkan hasil belajar siswa kelas VII-A SMP Brawijaya Smart School Malang / Agustin Eka Ariestari

 

Kata kunci : pembelajaran kooperatif, Think Pair Share, hasil belajar Hasil observasi awal yang dilakukan pada tanggal 09 dan 10 Mei 2012 di Kelas VII-A menunjukkan bahwa pembelajaran belum berpusat pada siswa. Hal tersebut diperkuat dengan hasil belajar siswa yang masih dibawah Standar Ketuntasan Minimal. Untuk mengatasi permasalahan tersebut, perlu dilakukan penelitian tentang penerapan model pembelajaran yang dapat meningkatkan hasil belajar siswa. Tujuan penelitian ini untuk mendeskripsikan penerapan pembelajaran kooperatif Think Pair Share dalam meningkatkan hasil belajar siswa kelas VII-A SMP Brawijaya Smart School Malang. Jenis penelitian yang digunakan dalam penelitian ini adalah Penelitian Tindakan Kelas. Kegiatan pembelajaran terdiri dari dua siklus. Pengambilan data dilakukan dengan observasi dan tes formatif. Materi yang digunakan dalam penelitian ini adalah Pola Kegiatan Ekonomi Penduduk, Penggunaan Lahan, dan Pola Permukiman Penduduk Berdasarkan Kondisi Fisik Muka Bumi. Hasil penelitian menunjukkan bahwa pada pra tindakan nilai rata-rata kelas sebesar 63,59 dengan 6 siswa tuntas, Siklus I 75,16 dengan 18 siswa tuntas, dan Siklus II 82,19 dengan jumlah siswa tuntas 28 siswa. Nilai rata-rata kelas ini mengalami peningkatan tiap siklus yaitu sebesar 18,19 % pada Siklus I dan sebesar 9,35% pada Siklus II. Berdasarkan hasil penelitian ini disarankan : (1) Sekolah diharapkan menggalakkan penggunaan pembelajaran kooperatif model Think Pair Share untuk perbaikan pembelajaran dan meningkatkan hasil belajar siswa. Upaya merealisasikannya melalui sosialisasi penggunaan pembelajaran kooperatif ataupun mengikutsertakan guru-guru mata pelajaran dalam pelatihan tentang penerapan pembelajaran kooperatif dengan model Think Pair Share, (2) guru hendaknya berusaha menggunakan pembelajaran kooperatif model Think Pair Share sebagai tindakan kelas untuk meningkatkan hasil belajar pada mata pelajaran IPS Geografi. Upaya pelaksanaannya dengan pembuatan Rancangan Pembelajaran yang disusun dengan memasukkan tata cara pembelajaran kooperatif Think Pair Share dalam kegiatan inti yang juga disesuaikan dengan evaluasi pembelajaran sehingga pembelajaran lebih optimal dan dapat lebih meningkatkan hasil belajar siswa, (3) Penulis mengharapkan penelitian ini dapat menjadi acuan bagi peneliti selanjutnya dalam penelitian maupun penulisan karya ilmiah mereka dalam penerapan pembelajaran kooperatif Think Pair Share untuk mengukur aspek yang lain.

Membantu anak berbakat di sekolah dasar / oleh Ratnawati Hadisuparto

 

Nilai-nilai keislaman dalam novel 99 Cahaya di Langit Eropa: Perjalanan Menapak Jejak Islam di Eropa karya Hanum Salsabiela Rais dan Rangga Almahendra / Umi Kalsum

 

ABSTRAK Kalsum, Umi. 2015. Nilai-Nilai Keislaman dalam Novel 99 Cahaya di Langit Eropa: Perjalanan Menapak Jejak Islam di Eropa Karya Hanum Salsabiela Rais dan Rangga Almahendra. Tesis. Program Studi Pendidikan Bahasa Indonesia, Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Djoko Saryono, M.Pd., (2) Dr. Yuni Pratiwi, M.Pd. Kata kunci: nilai, keislaman, novel Sastra hadir karena adanya manusia. Sastra diciptakan oleh manusia sebagai bentuk pemikiran yang memiliki ruang lingkup tertentu, yaitu imajinasi. Karya sastra merupakan hasil karya kreatif di bidang bahasa berisi gambaran kehidupan masyarakat yang dituangkan dalam bentuk tulisan oleh penulis dengan melibatkan imajinasi dan muatan nilai-nilai hasil analisis terhadap suatu masalah. Dalam karya sastra, pengarang menyampaikam nilai-nilai dalam bentuk pesan moral, sikap, dan tingkah laku para tokoh sesuai dengan pandangan pengarangnya tentang konsep moral. Pembaca diharapkan dapat menghayati pesan-pesan ini dan kemudian menerapkannya dalam kehidupannya. Wujud dan jenis pesan moral dalam karya sastra beragam dan bersifat tidak terbatas, termasuk di dalamnya adalah nilai keislaman. Nilai-nilai keislaman adalah nilai-nilai yang bersumber dari agama Islam dengan Quran dan Hadist sebagai penuntunnya. Novel 99 Cahaya di Langit Eropa merupakan novel inspiratif yang berisi tentang kisah perjalanan penulis dalam menjelajahi negara-negara di benua Eropa, dengan penganut agama Islam sebagai golongan minoritas. Penelitian ini bermaksud untuk mendiskripsikan nilai-nilai keislaman, yaitu nilai-nilai berdasarkan syariat dan akhlak yang tergambar pada tokoh novel 99 Cahaya di Langit Eropa karya Hanum Salsabiela Rais dan Rangga Almahendra. Akhlak yang dimaksud adalah akhlak mulia atau akhlak terpuji (akhlaqul karimah). Penelitian ini tergolong dalam penelitian kualitatif dengan pendekatan tekstual, di mana peneliti berupaya menggali nilai-nilai keislaman dengan memanfaatkan ayat Al-Qur’an dan Hadist dalam memahami dan memaknai teks. Data penelitian ini berwujud paparan kebahasaan tertulis yang mengandung nilai-nilai keislaman yang berupa paparan naratif dan kalimat percakapan (dialog) yang menggambarkan karakter, perbuatan, dan pemikiran tokoh. Data diperoleh melalui kegiatan; (1) membaca secara kritis, cermat, dan berulang-ulang dengan berbekal pengetahuan, wawasan, kemampuan, dan kepekaan peneliti, (2) identifikasi unit-unit paparan kebahasaan yang sesuai dengan fokus masalah, (3) pengkajian instrumen penelitian dengan data, dan (4) pemberian kode-kode. Analisis data menggunakan prosedur analisis Miles dan Huberman dengan langkah-langkah: (1) pengumpulan data, (2) reduksi data, (3) sajian data, dan (4) penarikan kesimpulan. Hasil penelitian menunjukkan bahwa dalam novel 99 Cahaya di Langit Eropa terdapat nilai-nilai keislaman yang berkaitan dengan nilai-nilai syariat dan nilai-nilai akhlak mulia. Nilai-nilai tersebut tumbuh dan berkembang di tengah himpitan pluralisme masyarakat. Kaum Islam sebagai golongan minoritas harus tetap bertahan dan berjuang untuk tetap berada dalam tuntunan dan syariah Islam. Keteguhan dan keyakinan iman Islam senantiasa berpijak kepada kebesaran Allah dengan 99 sifat baik yang melindungi golongan minoritas di belahan bumi Eropa. Sehubungan dengan itu, dapat ditarik kesimpulan sebagai berikut. Pertama Allah pencipta alam semesta memiliki 99 nama indah yang merupakan cerminan dari sifat-sifat Allah, dikenal dengan Asma’ul Husna. Sebagai umat yang beriman Islam, meyakini kebesaran 99 nama Indah Allah adalah hal yang mutlak. Memaknai sifat-sifat Allah ini dilakukan dengan meyakini dan meneladaninya dengan mengaplikasikannya dalam kehidupan sehari-hari. Berperilaku dan berakhlak mulia sesuai dengan tuntunan dan syariat Islam. Kedua, 99 Cahaya di Langit Eropa dalam perspektif Islam dimaknai sebagai 99 nama-nama Allah yang berkembang dan menjadi sebuah keyakinan bagi umat Islam yang tinggal di belahan bumi Eropa. Umat Islam yang hidup sebagai golongan minoritas harus berjuang keras untuk mempertahankan keimanan dan ketakwaan dengan ajaran Islam. Ketiga, nilai syariat sebagai nilai yang bersumber dari hukum atau peraturan yang berasal dari Allah menjadi tuntunan dalam menjalankan dan mengamalkan agama Allah untuk kemaslahatan umat manusia. Umat Islam hendaknya menjalankan agamanya berdasarkan ilmu, yaitu ilmu pengetahuan syariat yang kuat dan terpilih untuk menjaga konsep ahlus sunnah wal jamaah sebagai koridor keagamaan muslim. Keempat, nilai akhlak mulia bersumber dari nilai-nilai yang melekat pada diri manusia berwujud perbuatan, sikap, dan sifat-sifat baik dan terpuji. Dalam kehidupan di dunia hendaknya setiap manusia memiliki akhlak mulia (akhlakul mahmudah) agar tercipta kehidupan yang tenteram dan damai dan terwujud kerukunan hidup bersama. Berdasarkan hasil penelitian dan kesimpulan, beberapa saran disampaikan kepada pihak berikut. Pertama bagi pengajar bahasa dan sastra Indonesia, hasil penelitian dapat digunakan sebagai referensi dan apersepsi dalam pembelajaran Bahasa Indonesia tertutama pada kegiatan apresisasi sastra dikaitkan dengan pengembangan nilai-nilai, sebagai bekal siswa untuk hidup di masyarakat yang beradab dengan budi pekerti dan etika yang baik yang dapat diaplikasikan pada kehidupan masa kini. Kedua pembaca dan penikmat sastra, penelitian ini dapat dijadikan referensi sekaligus menggugah minat untuk mempelajari dan menggali nilai-nilai keislaman yang terdapat pada karya sastra yang lain, khususnya novel. Ketiga peneliti selanjutnya, hasil penelitian dapat dijadikan sebagai bahan kajian atau pembanding untuk penelitian sejenis.

Pengembangan bahan ajar agama Kristen kelompok umur remaja di Sekolah Minggu Gereja Kristus Tuhan Jemaat III Malang / Sony Julianto

 

ABSTRAK Julianto, Sony.2015. Pengembangan Bahan Ajar Agama Kristen Kelompok Umur Remaja Di Sekolah Minggu Gereja Kristus Tuhan Jemaat III Malang. .Tesis,PPSJ Teknologi Pembelajaran Program Pascasarjana Universitas Negeri Malang. Pembimbing (I) Prof. Dr. I Nyoman Sudana Degeng, M.Pd. (II) Dr. Wasis D. Dwiyogo, M.Pd. Kata Kunci : pengembangan, bahan pembelajaran, model Dick, Carey & Carey. Sekolah Minggu GKT III Malang adalah lemnbaga non-formal keagamaan yang mengajarkan Pendidikan Agama Kristen pada usia kelompok umur 2 tahun sampai 12 tahun. Lembaga keagamaan ini bertujuan dalam pengembangan dan pembelajaran nilai-nilai Kristiani kepada kelompok pembelajaran pedagogi (anak-anak) yang sangat mendasar dalam mengembangkan pemahaman pebelajar mengenai imannya. Berkenaan dengan nilai penting dari tujuan tersebut, diperlukan adanya proses pembelajaran yang lebih baik. Salah satu cirri dari proses pembelajaran yang baik adalah adanya bahan pembelajaran yang lebih baik dan bermutu. Tesis ini memuat proses pengembangan bahan pembelajaran Pendidikan Agama Kristen. Tahapan pengembangan dalam tesis ini menggunakan Dick, Carey & Carey. Pengembang memilih model ini karena Dick, Carey & Carey menawarkan desain yang utuh dan terstruktur dalam pengembahan bahan pembelajarannya. Rangkaian kegiatan yang dilakukan pengembang dalam mengembangkan Pendidikan Agama Kristen dengan topic Pertumbuhan Iman Kristen adalah: 1). mengidentifikasi kebutuhan untuk menentukan tujuan umum pembelajaran, 2). menanalisis pembelajaran, 3). menganalisis pebelajar dan konteks, 4). merumuskan tujuan pembelajaran khusus, 5). mengembangkan instrument penilaian, 6). mengembangkan strategi pembelajaran, 7). mengembangkan dan memilih bahan pembelajaran, 8). mendesain dan melaksanakan penilaian formatif, 9). merevisi produk pembelajaran. Selama proses pengembangan bahan pembelajaran, ahli isi pelajaran PAK, ahli media pembelajaran , ahli desain pembelajaran, pembelajar dan beberapa pebelajar memberikan tanggapan dan masukan perbaikan. Pengembangan bahan pembelajaran ini menghasilkan: 1). bahan pembelajaran, 2). panduan pembelajar, dan 3). Panduan pebelajar. Kajian produk menunjukkan bahwa: 1). Ahli isi PAK menyetujui substansi pelajaran yang disajikan dalam bahan pembelajaran, 2). ahli media pembelajaran menyetujui yang ditampilkan dalam bahan pembelajaran, 3). ahli desain pembelajaran menyetujui proses pembelajaran yang ditawarkan dalam bahan pembelajaran, 4). Pembelajar memberikan opini yang positif dalam penggunaan bahan pembelajaran di kelas, 5). Pebelajar memberikan respon yang antusias terhadap bahan pembelajaran. Bahan pembelajaran yang dikembangkan oleh Sony Julianto ini dapat digunakan oleh pembelajar dan pebelajar di Sekolah Minggu GKT 3 Malang untuk kelompok umur Remaja 10-12 tahun. Bahan ini juga bisa digunakan oleh pihak-pihak yang berminat mengajarkan Pertumbuhan Iman Kristen dalam pembelajaran kelompok umur Remaja 10-12 tahun.

Struktur gerak dalam wacana interaksi kelas di kelas X Bahasa SMA Negeri 5 Malang / Kiftian Hady Prasetya

 

ABSTRAK Prasetya, Kiftian Hady. 2015. Struktur Gerak Dalam Wacana Interaksi Kelas di Kelas X Bahasa SMA Negeri 5 Malang. Tesis, Program Studi Pendidikan Bahasa Indonesia, Pascasarjana Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Anang Santoso, M.Pd, (II) Dr. Imam Agus Basuki, M.Pd. Kata kunci: wacana, interaksi kelas, struktur gerak, fungsi tuturan. Wacana interaksi kelas pada merupakan suatu peristiwa komunikasi dengan corak yang khas dengan didasari oleh konteks interaksi yang melatarinya dan menyebabkan munculnya wacana lisan dengan ciri-ciri tertentu. Wacana interaksi kelas dibentuk oleh rangkaian struktur yang berjenjang. Jenjang atau peringkat struktur tersebut adalah pelajaran (lesson), transaksi (transaction), pertukaran (exchange), gerak (move), dan tindak (act). Pelajaran merupakan peringkat struktur tertinggi dalam interaksi kelas yang terdiri dari rangkaian transaksi. Transaksi meliputi pembukaan, inti, dan penutup dalam pembelajaran yang memuat beberapa pertukaran. Pertukaran merupakan satuan komunikasi yang ditandai dengan adanya gerak pembukaan, gerak penjawaban, dan gerak tindak lanjut yang terdiri atas beberapa tindak yang terefleksikan dalam bentuk-bentuk ujaran. Fokus penelitian yang dikaji dalam penelitian ini yaitu struktur gerak (gerak pembukaan, gerak penjawaban, dan gerak tindak lanjut) dan fungsi tuturan (fungsi menyatakan, menanyakan, memerintah, dan mengungkapkan) yang dilakukan oleh guru dan siswa dalam interaksi kelas. Penelitian ini memiliki kepentingan untuk mengetahui bagaimana penggunaan bahasa dan penataan informasi dalam tuturan guru dan siswa yang terimplikasi pada pola-pola struktur gerak dan fungsinya dalam wacana interaksi kelas yang layak dikaji dan menarik untuk dikaji karena memiliki karakteristik yang khas dan berbeda pada tiap interaksi di kelas. Penelitian ini merupakan penelitian kualitatif. Sumber data penelitian ini adalah guru mata pelajaran Bahasa Indonesia Titik Wulandari, S.Pd dan 38 orang siswa kelas X Bahasa SMA Negeri 5 Malang tahun akademik 2014/2015. Data penelitian ini adalah teks dalam konteks. Teks yang dimaksud adalah ujaran atau tuturan guru dan siswa (berupa kata, klausa, dan kalimat yang digunakan dalam berinterkasi) yang terjadi dalam konteks situasi (dalam hal ini pembelajaran di kelas X Bahasa SMA Negeri 5 Malang) dengan berlatar konteks budaya masyarakat Jawa. Data penelitian ini diperoleh dengan menggunakan alat bantu rekam yang berupa handycam dan audio recorder serta catatan lapangan yang selanjutnya ditranskrip, dikelompokkan sesuai dengan fokus penelitian, dimasukkan dalam instrumen pengumpulan data, dan kemudian dianalisis dengan menggunakan ancangan analisis wacana. Berdasarkan penganalisisan data, ditemukan hasil penelitian sebagai berikut. Pertama, struktur gerak dalam wacana interaksi kelas pada penelitian ini adalah gerak pembukaan, gerak penjawaban, dan gerak tindak lanjut. Gerak pembukaan memuat beberapa tindak tuturan yang berupa pertanyaan sesungguhnya, pertanyaan semu, permintaan manajemen langsung, permintaan manajemen tak langsung, permintaan disiplin langsung, permintaan disiplin tak langsung, informatif partisipan, informatif nonpartisipan, metastatemen, dan ekspresif. Gerak penjawaban memuat beberapa tindak tuturan yang berupa jawaban partisipan, jawaban nonpartisipan, reaksi verbal, reaksi nonverbal, ucapan terima kasih, pengulangan, dan pemicu ulang. Kemudian, struktur gerak tindak lanjut memuat beberapa tindak tuturan yang berupa penerimaan, penghargaan, pembetulan, komentar, pengulangan, dan parafrase. Kedua, fungsi tuturan berupa (1) fungsi menyatakan yang meliputi fungsi menyatakan informasi dan fungsi menyatakan penjelasan, (2) fungsi menanyakan yang meliputi fungsi pertanyaan untuk inisiasi/ pemicu, fungsi pertanyaan untuk negosiasi/ penawaran, dan fungsi pertanyaan untuk elisitasi/ konfirmasi, (3) fungsi memerintah yang meliputi fungsi menyuruh, fungsi menuntut, fungsi menganjurkan, fungsi melarang, dan fungsi memberi nasihat, serta (4) fungsi mengungkapkan yang meliputi fungsi mengungkapkan rasa senang, mengungkapkan rasa tidak senang, mengungkapkan permintaan maaf, dan mengungkapkan terima kasih. Dari analisis struktur gerak dan fungsi tuturan tersebut, dibahas mengenai relevansi struktur gerak, dominasi struktur gerak pembukaan, dan hilangnya tindak tuturan yang terjadi dalam wacana interaksi kelas di kelas X Bahasa SMA Negeri 5 Malang. Relevansi struktur gerak dibahas untuk mengetahui penggunaan struktur gerak sebagai penjalin keterhubungan suatu interaksi. Dominasi struktur gerak pembukaan dibahas untuk mengetahui upaya guru dalam mengontrol jalannya suatu interaksi yang sesuai dengan tujuan pembelajaran yang telah dirancang. Hilangnya tindak tuturan dibahas untuk mengetahui penggunaan tindak tuturan seperti tindak ucapan terima kasih pada gerak penjawaban dan tindak penghargaan pada gerak tindak lanjut yang tidak digunakan oleh guru maupun siswa dalam penelitian ini. Simpulan akhir, dengan ada dan tidaknya tindak tuturan pada masing-masing struktur gerak yang memiliki fungsi tuturan, hasil penelitian menunjukkan bahwa penggunaan tindak tuturan pada struktur gerak didasarkan pada (1) perkembangan proses pembelajaran, (2) perkembangan kogintif siswa, dan (3) perilaku dan kebiasaan guru dan siswa. Ada beberapa perilaku berbeda dari guru dalam memusatkan dan mengontrol proses pembelajaran dengan mengalihkan fokus pembelajaran saat pembahasan materi pelajaran sebagai upaya untuk memberikan refleksi kepada siswa agar pembelajaran yang berlangsung tidak terasa kaku dan membosankan. Selain itu, perlu dilakukan penelitian lain untuk memberikan perbandingan pada subjek yang berbeda seperti pelakuan pada dua guru atau lebih dalam kelas yang sama.

Visualization strategy on reading comprehension of college students as observed from cognitive styles and autonomous learning levels / Ainul Addinna

 

ABSTRAK Addinna, Ainul. 2016.StrategiVisualisasiPadaPemahamanMembacaMahasiswa yang Ditinjaudari Gaya KognitifdanTingkatanPembelajaranOtonom.Thesis. English Language Teaching, Graduate Program of State University of Malang. Advisors: (I)Dr.Suharmanto, M.Pd., (II) Prof. Dr.YazidBasthomi, M.A. KataKunci:StrategiVisualisasi, Field Independent (FI), Field Dependent (FD), TingkatanPembelajaranOtonom. Penelitianinibertujuanuntukmencaridampakdaristrategivisualisasipadapemahamanmembacadilihatdarigayakognitifdantingkatanpembelajaranotonomsiswadanjugainteraksiantarastrategimembaca, gayakognitifdantingkatanpembelajaranotonom.Penelitianiniadalahfaktorialdengan test akhir yang menggunakanduakelompokmahasiswa semester limajurusanbahasaInggrisUniversitasNegeri Malang tahunajaran2013/2014. GEFTtes, reading comprehension test, danautonomy level questionnaireadalahinstrumen yang digunakansebagaialatpengumpulan data dalampenelitianini. GEFTtesdigunakanuntukmengklasifikasisinswamenjadifield independent danfield dependent, sedangkanautonomy level questionnairedigunakanuntukmenentukantingkatanotonomsiswa.Skordarites pemahaman membacadidapatdarireading comprehension testdanhasil data tersebutdiolahsebagai data awaluntukmengujihipotesadengannilai level signifikanα .05. Hasiltemuanmenunjukkanbahwa level signifikandaristrategivisualisasidannonvisualisasi (konvensionalstrategi)lebihtinggidarinilaiα.05 (Sig .711 > Sig.α .05). Ini menjelaskan bahwa tidak ada perbedaan yang signifikan antarasiswa yang diajarkandenganstrategivisualisasidibandingkandenganmereka yang diajarkandenganstrateginonvisualisasi.Perbedaanantarasiswafield independent dansiswafield dependentterhadappemahamanmembacajugatidakmenunjukkanperbedaan yang signifikan α .05 (Sig .411 > Sig.α .05).Tidak hanya itu, level signifikan dari tingkatanotonomjugatidakmemperlihatkanperbedaan yang signifikan α .05 (Sig .412 > Sig.α .05). Iniberartitingkatanotonomsiswatidakmempengaruhipemahamanmembacamereka.Terakhir, tidakterdapatnyainteraksiantarastrategimembaca, gayakognitifdantingkatanpembelajaranotonomyang dibuktikansecarastatistik α .05(Sig .704 > Sig.α .05). Walaupunhasilpenelitianmenunjukkanhasil yang tidaksignifikanterhadapperbedaandanefekdarivariabelbebasdanterikat, namunberdasarkandarikuesioner yang didistribusikanpadagrupeksperimental, secaraobjektifmenjelaskanbahwastrategivisualisasimampumembawaatmosfir yang baguskedalamkelas. Strategiinimampumengurangi rasa bosansiswaselama proses pembelajarandanjugamampumemotivasisiswadalammembaca.

Pengembangan model pembelajaran ekspresi imajinasi untuk menulis puisi bebas kelas V sekolah dasar / Yunika Afryaningsih

 

Pemanfaatan aktivitas dan lingkungan sekitar siswa dalam proses belajar mengajar IPS terpadu pada kelas VIII SMP Terbuka IV Kota Malang / Kus Irawan Prabowo

 

ABSTRAK Prabowo, Kus Irawan. 2015. Pemanfaatan Aktivitas Dan Lingkungan Sekitar Siswa Dalam Proses Belajar Mengajar IPS Terpadu Pada Kelas VIII SMP Terbuka IV Kota Malang. Tesis, Prodi S2 Pendidikan Ekonomi Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Mit Witjaksono, MS.Ed. (II) Dr. Agung Haryono, S.E., M.P., Ak. Kata Kunci: Aktivitas, Lingkungan, IPS Terpadu, dan Sumber Belajar. Penelitian ini bertujuan mengetahui pemanfaatkan aktivitas siswa dalam proses belajar mengajar IPS Terpadu, mengetahui pemanfaatkan lingkungan sekitar siswa dalam proses belajar mengajar IPS Terpadu dan mengetahui hasil belajar IPS Terpadu dengan memanfaatkan aktivitas dan lingkungan sekitar siswa pada kelas VIII SMP Terbuka IV Kota Malang. Penelitian ini menggunakan pendekatan kualitatif dengan desain grounded theory. Tujuan menggunakan pendekatan kualitatif adalah berusaha memberikan gambaran yang sistematis, aktual dan akurat mengenai proses belajar mengajar IPS Terpadu dengan memanfaatkan aktivitas dan lingkungan sekitar siswa. Mengambil situs penelitian di SMP Terbuka IV Kota Malang, sebagai subjek penelitian adalah siswa kelas VIII SMP Terbuka IV Kota Malang, data dikumpulkan dengan metode observasi dan wawancara dengan didukung studi dokumentasi. Sebagai informan utama adalah siswa dan informan pendukung adalah wakil kepala sekolah, guru, dan orangtua. Data dianalisis dengan metode analisis Strauss dan Corbin. Aktivitas dan pengalaman siswa terbagi menjadi dua kategori yaitu aktivitas biasa dan aktivitas khusus (kerja), aktivitas biasa adalah aktivitas yang dilakukan sehari-hari, tidak berhubungan dengan kerja mencari uang, sedangkan aktivitas khusus adalah aktivitas yang berhubungan dengan keterampilan dunia kerja untuk mencari uang. Lingkungan sekitar siswa terdiri dari bermacam-macam pelaku usaha dan lahan pertanian. Hasil dari penelitian ini adalah aktivitas siswa dapat digunakan untuk memadukan materi dan sumber belajar IPS Terpadu, lingkungan sekitar siswa dapat digunakan untuk memadukan materi dan sumber belajar IPS Terpadu dan hasil belajar IPS Terpadu dengan memanfaatkan aktivitas dan lingkungan sekitar siswa membuat pembelajaran lebih efektif dan efisien, memberikan kemudahan dalam mendeskripsikan materi pelajaran, mempermudah mengingat materi yang telah diajarkan pada siswa kelas VIII SMP Terbuka IV Kota Malang dan memberikan pengetahuan mengenai sikap atau tindakan yang berguna bagi dirinya sendiri dan orang lain. Guru harus cerdas menggali informasi dan potensi yang melekat pada siswa baik di lingkungan sekolah maupun keluarga yang dapat digunakan sebagai inspirasi dan sumber belajar dalam pengajaran materi pelajaran IPS Terpadu. Guru harus membina hubungan fungsional antara siswa dan orangtua untuk mendukung proses belajar siswa sehingga dapat mencapai kompetensi lulusan.

Analisis pengaruh kinerja keuangan terhadap harga saham LQ45 di Bursa Efek Indonesia / Ferri Ferdian

 

Kata Kunci: Laporankeuangan, LQ45, Hargasaham, Debt to Equity Ratio, Price Earning Ratio, Earning per Share, Return on Equity, Price to Book Value. Laporankeuanganyang dipublikasikanmerupakansumberinformasi yang sangatpentingkhususnyainformasirasiokeuangan, yang menjadiperhatiandalamlaporankeuanganbagiparapenggunaterutamapihakeksternperusahaan.Rasiokeuangan yang dimilikiperusahaanmerupakansalahsatuinformasi yang dapatdigunakandalammenilaikinerjaperusahaan yang mewakilivariabel fundamental perusahaan.Pengumumanlaporankeuangantersebutdapatmempengaruhihargasekuritasperusahaanemiten yang melakukanpengumuman. Tujuanpenelitianiniadalahmengetahuiberapabesartingkatpengaruhdebt to equity ratio, price earning ratio, earning per share, return on equity danprice to book valueterhadaphargasahamLQ45 di Bursa EfekIndonesiaselamatahun 2006sampai 2009.Sampeldalampenelitianiniadalahsebanyak 28 perusahaan.Teknikpengambilansampeldalampenelitianinimenggunakanteknikpurposive sampling.Analisis data yang digunakandalampenelitianiniadalahanalisisregresi linear berganda, di manaanalisisinimengujisecaraparsialpengaruhvariabel–variabelbebasterhadapvariabelterikatnya. Hasildaripenelitianinimenjelaskanbahwaprice earning ratio,earning per share danreturn on equityberpengaruhsignifikanterhadaphargasahamdengantingkatsignifikansimasing-masingsebesar 0,039, 0,000, 0,006.Sedangkandebt equity ratiodanprice to book valuetidakberpengaruhterhadaphargasahamdengantingkatsignifikansimasing-masingsebesar 0,145 dan 0,344. Berdasarkanhasilpenelitianini, saran yang bisadiberikanuntukpenelitianselanjunyaadalahdenganmengembangkanvariabel-variabelpenelitian, menambahjumlahsampelpenelitiandanpengklasifikasianperusahaan yang diteliti agar didapatkanhasil yang lebihakuratdanrepresentatif.

Peningkatan keterampilan berbicara melalui metode diskusi pada siswa kelas V SDN Turi 2 Kota Blitar / Alfin Heremku

 

Kata Kunci: keterampilan berbicara, metode diskusi Berdasarkan observasi pratindakan, pembelajaran yang berlangsung kurang dapat melatih siswa dalam mengembangkan keterampilan berbicara. Guru cenderung menggunakan buku teks dalam melaksanakan pembelajaran khususnya penerapan keterampilan berbicara sehingga sebagian bersar siswa merasa kesulitan disaat diminta untuk mengungkapkan pendapatnya menggunanakan bahasa yang baik dan benar. Tujuan penelitian ini adalah (1) Mendeskripsikan penerapan metode diskusi untuk meningkatkan ketarampilan berbicara siswa kelas V SDN Turi 2 Kota Blitar, (2) mendeskripsikan peningkatan keterampilan berbicara siswa kelas V SDN Turi 2 Kota Blitar dengan metode diskusi, (3) mendeskripsikan sikap siswa kelas V SDN Turi 2 Kota Blitar dengan menggunakan metode diskusi. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) dengan model kolaboratif menggunakan acuan model siklus PTK. Penelitian ini dilaksanakan melalui 2 siklus, dengan subjek penelitian yaitu siswa kelas V yang berjumlah 33 siswa. Teknik pengumpulan data dilakukan dengan observasi, tes lisan dan dokumentasi. Instrumen penilaian yang digunakan berupa pedoman observasi, dan soal tes. Hasil penelitian ini menunjukan bahwa skor rata-rata kemampuan berbicara siswa pada tahap pratindakan adalah 45 dengan persentase 12 %. Hal ini menunjukah bahwa pembelajaran pada tahap pratindakan memperoleh kualifikasi nilai sangan kurang (SK). Pelaksanaan pembelajaran berbicara melalui metode diskusi dilaksanakn melalui 2 siklus. Pada siklus I skor rata-rata yang diperoleh adalah 19 dengan jumlah persentase sebesar 95 %, persentase tersebut termasuk kualifikasi sangat baik (SB). Pada siklus II skor rata-rata yang diperoleh tidak berubah sperti pada siklus I yaitu 19 dengan jumlah persentase 95 %. Kemammpuan berbicara siswa kelas V mengalami peningkatan pada tiap siklus. Perolehan skor rata-rata siswa yang mengalami peningkatan secara bertahap mulai dari, siklus I dan siklus II. Skor rata-rata yang diperoleh pada siklus I yaitu 82 dengan persentase 82 %. Siklus II skor rata-rata yang diperoleh yaitu 89 dengan persentase 89 %. Sikap siswa pada proses pembelajaran mengalami peningkatan pada tia siklus. Pada siklus I skor rata-rata yang diperoleh yaitu 64 dengan persentase 64 %, sedangkan pada siklus II mengalmi peningkatan yaitu 84 dengan persentase 84 %. Dengan demikian dapat disimpulkan bahwa penggunaan metode diskusi dapat meningkatkan kemampuan berbicara siswa. Berdasarkan hasil penelitian ini dapat disarankan agar dalam meningkatkan keterampilan berbicara guru dapat melaksanakan pembelajaran mengunakan metode diskusi.

Argumentasi pada teks pidato siswa kelas X SMA Negeri 1 Rambipuji / Beby Dwi Febriyanti

 

ABSTRAK Febriyanti, Beby Dwi. 2015. Argumentasi pada Teks Pidato Siswa Kelas X SMA Negeri 1 Rambipuji. Tesis. Program Studi Pendidikan Bahasa Indonesia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Sunaryo, H.S., S.H., M.Hum., (II) Dr. Kusubakti Andajani,M.Pd. Kata kunci: Argumentasi, teks pidato Secara umum penelitian ini bertujuan untuk mendeskripsikan argumentasi dalam teks pidato siswa kelas X SMA Negeri 1 Rambipuji. Argumentasi merupakan retorika yang berisikan adanya suatu penjelasan, pembuktian, alasan yang digunakan untuk meyakinkan orang lain. Argumentasi dapat ditemui dalam berbagai macam wadah, salah satunya teks pidato. Argumentasi tidak dapat dipisahkan dengan penalaran, sebab penalaran merupakan proses berpikir logis menyusun fakta dan alasan untuk menghasilkan kesimpulan yang menjadi tujuan penulis. Penelitian ini diarahkan untuk mendeskripsikan muatan argumentasi dalam teks pidato siswa yang meliputi, (1) elemen-elemen argumentasi, (2) pola argumentasi, dan (3) teknik penalaran untuk mengembangkan argumentasi. Penelitian ini termasuk dalam penelitian kualitatif. Sumber data dalam penelitian ini adalah teks pidato yang ditulis siswa kelas X SMA Negeri 1 Rambipuji, sedangkan data penelitian yang digunakan berupa kalimat atau susunan kalimat yang mengandung muatan argumentatif. Teks pidato yang dianalis sejumlah 50 teks.Pengecekan keabsahan data dilakukan dengan triangulasi.Analisis data dilakukan dalam beberapa tahapan, (1) reduksi data dilakukan dengan memilih dan mengidentifikasi data yang sesuai dengan fokus penelitian, (2) menyajikan dan memaparkan keseluruhan data, (3) penarikan simpulan dari data yang telah diperoleh,terkait dengan elemen argumentasi, pola argumentasi, dan teknik penalaran. Hasil penelitian ini membahas elemen, pola, dan teknik penalaran argumentasi. Pertama, tentang penggunaan elemen argumentasi pada teks pidato siswa yang mencakup (a) claim, claim nilai/claim fakta/claim kebijakan, (b) ground, (c) warrant, (d) backing, (e) qualifier, dan (f) rebuttal. Keenam elemen tersebut ditemukan pada teks pidato siswa. Kedua, tentang pola argumentasi teks pidato siswa yang diketahui membentuk pola I (C-G) hingga pola IV (C-G-W-B-Q). Pola I mengalami variasi dengan penambahan elemen qualifier dan rebuttal. Pola I variasi 1 (C-G-Q), pola I variasi 2 (C-G-R), pola I variasi 3 (C-G-Q-R). Pola II terdiri dari (C-G-W), juga mengalami variasi dengan adanya elemen qualifier dan rebuttal. Pola II membentuk variasi 1 (C-G-W-Q), pola II variasi 2 (C-G-W-R), dan pola II variasi 3 (C-G-W-Q-R). Pola III terdiri dari (C-G-W-B), hanya mengalami satu variasi dengan adanya elemen rebuttal, sehingga pola III variasi 1 (C-G-W-B-R). Pola IV pada teks pidato siswa terdiri dari (C-G-W-B-Q) tidak mengalami adanya variasi. Ketiga mengenai teknik penalaran pengembangan argumentasi yang terdiri atas (1) argumen dengan contoh, (2) argumen dengan analogi, (3) argumen dengan otoritas, (4) argumen dengan sebab, (5) argumen dengan deduktif. Berdasarkan hasil pembahasan dan simpulan, dikemukakan beberapa saran.Saran tersebut ditujukan kepada guru Bahasa Indonesia, bahwa hasil analisis dan temuan data penelitian ini dapat dijadikan bahan referensi mengenalkan siswa pada elemen argumentasi, pola argumentasi, dan teknik penalaran dalam penyusunan argumentasi. Guru juga disarankan lebih melatih siswa agar tanggap dan peka pada peristiwa di sekitarnya, sebab hal itu dapat dijadikan bahan siswa untuk keperluan argumennya.(2) peneliti selanjutnya diharapkan dapat mengembangkan penelitian lebih lanjut terkait dengan argumentasi ataupun penalaran pada objek yang berbeda dengan pembahasan yang lebih luas.

Pengaruh penerapan metode inkuiri terbimbing dipadu metode Numbered Heads Together (NHT) terhadap keterampilan metakognitif dan hasil belajar kognitif siswa kelas VII SMP Negeri 5 Malang / Sayu Chyntia Ekawati

 

Kata Kunci: Numbered Heads Together (NHT). Dalam kehidupan sehari-hari, keterampilan metakognitif merupakan salah satu kecakapan hidup yang dibutuhkan seorang siswa tidak hanya di sekolah tetapi dibutuhkan sepanjang hidup seseorang. Siswa yang memiliki keterampilan metakognitif memiliki peluang besar menjadi pebelajar mandiri. Keterampilan metakognitif seringkali tidak disadari keberadaannya didalam kegiatan belajar mengajar khususnya para guru maupun siswa itu sendiri. Untuk mengembangkan keterampilan metakognitif siswa perlu dilakukan pengelolaan metakognitif dengan menggunakan berbagai metode pembelajaran kooperatif. Pada penelitian ini digunakan pembelajaran kooperatif dengan menggunakan metode inkuiri terbimbing yang dipadukan dengan motode Numbered Heads Together (NHT). Dari hasil observasi lapangan dan wawancara dengan guru Biologi diketahui bahwa pembelajaran yang dilakukan di SMP Negeri 5 Malang masih tergolong teacher centered . Menurut guru biologi, siswa masih belum mampu dalam mengembangkan keterampilan metakognitif meskipun tanpa disadari mereka juga pernah menggunakan keterampilan metakognitif. Pengelolaan keterampilan metakognitif juga masih rendah karena siswa belum pernah dilatih untuk mengembangkan keterampilan metakognitifnya. Selain itu, pada proses pembelajaran biologi ditemukan beberapa permasalahan, baik permasalahan yang berasal dari siswa maupun dari guru. Selain dari permasalahan tersebut, hasil belajar kognitif siswa pun bervariasi dari tingkat tinggi, sedang dan rendah. Dari hasil belajar kognitif yang bervariasi tersebut dapat diketahui tingkat keterampilan metakognitif siswa. Tingkatan soal yang digunakan dalam Lembar Kerja Siswa (LKS) dan ulangan harian pun kebanyakan masih sebatas antara C1-C3. Penelitian ini dilakukan di SMP Negeri 5 Malang. Populasi dalam penelitian ini adalah seluruh siswa SMP Negeri 5 Malang Kelas VII tahun ajaran 2010/2011. Sampel dalam penelitian ini adalah siswa kelas VII RSBI 5 sebagai kelas kontrol dan siswa kelas VII RSBI 4 sebagai kelas eksperimen. Siswa kelas VII RSBI 5 terdiri atas 28 siswa sedangkan siswa kelas VII RSBI 4 terdiri dari 28 siswa. Jenis penelitian yaitu Penelitian quasi eksperimen atau eksperimen semu. Variabel bebas dalam penelitian ini adalah metode Pembelajaran inkuiri terbimbing yang dipadu metode Numbered Heads Together (NHT) pada kelas eksperimen dan metode pembelajaran konvensional pada kelas kontrol. Variabel terikat dalam penelitian ini adalah: keterampilan metakognitif dan hasil belajar kognitif. Dalam penelitian ini metode pengumpulan data melalui hasil pre tes yang dilakukan sebelum penerapan metode pembelajaran dan pos tes. Data keterampilan metakognitif dan hasil belajar kognitif yang diperoleh dari hasil pre tes dan post tes dianalisis dengan menggunakan teknik analisis statistik Anakova. Hasil penelitian menunjukkan metode pembelajaran inkuiri terbimbing yang dipadu dengan metode NHT berpengaruh terhadap keterampilan metakognitif siswa. Hal ini ditunjukkan dengan nilai probabilitas 0,001

Analisis buku teks tematik terpadu kurikulum 2013 kelas IV SD/MI tema berbagai pekerjaan (suatu kajian sebagai kelayakan bahan ajar) / Novita Kusuma Ningrum

 

ABSTRAK Ningrum, Novita Kusuma. 2015. Analisis Buku teks tematik terpadu Kurikulum 2013 Kelas IV SD/MI Tema Berbagai Pekerjaan (Suatu Kajian Sebagai Kelayakan Bahan Ajar). Tesis. Program StudiPendidikanDasar, Pascasarjana, UniversitasNegeri Malang. Pembimbing: (1) Dr. H. Abdur Rahman As’ari, M.Pd.,M.A., (II) Dr. EdyBambangIrawan, M.Pd. Kata Kunci: AnalisisBukuTeksTematik, Kurikulum 2013, TemaBerbagaiPekerjaan TujuanpenelitianiniadalahuntukmendeskripsikankesesuaianbukutekstematikterpaduKurikulum 2013 berdasarkanstandarisiKurikulum 2013, pembelajaranterpadu, danpendekatansaintifik. Ketiga kajian tersebut lebih spesifik untuk dijadikan pedoman analisis buku teks Tematik Terpadu Kurikulum 2013 Kelas IVTema Berbagai Pekerjaan, yaitu Standar Isi Kurikulum 2013 yang meliputi kesesuaian SKL, KI, dan KD kelas IV SD. Penelitianinimerupakanpenelitiandeskriptifkualitatif. Peneliti melakukan analisis isi (content analysis)terhadap buku tematik terpadu Kurikulum 2013 kelas IV SD/MI tema berbagai pekerjaan. Hasilanalisis aspek kesesuaian standarisidengan Kurikulum 2013 menunjukkan tingkat kesesuaian sebesar 93%dengankriteriacukupvalid. Hasilanalisis aspek Pembelajaranterpadukarakteristikholistikmenunjukkan tingkat kesesuaian sebesar 95,8%dengankriteriacukupvalid. Hasilanalisis aspek Pembelajaranterpadukarakteristikbermaknamenunjukkan tingkat kesesuaian sebesar 90,2%dengankriteriacukup valid.Hasilanalisis aspek Pembelajaranterpadukarakteristikotentikmenunjukkan tingkat kesesuaian sebesar 94,4%dengankriteriacukup valid. Hasilanalisis aspek Pembelajaranterpadukarakteristikaktifmenunjukkan tingkat kesesuaian sebesar 98,6%dengankriteriacukup valid.Hasil analisis aspek pendekatan saintifik menunjukkan tingkat kesesuaian sebesar 76,3 %. Hasil persentase kemudian dikonversikan menggunakan tabel kriteria tingkat kesesuaian termasuk dalam tingkat validitas cukup valid.

Kajian kualitatif tentang representasi makroskopik, submimkroskopik dan simbolik terhadap sistem dan prinsip kerja larutan penyangga siswa kelas XI-IPS SMAN 1 Lawang / Brian Anggriawan

 

Kata Kunci : kajian kualitatif, representasi makroskopik, submikroskopik dan simbolik, sistem dan prinsip kerja larutan peyangga. Pemahaman konsep kimia yang benar merupakan pondasi utama untuk dapat memahami konsep-konsep lain yang berkaitan dan lebih kompleks dengan benar. Materi larutan penyangga bersifat abstrak dan kompleks sehingga materi tersebut sukar untuk dipelajari, khususnya terkait dengan sistem dan prinsip kerja larutan penyangga. Pemahaman konsep kimia meliputi kemampuan untuk menggambarkan konsep dan fenomena yang terkait menggunakan representasi makroskopik, submikroskopik dan simbolik. Penelitian ini bertujuan untuk mengetahui (1) representasi makroskopik, (2) representasi submikroskopik, (3) representasi simbolik serta (4) pola hubungan diantara ketiga tingkat representasi terhadap sistem dan prinsip kerja larutan penyangga pada siswa. Penelitian ini merupakan penelitian kualitatif jenis studi kasus. Peranan peneliti di lapangan adalah sebagai instrumen dibantu protokol wawancara untuk melakukan wawancara mendalam. Partisipan penelitian adalah 8 siswa kelas XI-IPA SMA Negeri 1 Lawang yang telah dipilih secara sampel purposif. Analisis data yang dilakukan adalah menstranskrip hasil wawancara, mengidentifikasi, mengkaji representasi siswa dan membuat pernyataan umum terkait representasi seluruh siswa. Pengecekan keabsahan data yang dilakukan adalah pemeriksaan sejawat, pengecekkan partisipan dan triangulasi dengan hasil penelitian lain. Berdasarkan hasil analisis data tersebut, diketahui representasi siswa sebagai berikut. (1) Sebagian besar siswa dapat merepresentasikan sistem dan prinsip kerja larutan penyangga pada tingkat makroskopik ditinjau dari cara pembuatan dan sifat larutan penyangga dengan benar; (2) Sebagian besar siswa dapat membuat gambaran submikroskopik sistem larutan penyangga asam mendekati keadaan sesungguhnya, namun menunjukkan pemahaman yang salah terhadap ionisasi asam lemah dalam larutan dan/atau tidak dapat menjelaskan efek ion senama. Di sisi lain, hanya sebagian kecil siswa yang dapat merepresentasikan prinsip kerja larutan penyangga pada tingkat submikroskopik, namun hanya terbatas pada menjelaskan reaksi dan perubahan mol kedua komponen larutan penyangga ketika larutan penyangga ditambahkan sedikit asam atau basa. Sedangkan siswa lainnya kesulitan menjelaskan reaksi yang terjadi ketika larutan penyangga ditambahkan sedikit asam atau basa; (3) Seluruh siswa dapat merepresentasikan sistem larutan penyangga pada tingkat simbolik dengan cara menghitung pH larutan penyangga asam yang dibuat dengan cara menambahkan larutan asam lemah dengan garamnya yang dibentuk dengan basa kuat. Di sisi lain, sebagian besar siswa tidak dapat merepresentasikan prinsip kerja larutan penyangga pada tingkat simbolik dengan cara menghitung pH larutan penyangga setelah penambahan sedikit asam maupun basa dengan benar; dan (4) Pola hubungan yang sering ditunjukkan oleh siswa adalah hubungan representasi tingkat makroskopik dengan tingkat simbolik. Implikasi hasil penelitian ini dapat digunakan sebagai acuan agar guru dapat mempersiapkan pembelajaran secara maksimal dan mengetahui pemahaman konsep siswa

Penerapan pembelajaran scaffolding akuntansi menggunakan ujung jari pada materi jurnal untuk meningkatkan hasil belajar siswa kelas XI IPS-1 SMAN 5 Kupang Nusa Tenggara Timur / Subagya Susiati

 

ABSTRAK Subagya Susiati 2013, Penerapan Pembelajaran Scaffolding Akuntansi Menggunakan Ujung Jari pada Materi Jurnal Untuk Meningkatkan Hasil Belajar Siswa Kelas XI IPS-1 SMA Negeri 5 Kupang Nusa Tenggara Timur,Pascasarjana Universitas Negeri Malang, Program Studi Pendidikan Ekonomi . Pembimbing:(I) Prof. Dr. Wahjoedi, M.E., M.Pd, (II) Dr. Sri Umi Mintarti Widjaja, S.E.,MP.,Ak. Kata Kunci : Pembelajaran,Scaffolding, akuntansi menggunakan ujung jari, hasil belajar Masalah pembelajaran akuntansi bagi kelas XI IPS-1adalah kesulitan pemahaman dalam materi jurnal kurangnya penguasaan konsep, rendahnya penyelesaian tugas-tugas belajarnya yang dianggap sebagai cerminan kemalasan dalam belajar. Faktor penyebabnya adalah pengajaran guru tidak memenuhi kebutuhan siswa dan berorientasi pada target kurikulum. Bantuan yang diberikan guru tidak memperhatikan letak kesulitan anak ataupun cara yang mudah di pahami siswa, tidak memperhatikanpemilikan sumber daya yang cukup pada diri siswa untuk membuat kemajuan belajar mereka sehingga akibatnya hasil belajarmasih rendah. Berkaitan dengan permasalahan-permasalahan tersebut perlu diadakan penelitian penerapan pembelajaran scaffoldingakuntansi menggunakan ujung jari. Penerapan pembelajaran scaffoldingakuntansi mengunakan ujung jari merupakan praktek pembelajaran yang berdasarkan konsep Zona of Proximal Development dari Vygotsky. Penerapan pembelajaran scaffoldingberarti memberikankepada individu sejumlah besar bantuan guru atau orang lain yang lebih mampu selama tahap awal pembelajaran kemudian menarik bantuan tersebut, setelah dapat melakukan secara mandiri. Penelitian ini bertujuan untuk mengetahui (1) Bagaimana proses pembelajaran dengan penerapan pembelajaran scaffolding akuntansi menggunakan ujung jari pada materi jurnal siswa kelas XI IPS-1 di SMA Negeri 5 Kupang Nusa Tenggara Timur.(2) Apakah penerapan pembelajaran Scaffollding akuntansi menggunakan ujung jari pada materi jurnal dapat meningkatkan hasil belajar siswa kelas XI IPS-1(3) Bagaimana respon siswa terhadap penerapan pembelajaran scaffolding akuntansi menggunakan ujung jari pada materi jurnal. Jenis penelitian adalah Penelitian Tindakan Kelas (Classroom Action Reseach) mengacu pada model Kemmis & Mc Taggart, yang terdiri atas empat komponen yaitu : perencanaan, pelaksanaan tindakan, observasi dan refleksi. Penelitian Tindakan Kelas dilaksanakan dalam 2 siklus. Indikator keberhasilanpenelitian apabila siswa mampu mencapai nilai ketuntasan maksimal sebesar 70 dengan ketuntasan klasikal 80%. Metode penelitian menggunakan deskriptif kualitatif. Teknik pengumpulan data dengan observasi, tes, wawancara , catatan lapangan dan rekaman. Teknik analisis data dilakukan dengan reduksi data, display data dan verifikasi data. Hasil penelitian menunjukkan bahwa dengan penerapan pembelajaran scaffolding akuntansi menggunakan ujung jariberjalan dengan sangat baik, dengan sifat terpadunya scaffoldingakuntansi menggunakan ujung jari membantu melibatkan siswa, siswa menjadi aktif, antusias/bersemangat, termotivasi dan mengurangi frustrasi , pembelajaran menjadi efektif dan dapat meningkatkan pemahaman siswa sehingga mampu lebih mandiri untuk mencapai tujuan pembelajaran. Penerapan pembelajaran scaffolding akuntansi menggunakan ujung jari dapat meningkatkan hasil belajar siswa pada materi jurnal siswa kelas XI IPS-1 Kupang Nusa Tenggara Timur.Hasil tes awal siswa menunjukkan prosentase ketuntasan belajar klasikal yang dicapai 4% kriteria sangat kurang, hasil tes akhir siklus Imeningkat menjadi 40% kriteria sangat kurang dan hasiltes akhirsiklus II meningkat menjadi 92% kriteriasangat baik.Denganketerlaksana- an pembelajaran siklus I 78,1% kriteria baik dan siklus II 90.6% kriteria sangat baik dan aktivitas belajar siswa siklus I 77% kriteria baik siklus II 84% dengan kriteria baik. Respon siswa terhadap pembelajaran scaffoldingakuntansi menggunakan ujung jari baik karena menyenangkan dan dapat meningkatkan pemahaman. Disarankan bagi guru pembelajaran scaffolding akuntansi diujung jari dapat digunakan sebagai alternatif strategi pembelajaran yang inovatif untuk meningkatkan hasil belajar siswa pada kelas yang memiliki Zona of Proximal Development(ZPD) yang rendah.

Peningkatan kemampuan memahami isi teks dengan model pembelajaran SQ3R siswa kelas IV SDN Purwoasri 01 Kecamatan Singosari Kabupaten Malang / Singgih Dwi Prasetyo

 

Kata kunci: Model Pembelajaran SQ3R, Pembelajaran Bahasa Indonesia , Kemampuan Memahami isi teks. Model pembelajaran SQ3R adalah yang pada prinsipnya merupakan singkatan dari langkah-langkah mempelajari teks atau buku yang terdiri dari : (1) mensurvai isi ( survey : S ) (2) mengajukan pertanyaan yang dapat membimbing kita dalam kegiatan membaca ( question : Q ). (3) Membaca isi ( read : R1 ) (4) Menceritakan isi bacaan dengan kata-kata kita sendiri ( recite : R2 ) (5) Meninjau kembali isi bahan bacaan itu ; apakah yang kita ceritakan dengan kata-kata sendiri itu sesuai dengan isi yang sebenarnya atau tidak (review : R3 ). Dan membaca bacaan kurang dari 150 kata. Berdasarkan hasil observasi dilakukan oleh peneliti di kelas IV SDN Purwoasri 01 Kecamatan Singosari Kabupaten Malang pada waktu pembelajaran Bahasa Indonesia didapatkan fakta bahwa pembelajaran yang dilakukan masih berpusat pada guru dan masih menggunakan cara konvensional, sehingga siswa mengalami kebosanan dan siswa kurang aktif dalam pembelajaran. Dari hasil ulangan harian siswa pada materi menemukan kalimat utama menunjukkan rata-rata hasil belajar siswa hanya mencapai 59,5 dan hanya ada 11 siswa (55%) dari 20 siswa yang mencapai KKM yang ditentukan yaitu 65. Untuk itu agar dapat meningkatkan pembelajaran Bahasa Indonesia perlu diadakan perbaikan yaitu dengan menerapkan model pembelajaran SQ3R. Penelitian ini bertujuan untuk (1) Menerapkan Model Pembelajaran SQ3R untuk pada siswa Kelas IV SDN Purwoasri 01 Kecamatan Singosari Kabupaten Malang? (2) Meningkatkan kemampuan memahami isi teks dengan Model Pembelajaran SQ3R siswa Kelas IV SDN Purwoasri 01 Kecamatan Singosari Kabupaten Malang? Penelitian ini menggunakan pendekatan deskriptif kualitatif, sedangkan jenis penelitian yang digunakan dalam penelitian ini adalah penelitian tindakan kelas (classroom action research). Jenis Penelitian Tindakan Kelas ini menggunakan model kolaboratif partisipatoris. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara dan tes. Instrumen yang digunakan untuk pengumpulan data yaitu lembar observasi penyusunan RPP, lembar observasi pelaksanaan pembelajaran model SQ3R, lembar observasi aktivitas siswa, dan soal tes. Hasil penelitian yang telah dilakukan menunjukkan bahwa penggunaan model pembelajaran SQ3R untuk meningkatkan pembelajaran Bahasa Indonesia

Pendidikan dasar merupakan salah satu penunjang bagi pembangunan pendidikan / oleh Hanah Sjafradji

 

Pengaruh model reciprocal teaching terhadap hasil belajar kognitif siswa pada mata pelajaran akuntansi kelas XI IPS di SMA Islam Almaarif Singosari / Fian Primayanti

 

Kata kunci: Model Reciprocal Teaching, Hasil Belajar Kognitif Siswa Proses pembelajaran pada satuan pendidikan diselenggarakan secara interaktif, menyenangkan, menantang, dan memotivasi peserta didik untuk berpartisipasi secara aktif, serta memberikan ruang yang cukup untuk menumbuhkan kreatifitas, dan kemandirian sesuai dengan bakat, minat, dan perkembangan fisik, serta psikologis peserta. Hal ini menunjukkan bahwa mengajar yang didesain guru harus berorientasi pada aktivitas siswa sehingga kualitas pembelajaran meningkat. Peningkatan kualitas pembelajaran dalam implementasi KTSP menuntut kemandirian guru untuk menciptakan suasana belajar yang kondusif agar peserta didik dapat mengembangkan aktivitas dan kreatifitas belajar secara optimal, sehingga hasil belajar siswa meningkat. Salah satu cara untuk mengembangkan aktifitas belajar dan kreatifitas serta meningkatkan hasil belajar kognitif adalah model reciprocal teaching. Penelitian ini bertujuan untuk mengetahui pengaruh positif implementasi Reciprocal Teaching siswa pada mata pelajaran Akuntansi terhadap hasil belajar siswa kelas XI IPS di SMA Islam Almaarif Singosari. Hasil penelitian ini menunjukkan bahwa nilai signifikansi hasil belajar aspek kognitif siswa dari uji t independent sample one tail sebesar 0,009. Oleh karena itu dapat disimpulkan bahwa implementasi reciprocal teaching berpengaruh positif terhadap hasil belajar kognitif siswa. Hal ini juga didukung oleh tingkat keaktifan dan kemampuan berpikir kritis yang cukup tinggi pada siswa yang diajar dengan reciprocal teaching. Berdasarkan hasil penelitian ini, disarankan bagi guru dapat menggunakan reciprocal teaching sebagai suatu alternatif penerapan model pembelajaran yang positif dan disarankan bagi peneliti yang akan dating sebaiknya melakukan penelitian pada pokok bahasan akuntansi yang lain, melakukan pengukuran hasil belajar secara menyeluruh yaitu aspek kognitif, psikomotorik, dan afektif serta mempersiapkan instrumen penelitian secara matang, lebih memperluas dan memperdalam kajian baik yang berhubungan dengan segi konseptual maupun aplikasi model reciprocal teaching sehingga dapat memahami model pembelajaran ini dengan baik.

Oto-aktivitas sebagai dasar perkembangan academic achievement anak / oleh Sr. M. Laurentia Kartini

 

Using the think-pair-share strategy to improve speaking ability of students at the Islamic Education Department of STAIN Ternate / Abdurrahman HI. Usman

 

Thesis, English Language Education. Graduate Program, State University of Malang. Advisors: (1) Dr. Arwijati W. Murdibjono, M.Pd., Dip.TESL and (2) Dr. Gunadi Harry Sulistyo, M.A. Key words: teaching, speaking, the think-pair-share strategy, Islamic studies This research was conducted to improve the students’ speaking ability in English by using the think-pair-share strategy. The strategy was implemented through a classroom action research (CAR). The implementation of think-pair-share strategy involved three major stages of teaching and learning English, namely: Firstly, thinking: Students thought independently about the questions that have been posed, forming ideas of their own. Secondly, pairing: Students were discussing their thoughts in pairs. This step allows students to articulate their ideas and to consider those of others. Thirdrly, sharing: Students shared their ideas with other pairs and the whole class. This study was intended to give students the most appropriate strategy used to improve their speaking ability. The researcher employed four steps in each learning cycle, namely, planning an action, implementing the plan, observing the action, and reflecting on the results. In the teaching of speaking, the study encompassed the following produces: First, lecturer explained the materials about the topic; Second, the lecturer posed a problem or asked open-ended questions to which there might be a variety of answers. In this session, the lecturer gave the students ‘think time’ and directed them to think on their own about the question; Third, the lecturer grouped students into pairs (counting heads, A-B, A-B, male/female, etc.). Fourth, the lecturer then asked the students to pair with their partner and shared their ideas that they had thought before; Fifth, the pair then shared their ideas with another pair, or with the whole class. It was important that students need to be able to share their partner’s ideas as well as their own. The lecturer called on a few students to share their ideas with the rest of the class. The findings of the implementation of the think-pair-share strategy on the Cycle 1 was not successful. Some students were still not accustomed to experiencing the speaking process. Some were becoming frustrated when they were given speaking tasks and looked confused in completing the tasks, they were very slow to get started, and did not seem to have any ideas about what to speak. The average score achieved by the students in speaking performance at the end of Cycle 1 was 74.18 that did not meet the criteria. Thus, Cycle 2 was carried out by revising or modifying the plan. The revision consisted of: First, adding of the ‘think time’ from 5 to 10 minutes, Second, the students were given home assignment by asking not only to memorize the new words but also to make sentences at home by using the new words or terms given in the previous meeting. The students were asked to submit the home assignment to be scored for their final scores even the home assignment did not influence their scores in this study. This was done to motivate them to master the new words or terms. Third, in Cycle 2, the new words or terms given in the first and third meetings were checked not only by asking the students to mention the meaning of each word but also by dictating each other and mention the meaning of each word that were not done in Cycle 1. Fourth, the instructional media were not fully used during the teaching and learning process in some meetings in cycle 1, but in Cycle 2, the use of the instructional media was maximized in all meetings. The think-pair-share strategy applied in Cycle 2 was effective to enchance the students’ average speaking score that was 81.68 and it met the criteria of success. Based on the findings, it is suggested that the English lecturers can apply think-pair-share strategy since it is beneficial for the teaching of English at STAIN Ternate as well as for other subjects. Besides, it can motivate students to work together in developing ideas into the speaking activities.

Peranan gerakan Pramuka di sekolah dasar / oleh Sri Hartutik

 

Kompetensi pedagogik guru ekonomi yang telah lulus program sertifikasi dalam proses pembelajaran di SMA Negeri 1 Malang / Dian Justicia

 

Kata Kunci: Kompetensi Pedagogik, Guru Ekonomi, Proses Pembelajaran Upaya meningkatkan kualitas pendidikan terus menerus dilakukan pada setiap jenis dan jenjang pendidikan. Tugas dan peran guru semakin berat pada era globalisasi ini seiring dengan perkembangan ilmu pengetahuan dan teknologi. Maka dari itu diadakanlah program sertifikasi guru yang bertujuan untuk mensejahterakan kehidupan guru, tentunya guru yang mendapatkan tunjangan sertifikasi ini haruslah guru yang sudah menjalani proses uji kompetensi. Dengan adanya pemberian tunjangan yang diberikan pemerintah kepada guru yang professional diharapkan diimbangi dengan adanya usaha untuk memajukan pendidikan di Indonesia Tujuan penelitian ini adalah: (1) untuk mendeskripsikan kompetensi pedagogik guru ekonomi yang telah lulus program sertifikasi di SMA Negeri 1 Malang (2) untuk mendeskripsikan proses pembelajaran ekonomi di SMA Negeri 1 Malang? Pendekatan penelitian yang digunakan dalam penelitian ini adalah penelitian kualitatif . Sasaran penelitian ini adalah tiga guru ekonomi di SMAN 1 Malang yang telah mendapatkan tunjangan sertifikasi guru. Prosedur penelitian dalam penelitian ini adalah observasi awal, pelaksanaan penelitian, analisis data, penarikan kesimpulan data dan pelaporan. Teknik pengumpulan data yang dilakukan adalah observasi, dokumentasi dan wawancara mendalam. Instrumen yang digunakan untuk pengambilan data adalah wawancara mendalam tentang kompetensi pedagogik guru ekonomi yang telah lulus program sertifikasi di SMAN 1 Malang. Hasil dari penelitian ini menunjukkan bahwa kompetensi pedagogik yang dimiliki oleh guru ekonomi di SMAN 1 Malang sudah cukup baik, terbukti mereka semua telah berusaha menerapkan semua indikator yang terkandung dalam aspek-aspek yang ada pada kompetensi pedagogik meliputi: (1) penguasaan terhadap karakteristik peserta didik bisa ditempuh melalui berbagai cara seperti melakukan pengamatan tingkah laku (2) persiapan dalam mengajar dimulai dari pengembangan silabus, menyusun RPP, mempersiapkan media, dan menyusun format penilaian (3) cara melaksanakan pembelajaran dikelas disesuaikan dengan yang ada di RPP mulai dari kegiatan awal, kegiatan inti, daan penutup (4) menggunakan teori dan prinsip pembelajaran yang disesuaikan dengan materi seperti menerapkan pembelajaran kontekstual (5) dalam pemanfaatan media biasa menggunakan internet dan LCD (6) dalam mengaktualisasikan berbagai potensi yang dimiliki peserta didik bisa dilakukan dengan memmberikan motivasi dan pengarahan, memberikan pelatihan yang berkaitan dengan pelajaran yang diampu, bisa juga dengan menerapkan berbagai metode dalam pembelajaran seperti ceramah, diskusi, Tanya jawab, presentasi, penugasan, dan portofolio (7) dalam berkomunikasi dengan peserta didik diupayakan dua arah (two way traffic communication) dan dengan bahasa yang mudah dipahami (8) penilaian dan evaluasi dilakukan selama proses belajar mengajar berlangsung dan setelah proses usai. Bentuknya bisa melalui tes dan non tes,lisan dan tertulis (9) hasil dari evaluasi digunakan untuk mengukur ketercapaian KD, sebagai dasar penyusunan nilai rapot, dan digunakan untuk perbaikan proses belajar berikutnya (10) upaya dalam meningkatkan kualitas pembelajaran khususnya ekonomi di SMAN 1 Malang bisa ditempuh dengan berbagai cara seperti mengikuti Musyawarah Guru Mata Pelajaran (MGMP), mengembangkan bahan ajar, model pembelajaran, dan mengikuti seminar atau diklat. Dari hasil tersebut maka dapat ditarik beberapa kesimpulan dari penelitian ini, yaitu: (1) Pelaksanaan pembelajaran di SMA Negeri 1 Malang sudah terstruktur dengan baik yaitu diawali dari tahap pendahuluan, tahap inti dan tahap penutup; (2) kemampuan pedagogik masing-masing guru sudah cukup baik, dalam hal kemampuan guru dalam menguasai karakteristik peserta didik, persiapan dalam pengembangan kurikulum, menyelenggarakan pembelajaran yang mendidik, penggunaan teori dan prinsip pembelajaran, pemanfaatan TIK, cara mengaktualisasikan potensi peserta didik, cara berkomunikasi dengan peserta didik, menyelenggarakan penilaian dan evaluasi proses dan hasil belajar, memanfaatkan hasil penilaian dan evaluasi untuk kepentingan pembelajaran, melakukan tindakan reflektif untuk peningkatan kualitas pembelajaran. Saran yang dikemukakan adalah : (1) kepada guru ekonomi hendaknya selalu menerapkan butir-butir kompetensi pedagogic untuk mencapai tujuan pembelajaran (2) kepada pihak sekolah SMAN 1 Malang penelitian ini dapat dijadikan pengembangan dalam rangka meningkatkan kompetensi pedagogic guru di sekolah yang bersangkutan (3) bagi penulis sebagai motivasi untuk belajar dan meningkatkan kreatifitas agar lebih baik lagi.

Studi tentang marketing pada BUUD / KUD di Kecamatan Blimbing Kotamadya Malang / oleh M. Syarkani Akhda

 

Pelaksanaan pendidikan budi pekerti melalui budaya sekolah di SMP Negeri 10 Malang / Ruly Eko Setiawan

 

Kata kunci: Budi Pekerti, Budaya Sekolah. SMP Negeri 10 Malang merupakan salah satu sekolah yang menanamkan nilai-nilai moral yang berkaitan dengan nilai kedisiplinan, kejujuran, keadilan, tanggung jawab, estetika, kesopanan, hormat, kasih sayang, ramah, gotong royong, dan nilai religius melalui budaya sekolah. Hal ini dapat dilihat dari budaya bertegur sapa dan cium tangan antara siswa dengan guru, sholat berjamaah di Masjid sekolah, pengembangan kantin kejujuran, dan setiap siswa diharuskan menjaga kebersihan lingkungan sekolah, bahkan setiap siswa dianjurkan membawa sapu tangan demi menjaga kebersihan diri. Tujuan dari penelitian ini adalah (1) Mendeskripsikan upaya sekolah dalam mewujudkan pendidikan budi pekerti yang dibudayakan melalui budaya sekolah, (2) Mendeskripsikan karakteristik budaya siswa SMPN 10 Malang di lingkungan sekolah, (3) Mendeskripsikan pelaksanaan pendidikan budi pekerti melalui budaya sekolah di SMPN 10 Malang, (4) Mendeskripsikan hambatan yang dihadapi dalam pelaksanaan pendidikan budi pekerti melalui budaya sekolah di SMPN 10 Malang, (5) Mendeskripsikan upaya sekolah dalam mengatasi hambatan pelaksanaan pendidikan budi pekerti melalui budaya sekolah di SMPN 10 Malang. Penelitian ini menggunakan pendekatan kualitatif yang bersifat deskriptif dalam memaparkan data dari hasil penelitian dilapangan. Maka dari itu penelitian ini dapat disebut sebagai jenis penelitian deskriptif kualitatif. Lokasi penelitian yang dipilih adalah SMP Negeri 10 Malang. Sedangkan Sumber data dari penelitian ini dapat digolongkan sebagai data primer dan data skunder yang diperoleh melalui metode pengamatan, wawancara, dan dokumentasi (recording, catatan lapangan, dan dokumen). Analisis data yang digunakan dalam penelitian ini adalah analisis data interaktif seperti yang dikemukakan oleh Miles dan Huberman. Dalam pengecekan keabsahan penemuan maka peneliti menggunakan teknik (1) Perpanjangan keikutsertaan, (2) Ketekunan/keajegan pengamatan, dan (3) Triangulasi. Berdasarkan hasil penelitian di lapangan maka dapat diperoleh lima simpulan sebagai berikut. (1) Upaya sekolah dalam mewujudkan pendidikan budi pekerti yang dibudayakan melalui budaya sekolah diwujudkan dalam bentuk tata tertib dan pembiasaan di lingkungan sekolah. Pembiasaan bisa dilihat dari budaya cium tangan, pemeliharaan kebersihan lingkungan sekolah, pengembangan kantin kejujuran dan dalam bidang keagamaan dapat dilihat dari budaya sholat duhur berjamaah, kegiatan Imtaq bagi siswa muslim, siraman rohani bagi siswa non-muslim, dan kegiatan baca Al-Qur’an. (2) Karakteristik budaya siswa SMP Negeri 10 Malang di lingkungan sekolah dapat dilihat dari perilaku yang berkaitan dengan cara belajar, kerapian dan kebersihan, serta kerajinan dan kedisiplinan selama berada di lingkungan sekolah. (3) Pelaksanaan pendidikan budi pekerti melalui budaya sekolah di SMP Negeri 10 Malang diantaranya adalah rutinitas cium tangan siswa dengan guru setiap pagi, pelaksanaan Imtaq di Masjid sekolah pukul 6:20 menit, sholat duhur berjamaah, setiap siswa dibiasakan menjaga kebersihan lingkungan dan kebersihan diri sendiri, serta pengembangan kantin kejujuran merupakan sarana pendidikan anti-korupsi untuk menanamkan nilai kejujuran, keadilan, dan tanggung jawab. (4) Hambatan yang dihadapi dalam pelaksanaan pendidikan budi pekerti melalui budaya sekolah di SMP Negeri 10 Malang berasal dari guru dan siswa. Berasal dari guru yang berkaitan dengan ketegasan dalam penegakan aturan serta keterbatasan tenaga pendidik dalam memantau perilaku siswa. Dari siswa berkaitan dengan kesadaran, kemauan, dan sistem nilai yang dimilki setiap individu. (5) Upaya sekolah dalam mengatasi hambatan pelaksanaan pendidikan budi pekerti melalui budaya sekolah Di SMP Negeri 10 Malang yaitu: Berasal dari guru, ketegasan dalam menindak terhadap setiap pelanggaran yang dilakukan siswa serta himbauan kepada setiap warga sekolah khususnya guru untuk bekerja sama dalam menegakkan tata tertib sekolah. Untuk mengatasi hambatan yang berasal dari siswa maka dapat diamati dari keaktifan guru dalam membimbing siswa dan selalu mengingatkan siswa untuk mematuhi semua aturan sekolah serta adanya komitmen antara guru dengan siswa juga untuk mendidik siswa agar memiliki rasa tanggung jawab.

Tinjauan marketing pada pabrik keramik Dinoyo Malang / oleh Liliek Suminarti

 

Pengaruh persepsi siswa tentang kompetensi profesional guru PPL dan fasilitas belajar di sekolah terhadap motivasi dan prestasi belajar siswa pada pelajaran ekonomi kelas XI IPS di SMAN 1 Kepanjen / Baharrudin Ramadhani Wicaksono.

 

Kata kunci : Persepsi, Kompetensi Profesional Guru PPL, Fasilitas Belajar, Motivasi Belajar, Prestasi Belajar. Guru memiliki peranan penting dalam dunia pendidikan karena guru merupakan faktor utama dalam pendidikan dan pengajaran disekolah. Salah satu faktor yang mempengaruhi prestasi belajar adalah motivasi belajar. Kompetensi profesional yang dimiliki oleh guru PPL dan fasilitas belajar yang memadai di sekolah memiliki peran penting dalam meningkatkan motivasi belajar siswa, karena kedua komponen tersebut dapat dijadikan jembatan dalam penyampaian materi agar dapat dipahami oleh siswa. Jika kompetensi profesional guru PPL dan fasilitas belajar di sekolah baik, maka dapat meningkatkan motivasi belajar siswa dan secara tidak langsung mampu meningkatkan prestasi belajar siswa. Penelitian ini bertujuan untuk mengetahui pengaruh langsung dan tidak langsung antara persepsi siswa tentang kompetensi profesional guru PPL dan fasilitas belajar di sekolah terhadap motivasi dan prestasi belajar pada mata pelajaran ekonomii kelas XI IPS SMA Negeri 1 Kepanjen. Penelitian ini merupakan penelitian eksplanasi menggunakan analisis regresi dan analisis jalur (path analysis). Populasi penelitian ini adalah siswa kelas XI IPS SMA Negeri 1 Kepanjen Malang dengan jumlah 105 siswa. Data diperoleh dengan menyebarkan angket dan dokumentasi berupa nilai ujian akhir semester ganjil. Hasil penelitian menunjukkan bahwa: 1) terdapat pengaruh langsung persepsi siswa tentang kompetensi profesional guru PPL terhadap motivasi belajar, 2) terdapat pengaruh langsung fasilitas belajar di sekolah terhadap motivasi belajar, 3) terdapat pengaruh langsung motivasi belajar terhadap prestasi belajar, 4) terdapat pengaruh tidak langsung persepsi siswa tentang kompetensi profesional guru terhadap prestasi belajar melalui motivasi belajar, dan 5) terdapat pengaruh tidak langsung fasilitas belajar di sekolah terhadap prestasi belajar melalui motivasi belajar. Berdasarkan penelitian tersebut disarankan agar (a) sekolah dapat terus meningkatkan kompetensi profesional guru dan fasilitas belajar di sekolah dengan melanjutkan tingkat pendidikan guru ke jenjang yang lebih tinggi serta peningkatan faslitas belajar yang ada di sekolah karena hal tersebut dapat meningkatkan motivasi belajar siswa, (b) siswa terus berusaha untuk meningkatkan motivasi belajar yang didukung dengan kompetensi profesional guru PPL ekonomi/akuntansi SMA Negeri 1 Kepanjen Malang yang baik serta fasilitas belajar di sekolah yang memadai.

Manajemen kurikulum kelas bilingual (studi kasus di Sekolah Dasar Negeri Percobaan 1 Malang) / Yuli Ernawati

 

Kata kunci: manajemen kurikulum, kelas bilingual Manajemen adalah suatu proses perencanaan, pengorganisasian, pengarahan, pengawasan, usaha-usaha para anggota organisasi dan penggunaan sumber daya organisasi lainnya agar mencapai tujuan organisasi yang telah ditetapkan. Kurikulum adalah seperangkat rencana atau pengaturan mengenai tujuan, isi, dan bahan pelajaran serta cara yang digunakan sebagai pedoman dalam penyelenggaraan kegiatan pembelajaran untuk mencapai tujuan pendidikan yang telah ditentukan. Program bilingual yang ada di sekolah merupakan salah satu perkembangan pendidikan dalam hal kurikulum pembelajaran karena dilihat dari segi pembelajarannya pun berbeda dengan pembelajaran biasa, pembelajaran bilingual menggunakan dua bahasa (bahasa Indonesia dan bahasa Inggris). Kelas bilingual adalah tempat pembelajaran yang menggunakan bilingual (dua bahasa). SDN Percobaan 1 Malang tiga tahun yang lalu membuka kelas bilingual (dua bahasa) untuk Kelas 1 A dan B yang dalam pelaksanaan pembelajaran di kelas menggunakan dua bahasa secara bergantian. Kurikulum yang digunakan dalam kelas bilingual yaitu mengadopsi dan mengadaptasi dari KTSP (Kurikulum Tingkat Satuan Pendidikan), dalam hal ini sekolah memfasilitasi program bilingual dengan menyediakan buku, kamus, dan media sebagai penunjang pembelajaran. Guru merencanakan pembelajaran supaya mudah dipahami peserta didik, termasuk teknik pembelajaran, menyediakan media pembelajaran, aktif mengikuti workshop, dan lain-lain Penelitian ini bertujuan untuk memperoleh deskripsi yang jelas tentang manajemen kurikulum dalam kelas bilingual, yaitu bagaimana perencanaan, pelaksanaan, pengawasan, faktor pendukung dan penghambat, alternatif pemecahan dalam kelas bilingual. Penelitian ini menggunakan pendekatan penelitian kualitatif, dengan studi kasus yang pada akhirnya peneliti dapat mendeskripsikan secara rinci manajemen kurikulum kelas bilingual di SDN Percobaan 1 Malang. Pengambilan data menggunakan sumber data manusia dan non manusia. Sumber data manusia adalah kepala sekolah, waka kurikulum, guru bilingual (key informan), wali kelas. Sumber data non manusia adalah sumber tertulis berupa dokumen tentang kelas bilingual, arsip-arsip, foto. Pengumpulan data menggunakan teknik wawancara, observasi, dan dokumentasi. Pengecekan keabsahan data menggunakan teknik ketekunan pengamatan, dan triangulasi. Analisis data menggunakan reduksi data, display data, dan verifikasi data. Tahap penelitian meliputi tahap persiapan, pelaksanaan, dan pelaporan. Temuan penelitian ini yaitu (1) perencanaan kurikulum dari KTSP yang sudah dimodifikasi oleh sekolah dan guru bilingual yang disesuaikan dengan kondisi kelas. Setelah kurikulum selesai disusun selanjutnya membuat silabus dan RPP (Rancangan Program Pembelajaran) yang disusun oleh guru bilingual dibantu dengan waka kurikulum dan juga wali kelas; (2) pelaksanaan kurikulum dalam pembelajaran di kelas bilingual dilakukan di dalam kelas. Dalam pelaksanaan kelas bilingual yaitu 2 jam/mata pelajaran/minggu; (3) pengawasan kurikulum dilaksanakan oleh pihak sekolah dan juga dari pihak dinas pendidikan. Pengawasan oleh sekolah dilakukan kepala sekolah dengan tidak ada jadwal khusus, dan dari rapor bisa dilihat nilai peserta didik. Pengawas dari Dinas Pendidikan Kota Malang tidak terjadwal kapan pengawasan dilakukan hanya saja waktu pengawasan tiap satu tahun sekali; (4) faktor penghambat dan pendukung dalam pelaksanaan kelas bilingual untuk faktor penghambat dilihat dari beberapa segi, dari segi peserta didik dalam pelafalan vocabulary masih lemah, segi wali murid tidak sedikit wali murid yang dapat membantu putra-putrinya untuk mengerjakan PR, segi ruang kelas memang ukuran kelas besar dengan kapasitas peserta didik yang cukup banyak terkadang membuat suasana kelas tidak kondusif tetapi sejauh ini bisa dikendalikan. Untuk faktor pendukung dari peserta didik antusias dalam pembelajaran di kelas bilingual, dan dari wali murid juga mereka sangat mendukung adanya kelas bilingual di SDN Percobaan 1 Malang; dan (5) alternatif pemecahan masalah untuk peserta didik ketika mendapat PR disarankan di rumah memiliki kamus untuk mengerjakan PR, dan wali murid dapat membantu putra-putri di rumah. Saran yang diberikan terkait dengan hasil penelitian ini yaitu (1) bagi Kepala SDN Percobaan 1 Malang, lebih ditingkatkan lagi dalam melakukan pengawasan dan terjadwal kapan melakukan pengawasan oleh kepala sekolah; (2) bagi guru bilingual, hendaknya secara terus menerus melakukan perbaikan dalam melaksanakan tugas sebagai guru bilingual (pengajaran) agar menjadi lebih baik, dan dapat meningkatkan mutu dari pada kelas bilingual di SDN Percobaan 1 Malang; (3) bagi wali kelas dan guru, saling bekerja sama dalam pelaksanaan kelas bilingual agar dapat berjalan dengan baik; (4) bagi Ketua Jurusan Administrasi Pendidikan, penelitian ini dapat dijadikan bahan literatur dan bahan kepustakaan untuk mahasiswa Administrasi Pendidikan dalam bidang manajemen kurikulum dalam kelas bilingual; dan (5) bagi peneliti lain, hendaknya dapat dijadikan sebagai rujukan dalam menambah kajian tentang manajemen kurikulum dalam kelas bilingual dengan permasalahan yang serupa.

Pembangunan masyarakat desa di Desa Ngantru Kecamatan Trenggalek, khususnya usaha dalam meningkatkan hasil pertanian
oleh Suparyati

 

Pengembangan bahan ajar mendengarkan tembang macapat untuk SMP kelas VIII semester II berbasis multimedia / Peni Puspitasari

 

Peranan keluarga berencana terhadap perkembangan penduduk Desa Beru
oleh Sri Wahyuni

 

Peningkatan keterampilan mengidentifikasi unsur-unsur cerita anak melalui media audio siswa kelas V SDN Pagerwojo 01 Kabupaten Blitar / Vina Kristanti

 

Kata kunci: keterampilan, unsur-unsur cerita anak, media audio. Keterampilan berbahasa meliputi empat aspek yaitu menyimak, berbicara, membaca, dan menulis. Menyimak sebagai salah satu kegiatan berbahasa merupakan keterampilan yang cukup mendasar dalam aktivitas berkomunikasi. Penelitian ini bertujuan untuk mendiskripsikan penerapan media audio dalam meningkatkan keterampilan mengidentifikasi unsur-unsur cerita anak siswa kelas V, serta mendiskripsikan peningkatan keterampilan mengidentifikasi unsur-unsur cerita anak siswa kelas V SDN Pagerwojo 01Kabupaten Blitar. Pendekatan yang digunakan adalah Penelitian Tindakan Kelas (PTK) dengan model Kemmis dan Taggart. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Hasil penelitian yang dilakukan selama dua siklus pembelajaran menunjukkan adanya peningkatan keterampilan mengidentifikasi unsur-unsur cerita anak secara bertahap. Persentase siswa tuntas pada pratindakan sebesar 40%, siklus I 53,33%, dan siklus II 86,67%. Dari data tersebut dapat disimpulkan bahwa penerapan pembelajaran melalui media audio dapat meningkatkan keterampilan mengidentifikasi unsur-unsur cerita anak siswa kelas V. Dari hasil penelitian tersebut diharapkan agar senantiasa meningkatkan kualitas dan kinerjanya dengan menambah pengetahuan dan keterampilannya dalam menerapkan media pembelajaran yang baru.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 |