Pengaruh cara, kebiasaan, dan gaya belajar terhadap hasil belajar siswa pada mata pelajaran ekonomi siswa kelas XI IPS di SMA Negeri 1 Kepanjen / Nurul Laily Hidayati

 

Kata Kunci: cara belajar, kebiasaan belajar, gaya belajar, dan hasil belajar. Cara belajar siswa merupakan kegiatan yang dilakukan oleh siswa pada situasi belajar tertentu, dimana kegiatan-kegiatan tersebut mencerminkan usaha belajar yang dilakukan oleh siswa. Kebiasaan belajar dapat diartikan suatu bentuk perilaku yang dilakukan secara terus-menerus oleh individu untuk mendapatkan sesuatu hal yang baru baik berupa pengetahuan, ketrampilan maupun sikap dan nilai positif. Gaya belajar merupakan cara yang digunakan secara terus menerus oleh siswa dalam menerima, mengatur, dan mengolah informasi. Hasil belajar merupakan gambaran kemampuan siswa dalam memenuhi suatu tahapan pencapaian pengalaman belajar dalam satu kompetensi dasar. Penelitian ini merupakan penelitian deskriptif korelasional. Populasinya adalah siswa kelas XI IPS di SMA Negeri 1 Kepanjen yang berjumlah 83 siswa, dalam penelitian ini diambil sampel sebanyak 69 siswa berdasarkan rumus Slovin dengan menggunakan teknik proportional random sampling. Variabel dalam penelitian ini antara lain: cara belajar (X1), kebiasaan belajar (X2), gaya belajar (X3), dan hasil belajar pada mata pelajaran ekonomi (Y). Hasil penelitian ini menunjukkan bahwa (1) Pengaruh cara belajar siswa (X1) terhadap hasil belajar pada mata pelajaran ekonomi (Y) diperoleh nilai signifikansi sebesar 0,000 < α = 0,05 berarti cara belajar siswa berpengaruh terhadap hasil belajar siswa. (2) Pengaruh kebiasaan belajar siswa (X2) terhadap hasil belajar (Y) diperoleh nilai signifikansi sebesar 0,001 < α = 0,05 berarti kebiasaan belajar siswa berpengaruh terhadap hasil belajar siswa. (3) Pengaruh gaya belajar siswa (X3) terhadap hasil belajar (Y) diperoleh nilai signifikansi 0,000 < α = 0,05 berarti gaya belaajr siswa berpengaruh terhadap hasil belajar siswa. (4) Pengaruh cara (X1) , kebiasaan (X2) , dan gaya belajar siswa (X3) terhadap hasil belajar siswa pada mata pelajaran ekonomi (Y) diperoleh nilai signifikansi melalui uji simultan (uji F) sebesar 0,000 < α = 0,05, hal ini berarati cara, kebiasaan, dan gaya belajar siswa berpengaruh signifikan terhadap hasil belajar siswa pada mata pelajaran ekonomi kelas XI IPS di SMA Negeri 1 Kepanjen. Saran yang diajukan adalah (1) bagi guru ekonomi hendaknya menggunakan media tulisan atau power poin karena kebanyakan siswa memiliki gaya belajar visual (2) Bagi sekolah hendaknya mengelola dan memanfaatkan dengan baik komputer dan LCD yang ada di dalam kelas (3) Bagi peneliti selanjutnya diharapkan dapat memperluas subvariabel dari cara belajar seperti faktor-faktor yang mempengaruhi cara belajar siswa serta kebiasaan baik dan buruk siswa dalam proses pembelajaran.

Pengembangan multi media mobile learning pada mata pelajaran biologi pokok bahasan Sistem Ekskresi untuk kelas XI SMA Panjura Malang / Bazzari

 

ABSTRAK Bazzari. 2016. Pengembangan MultimediaMobile Learning Pada Mata Pelajaran Biologi Pokok Bahasan Sistem Ekskresi Untuk Kelas XI SMA Panjura Malang. Skripsi, Jurusan Teknologi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Susilaningsih, M.Pd. (II) Arafah Husna, S.Pd., M.Med.Kom. Kata Kunci: Pengembangan, Multimedia, Mobile Learning, Biologi, Sistem Ekskresi Perkembangan ilmu pengetahuan dan teknologi yang sangat pesat dibidang pendidikan yang membuat banyaknya sekolah yang menggunakan berbagai macam teknologi untuk pembelajaran. Penggunaan teknologi sebagai sarana penunjang kegiatan pembelajaran dapat dilihat dengan media pembelajaran yang digunakan siswa. Dari sekian banyak alat teknologi yang digunakan sebagai media pembelajaran, peneliti memilihi smartphone sebagai media pembelajaran. Pembelajaran tanpa dibatasi tempat, ruang dan waktu dapat terwujud dengan konsep pembelajaran berbasis mobile atau disebut dengan mobile learning. Permasalahan yang dihadapi siswa SMA Panjura Malang kelas XI adalah sulitnya memahami materi sistem ekskresi, yang terdapat beraneka organ dan bermacam-macam istilah yang sulit dipahami. Singkatnya waktu pembelajaran juga merupakan permasalahan disekolah in serta kurangnya media penunjang pembelajaran biologi yang abstrak. Berdasarkan permasalahan tersebut perlu dikembangkan Multimedia Mobile Learning untuk Mata Pelajaran Biologi Pokok Bahasan Sistem Eksrkresi Kelas XI SMA Panjura Malang. Tujuan dari penelitian ini adalah untuk mengembangkan Multimedia Mobile Learning (offline) sebagai media pembelajaran yang valid dan dapat meningkatkan perhatian, pemahaman siswa dalam memahami materi. Bentuk produk yang dihasilkan berupa sebuah aplikasi .apkberisikan materi dengan visualisasi menarik serta konten yang edukasional dalam berupa teks, gambar, animasi,dan audio. Dilengkapi fitur latihan yang bersifat sebagai evaluasi belajar. Model pengembangan yang digunakan dalam penelitian ini adalah model Lee dan Owens. Langkah-langkah pengembangan yang digunakan untuk mencapai hasil yang diharapkan. Adapun tahapan tersebut antara lain: (1) Tahap Analisis; (2) Tahap Desain; (3) Tahap Pengembangan ; (4) Tahap Implementasi; (5) Tahap Evauasi. Subjek penelitian dalam validasi yaitu siswa siswa kelas XI SMAatau yang mengikuti mata pelajaran Biologi. Jenis Data yang digunakan adalah data kuantitatif dan kualitatif. Hasil pengembangan mobile learning ini memenuhi kriteria valid yakni, ahli media 94%, ahli materi 92%, uji coba perseorangan 87,67%, uji coba kelompok kecil 83,33%, uji coba kelompok besar 95,55%.Selain itu terdapat isi-isi perbaikan, diantaranya perbaikan yang diperoleh dari ahli media adalah perbaikan dari script penilaian soal evaluasi yang kurang akurat. Ahli materi menyarankan untuk memperbaiki kualitas audio dan penambahan materi kulit.Sedangkan pada audience menyarankan untuk memperbaiki volume audio yang pelan.Dengan demikian produkmobile learningsstem ekskresi yang dikembangkan termasuk dalam kriteria valid atau layak digunakan dalam proses pembelajaran siswa.

Pengaruh modal intelektual dan pengungkapan modal intelektual terhadap nilai perusahaan pada perusahaan sektor perbankan yang listing di Bursa Efek Indonesia tahun 2013 / Detty Puspaningrum

 

ABSTRAK Puspaningrum, Detty. 2015. Pengaruh Modal IntelektualdanPengungkapan Modal IntelektualterhadapNilai Perusahaan pada Perusahaan SektorPerbankan yang Listing di Bursa Efek Indonesia tahun 2013. Skripsi, JurusanAkuntansi, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (I)Sulastri, S.Pd., MSA. (II) IkaPutriLarasati, S.E., M.Com. Kata Kunci:modal intelektual, pengungkapan modal intelektual, nilaiperusahaan Situasiperekonomian global saatinitelahberkembangpesat yang awalnyadidasarkanpadabisnis yang berbasistenagakerjamenjadiberbasispengetahuandanterdapatnilaitambahdalambentuk modal intelektual.Knowledge-based theorymenyatakanbahwapengetahuansebagaisumberdaya yang sangatstrategisbagiperusahaan (Sangkala, 2007: 56) sehinggaperusahaandapatmencapaikeunggulankompetitifberkelanjutandalamjangkapanjang. Signalling theory menjelaskanbahwapentingnyapengungkapan modal intelektual yang dikelurkanperusahaanterhadapkeputusaninvestasipihakeksternalperusahaan. Penelitianinibertujuanuntukmengujipengaruh modal intelektualdanpengungkapan modal intelektualterhadapnilaiperusahaansecaraparsialmenggunakanteknikanalisisregresi linier berganda.Modal intelektualdiukurmenggunakanmetode VAICTM, pengungkapan modal intelektualmenggunakan item indeks yang dikembangkanolehAbdolmohammadi, sedangkannilaiperusahaanditentukanolehrasiohargasahamnilaibuku. Populasipenelitianiniadalahperusahaansektorperbankanperiode 2013.Pengambilansampelmenggunakanteknikpurposive samplingdanterpilih 34perusahaan.Data yang digunakanmerupakan data sekunderberupalaporantahunan yang dipublikasikan di website Bursa Efek Indonesia. Hasilpenelitianmenunjukkanbahwa modal intelektualdanpengungkapan modal intelektualsecaraparsialtidakberpengaruhterhadapnilaiperusahaan.Hal inidisebabkankarenaperilaku investor yang irasionaldanadanyaperaturan BI tentangteknologiinformasiperbankan.

Penerapan pembelajaran dengan media buku ajar untuk menin gkatkan hasil belajar siswa pada mata pelajaran ekonomi kelas X-5 SMAN ! Sooko Mojokerto semester genap tahun pelajaran 2011/2012 / Prisma Intaniyah

 

Kata Kunci : Media Buku Ajar, Ekonomi, Hasil Belajar Pembaharuan di bidang pendidikan ini sebenarnya dimulai dari perubahan behaviorisme (aliran pendidikan) yang diwujudkan dengan pembelajaran yang bersifat teacher centered (berpusat pada guru) dengan pandangan konstruktivisme. Berkaitan dengan perubahan paradigma guru dalam proses belajar mengajar guru perlu menerapkan pembelajaran inovatif yang mampu dan memperkaya pengalaman belajar sehingga aktivitas siswa dalam belajar akan meningkat, akhirnya dapat meningkatkan hasil belajar siswa, khususnya dalam pembelajaran ekonomi. Buku ajar yaitu buku teks yang digunakan sebagai rujukan standard pada mata pelajaran tertentu yang disusun sistematis dan sederhana disertai petunjuk pembelajaran. Isi buku ajar yang disampaikan dalam bentuk ide, fakta, data, dan makna secara tertulis. Penelitian ini dilakukan di SMA Negeri 1 Sooko Mojokerto. Dengan mengambil tindakan pada satu kelas yakni kelas X-5 dengan jumlah 33 siswa yang terdiri dari 19 perempuan dan 14 laki- laki. Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK). Penelitian tindakan kelas ini bertujuan untuk meningkatkan dan memperbaiki kualitas pembelajaran. Subjek penelitian adalah siswa kelas X-5 SMAN 1 Sooko Mojokerto semester genap tahun ajaran 2011/2012 pada materi indeks harga dan inflasi. Penelitian dilaksanakan selama bulan Februari sampai Maret 2012. Instrumen penelitian berupa lembar observasi afektif siswa, lembar observasi aktivitas guru, pre tes dan pos tes, lembar wawancara guru, lembar catatan lapangan dan dokumentasi. Analisis hasil penelitian dideskripsikan menggunakan teknik persentase. Hasil penelitian ini menunjukkan bahwa hasil belajar siswa kelas X-5 pada siklus ke II mengalami peningkatan yang signifikan pada aspek belajar kognitif dan aspek afektif dengan kelas yang menggunakan pembelajaran konvensional. Hasil belajar siswa X-5 meningkat mencapai skor klasikal kelas yakni 85% dengan nilai SKBM adalah 75 untuk nilai mata pelajaran ekonomi. Berdasarkan hasil penelitian ini, dapat disarankan agar dalam mengajar guru hendaknya menggunakan modul, untuk meningkatkan hasil belajar siswa yang tinggi sehingga modul yang dipelajari dapat diselesaikan tepat waktu, dan bagi peneliti lain disarankan untuk melakukan penelitian tentang penggunaan media buku ajar pada materi lain dan diharapkan hasil penelitian ini bisa dijadikan sebagai dasar pengembangan media buku ajar sesuai dengan mata pelajaran yang diberikan di sekolah.

Pemaparan bahasa pada teks anekdot karya siswa kelas X SMK Negeri 3 Malang / Langen Puspito

 

ABSTRAK Puspito, Langen. Pemaparan Bahasa dalam Teks Anekdot Karya Siswa Kelas X SMK Negeri 3 Malang. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang, Pembimbing (I) Prof. Dr. Imam Suyitno, M.Pd, (II) Dr. Widodo Hs., M.Pd. Kata kunci: teks anekdot, kalimat, diksi, humor. Pembelajaran teks anekdot merupakan kompetensi dasar yang terdapat dalam kurikulum 2013 kelas X. Teks anekdot merupakan cerita yang bertujuan untuk menyampaikan sebuah kritikan dan sindiran dalam bentuk humor. Dilihat dari tujuannya, teks anekdot sangat diperlukan siswa untuk melatih penggunaan bahasa dalam mengkritik yang beretika melalui humor di dalamnya dengan menggunakan unsur-unsur bahasa dan struktur yang sesuai serta dapat menuangkan pendapat dan kritik secara kreatif dalam bentuk tulisan. Sindirian dan kritikan yang dikemas dalam cerita lucu atau humor akan membuat pembaca lebih ringan menerima. Sebagai unsur pembangun kebahasaan teks anekdot penggunaan kalimat dan diksi merupakan unsur pokok dalam menyampaikan kritikan dan sindiran dalam bentuk humor. Berkaitan dengan itu, diperlukan pembahasan mengenai pemaparan bahasa pada teks anekdot yang merujuk pada penggunaan kalimat, diksi, dan humor dalam menyampaikan kritikan dan sindiran yang kemudian dijadikan fokus penelitian yang meliputi, (1) bahasa yang menggambarkan informasi pendahuluan dalam teks anekdot karya siswa kelas X SMK Negeri 3 Malang, (2) bahasa yang menggambarkan kelucuan menyampaikan kritikan dalam teks anekdot karya siswa kelas X SMK Negeri Malang, dan (3) bahasa yang menggambarkan simpulan dalam teks anekdot karya siswa kelas X SMK Negeri Malang. Penelitian ini dilaksanakan untuk mendeskripsikan beberapa hal, yang mencakup penggunaan kalimat dan penggunaan diksi yang menyatakan humor dalam menyampaikan kritikan dan sindiran. Penelitian ini menggunakan rancangan deskriptif kualitatif. Data yang diambil berupa bentuk paparan kebahasaan dalam penggunaan kalimat dan diksi yang menyatakan kritikan dan sindiran yang terdapat pada masing-masing struktur teks anekdot karya siswa. Pengumpulan data dalam penelitian ini menggunakan teknik wawancara dan studi dokumen. Untuk menjaga keabsahan data, dilakukan kegiatan triangulasi data. Analisis data dalam penelitian ini dilakukan dengan cara reduksi data, penyajian data, dan penarikan kesimpulan. Berdasarkan hasil analisis tersebut, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, paparan bahasa yang menggambarkan informasi pendahuluan yaitu mencakup abstraksi dan orientasi pada struktur teks anekdot. Penggunaan kalimat dan diksi dalam mengenalkan tohoh, peristiwa, dan latar. Kalimat yang menyatakan hubungan semantis dalam informasi pendahuluan meliputi hubungan penjumlahan, hubungan waktu, hubungan perurutan, hubungan perlawanan, hubungan sebab. Diksi yang digunakan mengacu pada dua aspek yaitu ketepatan penggunaan makna kata dan kesesuaian penggunaan ungkapan. Penggunaan kalimat dan diksi mengacu pada humor yang menyatakan kritikan dan sindiran dalam informasi pendahuluan. Kedua, paparan bahasa yang menggambarkan isi atau peristiwa yang mencakup krisis pada struktur teks anekdot. Penggunaan kalimat meliputi hubungan perjumlahan, hubungan waktu, hubungan perurutan, hubungan perlawanan, hubungan sebab, hubungan perbandingan, hubungan syarat, dan hubungan lebih. Pada penggunaan diksi meliputi ketepatan penggunaan makna kata dan kesesuaian penggunaan ungkapan. Penggunaan kalimat dan diksi mengacu pada adanya kritikan dan sindiran pada masalah atau peritiwa yang sedang berlangsung yang dinyatakan dalam bentuk humor. Ketiga, paparan bahasa yang menggambarkan simpulan mencakup reaksi dan koda pada struktur teks anekdot. Pada simpulan, penggunaan kalimat yang menyatakan hubungan semantis dapat ditemukan hubungan penjumlahan, hubungan perurutan, hubungan perlawanan, hubungan perbandingan, hubungan sebab, hubungan tak bersyarat, dan hubungan harapan. Penggunaan diksi, ketepatan makna kata dan kesesuaian ungkapan dalam mengakhiri suatu masalah atau peristiwa. Kalimat dan diksi yang dinyatakan dalam humor dalam menyampaikan kritikan dan sindiran menyatakan suatu akhir dari masalah atau peristiwa serta simpulan. Berdasarkan penelitian di atas, dapat diajukan dua saran yaitu bagi guru bahasa Indonesia disarankan agar menyampaikan unsur kebahasaan teks anekdot secara terperinci sehingga siswa tidak mengalami kesulitan dalam menulis teks anekdot yang sesuai dengan unsur kebahasaan teks anekdot dan bagi peneliti lain, diharapkan agar dapat menggunakan skripsi ini sebagai sarana untuk melakukan penelitian mengenai unsur kebahasaan terhadap teks lain.

Analisis strategi pengembangan sentra industri mebel di Desa Catakgayam Kabupaten Jombang / Dicky Tri Setiawan

 

ABSTRAK Setiawan, Dicky Tri. 2016. Analisis Strategi Pengembangan Sentra Industri Mebel di Desa Catakgayam, Kabupaten Jombang. Skripsi, Jurusan Ekonomi Pembangunan. Fakultas Ekonomi. Universitas Negeri Malang. Pembimbing (I) Dr. Sugeng Hadi Utomo, M.Ec., (II) Dr. Farida Rahmawati, S.E., M.E. Kata Kunci : Strategi Pengembangan, Sentra Industri Mebel Sektor industri pengolahan merupakan salah satu sektor yang tinggi kontribusinya terhadap PDRB Kabupaten Jombang. Sektor industri yang berkembang di Kabupaten Jombang adalah industri mebel yang terkenal adalah sentra industri mebel Desa Catakgayam, Kecamatan Mojowarno. Strategi pengembangan industri yang tepat diperlukan sehingga para pengusaha industri mebel di Desa Catakgayam tidak mengalami kesulitan dalam mengembangkan usahanya. Tujuan dalam penelitian ini adalah untuk mengetahui bagaimana strategi pengembangan usaha yang telah dilakukan pada sentra industri mebel di Desa Catakgayam, Kecamatan Mojowarno, Kabupaten Jombang. Penelitian ini menggunakan pendekatan kualitatif dengan jenis fenomenologi. Penelitian dengan berdasarkan fenomenologi harus melihat objek penelitian dalam suatu konteks naturalnya, untuk itu dalam mengobservasi data lapangan seorang peneliti tidak dapat melepas konteks atau situasi yang menyertainya. Fenomena yang ada menunjukan motif yang unik dan khas dari sentra mebel Catakgayam ini adalah motif Arimbi yang terinspirasi dari Candi Rimbi dimana candi ini merupakan salah satu ikon Kota Jombang selain Ringin Contong. Teknik analisis data yang digunakan adalah reduksi data, penyajian data, dan verifikasi atau penarikan kesimpulan. Hasil penelitian menunjukan strategi pengembangan usaha yang telah dilakukan pada sentra industri mebel di Desa Catakayam, Kecamatan Mojowarno, Kabupaten Jombang baik dari pihak pengrajin maupun dari pihak pemerintah dilihat dari empat aspek yakni Produksi dan Pengolahan, Pemasaran, Sumber Daya Manusia (SDM) dan Teknologi bertujuan untuk memajukan usaha agar lebih berkembang. Pengusaha hendaknya lebih meningkatkan kegiatan promosi produk agar industri mebel dikenal masyarakat secara umum dan menjangkau pasar yang lebih luas sehingga dapat bersaing dengan industri sejenis dari daerah lain. Mempertahankan ciri khas produk dan meningkatkan kualitas produk dengan cara menciptakan inovasi dalam pengolahan produk, penambahan jenis produk agar memiliki daya tarik yang tinggi agar tetap mampu bersaing dengan produk lain.

Pengembangan modul pembelajaran muatan lokal tata boga semester ganjil kelas IX SMP Negeri 1 Prigen / Ainul Mufidah

 

ABSTRAK Mufidah, Ainul. 2016. Pengembangan Modul Pembelajaran Muatan Lokal Tata Boga Semester Ganjil Kelas IX SMP Negeri 1 Prigen. Skripsi, Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Amat Nyoto, M.Pd., (II) Lismi Animatul Chisbiyah, S.Pd., M.Pd. Kata Kunci: Modul Pembelajaran, Tata Boga, Kelas IX SMP Modul merupakan buku yang diciptakan untuk peserta didik yang bertujuan agar siswa dapat belajar secara mandiri atau tanpa bimbingan guru. Tujuan penelitian pengembangan ini adalah: Untuk menghasilkan produk modul mulok tata boga di SMP Negeri 1 Prigen, Untuk menghasilkan modul pembelajaran yang mudah dipelajari siswa, Untuk menghasilkan modul pembelajaran yang menarik bagi siswa. Dan menghasilkan modul pembelajaran yang efektif untuk belajar siswa. Desain yang digunakan dalam penelitian pengembangan ini menggunakan desain Dick & Carey yang di sesuaikan dengan pengembangan modul yang dibuat oleh peneliti, penyajian data hasil validasi dan uji kelompok besar maupun kecil, peneliti menggunakan format penilaian skor hasil angket yang telah divalidasi oleh validator antara lain dosen ahli bahasa, dosen ahli media, ahli materi (guru dan dosen) serta siswa selaku objek penelitian. Hasil uji coba menunjukkan bahwa pengembangan Modul Muatan Lokal Tata Boga telah dilakukan sesuai dengan tujuan yang telah ditetapkan, serta menguji kelayakan Modul Muatan Lokal Tata Boga Kelas IX Sekolah Menengah Pertama Negeri 1 Prigen. Hasil uji coba kelompok kecil rata-rata penilaian pada semua komponennya mendapatkan nilai 89% kriteria sangat valid, hasil uji coba kelompok besar yang merupakan tahap akhir pada uji coba keseluruhan mendapatkan 89,5% kriteria sangat valid pada setiap komponen.

Pengaruh self-efficacy dan motivasi belajar terhadap hasil belajar dengan kemandirian belajar sebagai variabel intervening pada mahasiswa S1 Pendidikan Akuntansi angkatan 2009 Fakultas Ekonomi Universitas Negeri Malang / Ade Fatichah Nur

 

Kata Kunci: Self-Efficacy, Motivasi Belajar, Kemandirian Belajar, Hasil Belajar Tujuan Pendidikan nasional bukan sekedar membentuk peserta didik yang berilmu, tetapi juga mandiri dalam belajar. Menurut ahli pendidikan, kemandirian belajar hanya ditujukan kepada orang dewasa (andragogi). Pendidikan di perguruan tinggi bagi mahasiswa tergolong dalam pendidikan andragogi, dimana pendidikan di perguruan tinggi terdapat tuntutan kompetensi bagi mahasiswa bukan hanya dalam tataran teoritis, tetapi juga skill praktis yang terkonsep secara teoritis. Karena kemandirian berasal dari kata dasar “diri”, maka yang diduga kuat mempengaruhinya adalah Self-Efficacy dan Motivasi Belajar yang ada dalam diri mahasiswa masing-masing. Jika Self-Efficacy dan Motivasi Belajar mahasiswa baik, maka dapat meningkatkan Kemandirian Belajar dan secara tidak langsung mampu meningkatkan Hasil Belajar mahasiswa. Penelitian ini bertujuan untuk mengetahui pengaruh langsung dan tidak langsung antara Self-Efficacy dan Motivasi Belajar terhadap Hasil Belajar dengan Kemandirian Belajar sebagai variabel intervening pada mahasiswa S1 Pendidikan Akuntansi Angkatan 2009 FE UM. Penelitian ini merupakan penelitian kausal komparatif menggunakan analisis jalur (path analysis). Populasi penelitian ini adalah mahasiswa S1 Pendidikan Akuntansi Angkatan 2009 FE UM berjumlah 85 mahasiswa, dengan sampel 65 mahasiswa. Data diperoleh dengan menyebarkan angket dan dokumentasi berupa nilai Indeks Prestasi mahasiswa semester gasal tahun ajaran 2011/2012. Hasil penelitian menunjukkan bahwa: 1) terdapat pengaruh langsung Self-Efficacy terhadap Kemandirian Belajar, 2) terdapat pengaruh langsung Motivasi Belajar terhadap Kemandirian Belajar, 3) terdapat pengaruh langsung Kemandirian Belajar terhadap Hasil Belajar, 4) terdapat pengaruh tidak langsung Self-Efficacy terhadap Hasil Belajar melalui Kemandirian Belajar, dan 5) terdapat pengaruh tidak langsung Motivasi Belajar terhadap Hasil Belajar melalui Kemandirian Belajar. Berdasarkan penelitian tersebut disarankan agar (a) pendidik (dosen) mampu menumbuhkan Self-Efficacy dan Motivasi Belajar secara ekstrinsik yang dimiliki mahasiswa untuk menumbuhkan Kemandirian Belajar (b) mahasiswa terus memupuk Self-Efficacy dan Motivasi Belajar yang dimiliki, serta menyediakan hal-hal yang menunjang belajar, karena baik Self-Efficacy, Motivasi Belajar, dan Kemandirian Belajar berpengaruh terhadap Hasil Belajar.

Identifikasi tingkat kekerasan paduan Al-Si yang diquenching dengan variasi media pendingin dan waktu pencelupan / Yuli Cahyo Pamungkas

 

ABSTRAK Pamungkas, Yuli Cahyo. 2016. Identifikasi Tingkat Kekerasan Paduan Al-Si yang Di-Quenching dengan Variasi Media Pendingin dan Waktu Pencelupan. Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Wahono, S.ST., M.Pd., (II) Prihanto Trihutomo, S.T., M.T. Kata Kunci: paduan Al-Si, quenching, media pendingin, waktu pencelupan Paduan non-ferro Al-Si merupakan material non ferro yang sangat lazim digunakan di bidang manufaktur. Paduan ini memiliki beberapa keunggulan, yakni kekerasannya memadai, dan untuk persentase paduan tertentu dapat dikeraskan. Penelitian ini akan mengkaji tentang pengaruh berbagai media pendingin pendinginan terhadap tingkat kekerasan paduan Al-Si. Tujuan penelitian ini adalah untuk mengetahui tingkat kekerasan paduan Al-Si yang di-quench menggunakan media pendingin variasi campuran air-oli Mesran SAE 40, air-oli Mesran SAE 50, dan Oli Mesran SAE 40-SAE 50 dengan variasi waktu pencelupan. Penelitian ini merupakan penelitian eksperimental dengan jenis kuatitatif yang datanya dianalisis dengan statistik deskriptif dan divisualisasikan dengan grafik. Temuan penelitian ini adalah sebagai berikut: (1) Tingkat kekerasan Al-Si pada proses quenching menggunakan media pendingin campuran 90% oli Mesran SAE 40 dan perbandingan 10% air dengan lama pencelupan 5 menit, 10 menit, dan 15 menit, masing-masing 57,54 V, 58,01 HV, dan 58,15 HV, (2) tingkat kekerasan Al-Si pada proses quenching menggunakan media penggunakan pendingin campuran 10% oli Mesran SAE 50 dan perbandingan 90% air dengan lama pencelupan 5 menit, 10 menit, dan 15 menit, masing-masing 57,61 HV, 58,03 HV, dan 58,25 HV, dan (3) tingkat kekerasan Al-Si pada proses quenching menggunakan media penggunakan pendingin campuran 50% oli Mesran SAE 50 dan perbandingan 50% oli Mesran SAE 40 dengan lama pencelupan 5 menit, 10 menit, dan 15 menit, masing-masing 57,71 HV, 58,18 HV, dan 58,28 HV. Berdasarkan hasil penelitian ini dapat disarankan sebagai berikut;(1) Perlu adanya tindak lanjut untuk penelitian berikutnya dengan berbagai variasi waktu pencelupan yang penulis belum lakukan, misalnya variasi dengan waktu yang lebih lama, (2) perlu adanya tindak lanjut untuk penelitian berikutnya dengan lebih menambah kadar garam, untuk mengetahui perubahan sifat mekanisnya, (3) perlu dilakukan pengujian lain selain pengujian kekerasan dengan menggunakan Mikro Vickers, dan (4) perlu dilakukan pengujian lain dengan berbagai bahan yang lebih bervariasi. Misalnya dilakukan uji tarik dan uji struktur mikro.

Hubungan antara kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA dengan minat melanjutkan pendidikan ke Fakultas Ekonomi di perguruan tinggi (Studi kasus pada kelas XII IPS SMA Negeri 3 Kota Probolinggo) / Fidyah Jayatri

 

Kata Kunci: sosial ekonomi, prestasi akademik, minat melanjutkan pendidikan Kondisi sosial ekonomi merupakan suatu kondisi keluarga banyak menentukan perkembangan dan pendidikan anak karena kebutuhan belajar anak memang memerlukan dana. Prestasi akademik mata pelajaran ekonomi SMA merupakan pencapaian hasil belajar siswa setelah melakukan usaha belajar. Jadi ketika ketika kondisi sosial ekonomi keluarga siswa semakin mendukung pemenuhan kebutuhan belajar siswa, maka pencapaian prestasi akademik siswa diharapkan dapat maksimal sehingga akan memunculkan minat siswa untuk dapat melanjutkan pendidikannya ke jenjang yang lebih tinggi. Penelitian ini bertujuan mengetahui hubungan secara parsial dan simultan variabel kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA dengan minat siswa kelas XII IPS SMA Negeri 3 Probolinggo untuk melanjutkan pendidikan ke Perguruaan Tinggi. Populasi dalam penelitian ini yaitu siswa kelas XII IPS SMA Negeri 3 Probolinggo dengan sampel 52 siswa dari tiga kelas tersebut sebagai responden. Metode penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Pengumpulan data dilakukan dengan teknik angket,dokumentasi dan wawancara. Teknik analisis yang digunakan adalah analisis korelasi ganda. Dengan menggunakan analisis korelasi melalui SPSS 17.0 diperoleh hasil thitung > ttabel untuk tiap-tiap variabel yaitu 4,450 > 2,021 untuk variabel kondisi sosial ekonomi dan 5,117 > 2,012 untuk variabel prestasi akademik mata pelajaran ekonomi SMA. Dari hasil analisis diketahui pula bahwa sekitar 71,4 % minat melanjutkan pendidikan ke jurusan ekonomi di Perguruan Tinggi berhubungan dengan kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA. Sehingga dapat disimpulkan bahwa terdapat hubungan yang signifikan secara parsial dan simultan variabel kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA dengan minat siswa SMA Negeri 3 Probolinggo untuk melanjutkan pendidikan ke jurusan ekonomi di Perguruan Tinggi. Berdasarkan hasil penelitian ini maka disarankan (1) bagi guru untuk memberi gambaran kepada siswa mengenai pentingnya meraih keinginan yang baik bagi siswa demi masa depannya. (2) bagi siswa diharapkan terus belajar dengan baik serta tetap menjaga harapan yang sesuai minatnya dengan baik agar dapat mencapai cita – cita yang diharapkan. (3) Penelitian selanjutnya yang melakukan penelitian dengan topik sama diharapkan dapat mengambil populasi lebih besar dan dapat dilakukan di tempat/jenjang pendidikan yang berbeda.

Hubungan antara self esteem, body image dan pembentukan self identity dengan self control dalam perilaku selfie siswa SMA Negeri di Kota Malang / Dyah Luthfia Kirana

 

ABSTRAK Kirana, DyahLuthfia. 2016.HubunganAntara Self Esteem, Body Image danPembentukan Self Identity dengan Self Control dalamPerilakuSelfieSiswa SMA Negeri di Kota Malang. Tesis.Program StudiBimbingandanKonseling,PascasarjanaUniversitasNegeri Malang.Pembimbing: (1) Dr. M.Ramli,M.A, (2) Dr.H.IM.Hambali, M.Pd Kata Kunci: self esteem, body image, self identity, self control, perilakuselfie PerkembanganSmartphonedan media sosialterutamainstagram,memicumeledaknyafenomenaselfie.Fenomenainimembuathampirsemua orang melakukanfotoselfie.Fotoselfiejikadilakukanberlebihanmakadapatmenimbulkandampak negative, sehinggabeberapapsikologmengungkapkanbahwaperluadanyaself controldalamperilakuselfie.Banyakalasanseseorangmelakukanselfieantaralain, inginmencariperhatian, inginterlihatcantik, inginmenunjukkaneksistensidiridanplaying identity. Beberapaalasantersebutmenunjukkanbahwadalamperilakuselfieterdapatbeberapaaspekpsikologisseperti, self esteem, body imagedanself identity.Olehkarenaitu, penelitianinibertujuanuntukmengetahuihubunganantaraSelf Esteem, Body ImagedanSelf IdentitydenganSelf ControldalamPerilakuSelfiesiswa SMA Negeri di Kota Malang. Penelitianinimerupakanpenelitiankorelasionallapangan.Teknikanalisis yang digunakanialahregresiganda.Subyekpopulasidalampenelitianiniadalahsiswa SMA Negeri di Kota Malang sebanyak 6.086. Total subjekyang digunakansebagaisampelsebanyak 397 responden.TeknikPengambilansampelmelaluicluster random sampling. Metodepengumpulan data denganmenggunakanskalauntukmengukur variable Self Esteem, Body Image, PembentukanSelf IdentitydanSelf ControldalamPerilakuSelfie. HasilreliabilitasmelaluiCronbach Alpha variable self esteem 0,625, Body Image 0,751, PembentukanSelf Identity 0,673 danSelf ControldalamPerilakuSelfie 0,788.Hasilujianalisisfaktoreksploratori KMO-MSA (Kaiser-Mayer-Olkin-Measurment of Sampling Adequacy) pada variable self esteem 0,688, Body Image 0,649, PembentukanSelf Identity 0,642 danSelf ControldalamPerilakuSelfie 0,733. Berdasarkanhasilpenelitiandiketahuibahwaterdapathubunganyang signifikanantaraself esteemdenganself controlpadaperilakuselfiesiswa SMANegeri di Kota Malang yang di tunjukkandengannilai Sig = 0,002 < 0,05. UjiHipotesiskeduamenunjukkanBody image (X2) tidakmemilikihubunganyang signifikandenganself controlpadaperilakuselfie (Y) siswa SMA Negeri di kota Malang yang di tunjukkandengannilai Sig = 0,275 > 0,05. Hipotesisketigamenunjukkanbahwapembentukanself identity (X3) memilikihubunganyang signifikandenganself controlpadaperilakuselfie (Y) siswa SMA Negeri di kota Malang dengannilai Sig = 0,016 < 0,05. Nilai R bernilai positif sebesar 0,288 yang menunjukkanbahwa Variabel self esteem,body image, pembentukanself identitydengan variabel self controlpadaperilakuselfiememilikihubungan lineardansignifikansecarasimultan yang artinya, jika nilai self esteem,body image, pembentukanself identitytinggi maka nilaiself controlpadaperilakuselfie juga akan tinggi.Nilai adjusted R square sebesar 0,076. Hal ini berarti 7,6% variasi dari self controldalamperilakuselfie bisa dijelaskan oleh ketiga variabel bebas. Sedangkan sisanya dijelaskan oleh sebab-sebab yang lain. Sumbanganefektifself esteem terhadapself controldalamperilakuselfieadalah sebesar 17,2%danpembentukanself identitymemberikan sumbanganterhadap self controldalamperilakuselfie sebesar 13,5%. Saran yang diberikanberdasarkanhasilpenelitian: (1) Bagikonselorhendaknyameningkatkanself esteemsiswauntukmeningkatkanself controlpadaperilakuselfiesiswa; (2) Bagipeneliti lain diharapkandapatmenelitifaktor-faktoreksternaldan internal lain yang lebihkomprehensif; (3) Bagisiswahendaknyadapatmengarahkanpengembangankepribadiannyadenganmenggunakanhasilpenelitianini.

Hubungan wawasan dunia kerja dan kompetensi akademik dengan kesiapan memasuki dunia kerja padxa siswa kelas XII Program Stusi Elektronika SMK di Malang / Habibi

 

Kata Kunci: Wawasan Dunia Kerja, Kompetensi Akademik, Kesiapan Memasuki Dunia Kerja, Siswa Kelas XII, Program Studi Elektronika. Dunia kerja merupakan tujuan akhir yang ingin diraih oleh setiap lulusan, termasuk lulusan SMK program studi elektronika. Karena pendidikan kejuruan merupakan pendidikan menengah yang mempersiapkan siswanya untuk bekerja dalam bidang tertentu. Namun pada kenyataannya 50 persen lebih lulusan SMK belum mendapatkan pekerjaan sesuai bidang keahliannya. Hal ini dikarenakan siswa tidak mengetahui kompetensi yang dibutuhkan dunia kerja. Oleh karena itu, sebelum lulus siswa harus memiliki wawasan dunia kerja dan kompetensi akademik yang tinggi untuk memasuki dunia kerja. Dengan demikian siswa dapat memiliki kesiapan yang matang untuk memasuki dunia kerja. Tujuan dalam penelitian ini adalah untuk: (1) Mendeskripsikan tingkat wawasan dunia kerja (X1); (2) Mendeskripsikan tingkat kompetensi akademik (X2); (3) Mendeskripsikan tingkat Kesiapan memasuki dunia kerja (Y); (4) Mendeskripsikan signifikansi hubungan X1 dengan Y; (5) Mendeskripsikan signifikansi hubungan X2 dengan Y; dan (6) Mendeskripsikan signifikansi hubungan X1 dan X2 dengan Y. Metode yang digunakan dalam penelitian ini adalah deskriptif korelasional. Metode sampling yang dipakai adalah proporsional random sampling dengan responden 155 siswa. Analisis diperoleh dengan menggunakan teknik regresi linear ganda, yaitu untuk mengetahui besarnya hubungan X1 dan X2 secara bersama- sama dengan Y. Analisis data dilakukan dengan bantuan program SPSS for windows release 16. Hasil penelitian adalah sebagai berikut: (1) Tingkat X1 dalam kategori tinggi yaitu sebanyak 82 responden (53%); (2) Tingkat X2 dalam kategori tinggi yaitu sebanyak 152 responden (98%); (3) Tingkat Y dalam kategori sangat tinggi yaitu sebanyak 75 responden (48%). Nilai koefisien parsial antara X1 dengan Y yaitu Ry1 sebesar 0,686. Nilai koefisien korelasi parsial antara X2 dengan Y yaitu Ry2 sebesar 0,293. Besarnya nilai koefisien korelasi ganda 2 prediktor antara X1 dan X2 dengan Y yaitu R sebesar 0,695. Kesimpulan penelitian ini adalah sebagai berikut: (1) X1 berada dalam kategori tinggi, X2 berada dalam kategori tinggi, dan Y berada dalam kategori sangat tinggi; (2) Ada hubungan positif antara X1 dengan Y dengan sig. = 0,00 < 0,05; (3) Ada hubungan positif antara X2 dengan Y dengan sig. = 0,00 < 0,05; (4) Ada hubungan positif dan signifikan antara X1 dan X2 dengan Y dengan sig. = 0,00 < 0,05. Variabel wawasan dunia kerja dan kompetensi akademik memberikan sumbangan efektif terhadap kesiapan memasuki dunia kerja sebesar masingmasing 46,34% dan 2,06% dengan total sumbangan 48,40%. Sedangkan 51,60% disebabkan variabel lain yang tidak diteliti dalam penelitian.

Peningkatan hasil belajar penjumlahan pecahan melalui model pembelajaran two stay two stray (TSTS) pada siswa kelas IV SDN Madyopuro 2 Malang / Nangsi Wadjin

 

Kata kunci: Pembelajaran Matematika, Model Two Stay-Two Stray (TSTS). Pelaksanaan pembelajaran matematika hendaknya guru dapat mengoptimalkan kegiatan belajar mengajar yang ditujukan kepada siswa agar dapat mencapai tujuan belajarnya. Permasalahannya tentang aktivitas dan hasil belajar siswa. Akar penyebab munculnya hasil belajar siswa di bawah SKM yang ditetapkan oleh sekolah yaitu 70%, karena dalam proses KBM guru di kelas masih cenderung menggunakan metode ceramah dan tanya jawab, tugas individu dan guru belum paham dengan model-model pembelajaranKegiatan pembelajaran tersebut berdampak pada aktivitas dan pemahaman siswa tarhadap materi yang diajarkan. Siswa cenderung pasif, lebih dominan bercerita dengan teman sebangkunya. sehingga pemahaman siswa pada materi penjumlahan pecahan kurang. Hasil Tes menjukan bahwa kesalahan siswa dalam menyelesaikan soal. Untuk soal no 1Sebanyak 17, %, untuk soal no 2 sebanyak 15%, untuk soal no 3 sebanyak , 57,5%, untuk soal no 4 sebanyak 13 % dan untuk soal no 5 sebanyak 67,5%. Hasil tes menunjukan bahwa siswa kurang terampil dalam menghitung penjumlahan pecahan. Tujuan penilitian ini: 1)Mendiskripsikan penerapan model TSTS dalam pembelajaran Matematika kelas IV SDN Madyopuro 2 Malang, 2)Mendiskripsikan peningkatan Aktivitas belajar Matematika siswa kelas IV SDN Madyopuro 2 Malang setelah belajar melalui model pembelajaran TSTS, 3)Mendeskripsikan hasil siswa kelas IV SDN Madyopuro 2 Malang dalam pembelajaran Matematika yang diajar dengan model TSTS. Penelitian ini dirancang dengan model penelitian tindakan kelas deskritif kualitatif. Teknik pengumpulan data dalam penelitian ini menggunakan tes, observasi, lembar APKG dan dokumentasi. Selama proses pembelajaran. Penelitian ini dilaksanakan sebanyak dua siklus sesuai dengan alur penelitian PTK. Hasil penelitian yang diperoleh dari nilai rata-rata hasil belajar siswa siklus I pertemuan pertama 68,22 termasuk kategori (rendah) dan pertemuan kedua nilai rata-rata hasil belajar siswa 75,11 termasuk kategori(cukup). Pelaksanaan tindakan siklus I pada pertemuan pertama dan pertemuan kedua meningkat sebesar (6, 89%). sedangkan siklus II pertemuan pertama hasil belajar siswa (76,22) termasuk kategori(cukup) dan pertemuan kedua mencapai 79,77 termasuk kategori(tinggi). Pelaksanaan tindakan siklus II pertemuan pertama dan kedua mengalami peningkatan sebesar (3,55%). Dari data hasil temuan peneliti di atas dapat disimpulkan bahwa terdapat “Peningkatan Hasil Belajar Penjumlahan Pecahan Melalui Model Pembelajaran Two Stay-Two Stray (TSTS) Pada Siswa Kelas IV SDN Madyopuro 2 Malang.

Kemampuan membaca pemahaman teks berbahasa Jawa siswa kelas V SD Negeri Gambirkuning Kecamatan Kraton Kabupaten Pasuruan tahun pelajaran 2009/2010 / Tri Wusananingrum

 

Kata kunci: kemampuan membaca pemahaman, teks berbahasa Jawa Salah satu kompetensi dasar di dalam kurikulum muatan lokal Bahasa Jawa kelas V SD yang terkait dengan kemampuan membaca adalah membaca pemahaman. Kemampuan siswa dalam memahami bacaan yang dibaca dapat diketahui apabila siswa dapat menjawab pertanyaan yang berkaitan dengan isi teks bacaan dan dapat menceritakan kembali isi teks yang telah dibacanya. Oleh karena itu, penelitian ini bertujuan untuk memperoleh deskripsi tentang kemampuan siswa dalam menjawab pertanyaan yang berkaitan dengan isi teks dan kemampuan siswa dalam menceritakan kembali isi teks berbahasa Jawa yang telah dibaca. Berdasarkan tujuan penelitian, penelitian ini menggunakan pendekatan kuantitatif. Data dalam penelitian ini berupa skor kemampuan menjawab pertanyaan yang berkaitan dengan isi teks dan skor kemampuan menceritakan kembali isi teks yang telah dibaca. Berdasarkan analisis data, dapat diketahui bahwa kemampuan siswa kelas V SD Negeri Gambirkuning, Kecamatan Kraton, Kabupaten Pasuruan tahun pelajaran 2009/2010 dalam membaca teks berbahasa Jawa kurang memadai. Hal ini diketahui dari jumlah siswa yang memperoleh skor 60, baik dalam tes menjawab pertanyaan maupun tugas menceritakan kembali isi teks yang telah dibaca, kurang dari 75% dari jumlah siswa sampel. Dari kesimpulan hasil penelitian dapat dikemukakan beberapa saran berikut ini: (1) guru hendaknya sering memberikan latihan membaca, (2) guru hendaknya lebih sering memberikan tes menjawab pertanyaan yang berkaitan dengan isi teks bacaan, (3) dalam kegiatan pembelajaran membaca, guru hendaknya sering melatih siswa untuk menceritakan kembali teks yang telah dibacanya, sehingga pembelajaran membaca tidak berhenti hanya pada kegiatan membaca, (4) guru hendaknya menanamkan kebiasaan membaca kepada siswa. (5) siswa hendaknya membiasakan diri untuk membaca setiap hari, baik di sekolah maupun di rumah, dan (6) untuk peneliti selanjutnya, hendaknya lebih memperluas lingkup objek penelitian, indikator-indikator yang dapat digunakan untuk mengukur kemampuan membaca, serta penggunaan strategi membaca pemahaman sehingga didapat hasil penelitian yang lebih komprehensif.

Pengaruh hormon tumbuhan IAA `dan GA3 dengan berbagai konsentrasi terhadap pertumbuhan tanaman cattleya
C. OKami Kunitachi" >< C. Nancy Wittorf / oleh Sugeng Ibnu Priawan"

 

Permasalahan dan solusi guru ekonomi yang tersertifikasi dalam mengembangkan bahan ajar ekonomi (penelitian pada SMA Negeri di Kota Malang) / Maya Arista

 

Kata Kunci: Masalah, Solusi, Pengembangan, Bahan Ajar Kemampuan guru dalam menyusun perencanan pengajaran dan mengembangkan komponen-komponen rancangan pembelajaran, merupakan salah satu indikator dari ketercapaian kompetensi pedagogik dan kompetensi profesional. Perencanaan pengajaran dituntut dapat merumuskan kebutuhan belajar, sumber belajar, media pembelajaran dan bahan ajar yang dibutuhkan. Pengembangan bahan ajar yang dilakukan oleh guru ekonomi selama ini terdapat berbagai permasalahan yang menghambat proses belajar mengajar. Tujuan penelitian ini, yaitu untuk mengetahui masalah yang dihadapi guru dalam menembangkan bahan ajar dan solusi guru untuk mengatasi masalah tersebut. Penelitian ini merupakan penelitian survei dengan pendekatan kualitatif yang dilaksanakan pada tanggal 10 Maret sampai 8 April 20111. Subyek dalam penelitian ini adalah guru mata pelajaran Ekonomi pada SMA Negeri di Kota Malang. Analisis data secara deskriptif digambarkan dengan bantuan program microsoft office excel 2007 dengan teknik diagram yang menggambarkan frekuensi jawaban responden pada masing- masing pertanyaan. Hasil penelitian ini menunjukkan bahwa pengembangan bahan ajar penting dilakukan untuk mendapatkan bahan ajar baru sesuai dengan yang diharapkan guru. Kesimpulan yang dapat diambil, yaitu Masalah yang dihadapi guru dalam mengembangkan bahan ajar meliputi keterbatasan kesediaan buku yang menjadi sumber bahan ajar dan diatasi dengan penggunaan sumber bahan ajar lain, ketidak sesuaian isi buku dengan yang diharapkan guru dan diatasi dengan memadukan isi dari berbagai sumber bahan ajar, ketidak mampuan guru mengakses internet untuk mencari sumber bahan ajar diatasi dengan mengikuti pelatihan-pelatiah dan seminat TIK serta menggunakan sumber bahan ajar lain, masalah aktivitas guru yang cukup padat diatasi dengan memanfaatkan aktivitas tersebut untuk mendapatkan tambahan informasi mengenai pengembangan bahan ajar, masalah kurangnya sarana-prasarana yang mendukung proses pengembangan bahan ajar diatasi dengan mengakses internet dengan biaya sendiri dan memohon pada pihak sekolah untuk memperbaiki fasilitas sarana-prasarana, masalah tidak adanya patokan khusus pemilihan sumber bahan ajar dan patokan khusus evaluasi bahan ajar diatasi dengan mendiskusikan patokan tersebut dengan rekan MGMP.

Penerapan teknik permainan bahasa crossword untuk meningkatkan keterampilan menulis puisi di kelas IV SDN Madyopuro 5 Kecamatan Kedungkandang kota Malang / Tina Wamona

 

Kata Kunci: Permainan Crossword, Keterampilan Menulis Puisi di SD. Bahasa Indonesia adalah belajar berkomonikasi. Bahasa merupakan saran komonikasi dalam masyarakat. Untuk dapat berkomonikasi yang baik, seseorang perlu belajar cara berbahasa yang baik dan benar. Pembelajaran bahasa akan lebih baik manakalah dipelajari sejak dini dan berkesinambungan. Begitu pula di Indonesia, bahasa Indonesia mmenjadi materi pembelajaran yang wajib diberikan disetiap jenjang pendidikan, mulai dari sekolah dasar sampai perguruan tinggi. Hal itu dilakukan supaya peserta didik mampu menguasai bahasa Indonesia dengan baik dan benar serta mampu menerapkannya dalam kehidupan masyarakat. Penelitian ini bertujuan untuk mengetahui dan menggungkapkan (1) Penerapan Menggunakan Teknik Permainan Bahasa Crossword untuk meningkatkan keterampilan menulis puisi, (2) Penerapan menggunakan Teknik Permainan Bahasa crossword dapat meningkatkan keterampilan menulis puisi pada siswa. Jenis penelitian yang digunakan dalam penelitian ini adalah penelitian tindakan kelas (PTK). Data yang diperoleh dalam penelitian ini meliputi data pelaksanaan pembelajaran pada tahap para tindakan dan pelaksanaan penelitian dengan menggunakan teknik permainan bahasa crossword, wawancara, tes, dokumentasi (foto). Hasil penelitian menunjukan bahwa (1) pembelajaran masih bersifat konvesional dimana pembelajaran berpusat pada guru, (2) Hasil belajar pada pembelajaran bahasa Indonesia masih perentase nilai rata-rata 53.15% dari 46 siswa, dengan tingkat keberhasilan siswa mencapai 24.45% , (3) Hasil pembelajaran siswa pada siklus I pertemun pertama memperoleh presentasi rata-rata kels 56.6%, sedangkan pada pertemuan II memperoleh presentase rata-rata kels 69%, pada siklus II pertemuan I memperoleh presentase rata-rata kelas 74.86% sedangkan pada pertemuan II memperoleh presentase rata-rata kelas dengan penigkatan 85.95% Berdasarkan pembelajaran dapat disimpulkan bahawa penerapan teknik permainan bahasa crossword dapat meningkatakan keterampilan menulis puisi pada siswa kelas IV SDn Madyopuro 5 Kecamatan Kedungkandang Kota Malang. Berdasarkan penelitian ini, didasarkan kendaknya guru dapat memelih dan menggunakan teknik permainan bahasa yang tepat dan sesuai dengan materi yang diajarkan.

Pengaruh penerapan strategi pembelajaran berbasis proyek terhadap kemampuan metakogniotif, penguasaan konsep, dan retensi siswa kelas X di SMAN 7 dan SMAN Gondanglegi Malang / Mawarti Endah Pratiwi

 

Program Studi Pendidikan Biologi. Program Pasca Sarjana. Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. A.D. Corebima, M.Pd; (II) Prof. Dr. Hj. Siti Zubaidah, M.Pd Kata kunci: pembelajaran berbasis proyek, metakognitif, penguasaan konsep, retensi Pembelajaran IPA di Indonesia khususnya mata pelajaran Biologi saat ini diarahkan untuk mencari tahu dan melaksanakan suatu eksperimen sehingga dapat membantu peserta didik memperoleh pemahaman tentang dirinya sendiri dan alam sekitar. Kompetensi yang diharapkan dapat tercapai melalui pembelajaran ini adalah tercapainya kemampuan metakognitif siswa yaitu kesadaran siswa terhadap sesuatu yang dipikirkannya, tercapai peningkatan penguasaan konsep Biologi siswa serta peningkatan retensi siswa. Salah satu strategi pembelajaran yang diharapkan mampu meningkatkan tiga kemampuan tersebut adalah strategi pembelajaran berbasis proyek. Penelitian ini dilakukan untuk mengetahui pengaruh penerapan strategi pembelajaran berbasis proyek terhadap kemampuan metakognitif, penguasaan konsep serta retensi siswa. Penelitian dilakukan di SMA Negeri 7 Malang dan SMAN Gondanglegi Malang pada semester genap 2009/2010 dengan populasi penelitian adalah seluruh siswa kelas X SMA Negeri di Malang tahun ajaran 2009/2010. Sedangkan sampel penelitian ini adalah kelas siswa kelas X SMAN 7 dan SMAN Gondanglegi Malang masing-masing dalam 2 rombongan belajar. Rancangan penelitian ini menggunakan rancangan penelitian eksperimen semu (quasi experiment) dengan desain penelitian menggunakan non equivalent group design. Analisis yang digunakan adalah analisis anakova nonfaktorial. Hasil penelitian menunjukkan bahwa strategi pembelajaran berbasis proyek tidak memberikan pengaruh yang berbeda terhadap kemampuan metakognitif, penguasaan konsep, dan retensi jika dibandingkan dengan pembelajaran multistrategi yang diterapkan pada kelas kontrol. Peningkatan kemampuan metakognitif siswa pada kelas eksperimen adalah sebesar 3,2% sedangkan siswa pada kelas kontrol yang difasilitasi pembelajaran multistrategi mengalami peningkatan kemampuan metakognitif sebesar 5,5%. Penguasaan konsep siswa yang difasilitasi dengan strategi pembelajaran berbasis proyek meningkat sebesar 17,88%. Siswa yang difasilitasi dengan pembelajaran multistrategi peningkatan penguasaan konsepnya dibandingkan hasil pretes adalah 9,37%. Kenaikan retensi hasil belajar dibandingkan hasil postes pada siswa yang difasilitasi pembelajaran berbasis proyek adalah sebesar 10,63%. Pada siswa yang difasilitasi pembelajaran multistrategi pada kelas kontrol kenaikan retensinya dibandingkan hasil postes adalah sebesar 3,78%. Strategi pembelajaran berbasis proyek berdasarkan penelitian ini selain mampu meningkatkan retensi siswa, diduga mampu mengembangkan keterampilan proses sains siswa dan menumbuhkan rasa percaya diri serta sikap siswa terhadap lingkungan. Oleh karena itu perlu dilakukan penelitian lebih lanjut untuk mengetahui pengaruh strategi pembelajaran proyek terhadap kemampuan keterampilan proses dan sikap siswa terhadap lingkungan.

Peningkatan hasil belajar IPS melalui media maket boneka tongkat kelas III SDN Selokajang 02 Kecamatan Srengat Kabupaten Blitar / Ayuk Septina Christianty

 

Christiany, Ayuk Septina. 2015. Peningkatan Hasil Belajar IPS Melalui Media Maket Boneka Tongkat Kelas III SDN Selokajang 02 Kecamatan Srengat Kabupaten Biltar. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Program Studi S1 Pendidikan Guru Sekolah Dasar, Universitas Negeri Malang. Pembimbing:(1)Dra.Tri Murti, S.Pd., M.Pd., (2) Dra.Widayati, M.H. Kata kunci: hasil belajar, IPS, media maket boneka tongkat Berdasarkan hasil observasi yang dilakukan peneliti pada kelas III SDN Selokajang 02 Kecamatan Srengat Kabupaten Blitar diketahui bahwa: (1) proses pembelajaran masih berpusat pada guru dan belum ada aktivitas siswa yang op-timal selama proses belajar, seperti halnya hanya membaca dan menulis rang-kuman, dan (2) guru tidak menggunakan media dalam proses pembelajaran. Siswa kesulitan memahami suatu materi pelajaran yang diperoleh dari kegiatan memba-ca dan menulis saja, serta merasa jenuh bila pembelajaran yang disajikan kurang menarik, hal ini mengakibatkan siswa tidak berkonsentrasi. Proses belajar yang rendah berdampak pada hasil belajar siswa yang rendah. Penelitian ini bertujuan untuk mendeskripsikan penerapan media maket boneka tongkat dan mendeskripsi-kan peningkatkan hasil belajar siswa pada pembelajaran IPS menggunakan media maket boneka tongkat. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kuali-tatif dengan jenis penelitian tindakan kelas (PTK). Penelitian dilaksanakan dalam dua siklus yaitu siklus I dan siklus II yang masing-masing terdiri dari 4 tahap, yaitu perencanaan, pelaksanaan, observasi, dan refleksi. Peneliti sebagai instru-men utama. Subjek dalam penelitian ini adalah siswa kelas III SDN Selokajang 02 sebanyak 18 siswa. Pengumpulan data dilakukan dengan menggunakan teknik observasi, tes, wawancara, dokumentasi, dan catatan lapangan. Hasil penelitian ini, menunjukkan aktivitas siswa yang terdiri dari aktivitas perbuatan (kerjasama, keaktifan, keberanian, dan kemandirian) dan aktivitas tugas individu mengalami peningkatan. Pada siklus I aktivitas siswa sebesar 72%, se-dangkan siklus II naik menjadi 91%. Aktivitas guru pun mengalami peningkatan, siklus I sebesar 71% dan siklus II naik menjadi 90%. Penggunaan media maket boneka tongkat juga meningkatkan hasil belajar siswa. Siklus I rata-rata nilai siswa 83, jumlah siswa yang mencapai KKM 14 siswa, ketuntasan belajar klasikal 78% dan taraf keberhasilan cukup. Sedangkan siklus II, rata-rata nilai siswa naik menjadi 89, jumlah siswa yang mencapai KKM 16 siswa, ketuntasan belajar kla-sikal 89% dan taraf keberhasilan baik. Kesimpulan penelitian ini adalah penerapan media maket boneka tongkat terbukti dapat meningkatkan aktivitas siswa dan guru, serta dapat meningkatkan hasil belajar siswa. Dengan demikian disarankan agar guru menggunakan media maket boneka tongkat dalam pembelajaran IPS khususnya materi jenis-jenis pekerjaan, karena dapat meningkatkan aktivitas siswa dan guru, serta hasil belajar siswa.

Pengaruh kualitas layanan terhadap kepuasan pelanggan (Studi pada pengunjung Taman Wisata Jawa Timur Park Batu) / Nur Alifatul CH.

 

Kata kunci: Kualitas Layanan, Kepuasan Pelanggan Kualitas Layanan pada suatu bisnis sangat penting untuk diperhatikan karena kualitas layanan yang baik akan mempengaruhi kepuasan pelanggan dan kinerja yang sesuai dengan harapan pelanggan akan mempengaruhi kepuasan pelanggan. Dengan menggunakan kualitas layanan yang baik, maka hal ini menunjukkan bahwa penyedia jasa mengutamakan keunggulan produk jasa yang merupakan ciri khas dari produk tersebut sehingga pada akhirnya bisa mencapai kepuasan pelanggan. Diperlukan adanya profesionalisme dalam mengelola yaitu dengan cara meningkatkan kualitas layanan karena kunci dari keberhasilan perusahaan yang bergerak dibidang jasa. Penelitian ini bertujuan (1) Deskripsi kualitas layanan, (2) Pengaruh kualitas layanan secara parsial dan simultan terhadap kepuasan pelanggan, (3) Variabel yang dominan mempengaruhi kepuasan palanggan. Variabel bebas penelitian ini adalah tangibles (X1), reliability (X2), responsiveness (X3), assurance (X4), emphaty (X5). Penelitian ini dilakukan selama bulan Februari-Maret 2012. Teknik pengambilan sampel dalam penelitian ini menggunakan Accidental sampling. Penyebaran kuesioner dilakukan terhadap 156 responden dari populasi sebanyak 135.611 pengunjung. Hasil tersebut dihitung dengan menggunakan rumus Isaac dan Michael. Teknik analisis data yang digunakan dalam penelitian ini adalah regresi berganda dengan menggunakan program SPSS For Windows seri 17.0. Hasil analisis menunjukkan bahwa: (1) variabel tangibles responden menjawab setuju pada kinerja sebesar 60.9%, (2) variabel reliability pada kinerja diketahui sebanyak 61,5% responden menjawab setuju pada kinerja, (3) variabel responsivenes diketahui sebanyak 61,6 % responden menjawab setuju pada kinerja, (4) Variabel assurance diketahui sebanyak 50% responden menjawab setuju pada kinerja, (5) Variabel emphaty diketahui sebanyak 64,1% responden menjawab setuju pada kinerja. Berdasarkan penelitian ini dapat disimpulkan bahwa: (1) Kualitas layanan yang terdiri dari tangibles, reliability, responsiveness, assurance, emphat, berpengaruh terhadap kepuasan Pelanggan Wisata Jawa Timur Park Batu. Pelanggan mempunyai persepsi yang baik karena sudah sesuai dengan harapan pelanggadari tangibles, reliability, responsiveness, assurance, emphat, terhadap kepuasan pelanggan Taman Wisata Jawa Timur Park Batu, (3) jika dibandingkan dengan variabel tangibles, responsiveness, assurance, emphat variabel reliability memiliki pengaruh dominan terhadap kepuasan pelanggan Taman Wisata Jawa Timur Park Batu. Saran yang dapat diberikan adalah: (1) Taman Wisata Jawa Timur Park Batu terus meningkatkan kualitas layanan dalam pelaksanaannya perlu ditingkatkan lagi, agar dapat beradaptasi dengan kebutuhan pelanggan, dengan begitu pelanggan akan mendapat layanan yang memuaskan sesuai dengan harapan pelanggan, (2) Sebaiknya Karyawan yang cepat dalam melayani pelanggan, serta sikap ramah yang selalu ditunjukkan oleh setiap karyawan menjadi indikator yang terus dilakukan, sehingga pengunjung akan merasa nyaman dalam berkunjung di Taman Wisata Jawa Timur Park Batu, maka disarankan bagi peneliti (3) Bagi peneliti selanjutnya disarankan untuk menambah jumlah variabel kualitas layanan: features, conformance to specification, dan yang lainya, yang dapat mempengaruhi kepuasan pelanggan selain variabel tangibles, reliability, responsiveness, assurance, emphaty yang diteliti pada penelitian ini, sehingga penelitian ini dapat lebih berkembang, (4) Bagi peneliti selanjutnya disarankan untuk mengambil populasi diluar objek wisata karena pengunjung Taman Wisata yang sedang melakukan kunjungan biasanya menginginkan liburan tanpa memikirkan apapun apalagi untuk mengisi kuesioner dari para mahasiswa yang sedang melakukan observasi, sehingga pengunjung biasanya untuk mengisi kuesioner tidak sesuai kebanyakan mengisi seenaknya tanpa memperhatikan isi kuesioner.

Pengaruh komposisi ZnO pada nanokomposit Fe3O4/ZnO core-shell terhadap struktur, morfologi dan fotodegradasi pada pewarna methylene blue / Siti Maryam

 

ABSTRAK Maryam, Siti. 2016. Pengaruh Komposisi ZnO pada Nanokomposit 〖Fe〗_3 O_4/ZnO Core-Shell terhadap Struktur, Morfologi dan Fotodegradasi pada Pewarna Methylene Blue. Skripsi, Program Studi Fisika, Jurusan Fisika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (1) Nandang Mufti,S.Si, M.T, Ph.D. (2) Dr. Ahmad Taufiq, M.Si. Kata kunci: Fe_3 O_4/ZnO, core-shell, fotokatalis, fotodegradasi. Penghilangan zat warna menggunakan metode fotodegradasi dengan bantuan fotokatalis ZnO memiliki keuntungan mudah digunakan, tidak beracun, ramah lingkungan, fotosensitif, dan mempunyai kemampuan baik dalam mendekomposisi senyawa organik dan bakteri berbahaya yang sering mengkontaminasi lingkungan. Akan tetapi ZnO tidak bersifat magnetik maka material ini sulit dipisahkan dari larutan setelah digunakan.Oleh karena itu, untuk memaksimalkan kemampuan ZnO agar dapat digunakan secara berulang maka pembentukan komposit berstruktur core-shelldengan material magnetik Fe_3 O_4 perlu dikembangkan. Pada penelitian ini, dilakukan variasi komposisi ZnO untuk mengetahui pengaruhnya terhadap struktur kristal dan morfologi nanokomposit Fe_3 O_4/ZnOcore-shell dan sifat fotodegradasi pada pewarna Methylene Blue. Bahan dasar yang digunakan adalah pasir besi, HCl dan NH_4OH untuk pembentukan Fe_3 O_4 sebagai core (inti), Zn-asetat dan NH_3 untuk pembentukan ZnO sebagai shell (kulit). Metode yang digunakan adalah kopresipitasi untuk pembentukan Fe_3 O_4 dan presipitasi untuk pembentukan nanokomposit Fe_3 O_4/ZnOcore-shell. Serbuk yang dihasilkan dikarakterisasi menggunakan XRD, SEM-EDX, BET dan UV-Spetrofotometer. Struktur kristal dianalisis menggunakan Rietica dan Microcal Origin, ukuran butir rata-rata dianalisis menggunakan ImageJ berdasarkan hasil fotografi SEM dan luas permukaan diperoleh dari hasil analisis Multi Point BET. Hasil penelitian menunjukkan bahwa nanokomposit Fe_3 O_4/ZnOcore-shell telah berhasil disintesis dengan kandungan atom ZnO 2,8-12,32 %. Pada komposisi ZnO di bawah 9%, terbentuk fase baru berupa Fe_2 O_3 yang terbentuk akibat Fe_3 O_4 yang teroksidasi. Komposisi ZnO tidak mempengaruhi struktur kristal tetapi mempengaruhi morfologi karena tingkat aglomerasi tiap sampel berbeda.Ukuran butir komposit mengalami penurunan dengan meningkatnya konsentrasi ZnO sedangkan luas permukaannya berbanding terbalik dengan ukuran butir. Tingkat degradasi terhadap pewarna methylene bluepada sampel yang mengandung Fe_2 O_3semakin menurun dengan bertambahnya komposisi ZnO tetapi semakin naik pada sampel tanpaFe_2 O_3.

Pengembangan media pembelajaran berbasis adobe flash untuk meningkatkan hasil belajar pada mata pelajaran administrasi kepegawaian (syudi pada siswa kelas XI APK SMKN 1 Pasuruan) / Moh. Fasikhullisan

 

ABSTRAK Fasikhullisan, Moh. 2016. Pengembangan Media Pembelajaran Berbasis Adobe Flash Untuk Meningkatkan Hasil Belajar Pada Mata Pelajaran Administrasi Kepegawaian (Studi Pada siswa Kelas XI APK SMKN 1 Pasuruan). Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing (1) Dr. Wening Patmi Rahayu, S.pd, M.M. (2) Drs. H. Moh. Arief, M.Si. Kata kunci: Media pembelajaran, Adobe Flash, Hasil Belajar Media pembelajaran merupakan alat bantu yang dapat digunakan untuk menunjang kegiatan belajar mengajar baik oleh guru maupun siswa. Perkembangan Teknologi dan informasi yang semakin berkembang diharapkan dapat dimanfatkan untuk menciptakan media pembelajaran yang inovatif sehingga dapat mendorong minat dan motivasi siswa dalam belajar. Melalui pengembangan media pembelajaran berbasis Adobe Flash ini diharapkan mampu menarik minat siswa dalam belajar sehingga dapat meningkatkan hasil belajar siswa. Tujuan dalam penelitian ini adalah (1) Menghasilkan media pembelajaran berbasis Adobe Flash yang valid pada mata pelajaran Administrasi Kepegawaian kelas XI Program keahlian Administrasi Perkantoran SMK Negeri 1 Pasuruan, (2) Meningkatkan Hasil belajar siswa kelas XI Program keahlian Administrasi Perkantoran SMK Negeri 1 Pasuruan dengan pengunaan media pembelajaran berbasis Adobe Flash pada mata pelajaran Administrasi Kepegawaian. Pengembangan media pembelajaran berbasis Adobe Flash ini dilakukan dengan mengunakan metode penelitian dan pengembangan Borg & Gall dalam Punaji yang telah dimodifikasi dengan disesuaikan berdasarkan kebutuan penelitian. Berikut langkah-langkah yang dihasilkan (1) penelitian dan pengumpulan informasi awal; (2) desain produk; (3) validasi produk; (4) revisi produk; (5) uji coba lapangan ; (6) revisi produk; (7) produk akhir. Validasi media dilakukan oleh 2 ahli materi dan 2 ahli media. Uji coba lapangan dalam penelitian ini mengunakan siswa kelas XI APK di SMKN 1 Pasuruan. Hasil analisis validasi ahli materi menunjukan sebesar 96,87 dari ahli materi I dengan kriteria sangat valid dan sebesar 76,56 % dari ahli materi II dengan kriteria valid sedangkan ahli media menunjukan sebesar 82,35% dari ahli media I dan sebesar 91,18% dari ahli media II kedua ahli media menyatakan bahwa media pembelajaran berbasis Adobe Flash sangat valid dan rata-rata hasil validasi dari para ahli diperoleh sebesar 86,74% yang artinya media sangat valid dan dapat digunakan. Hasil rata-rata nilai uji Posttest untuk kelas eksperimen sebesar sebesar 94,14, sedangkan rata-rata hasi belajar siswa kelas kontrol sebesar 70, artinya adanya perbedaan hasil belajar siswa antara kelas eksperimen dan kelas kontrol. Berdasarkan hasil validasi para ahli dan uji coba di lapangan, dapat ditarik kesimpulan bahwa pengembangan media pembelajaran berbasis Adobe Flash mampu meningkatkan hasil belajar. Saran bagi pengembangan selanjutnya agar dapat mengembangan media pembelajaran pada mata pelajaran Administrasi Kepegawaian dengan kompetensi dasar yang lain

Potensi getah jarak pagar (Jatropha curcas) terhadap proses penyembuhan luka pada mencit (Mus musculus) galur Balb C sebagai sumber belajar mata kuliah fisiologi hewan di perguruan tinggi / Bevo Wahono

 

Program Studi Pendidikan Biologi, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Umie Lestari, M.Si dan (II) Dr. H. Abdul Gofur, M.Si. Kata Kunci: jarak pagar, proses penyembuhan luka Masyarakat menggunakan obat herbal sebagai salah satu pilihan dalam pengobatan. Salah satu tanaman yang sering digunakan masyarakat untuk pengobatan adalah jarak pagar. Jarak pagar mengandung tannin, flavonoid, saponin, curcacyline, cyclic octapeptide dan curcain. Zat-zat ini secara sinergis dapat mempengaruhi proses penyembuhan luka pada kulit. Penelitian ini bertujuan untuk: 1) menguji potensi getah jarak pagar terhadap proses penyembuhan luka pada mencit (Mus musculus), 2) memanfaatkan hasil penelitian potensi getah jarak pagar terhadap proses penyembuhan luka pada mencit (Mus musculus) sebagai sumber belajar berkarakter pada mata kuliah fisiologi hewan. Penelitian ini menggunakan pendekatan kuantitatif eksperimental, rancangannya mengikuti rancangan acak kelompok. Variabel bebasnya adalah konsentrasi getah jarak pagar 0%, 50%, 75% ,100% dan lama hari pengamatan hari ke-4 dan hari ke-7. Variabel terikatnya adalah jumlah sel fibroblast, neokapilerisasi, dan re-epitelisasi. Data jumlah sel fibroblas, neokapilerisasi dan re-epitelisasi yang didapat, dianalisis menggunakan Analisis Varians Dua Jalur (Two Way ANOVA) dengan tingkat signifikan 5%. Apabila terdapat perbedaan, dilakukan uji lanjut dengan uji Least Significant Difference (LSD) dengan taraf signifikan 5%. Hasil penelitian menunjukan bahwa ada potensi getah jarak pagar terhadap proses penyembuhan luka pada mencit. Getah jarak pagar dengan konsentrasi 50%, 75% dan 100% berpengaruh signifikan terhadap jumlah sel fibroblas pada pengamatan hari ke-4 dan hari ke-7, re-epitelisasi terhadap waktu pengamatan hari ke-4 dan ke-7, namun tidak berpengaruh signifikan terhadap re-epiteliasi pada masing-masing kelompok perlakuan dan neokapilerisasi pada pengamatan hari ke-4 dan ke-7 pada masing-masing kelompok perlakuan. Berdasarkan hasil penelitian ini dan kajian pustaka yang relevan, disusun sebuah bahan ajar yang berupa modul berkarakter bagi mahasiswa pada mata kuliah Fisiologi Hewan pokok bahasan sistem integumen.

Dekomposisi pembakaran mikroalga spirulina platensis pada variasi kadar katalis zinc oxide sebagai bahan bakar alternatif terbarukan / Muhammad Misbachul Huda

 

ABSTRAK Huda,Muhammad Misbachul,Dekomposisi Pembakaran Mikroalga Spirulina Platensis Pada Variasi Kadar Katalis Zinc Oxide Sebagai Bahan Bakar Alternatif Terbarukan. Skripsi, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Sukarni, S.T., M.T.(II) Rr. Poppy Puspitasari, S.Pd., M.T. Ph.D. Kata Kunci:Mikrolaga Spirulina platensis,Analisis thermogravimetric, dekomposisi pembakaran, ZnO. Menipisnyacadanganbahanbakarminyakduniakhususnyadaribahanbakarfosil yang tidakdapatdiperbaruitelahmenimbulkanmasalahberupakrisisenergi. Banyakcaramenanganimasalahinisalahsatunyadenganpenghematanpenggunaan. Namun, penghematansajabelumcukupmenyelesaikanmasalah. Perluadatindakanlebihdarisekedarmengurangipemakaianmisalnyadenganmenciptakanenergiterbarukan. Mikroalgadenganlajupertumbuhannya yang cepat, dantelahdilakukanpenelitianbahwamikroalgadapatmenghasilkan biofuel, yakni biodiesel dan bioethanol, menjadikanlatarbelakangtulisaniniuntukmenelitimikroalgasebagaibahanbakaralternatifterbarukan, dengandilihatdaridekomposisipembakaranmenggunakankataliszinc oxide. PengujiandilakukandenganmikroalgaSpirulina p.dibakardenganpadasuhuruanganhinggasuhu 1200 oCdenganlajupemanasan 10 oC/min padaudara atmosphere denganlajuudara 50 ml/min. dengandidapatkanbahwa, semakintinggikadarkatalis, semakinbanyak pula massaSpirulina p. yang dilepaskanpadasaatpembakaran. Penelitian ini bertujuan untuk mengetahui dekomposisi pembakaran campuran mikroalga Spirulina p.dan zinc oxidesebagai bahan bakar terbarukan. Metode penelitian yang digunakan dalam penelitian ini adalah menggunakanpenelitian eksperimental. Metode tersebut merupakan metode yang mengidentifikasi sifat mendasar terlebih dahulu pada material yang diteliti kemudian dilakukan beberapa pengujian untuk diketahui data dan info tema penelitian yang diangkat.BerdasarkanhasilpenelitiandekomposisipembakaranmikroalgaSpirulina p.terjadipada 4 tahappembakaran. Tahappertamamerupakantahappelepasankandungan moisture, tahapkeduaadalahtahapdimanavolatil matters terlepas, kemudiantahapketiga proses terdekomposisidanterlepasnyafixed carbon, sertatahapkeempatadalahtahapakhirdaridekomposisipembakaran, tahapinimerupakan proses dekomposisilambatabu. Dibandingkan di antaralimavariasi, kadarzinc oxide yang paling baikdigunakanuntukcampuranbiomassamikroalgaSpirulina p.adalah 6% dan 9 % darimassa total sampel. Penambahan 6% dan 9% kataliszinc oxidedapatmempercepatlajukehilanganmassa, zinc oxidedengankadar 6% dan 9% jugaefektifdigunakanuntukmenghilangkanmoisture, volatil matter, danfixed carbonjikadibandingkandenganzinc oxidedengankadar 3%, 12% dan 15%. Selainituzinc oxidedengankadar 6% dan 9% mampumenurunkantemperaturpembakaranmasing-masingsekitar 13,7oCdan 10,9 oCpadatahappelepasan moisture. Zinc oxidedengankadar 6%, dan 9% mampumenurunkantemperaturmasing-masingsekitar 7 oCdan 4,8 oCpadalajupelepasanvolatile matter.Padapelepasanfixed carbonzinc oxide kadar 9% mampumenurunkantemperaturmasing-masingsekitar 5oC.

Hubungan tentang intensitas pendampingan belajar dari orang tua dengan prestasi belajarnya kelas IV di SDN se-gugus I Desa Depok Kecamatan Panggul Trenggalek / Herwin

 

Herwin. 2015. Hubungan Tentang Intensitas Pendampingan Belajar dari Orang tua Terhadap Prestasi Belajar Siswa Kelas 4 Se-Gugus 1 Desa Depok Trenggalek Tahun Ajaran 2013-2014. Sekripsi, Jurusan Kependidikan Sekolah Dasar dan PraSekolah, Fakultas Ilmu Pendidikan , Universitas Negri Malang. Pembumbing: (1) Prof.Dr.H.Sa’dun Akbar,M.Pd , (2) Drs.H.Rumidjan ,M.Pd. Kata Kunci : Intensitas, Pendampingan Belajar, Prestasi Belajar , SD.      Prestasi belajar merupakan salah satu bukti yang menunjukkan kemampuan atau keberhasilan seseorang yang melakukan proses belajar sesuai dengan bobot atau nilai yang berhasil diperolehnya. Banyak faktor yang mempengaruhi presatsi belajar siswa, antara lain cara pendampingan, bimbingan belajar dan intensitas pendampingan dari orang tua. Penelitian ini bertujuan untuk : (1) mendeskripsikan tentangIntensitas Pendampingan Belajar dari Orang tua, (2) mendeskripsikan Prestasi Siswa tentang Intensitas Pendampingan Belajar Dari Orang tua, (3) menjelaskan Hubungan Antara Intensitas Pendampingan Belajar dari orang Dengan Prestasi Belajar Siswa. Jenis penelitian ini adalah penelitian korelasional. Populasi dalam penelitian ini adalah seluruh siswa kelas IV Se-Gugus 1 Desa Depok Trenggalek yang berjumlah 60 siswa. Instrumen yang digunakan untuk mengumpulkan data adalah kuisioner (angket). Analisis data menggunakan statistik non parametrik dengan teknik analisis korelasi tata jenjang atau Rank Spearman. Hasil penelitian menunjukkan bahwa sebagian siswa kelas IV SDN Se-Gugus 1 Desa Depok Kecamatan Panggul Kabupaten Trenggalek memiliki 4 rentangan, Pendampingan belajar dengan taraf nilai sangat tinggi adalah 14 responden (23,33 %), dengan taraf nilai tinggi adalah 38 responden (63,33 %), taraf nilai sedang 5 responden (8,33 %)dan sisanya memiliki taraf nilai rendah 3 responden (5 %). Dengan demikian Intensitas Pendampingan Belajar Dari Orang tua Terhadap Prestasi Belajar Siswa kelas 4 SDN Se-Gugus 1 Desa Depok Kecamatan Panggul Kabupaten Trenggalek memiliki taraf pendampingan belajar tinggi. Disarankan bagi wali murid untuk lebih meningkatkan dalam pendampingan belajar kepada putra-putrinya dengan cara menegur bila sudah waktunya untuk belajar, memberikan motivasi belajar, menyediakan alat-alat belajar dengan tujuan meningkatkan prestasi belajar siswa.

Manajemen kelas inklusi: Studi multikasus pada TK Roudhotul Hikmah dan SD Islam Sabilillah di Kabupaten Jombang / Nawaafila

 

Kata kunci: manajemen kelas, sekolah inklusi. Manajemen kelas inklusi merupakan suatu proses kegiatan perencanaan, pelaksanaan, dan evaluasi yang dilakukan oleh guru agar dapat menjaga suasana kelas agar kondusif sehingga tujuan pembelajaran di kelas inklusi tercapai. Di kabupaten Jombang, jumlah sekolah inklusi masih terbatas. Namun, Lembaga Pendidikan Roudhotul Hikmah merupakan satu-satunya lembaga pendidikan yang membuka kelas inklusi mulai dari TK hingga SD. Berdasarkan hal tersebut, maka dilakukan suatu penelitian untuk mempelajarai manajemen kelas inklusi di TK Roudhotul Hikmah dan SDI Sabilillah, dengan fokus serta tujuan penelitian diantaranya tentang (1) perencanaan; (2) pelaksanaan; (3) evaluasi/penilaian; (4) faktor pendukung dan penghambat dalam pelaksanaan kelas inklusi. Penelitian ini dilakukan dengan pendekatan kualitatif eksplanatoris, yaitu suatu metode penelitian yang tidak menguji hipotesis melainkan memaparkan dan mengelola data. Jenis penelitian ini adalah multikasus karena terdapat dua kasus pada dua objek penelitian, yaitu TK Roudhotul Hikmah dan SDI Sabilillah di Kabupaten Jombang. Dalam penelitian ini, peneliti sendiri yang berperan sebagai instrumen kunci, dengan subjek penelitian adalah kepala sekolah, guru/terapis, dan prompter di TK Roudhotul Hikmah dan SDI Sabilillah. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian, dan dokumen yang berkaitan dengan manajemen kelas inklusi. Data yang diperoleh dianalisis selama pengumpulan data dan setelah pengumpulan data. Untuk mengumpulkan data yang relevan guna menjawab fokus penelitian, skripsi ini menggunakan beberapa teknik pengumpulan data, seperti wawancara, observasi, dan studi dokumentasi. Tahap analisis data dengan cara memilah-milah data, pada setiap data yang didapat langsung diolah. Penggunaan triangulasi data dengan menggunakan tahapan: (1) mengajukan berbagai macam variasi pertanyaan, (2) mengeceknya dengan berbagai sumber data, (3) memanfaatkan berbagai metode agar pengecekan kepercayaan data dapat dilakukan. Hasil penelitian menunjukkan bahwa manajemen kelas inklusi di TK Roudhotul Hikmah dan SDI Sabilillah, meliputi tahapan-tahapan yaitu perencanaan, pelaksanaan, dan penilaian, serta faktor pendukung dan penghambat dalam manajemen kelas inklusi. Perencanaan kelas inklusi dilakukan oleh guru kelas. Perencanaan yang dilakukan di TK Roudhotul Hikmah sebelum mengelola kelas yakni menyiapkan LKH, menyiapkan media pembelajaran, dan mengkondisikan peserta didik. Sedangkan perencanaan kelas inklusi di SDI Sabilillah meliputi persiapan media dan mengkondisikan peserta didik. Di TK Roudhotul Hikmah, pelaksanaan kelas meliputi, (1) menerapkan model kelas inklusi berupa kelas khusus penuh, (2) kelas inklusi memiliki dua ruangan kelas, yakni kelas besar (gazebo) dan kelas kecil ( 2 x 2 m) untuk satu peserta didik dan satu terapis, (3) menggunakan metode pengajaran ABA (Applied Behavior Analysis) secara one on one (individual), (4) setiap peserta didik memiliki kepribadian unik sehingga guru harus memahami karakteristik masing-masing peserta didik, (5) bertujuan untuk memanamkan kemandirian, konsentrasi, dan kepatuhan peserta didik, (6) sosialisasi di kelas regular setiap satu minggu sekali untuk melatih peserta didik memahami lingkungannya, (7) kegiatan pembelajaran setiap hari senin s.d. jumat, kegiatan pembelajaran di kelas meliputi kegiatan awal, inti, dan penutup. Sedangkan pelaksanaan kelas inklusi di SD Sabilillah meliputi, (1) menerapkan model kelas inklusi penuh, di mana peserta didik berkebutuhan khusus melaksanakan kegiatan pembelajaran bersama denga peserta didik lainnya (normal) sepanjang hari di kelas reguler dengan menggunakan kurikulum yang sama, (2) kelas inklusi hanya memiliki satu ruangan saja, di kelas 1 dan 4, (3) menggunakan metode pengajaran secara klasikal, kelompok, dan individual sesuai dengan materi yang diajarkan, (4) setiap peserta didik memiliki kepribadian unik, (5) bertujuan mengajarkan peserta didik dalam memahami materi yang disampaikan secara lisan, tulis, dan praktik, (6) sosialisasi dilakukan setiap hari, (7) Kegiatan pembelajaran setiap hari senin s.d. sabtu, kegiatan pembelajari diawali dengan salam dan doa bersama, begitu juga pada kegiatan penutup. Penelitian tentang manajemen kelas inklusi yang dilakukan oleh pengelola TK Roudhotul Hikmah dan SDI Sabilillah menghasilkan temuan-temuan penelitian yang dibahas dengan cara membandingkan informasi yang diperoleh dari kedua objek penelitian tersebut, sehingga dapat disimpulan bahwa terdapat persamaan yaitu dalam: (1) berada pada satu naungan yayasan yang sama; (2) penyiapan media dan materi; (3) menggunakan metode penyampaian materi disesuaikan dengan kondisi peserta didik; (4) faktor penghambat dan kesulitan dalam mengkondisikan kelas; (5) penilaian pada proses dan hasil akhir. Sedangkan perbedaannya meliputi beberapa aspek, yaitu (1) model kelas; (2) model pembelajaran; (3) fokus materi; (4) karakteristik peserta didik; (5) model penilaian. Berdasarkan hasil penelitian ini, dapat disarankan bagi (1) pengelola TK dan SDI Roudhotul Hikmah Roudhotul hikmah agar terus melakukan perbaikan dan penyempurnaan dalam menyelenggarakan pendidikan inklusi; (2) Ketua Jurusan Administrasi Pendidikan agar turut serta mengkaji segala permasalahan pendidikan inklusi untuk memperkaya khasanah ilmu dan sebagai wujud pendalaman ilmu Manajemen Pendidikan; (3) Kepala Dinas Pendidikan Kabupaten Jombang agar melaksanakan pelatihan-pelatihan yang diberikan kepada kepala sekolah dan guru sekolah inklusi untuk meningkatkan kemapuan dan keterampilan secara administrasi dan kemampuan dalam mengelola kelas inklusi; (4) peneliti lain agar melakukan penelitian lanjutan misalnya Kepemimpinan Kepala Sekolah Inklusi atau Manajemen Kurikulum Inklusi.

Pengaruh model pembelajaran kooperatif Numbered Heads Together terhadap keterampilan metakognitif dan hasil belajar kognitif biologi siswa kelas XI SMA Negeri 1 Ngoro Mojokerto / Bea Hana Siswati

 

Kata Kunci: Numbered Heads Together, metakognitif, hasil belajar. Kegiatan pembelajaran di sekolah merupakan kegiatan utama dalam proses pendidikan yang pada umumnya bertujuan membawa anak didik menuju pada keadaan yang lebih baik. Keaktifan siswa dalam belajar merupakan salah satu faktor yang mempengaruhi keberhasilan dalam belajar, oleh karena itu dalam mengembangkan keaktifan siswa diperlukan model pembelajaran yang dapat mendorong siswa untuk aktif selama proses pembelajaran. Permasalahan tersebut dapat diatasi dengan menerapkan model pembelajaran numbered heads together (NHT). Model NHT berpotensi untuk mengembangkan keterampilan metakognitif dan hasil belajar kognitif siswa karena dengan menggunakan model pembelajaran NHT siswa menjadi siap dalam pembelajaran dan dapat melakukan diskusi dengan sungguh-sungguh. Tujuan penelitian ini ialah: 1) mengetahui pengaruh penerapan model pembelajaran NHT terhadap ketrampilan metakognitif siswa kelas XI SMAN 1 Ngoro Mojokerto, 2) mengetahui pengaruh penerapan model pembelajaran NHT terhadap hasil belajar kognitif siswa kelas XI SMAN 1 Ngoro Mojokerto. Rancangan penelitian yang digunakan ialah quasi eksperimen dengan Pretest-Postest Nonequivalent Control Group Design. Variabel bebas adalah model pembelajaran (numbered heads together) dan model pembelajaran multistrategi. Variabel terikat adalah keterampilan metakognitif dan hasil belajar kognitif. Populasi penelitian ialah seluruh siswa kelas XI SMAN 1 Ngoro Mojokerto. Sampel penelitian adalah siswa kelas XI-IA1 sebagai kelas kontrol dan XI-IA2 sebagai kelas perlakuan. Keterampilan metakognitif diukur menggunakan rubrik metakognitif. Hasil belajar diukur dengan menggunakan tes essay. Instrumen tes terlebih dahulu diuji validitas dan reliabilitas. Data diambil pada saat pretes dan postes. Uji hipotesis menggunakan anakova dengan taraf signifikansi 0,05 (P < 0,05). Sebelum uji anakova, dilakukan uji normalitas data dengan uji kormogolov-smirnov dan uji homogenitas data dengan levene tes. Hasil penelitian menunjukkan: 1) Model pembelajaran berpengaruh terhadap keterampilan metakognitif, 2) Model pembelajaran berpengaruh terhadap hasil belajar kognitif. Model pembelajaran NHT terbukti dapat meningkatkan proses dan hasil belajar, dan disarankan bagi guru untuk mencoba mengimplementasikan model pembelajaran NHT dalam pembelajaran Biologi.

Studi tentang korelasi bakat mekanik dengan prestasi mengelas dasar pada matakuliah praktikum teknologi pengerjaan logam III bagi mahasiswa jurusan Pendidikan Teknik Mesin FPTK IKIP MALANG
oleh Untung Supriyanto

 

Developing English syllabus for the Restaurant Department in SMKN 1 Pogalan Trenggalek / Adi Purwanto

 

Thesis, Graduate Program in English Language Education, the State University of Malang. Advisors: (1) Prof. Dr. Nur Mukminatien, M.Pd. (2) Dr. M. D. D. Oka, M.A. Key words: English syllabus, the Restaurant Department, English for Specific Purpose, and competency based syllabus. Developing an English syllabus for the Restaurant Department in SMKN 1 Pogalan is very important in order to facilitate the students of the Restaurant Department to be competent and professional in their field of study and in the field of work at the restaurant industry. In this study, the English syllabus is developed based on the educational research and development (R and D) because the objective of the study is to develop a model syllabus. The procedure of the syllabus development is based on the theory of Yalden (1987:88). In his language program development, specifically on syllabus design, his theory covers seven stages: (1) needs survey, (2) description of purpose, (3) selection/development of syllabus type, (4) production of a proto syllabus, (5) production of pedagogical syllabus, (6) development and implementation of classroom procedures, and (7) evaluation. The instruments of the research used were the questionnaires and interview as the the way of collecting the data. The product of this study is an English syllabus for the Restaurant Department, an example of instructional material, and one lesson plan. This English syllabus consists of several components: identity of school/institution, subject, grade/semester, a standard competence that refers to the graduate competence standard, time allocation, basic competences that refer to graduate competence standard, 11 subcompetences, indicators, instructional materials that include “knowledge, skills, and character building,” teaching learning activities, assessment (oral and written), time allocation, and sources. The English syllabus for the Restaurant Department takes into account the ESP principles (English for Specific Purpose) and Competency-based syllabus. ESP principles consider the needs of particular learners that relate to the field of study and work. In a competency based syllabus, the primary purpose of the instruction is to teach the students based on a specification of the competencies. The developed English syllabus for the Restaurant Department can be used and implemented for the basis of teaching and learning process since it is validated by a professional expert of syllabus development. This product facilitates the students of the Restaurant Department to be competent and professional in the field of study and in the field of work at the restaurant industry.

Pengembangan program bimbingan dan konseling di Universitas Muslim Indonesia Makasar
oleh Andi Bunyamin

 

Strategi menyimak mahasiswa pProgram Studi Pendidikan Bahasa Jerman Universitas Negeri Malang pada matakuliah Deutsch IV / Nur Fitri Diyastitin

 

Diyastitin, Nur Fitri. 2015. Strategi Menyimak Mahasiswa Program Studi Pendidikan Bahasa Jerman Universitas Negeri Malang pada Matakuliah Deutsch IV. Skripsi, Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. Rizman Usman, M.Pd., (II) Deddy Kurniawan, S.Pd., M.A. Kata Kunci: menyimak, strategi menyimak, Deutsch IV Menyimak merupakan keterampilan berbahasa yang paling penting, karena menyimak merupakan dasar bagi pembelajaran bahasa. Menyimak juga termasuk ke dalam keterampilan yang sulit, terutama dalam mempelajari bahasa asing. Salah satu kesulitan dalam menyimak adalah pembelajar tidak mampu mengikuti kecepatan teks yang diperdengarkan. Kesulitan tersebut juga dialami oleh mahasiswa Program Studi Pendidikan Bahasa Jerman ketika menyimak teks bahasa Jerman pada matakuliah Deutsch IV. Untuk mengatasi kesulitan tersebut, mahasiswa menggunakan berbagai macam strategi menyimak. Tujuan dari penelitian ini adalah untuk mendeskripsikan strategi menyimak yang digunakan oleh mahasiswa Program Studi Pendidikan Bahasa Jerman pada matakuliah Deustch IV. Secara khusus, tujuan dari penelitian ini adalah untuk mendeskripsikan strategi sebelum, selama, dan setelah menyimak yang digunakan oleh mahasiswa. Penelitian ini menggunakan metode kualitatif deskriptif. Data primer dalam penelitian ini adalah informasi mengenai strategi menyimak yang digunakan oleh mahasiswa. Sumber data tersebut adalah mahasiswa Program Studi Pendidikan Bahasa Jerman Angkatan 2013 offering B. Data tersebut diambil menggunakan teknik wawancara. Selanjutnya, data sekunder dalam penelitian ini adalah aktivitas menyimak mahasiswa yang diperoleh dari kegiatan pembelajaran menyimak pada matakuliah Deutsch IV. Data tersebut diambil menggunakan teknik observasi. Kedua data tersebut juga didukung oleh foto-foto hasil dokumentasi mengenai aktivitas mahasiswa dalam proses pembelajaran menyimak. Dalam penelitian ini peneliti berperan sebagai instrumen kunci, sedangkan instrumen penunjangnya berupa pedoman wawancara, lembar observasi, dan kamera. Hasil penelitian menunjukkan bahwa mahasiswa menggunakan strategi menyimak yang bervariasi. Strategi sebelum, selama, dan setelah menyimak yang digunakan oleh mahasiswa tergolong ke dalam strategi langsung dan tidak langsung. Strategi langsung merupakan strategi yang berkaitan secara langsung dengan materi menyimak, seperti membaca dan memahami soal sebelum teks menyimak diperdengarkan. Strategi tidak langsung merupakan strategi yang berkaitan dengan sikap dan perilaku mahasiswa dalam mengikuti pembelajaran menyimak, seperti berdoa sebelum dan setelah menyimak. Hal ini menunjukkan bahwa dalam pembelajaran menyimak mahasiswa tidak hanya mengutamakan aspek kognitifnya saja, melainkan mereka juga memperhatikan aspek afektif yang berkaitan dengan kegiatan spiritual.

Pengaruh model pembelajaran Think Pair Share dipadu dengan Talking Stick terhadap keterampilan metakognitif dan hasil belajar kognitif biologi siswa kelas VIII SMP Negeri 2 Pakis / Nur Alfi Laili

 

Kata Kunci: think pair share, talking stick, keterampilan metakognitif, dan hasil belajar kognitif. Sistem pembelajaran yang masih didominasi penyampaian materi oleh guru menyebabkan siswa tidak mampu membangun dan menemukan sendiri pengetahuannya sehingga mengakibatkan siswa hanya menghafal konsep-konsep yang diberikan oleh guru. Pengetahuan yang bersifat hafalan akan berdampak buruk terhadap keterampilan metakognitif siswa. Rendahnya keterampilan metakognisi siswa berkorelasi dengan rendahnya hasil belajar kognitif. Permasalahan tersebut dapat diatasi dengan menerapkan model pembelajaran think pair share (TPS) dipadu dengan talking stick (TS). Model TPS menekankan pada tanggung jawab kelompok sedangkan model TS menekankan pada tanggung jawab individu. Dengan demikian kombinasi TPS-TS dapat menjadi model pembelajaran yang berpotensi untuk meningkatkan keberhasilan belajar siswa, termasuk dalam aspek keterampilan metakognitif dan hasil belajar kognitif siswa. Tujuan penelitian ini ialah: 1) Mengetahui perbedaan keterampilan metakognitif siswa kelas VIII SMP yang dibelajarkan dengan model gabungan TPS-TS dan yang dibelajarkan dengan model konvensional dan 2) Mengetahui perbedaan hasil belajar kognitif siswa kelas VIII SMP yang dibelajarkan dengan model gabungan TPS-TS dan yang dibelajarkan dengan model konvensional. Rancangan penelitian yang digunakan ialah quasi eksperiment dengan Pretest-Postest Nonequivalent Control Group Design. Variabel bebas adalah model pembelajaran (TPS-TS dan pembelajaran konvensional). Variabel terikat adalah keterampilan metakognitif dan hasil belajar kognitif. Populasi penelitian ialah seluruh siswa kelas VIII SMPN 2 Pakis. Sampel penelitian adalah siswa kelas VIII-B sebagai kelas perlakuan dan VIII-C sebagai kelas kontrol. Keterampilan metakognitif diukur dengan menggunakan panduan rubrik keterampilan metakognitif yang terintegrasi dengan tes essay. Hasil belajar kognitif diukur dengan menggunakan tes essay. Instrumen tes terlebih dahulu diuji validitas dan reliabilitas. Data diambil pada saat pretes dan postes. Uji hipotesis menggunakan anakova dengan taraf signifikansi 0,05 (P < 0,05). Sebelum uji anakova, dilakukan uji prasyarat, yaitu normalitas data dengan uji kormogolov-smirnov dan uji homogenitas data dengan levene tes. Hasil penelitian menunjukkan: 1) Model pembelajaran berpengaruh terhadap keterampilan metakognitif dan 2) Model pembelajaran berpengaruh terhadap hasil belajar kognitif. Model gabungan think pair share-talking stick terbukti dapat meningkatkan keterampilan metakognitif dan hasil belajar kognitif siswa, dan disarankan bagi guru untuk mencoba mengimplementasikan model gabungan think pair share-talking stick dalam pembelajaran Biologi.

Peningkatan kemampuan kognitif melalui kegiatan eksplorasi pada anak Kelompok A di TK Kartika IX-41 Malang / Dine Damayanti

 

Damayanti, Dine. 2015. Peningkatan Kemampuan Kognitif Melalui Kegiatan Eksplorasi Lingkungan Pada Anak Kelompok A Di TK Kartika IX-41 Malang. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Program S-1 Pendidikan Anak Usia Dini, Universitas Negeri Malang, Pembimbing: (I) Drs. Ahmad Samawi, M.Hum, (II) Drs. Tomas Iriyanto, S.Pd, M.Pd. Kata kunci: kegiatan eksplorasi lingkungan, kognitif, anak kelompok A Berdasarkan observasi awal yang dilakukan di TK Kartika IX-41 Kelompok A2 semester 2 diketahui bahwa kemampuan kognitif anak dalam mengamati keadaan lingkungan, mengelompokkan benda-benda berdasarkan jenis, dan menceritakan kembali hal yang telah dipelajari sebelumnya masih belum mencapai TPP. Hal ini disebabkan (1) Anak merasa bosan dengan media yang digunakan seperti, lembar kerja, buku, gambar, cerita. (2) Antusias anak masih sangat kurang ketika pembelajaran di dalam kelas dengan metode pembelajaran yang sama. (3) Konsentrasi anak dalam mengikuti kegiatan pembelajaran di dalam kelas masih rendah terbukti beberapa anak asik dengan aktivitasnya sendiri tanpa memperhatikan guru. Tujuan penelitian ini adalah (1) Mendeskripsikan penerapan kegiatan eksplorasi lingkungan untuk meningkatkan kemampuan kognitif anak dalam mengelompokkan benda berdasarkan jenis di TK Kartika IX-41. (2) Mendeskripsikan peningkatan kemampuan kognitif melalui kegiatan eksplorasi lingkungan di TK Kartika IX-41. Rancangan Penelitian yang digunakan adalah Penelitian Tindakan Kelas. Tahapan penelitian meliputi perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian ini dilakukan pada kelompok A2 di TK Kartika IX-41 Malang. Alat yang digunakan untuk mengumpulkan data berupa lembar observasi, format penilaian kognitif, wawancara, dan dokumentasi. Berdasarkan hasil analisis data, kegiatan eksplorasi lingkungan untuk meningkatkan kemampuan kognitif dapat terlaksana dengan baik. Kegiatan eksplorasi lingkungan tersebut dilakukan secara berkelompok dan menggunakan sumber belajar yang langsung diambil dari lingkungan. Berdasarkan kegiatan tersebut diketahui hasil kemampuan kognitif pada pratindakan sebesar 48,10%, kemudian dilakukan kegiatan siklus 1 sebesar 62,93% dan pada siklus II sebesar 86,66 %. Berdasarkan hasil penelitian ini, disimpulkan bahwa kegiatan eksplorasi lingkungan dapat meningkatkan kemampuan kognitif dalam mengamati keadaan lingkungan, mengelompokkan benda-benda berdasarkan jenis, dan menceritakan kembali hal yang telah dipelajari sebelumnya. Disarankan pada guru agar memanfaatkan lingkungan sekitar sehingga sumber belajar untuk meningkatkan kemampuan kognitif anak.

Pengaruh Kualitas Aktiva Produktif (KAP), Return on Asset (ROA), dan Financing to Debt Ratio (FRD) terhadap tingkat bagi hasil pihak ketiga pada perbankan Syariah di Indonesia periode 2008-2010 / Aditya Rachman Dwiatmaja

 

Kata kunci: Kualitas Aktiva Produktif (KAP), Return On Assets (ROA), Financing to Deposit Ratio (FDR), Bagi Hasil Pihak Ketiga Semakin banyaknya bank umum yang membuka unit syariah untuk melayani kebutuhan masyarakat Indonesia yang beragama Islam berdampak pada perkembangan perbankan syariah. Prinsip syariah mengharamkan sistem bunga dan digantikan dengan bagi hasil. Sistem bagi hasil merupakan sistem di mana dilakukan perjanjian dalam melakukan kegiatan usaha. Di dalam usaha tersebut diperjanjikan adanya pembagian hasil atas keuntungan yang akan didapat. Penelitian ini bertujuan untuk mengetahui pengaruh kualitas aktiva produktif, return on asset dan financing to deposit ratio terhadap bagi hasil pihak ketiga perbankan syariah di Indonesia, baik secara parsial maupun secara simultan. Penelitian ini menggunakan teknik purposive sampling dan diperoleh 3 sampel. Sampel yang digunakan dalam penelitian ini adalah laporan keuangan triwulanan PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mega Indonesia dan PT Bank Syariah Mandiri tahun 2008-2010. Jenis data yang digunakan adalah kuantitatif dan merupakan data sekunder yang diperoleh dari PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mega Indonesia dan PT Bank Syariah Mandiri tahun 2008-2010. Metode analisis yang digunakan dalam penelitian ini yaitu menggunakan analisis regresi berganda melalui pengujian SPSS dengan mempertimbangkan uji asumsi klasik. Hasil penelitian menunjukkan secara parsial KAP dan ROA berpengaruh signifikan terhadap bagi hasil pihak ketiga dengan tingkat signifikansi sebesar 0,000. FDR tidak berpengaruh terhadap bagi hasil pihak ketiga dengan tingkat signifikansi 0,076. Secara simultan terdapat pengaruh signifikan variabel KAP, ROA dan FDR terhadap bagi hasil pihak ketiga dengan tingkat signifikansi 0,000. Saran yang diberikan adalah : (1) untuk penelitian selanjutnya diharapkan untuk menambah sampel, atau memperluas sampel penelitian dengan meneliti Unit Usaha Syariah atau Bank Pembiayaan Rakyat Syariah, (2) melakukan penelitian kembali dengan melakukan penelitian menggunakan data rasio keuangan tahunan supaya hasilnya lebih akurat, (3) menambah variabel penelitian seperti GWM, BOPO, CAR, ROE, dan variabel lain yang mempengaruhi bagi hasil pihak ketiga.

Kajian struktur gerak Tari Topeng Gunungsari di Desa Jabung Kecamatan Jabung Kabupaten Malang / Rustiya Novikasari Utama

 

Utama, Rustiya Novikasari. 2014. Kajian Struktur Gerak Tari Topeng Gunungsari Di Desa Jabung Kecamatan Jabung Kabupaten Malang. Skripsi, Program Studi Pendidikan Seni Tari dan Musik, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (1) Dra. Lilik Indrawati, M.Pd (2) Hartono, S.Sn, M.Sn. Kata Kunci : Struktur Gerak, Tari topeng Gunungsari. Tari topeng Gunungsari merupakan tarian yang terdapat pada pertunjukan wayang topeng di Desa Jabung Kecamatan Jabung Kabupaten Malang. Tari topeng Gunungsari menceritakan tokoh ksatria dalam wayang topeng yaitu Raden Gunungsari. Wayang topeng merupakan kesenian turun-menurun yang terdapat di Desa Jabung Kecamatan Jabung Kabupaten Malang. Tujuan dari penelitian ini adalah untuk mendeskripsikan struktur gerak tari topeng Gunungsari yang terdiri dari unsur gerak, motif gerak, dan ragam gerak berupa dokumentasi tertulis struktur gerak tari topeng Gunungsari di Desa Jabung Kecamatan Jabung Kabupaten Malang. Penelitian ini menggunakan penelitian kualitatif dengan jenis penelitian deskriptif, karena penelitian ini memperoleh datanya dilakukan secara alami dimana hasil dari penelitian tersebut dideskripsikan dalam bentuk kata-kata, gambar dan bukan angka-angka. Lokasi penelitian ini berada di Jalan Anjasmoro RT 03 RW 03 Desa Jabung Kecamatan Jabung Kabupaten Malang yang merupakan tempat tinggal seniman wayang topeng di Desa Jabung. Metode pengumpulan data menggunakan wawancara, observasi dan tambahan dokumentasi berupa gambar. Analisis yang dilakukan dengan mengelompokkan data serta klasifikasi data, memaparkan data dan menarik kesimpulan. Hasil penelitian struktur gerak tari topeng Gunungsari di Desa Jabung Kecamatan Jabung Kabupaten Malang yaitu: (1) Unsur gerak yang terdiri dari unsur gerak kepala, tangan, badan, dan kaki. (2) Motif gerak tari topeng Gunungsari terdiri dari motif gerak statis dan motif gerak dinamis. Motif gerak statis terdiri dari sikap tanjak, bapangan, sembahan, sikap Gunungsari. Motif gerak dinamis terdiri dari geberan, bukak slambu, lembehan, labas, ngrawit golengan, kencak, nggelap, pogukan lamba, pogukan rangkep, sowangan,kopyokan, pogukan ukel, wiletan, semarangan, sembahan, sowangan jengkeng, merak ngombe, merak geber, merak ngigel, gejegan,dan menjangan ranggah. (3) Ragam gerak tari topeng Gunungsari terdiri dari ragam gerak statis dan dinamis. Ragam gerak statis tari topeng Gunungsari yaitu lembehan, bapangan, golengan, kencak, sowangan, kopyokan. Ragam gerak dinamis tari topeng Gunungsari yaitu geberan, singget, labas, nggelap, pogukan lamba, pogukan rangkep, sowangan, pogukan ukel, semarangan, wiletan, sembahan, merak ngombe, merak geber, merak ngigel, kipatan sampur, gejegan dan menjangan ranggah. Penelitian ini diharapkan berguna bagi pelestarian tari topeng Gunungsari yang pada saat ini sudah jarang diminati oleh generasi muda sebagai generasi penerus bangsa. Selain itu penelitian ini diharapkan berguna untuk mendukung adanya penelitian serupa yang lebih mendalam mengenai tari topeng Gunungsari di Desa Jabung Kecamatan Jabung Kabupaten Malang.

Pengembangan strategi pembelajaran fonik dalam peningkatan berbicara anak Kelompok A di TK Tunas Harapan Kota Probolonggo / Dea Rahmania

 

Rahmania. D. 2015. Pengembangan Strategi Pembelajaran Fonik Dalam Peningkatan Berbicara Anak A Di TK Tunas Harapan Kota Probolinggo. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Drs. Abdul Huda, M.Pd., (2) Drs. I Made Seken, M.Pd Kata kunci: strategi pembelajaran fonik, peningkatan, berbicara, anak usia dini     Pada studi pendahuluan di TK Tunas Harapan Probolinggo diketahui bahwa kemampuan berbicara anak masih kurang, disebabkan beberapa faktor: (1) perkembangan bicara anak belum benar-benar diamati, (2) sebagian orang menganggap perkembangan bicara hanya akan berjalan seiring waktu, (3) kegiatan peningkatan berbicara monoton. Peneliti ingin mengembangkan strategi pembelajaran yang dapat meningkatkan kemampuan berbicara anak dengan tujuan menghasilkan produk yang valid dan efektif.     Subjek penelitian ini yaitu seluruh anak didik kelompok A TK Tunas Harapan Kota Probolinggo. Tahap dalam penelitian ini (1) Pengumpulan data, (2) Perencanaan (Planning), (3) Pengembangan Draf Produk, (4) Uji coba lapangan awal, (5) Revisi hasil uji coba, (6) Penyempurnaan Produk, (7) Uji pelaksanaan lapangan, (8) Penyempurnaan produk akhir. Instrumen pada penelitian ini berupa (1) Kuisioner ahli pembelajaran anak usia dini, (2) Kuisioner ahli bahasa anak usia dini, (3) Kuisioner pendidik anak usia dini, (4) Wawancara pendidik anak usia dini. Hasil penelitian menunjukkan bahwa pelaksanaan kegiatan pembelajaran yang dilakukan dengan menggunakan strategi pembelajaran fonik yang diaplikasikan dalam bentuk kegiatan bernyanyi mampu meningkatkan kemampuan berbicara anak kelompok A TK Tunas Harapan Kota Probolinggo. Berdasarkan hasil uji coba kelompok kecil (aspek kemudahan) diperoleh hasil 91,6%, hasil uji coba kelompok kecil (aspek pengaplikasian kegiatan) diperoleh hasil 87,5%, hasil uji coba kelompok kecil (aspek kesenangan) diperoleh hasil 95,8%, dan berdasarkan hasil uji coba kelompok keci (aspek peningkatan berbicara) diperoleh hasil 89,6%. Sedangkan pada uji coba lapangan (aspek kemudahan) diperoleh hasil 89,3%, hasil uji coba lapangan (aspek pengaplikasian) diperoleh hasil 83,3%, hasil uji coba lapangan (aspek kesenangan) 97,3%, hasil uji coba lapangan (aspek peningkatan berbicara) 92,7%.      Dengan demikian dapat disimpulkan strategi pembelajaran fonik dapat digunakan dalam pengembangan berbicara anak. Disarankan kepada guru dapat menjadi acuan untuk peningkatan berbicara dengan memperhatikan bagaimana cara atau langkah – langkah pelaksanaan strategi pembelajaran dengan benar serta, motivasi bagi guru untuk mengembangkan inovasi dan kreativitas dalam kegiatan strategi pembelajaran fonik agar meningkatkan kemampuan berbicara anak.

Strategi pengelolaan pembiayaan pendidikan pada sekolah gratis di SD Negeri 2 Padokan Kecamatan Kasihan Kabupaten Bantul Daerah Istimewa Yogyakarta / Purwantiningsih

 

Purwantiningsih. 2015. Strategi Pengelolaan Pembiayaan Pendidikan Pada Sekolah Gratis di SD Negeri 2 Padokan Kecamatan Kasihan, Kabupaten Bantul, Daerah Istimewa Yogyakarta. Tesis, Program Studi Manajemen Pendidikan, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Kusmintardjo, M.Pd., (II) Prof. Dr. Hj. Nurul Ulfatin, M.Pd. Kata kunci: strategi, pengelolaan pembiayaan, sekolah gratis.     Strategi pengelolaan pembiayaan pendidikan merupakan salah satu langkah yang strategis dalam pencapaian tujuan pendidikan. Pada kebijakan sekolah gratis, perlu adanya strategi untuk mengatasi masalah-masalah yang dihadapi dan mengoptimalkan sumber dana yang tersedia agar kegiatan-kegiatan sekolah dapat berjalan secara efektif dan efisien. Selain itu, strategi dan transparansi pengelolaan pembiayaan sekolah perlu diterapkan untuk meningkatkan peran serta masyarakat dalam pembiayaan pendidikan sekolah gratis.     Tujuan pelitian ini adalah: (1) mendiskripsikan profil sekolah dasar negeri yang menerapkan sekolah gratis, (2) mendiskripsikan strategi sekolah dasar negeri yang menerapkan sekolah gratis dalam menggali sumber dana pendidikan dalam pengelolaan pembiayaan pendidikan, (3) mendiskripsikan strategi sekolah dasar negeri yang menerapkan sekolah gratis dalam mengelola pembiayaan pendidikan, (4) mendiskripsikan transparansi pengelolaan pembiayaan pendidikan di sekolah dasar negeri yang menerapkan sekolah gratis, dan (5) mendiskripsikan strategi sekolah dasar negeri yang menerapkan sekolah gratis dalam mengatasi masalah-masalah yang dihadapi dalam pengelolaan pembiayaan pendidikan sekolah gratis.     Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus. Data penelitian dihasilkan peneliti ketika proses pengumpulan data di lokasi penelitian. Teknik pengumpulan data yang digunakan adalah studi dokumentasi, observasi, dan wawancara mendalam. Sedangkan credibility, transferability, dependability, dan confirmability diterapkan untuk mengecek keabsahan data. Analisis data dilakukan dengan tiga tahap, yaitu: reduksi data, penyajian data, dan penarikan kesimpulan/verifikasi.     Hasil penelitian menunjukkan bahwa SD Negeri 2 Padokan merupakan sekolah dasar negeri yang menerapkan sekolah gratis yang mempunyai jumlah guru, murid, kegiatan, dan prestasi yang banyak. Strategi sekolah dalam menggali sumber dana dan mengoptimalkan sumber dana yang ada antara lain adalah: (1) menganalisa kebutuhan dan kemampuan sekolah, (2) mengidentifikasi sumber daya yang dapat dimanfaatkan, (3) mengklasifikasikan sumber dana dan alokasi dana berdasarkan skala prioritas, (4) menjalin kerjasama dengan masyarakat dan lembaga-lembaga lain, (5) mengajukan permohonan bantuan kepada lembaga-lembaga dalam bidang kelembagaan, (6) mengajukan permohonan bantuan kepada masyarakat berupa fasilitas yang dimiliki oleh masyarakat, (7) menjalin kerjasama dengan orangtua wali murid, dan (8) memanfaatkan bantuan dari masyarakat dan lembaga lain untuk peningkatan mutu sekolah dan kebutuhan/kegiatan sekolah yang tidak dianggarkan pada alokasi dana yang bersumber dari pemerintah. Strategi pengelolaan pembiayaan pendidikan melalui empat tahap yaitu: (1) perencanaan pembiayaan dengan menyusun RKAS, (2) pelaksanaan pembiayaan dilakukan sesuai dengan prosedur dan jadwal pelaksanaan dalam anggaran oleh guru dan karyawan yang berkepentingan dalam pengalokasian anggaran sekolah dengan melakukan pertanggungjawaban kepada bendahara sekolah, (3) pengawasan pembiayaan, dilakukan oleh pemerintah, kepala sekolah, guru, karyawan, orangtua/wali murid dan masyarakat, dan (4) evaluasi pembiayaan, dilakukan dengan menyusun laporan pertanggungjawaban penggunaan dana sekolah baik dana yang bersumber dari pemerintah, masyarakat, orangtua wali murid, maupun dana yang bersumber dari lembaga-lembaga lain. Transapransi pengelolaan pembiayaan dilakukan mulai dari proses perencanaan, pelaksanaan, pengawasan, dan evaluasi pembiayaan pendidikan dengan peran serta pihak yang terkait dalam pengelolaan pembiayaan dan ditempelnya dokumen RKAS dan laporan pertanggungjawaban penggunaan dana BOS. Strategi sekolah dalam mengatasi masalah-masalah pembiayaan sekolah gratis antara lain: (1) mengalokasikan anggaran rutin dengan sumber dana dari pemerintah pusat yang bisa dipastikan waktu penerimaannya, (2) memberikan tugas tambahan yang menghasilkan honor tambahan kepada GTT dan PTT agar kesejahteraan mereka meningkat, dan (3) membentuk paguyuban wali murid.     Saran-saran penelitian diharapkan (1) pemerintah pusat, sebaiknya menjadikan masalah-masalah yang dialami sekolah sebagai masukan untuk mengevaluasi kebijakan yang telah dicanangkan dan menjadikan acuan untuk menetapkan kebijakan pendidikan di masa yang akan datang, (2) pemerintah daerah, sebaiknya mengelola keuangan daerah dengan baik agar tidak terjadi keterlambatan pencairan dana BOS daerah dan memberikan peluang yang sebesar-besarnya kepada masyarakat dan lembaga lain yang ingin memberikan bantuan kepada sekolah, (3) sekolah , sebaiknya menjalin hubungan yang baik dengan alumni, lembaga lain, dan masyarakat agar peran serta mereka dapat dioptimalkan, (4) masyarakat, sebaiknya memberikan kontribusi dalam bentuk tenaga, pikiran, waktu, maupun fasilitas yang dimiliki terhadap sekolah untuk mendukung terlaksananya kegiatan sekolah dan peningkatan mutu sekolah, dan (5) peneliti selanjutnya, sebaiknya melanjutkan/mengembangkan penelitian ini baik dengan fokus penelitian yang sama maupun aspek-aspek lainnya mulai dari lembaga pendidikan dasar hingga lembaga pendidikan tinggi.

Pengembangan modul berbasis elektronik dengan pendekatan saintifik pada mata pelajaran pengantar akuntansidan keuangan kelas X Perbankan SMK Muhammadiyah 7 Gondanglegi / Nur Hayyu Khosyiyati

 

ABSTRAK Khosyiyati, Nur Hayyu. 2016. Pengembangan Modul Berbasis Elektronik dengan Pendekatan Saintifik Pada Mata Pelajaran Pengantar Akuntansi dan Keuangan Kelas X Perbankan SMK Muhammadiyah 7 Gondanglegi. Skripsi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Sriyani Mentari, S.Pd., M.M., (2) Ika Putri Larasati, S.E., MCom. Kata Kunci:Modul, Modul Berbasis Elektronik dengan Pendekatan Saintifik Modul merupakan bentuk bahan ajar yang memberikan kesempatan peserta didik untuk belajar mandiri sesuai dengan kecepatan pemahaman dan gaya belajar masing-masing peserta didik. Modul yang didukung dengan perkembangan teknologi akan semakin meningkatkan minat dan hasil belajar peserta didik. Dalam membuat bahan ajar tidak lepas dari kurikulum yang berlaku yaitu kurikulum 2013 dengan pendekatan saintifik sebagai ciri khas. Penelitian ini dilaksanakan dengan tujuan menghasilkan produk modul berbasis elektronik dengan pendekatan saintifik yang telah melalui proses validasi sehingga dinyatakan efektif meningkatkan hasil belahar siswa. Penelitian ini menggunakan penelitian pengembangan dengan model Borg and Gall. Tahapan meliputi analisis kebutuhan, pengembangan produk awal, validasi ahli, revisi I, uji coba lapangan terbatas, revisi II,dan produk akhir. Validasi modul elektronik dengan pendekatan saintifik dilakukan oleh tiga subjek ahli yaitu ahli media, materi, dan pengguna. Hasil validasi menunjukkan bahwa modul elektronik efektifmeningkatkan hasil belajar siswa. Selain itu modul elektronik terdapat keterbatasan yaitu tidak memungkinkan adanya interaksi antara siswa dan guru atau antar siswa, menggunakan akses internet untuk mengerjakan soal latihan, dan siswa tidak dapat mengetahui benar atau salahnya jawaban ketika mengerjakan soal essay. Saran lebih lanjut untuk penelitian ini adalahdengan membuatforum diskusi dalam modul, membuat soal latihan offline, dan membuat umpan balik pada soal essay.

Defragmenting struktur berpikir siswa field dependence melalui pemetaan kognitif untuk memperbaiki kesalahan dalam memahami perbandingan trigonometri / Tantri Ika Yulandari

 

Yulandari, I. T. Defragmenting Struktur Berpikir Siswa Field Dependence Melalui Pemetaan Kognitif untuk Memperbaiki Kesalahan dalam Memahami Perbandingan Trigonometri. Tesis. Program Studi Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing (1) Prof. Dr. Toto Nusantara, M.Si., (2) Dr. Hery Susanto, M.Si. Kata kunci: Struktur Berpikir, Kesalahan SiswaField Dependence(FD), Defragmenting, Pemetaan Kognitif, PerbandinganTrigonometri Penelitian ini bertujuan untuk mendapatkan deskripsihambatan berpikir yang diwujudkan dalam bentuk kesalahan siswa dan defragmenting struktur berpikir melalui pemetaan kognitif dalam menyelesaikan masalah perbandingan trigonometri pada segitiga siku-siku. Berdasarkan pada hasil observasi, peneliti menemukan kesalahan yang dialami oleh siswa antara lain masalah konseptual dan prosedural. Sebagai salah satu variabel pembelajaran, gaya kognitif mencerminkan karakteristik siswa. Peneliti akan melakukan defragmenting kepada siswa dengan gaya kognitif strongly FD yang melakukan kesalahan dalam mengerjakan masalah tentang perbandingan trigonometri pada segitiga siku-siku. Oleh karena itu, dalam penelitian ini dikaji defragmentingstruktur berpikir siswa FD melalui pemetaan kognitif untuk memperbaiki kesalahan dalam memahami perbandingan trigonometri. Peneliti memberikan tes penggolongan gaya kognitif kepada 33 siswa kelas XI IA 2 SMAN 7 Malang. Dari hasil tes tersebut, 9 siswa dengan kategori strongly FD. Siswa dengan gaya kognitif strongly FD diminta untuk mengerjakan soal tentang perbandingan trigonometri pada segitiga siku-siku, bertujuan untuk mengetahui kesalahan yang dilakukan siswa ketika mengerjakan soal tersebut dan langkah-langkah defragmenting yang dilakukan. Dari 9 siswa tersebut ternyata 4 siswa benar dalam menyelesaikannya dan 5 siswa masih salah dalam menyelesaikannya, peneliti mengambil 4 siswa sebagai subjek penelitian dengan pertimbangan skor kognitif yang sama. Dari hasil temuan ini, peneliti melakukan defragmenting kepada siswa strongly FD. Peneliti menganalisis hasil pekerjaan dan meminta siswa strongly FD untuk merefleksi hasil pekerjaannya sehingga mengetahui cara berpikirnya dalam menyelesaikan masalah perbandingan trigonometri pada segitiga siku-siku. Setelah itu peneliti melakukan scaffolding kepada siswa strongly FD, hasil scaffolding menjadikan siswa strongly FD bisa menyelesaikan masalah perbandingan trigonometri pada segitiga siku-siku dengan benar sesuai dengan struktur masalah. Defragmenting selain dapat memperbaiki kesalahan siswastrongly FD, juga dapat merestrukturisasi berpikir siswa strongly FD menjadi struktur berpikir yang benar. Dalam menyelesaikan masalah, struktur berpikir siswa strongly FD dikaji berdasarkan empat langkah Polya. Setelah itu siswa dengan gaya kognitif strongly FD diberi soal yang sejenis untuk mengetahui efektifitas defragmenting. Dari hasil penelitian ditemukan hambatan berpikir siswadalam menyelesaikan masalah antara lain 1) hambatan dalam membuat sketsa awal segitiga siku-siku, 2) hambatan mengingat konsep Perbandingan Trigonometri dan 3) kesalahan konsep Teorema Pythagoras. Kesimpulan dari penelitian ini antara lain 1) struktur berpikir siswa sebelum dan sesudah proses defragmenting mengalami perubahan yakni yang awalnya kurang lengkap dan tidak sesuai dengan struktur masalah, setelah didefrag struktur berpikirnya sudah sesuai dengan struktur masalah, dan 2) Efektifitas defragmenting yang dilakukan peneliti terbukti dapat menata dan memperbaiki struktur berpikir siswa yang awalnya salah menjadi struktur berpikir yang benar.

Pengembangan perangkat kurikulum terpadu mata pelajaran IPA kelas VIII di MTs Negeri Batu / Khoridah Sativa

 

Kata Kunci : perangkat kurikulum terpadu, IPA SMP, bahan kajian IPA IPA berkaitan dengan cara mencari tahu tentang alam secara sistematis se-hingga IPA bukan hanya penguasaan konsep-konsep atau prinsip-prinsip saja. Struktur IPA SMP/MTs berdasarkan Permendiknas nomor 22 tahun 2005 substan-sinya adalah materi IPA terpadu, sehingga kurikulum IPA di jenjang ini merupa-kan kurikulum terpadu yang tidak ada pemisahan anatara pembelajaran biologi, fi-sika, dan kimia. Pendekatan yang digunakan juga diusahakan bersifat integral. MTs Negeri Batu menjalankan KTSP sebagai kurikulum untuk mewujudkan visi dan misi MTs Negeri Batu. Khusus pada mata pelajaran IPA, MTs Negeri Batu belum menerapkan IPA terpadu. Pembelajaran IPA yang pernah diterapkan dinilai kurang efektif dan menurunnya hasil UAN. Hal ini disebabkan guru harus me-ngajar dua bidang sekaligus dimana guru hanya berlatar belakang disiplin ilmu tertentu, tidak adanya contoh silabus dan RPP terpadu yang representatif dan ku-rangnya pengetahuan guru mengenai model-model keterpaduan kurikulum. Pe-rangkat kurikulum terpadu yang dikembangkan terbatas pada silabus dan RPP ter-padu, untuk kelas VIII semester ganjil, untuk bahan kajian tertentu. Model-model kurikulum terpadu yang digunakan adalah model kurikulum terpadu miliki Robin Fogarty. Model keterpaduan ini berjumlah 10 namun hanya 3 model saja yang digunakan untuk mengembangkan silabus dan RPP terpadu de-ngan menyesuaikan bahan kajian yang ada pada semester ganjil tersebut. Model keterpaduan yang dikembangkan adalah model connected, nested dan shared. Ke-mudian dari model pemaduan tersebut dikembangkan perangkat kurikulum terpa-du, satu model pemaduan satu topik. Penelitian ini bertujuan untuk menghasilkan perangkat kurikulum terpadu berupa silabus dan RPP terpadu menggunakan model keterpaduan Fogarty. Pe-rangkat yang dikembangkan adalah silabus terpadu model connected, silabus ter-padu model nested, silabus terpadu model shared, RPP terpadu model conneted, RPP terpadu model nested, dan RPP terpadu model shared. Pengembangan pe-rangkat kurikulum terpadu menggunakan model penelitian dan pengembangan R&D Borg dan Gall yang telah disederhanakan dan dipadukan dengan alur pe-ngembangan kurikulum IPA SMP/MTs. Tahap-tahap penelitian dan pengemba-ngan yaitu (a) studi pendahuluan, (b) perancangan program, c) pengembangan program yang mencakup penyusunan silabus dan RPP terpadu, dan d) validasi program yang mencakup penilaian kelayakan produk, uji coba pelaksanaan RPP terpadu kelompok kecil, dan revisi produk. Validasi isi melibatkan dua orang do-sen jurusan Biologi FMIPA UM dan dua orang guru IPA MTs Negeri Batu se dangkan uji coba pelaksanaan RPP terpadu kelompok kecil dilakukan kepada 5 orang siswa kelas VIII MTs Negeri Batu. Data yang diperoleh berupa data kualitatif dan data kuantitatif. Data kuan-titatif diperoleh dari pengubahan skor kumulatif yang diperoleh dari validator ter-hadap masing-masing kisi angket menjadi data persentase serta hasil penilaian sis-wa, respon siswa, dan keterlaksanaan RPP terpadu pada uji coba kelompok kecil. Berdasarkan hasil validasi, masing-masing perangkat kurikulum memperoleh per-sentase kelayakan secara berturut-turut silabus terpadu model connected 85.05%, silabus terpadu model nested 84.38%, silabus terpadu model shared 84.6%, RPP terpadu model connected 90.73%, RPP terpadu model nested 91.35% dan RPP terpadu model shared 89.34%. Beberapa revisi dilakukan berdasarkan data kua-litatif berupa saran perbaikan. Pada akhir penelitian ini dihasilkan produk berupa silabus dan RPP terpadu sebagai perangkat kurikulum terpadu mata pelajaran IPA kelas VIII di MTs Negeri Batu yang dinyatakan layak dan dapat menjadi al-ternatif pembelajaran terpadu di MTs Negeri Batu

Pengaruh model Project Based Learning (PjBL) terhadap kemampuan karya tulis ilmiah geografi siswa kelas XI IPS / Firayatin Yashintawati

 

ABSTRAK Yashintawati, Firayatin. 2015. Pengaruh Model Project Based Learning (PjBL) terhadap Kemampuan Menyusun Karya Tulis Ilmiah Geografi Siswa Kelas XI IPS. Skripsi, Jurusan Geografi FIS, Universitas Negeri Malang. Pembimbing: (I) Drs. Hadi Soekamto S.H., M.Pd., M.Si., (II) Dra. Yuswanti Ariani Wirahayu, M.Si. Kata Kunci: Project Based Learning (PjBL), Kemampuan Menyusun Karya Tulis Ilmiah Model Project Based Learning (PjBL) tidak hanya mendorong siswa aktif di kelas, namun juga dapat membantu siswa dalam mengasah keterampilan berpikir sistematis, logis, kritis, kreatif serta pemecahan masalah karena pembelajarannya bermakna, menyenangkan dan bersinggungan langsung dengan dunia nyata. Hal tersebut karena model Project Based Learning (PjBL) berlandaskan teori konstruktivisme, konstruksionisme dan kolaboratif yang bersifat kontekstual, serta berbasis saintifik yang sintak pembelajarannya dilakukan sesuai dengan prosedur ilmiah. Kesemua keterampilan tersebut sangat membantu dalam penyusunan karya tulis ilmiah. Oleh karena itu, penerapan model Project Based Learning (PjBL) dalam kegiatan pembelajaran secara tidak langsung dapat mengasah kemampuan siswa dalam menyusun karya tulis ilmiah. Penelitian ini dilakukan untuk mengetahui pengaruh model Project Based Learning (PjBL) terhadap kemampuan siswa kelas XI IPS dalam menyusun karya tulis ilmiah pada mata pelajaran Geografi. Jenis penelitian ini adalah penelitian kuantitatif dengan bentuk penelitian eksperimen semu (quasy eksperimental) yang menggunakan rancangan post-test only design. Subyek penelitian berjumlah 73 siswa, yang dibagi ke dalam kelas eksperimen sebanyak 36 siswa dan kelas kontrol sebanyak 37 siswa. Kelas eksperimen diberi perlakuan menggunakan model Project Based Learning (PjBL), sedangkan kelas kontrol menggunakan pembelajaran konvensional (ceramah, diskusi dan tanya jawab). Teknik pengolahan data menggunakan rubrik penilaian penulisan karya tulis ilmiah yang dikembangkan oleh peneliti. Data penelitian ini diuji menggunakan uji t dengan sampel tidak berpasangan, yakni dengan bantuan program SPSS 18.0 for Windows independent sample t-test. Hasil yang diperoleh adalah Sig. (2-tailed) < 0,05 yakni 0,000 yang berarti H0 ditolak atau tidak dapat diterima, dengan selisih rata-rata nilai antara kelas eksperimen dengan kelas kontrol adalah 13,27. Rata-rata nilai menulis karya tulis ilmiah kelas eksperimen menunjukkan angka lebih tinggi yakni 80,06 sedangkan rata-rata nilai menulis karya tulis ilmiah kelas kontrol hanya 66,78. Oleh karena itu, penelitian ini menghasilkan temuan bahwa model Project Based Learning (PjBL) berpengaruh positif terhadap kemampuan menyusun karya tulis ilmiah geografi siswa kelas XI IPS. Saran bagi pihak sekolah terutama yang telah menerapkan K13, hendaknya mewajibkan atau minimal aktif memberikan arahan kepada para guru untuk menerapkan model Project Based Learning (PjBL) dalam kegiatan pembelajaran karena mampu meningkatkan kemampuan menyusun karya tulis ilmiah siswa serta mengintegrasikan model Project Based Learning (PjBL) ke dalam program sekolah. Sedangkan bagi guru, diharapkan mampu memahami betul kelebihan dan kekurangan model Project Based Learning (PjBL) dalam kegiatan pembelajaran agar pembelajaran dapat berjalan dengan baik, sehingga dapat berpengaruh positif dalam meningkatkan kompetensi siswa. Bagi peneliti lain yang akan melakukan penelitian terhadap model Project Based Learning (PjBL) dapat menerapkannya pada mata pelajaran lain yang memiliki materi bersifat aplikatif, atau dapat juga meneliti pengaruh model Project Based Learning (PjBL) terhadap kompetensi lain misalnya berpikir kompleks, berpikir analitis, life skill, dan dapat pula membandingkan keefektifan model Project Based Learning (PjBL) dengan model pembelajaran berbasis saintifik lainnya dalam kegiatan pembelajaran di kelas.

Pengembangan modul memahami prinsip-prinsip penyelenggaraan administrasi perkantoran dengan pendekatan kontekstual untuk meningkatkan hasil belajar siswa (studi pada siswa Administrasi Perkantoran kelas X di SMK Muhammadiyah 5 Kepanjen Kabupaten Malang) / Alfiatul Khasa

 

ABSTRAK Khasanah, A. 2016.Pengembangan Modul Memahami Prinsip-Prinsip Penyelenggaraan Administrasi Perkantoran dengan Pendekatan Kontekstual Untuk Meningkatkan Hasil Belajar Siswa (Studi Pada Siswa Administrasi Perkantoran Kelas X di SMK Muhammadiyah 5 Kepanjen Kabupaten Malang). Skripsi. Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Drs. H. Moh. Arief, M.Si., (2) Drs. H. Gatot Isnani, M.Si. Kata Kunci: pendekatan kontekstual, modul pembelajaran, hasil belajar. Kegiatan belajar mengajar sekarang ini lebih mengutamakan partisipasi siswa daripada guru.Besarnya partisipasi siswa dalam pembelajaran diharapkan mampu membantu siswa dalam menemukan dan mengembangkan baik informasi maupun masalah yang dihadapi dalam setiap pembelajaran.Tidak hanya itu besarnya partisipasi juga diharapkan agar siswa dapat menerapkannya dalam dunia nyata.Oleh karena itu, pembelajaran yang dilakukan lebih menekankan pada pemahaman daripada konsep yang berupa hafalan.Pemahaman dapat dengan mudah jika dilakukan berulang-ulang dan dikaitkan dengan dunia nyata.Tentunya pengulangan tersebut dilakukan dengan tujuan untuk mengembangkan hal-hal yang telah dipelajari dan memperoleh hasil yang maksimal.Melalui modul pembelajaran yang dikembangkan, diharapkan dapat meningkatkan hasil belajar siswa kelas X Administrasi Perkantoran. Pengembangan modul pembelajaran ini bertujuan untuk (1) menghasilkan modul dengan pendekatankontekstual dengan kompetensi dasar Mendeskripsikan Fungsi Pekerjaan Kantor dalam Organisasi dan Mengidentifikasi Pekerjaan Kantor, (2) mengetahui kelayakan modul yang telah dibuat melalui proses uji validasi, (3) mengetahui tingkat efektivitas melalui perbandingan hasil belajar siswa dengan menggunakan modul Memahami Prinsip-Prinsip Penyelenggaraan Administrasi Perkantoran dengan siswa yang tidak menggunakan modul. Prosedur penelitian dan pengembangan pada penelitian ini memodifikasi model penelitian dan pengembangan Borg & Gall yang terdiri dari beberapa tahap yaitu: (1) penelitian dan pengumpulan data, (2) perencanaan, (3) pengembangan draf produk, (4) uji coba lapangan awal, (5) revisi hasil uji coba, (6) uji coba lapangan, dan (7) penyempurnaan produk akhir. Validasi modul pembelajaran dilakukan oleh 2 ahli modul, 2 ahli materi dan siswa.Untuk mengetahui efektivitas modul diterapkan di kelas eksperimen dan kelas kontrol dengan menggunakan Posttest Only Control Design.Subjek coba pada penelitian dan pengembangan ini adalah siswa kelas X Administrasi Perkantoran SMK Muhammadiyah 5 Kepanjen, di mana siswa kelas X APK 1 sebagai kelas eksperimen dan kelas X APK 2 sebagai kelas kontrol.Soal posttest diuji cobakan untuk mengetahui soal yang baik untuk digunakan soal posttestranah kognitif.Instrumen yang digunakan untuk pengumpulan data berupa angket atau kuesioner terbuka dan tertutup.Skala pengukuran yang digunakan adalah skala Likert dengan 5 alternatif jawaban yaitu sangat setuju, setuju, cukup setuju, tidak setuju, dan sangat tidak setuju.Teknis analisis data yang digunakan dalam penelitian dan pengembangan ini adalah data kuantitatif kualitatif.Data kualitatif berupa analisis tanggapan, kritik dan saran dari hasil validasi ahli modul, ahli materi dan siswa, sedangkan data kuantitatif diperoleh dari hasil validasi, taraf kesukaran, daya pembeda dan hasil belajar kelas ekperimen dan kelas kontrol.Pada analisis hasil belajar menggunakan uji F dan uji t dengan bantuan software IBM SPSS Statistics 21. Pada uji coba soal didapat 20 soal yang memenuhi kriteria taraf kesukaran dan daya pembeda untuk digunakan soal posttest ranah kognitif.Hasil validasi ahli materi adalah 82,63% yang menyatakan modul pembelajaran sangat valid dan dapat digunakan tanpa perbaikan, hasil validasi ahli modul 89,23% yang menyatakan modul pembelajaran sangat valid dan dapat digunakan tanpa perbaikan, dan validasi siswa 88,5% yang menyatakan modul pembelajaran sangat valid dan dapat digunakan tanpa perbaikan. Berdasarkan independent samples t-test pada output pertama rata-rata kelas eksperimen lebih tinggi daripada kelas kontrol, rata-rata nilai eksperimen adalah 78,90 dan kelas kontrol 71,47. Pada output kedua menunjukkan bahwa nilai thitung lebih kecil daripada ttabelmaka Hoditerima artinya tidak ada perbedaan rata-rata hasil belajar yang signifikan antara kelas ekperimen dengan kelas kontrol. Berdasarkan output pertama dan kedua dapat disimpulkan bahwa terdapat perbedaan tetapi tidak signifikan antara hasil belajar siswa kelas eksperimen dengan kelas kontrol, keefektifan modul dalam peningkatan hasil belajar termasuk dalam kategori sangat rendah. Berdasarkan hasil penelitian penelitian dan pengembangan ini termasuk dalam kategori valid karena ada peningkatan hasil belajar meskipun tidak signifikan.Saran Pemanfaatan modul pembelajaran bagi guru,(1) Pemanfaatan ModulMemahami Prinsip-Prinsip Penyelenggaraan dengan Pendekatan Kontekstual dapat didampingi bahan ajar lain yang relevan dengan materi, (2) Guru melakukan dan membimbing siswa selama kegiatan belajar mengajar menggunakan modul, dan (3) Guru dapat menambahkan contoh kasus, tugas atau hal lain yang berkaitan dengan materi.Saran pemanfaatan bagi siswa,(1) Siswa dapat meminta arahan atau bimbingan dari guru atau teman belajar, (2) Mengerjakan evaluasi dan tugas baik secara kelompok maupun individu, dan (3) Melakukan cek kemampuan sebelum melanjutkan ke kegiatan belajar selanjutnya. Berdasarkan kajian produk yang telah direvisi dapat disimpulkan sebagai berikut (1) hasil dari penelitian dan pengembangan ini adalah Modul Memahami Prinsip-Prinsip Penyelenggaraan Administrasi Perkantoran dengan Pendekatan Kontekstual, (2) hasil validasi modul dari ahli materi, ahli modul dan siswa adalah sangat valid, sangat efektif, sangat tuntas, dapat digunakan tanpa perbaikan, (3) terdapat perbedaan antara rata-rata hasil belajar kelas eksperimen dan kelas kontrol tetapi tidak signifikan, keefektifan modul terhadap peningkatan hasil belajar termasuk dalam kategori rendah.

Memahamkan konsep volume berbantuan benda manupulatif melalui pembelajaran penemuan terbimbing / Ahmad Mansur Darmawan

 

ABSTRAK Darmawan, Ahmad Mansur. 2015. Memahamkan Konsep Volume Berbantuan Benda Manipulatif Melalui Pembelajaran Penemuan Terbimbing. Tesis, Program Studi Pendidikan Matematika, Program Pasca Sarjana, Universitas Negeri Malang, Pembimbing: (I) Prof. Drs. Gatot Muhsetyo, M.Sc. dan (II) Dr. Sri Mulyati, M.Pd. Kata Kunci: Konsep Volume, Benda Manipulatif, Penemuan Terbimbing. Berdasarkan hasil tes awal yang dilakukan peneliti menunjukkan bahwa siswa mengalami kesulitan pada materi geometri terutama volume bangun ruang sisi lengkung. Hal ini disebabkan karena dalam pembelajaran siswa hanya mendengarkan, menulis, menghafal dan mengerjakan soal sesuai contoh. Faktor lain karena guru tidak melibatkan dunia nyata dalam pembelajaran. Bahan manipulatif sebagai salah satu media penghubung antara dunia ide dan dunia nyata. Perlu dilakukan pembelajaran yang melibatkan aktifitas siswa melalui pembelajaran penemuan terbimbing. Penelitian ini bertujuan untuk mendeskripsikan keterlaksanaan langkah-langkah pembelajaran penemuan terbimbing berbantuan benda manipulatif. Langkah-langkah pembelajaran penemuan terbimbing terdiri dari enam tahapan yaitu: (a) memberikan rangsangan, (b) mengidentifikasi masalah, (c) pengumpulan data, (d) pengolahan data, (e) verifikasi data, dan (f) kesimpulan. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK). Penelitian ini terdiri dari dua siklus dan setiap siklus terdiri dari empat tindakan. Sumber data yang yang digunakan dalam penelitian ini adalah siswa kelas IX SMP Islam Bustanul Ulum. Data yang dikumpulkan antara lain berasal dari: a) hasil pekerjaan siswa secara tertulis, b) hasil wawancara, c) hasil observasi, dan d) hasil wawancara respon siswa. Temuan dalam penelitian ini terdapat siswa dalam menyelesaikan tes akhir kurang teliti dalam melakukan penghitungan, terburu-buru dalam menyelesaikan soal sehingga rumus yang ditulis tidak lengkap. Oleh karena itu peneliti mengarahkan siswa agar dalam menyelesaikan soal untuk lebih teliti. Saran yang dapat dikemukakan peneliti antara lain: a) bahan manipulatif yang digunakan dalam pembelajaran sebaiknya digunakan bahan dari mika agar lebih mudah dalam pembuatannya, b) Untuk menghindari kemungkinan siswa menjadikan benda manipulatif sebagai bahan mainan, bisa dilakukan dengan membuat aturan yang telah disepakati bersama (c) mengembangkan penelitian dengan metelusuri lebih dalam tentang kesulitan siswa dalam menuliskan kesimpulan secara benar.

Pengembangan modul administrasi humas dan keprotokolan berbasis guided inquiry untuk meningkatkan hasil belajar siswa (studi pada siswa kelas XI Program Studi Administrasi Perkantoran SMKN 1 Malang) / Annita Virgia Putri

 

ABSTRAK Putri, Annita Virgia. 2016.PengembanganModulAdministrasiHumasdanKeprotokolanBerbasis Guided Inquiry Untuk Meningkatkan Hasil Belajar Siswa (StudipadaSiswaKelas XI Program StudiAdministrasiPerkantoran SMKN 1 Malang). Skripsi. Program Studi Pendidikan Administrasi Perkantoran,JurusanManajemen, FakultasEkonomi, UniversitasNegeri Malang. Pembimbing: (1) Drs. H. Mohammad Arief, M.Si., (2) Dr. WahjuWibowo, A.Md, S.E., M.Si Kata Kunci:modul, guided inquiry, humas dan keprotokolan, hasil belajar. Belum tersedianya modul pembelajaran Administrasi Humas dan Keprotokolan yang sesuai dengan kurikulum 2013, dan guru mengumpulkan materi dari berbagai sumber dan menyesuaikan dengan silabus di SMK Negeri 1 Malang. Sehingga, peneliti mengembangkan modul pembelajaran Administrasi Humas dan Keprotokolan berbasis guided inquiry. Tujuanpenelitianini adalah: (1) menghasilkanmodulAdministrasiHumasdanKeprotokolanberbasis guided inquiryuntuksiswakelas XI program studiAdministrasiPerkantoran semester genap, (2) mengetahui kelayakan modul yang dikembangkan melalui hasil validasi, dan (3) mengetahui perbedaan hasil belajar siswa yang menggunakan modul dengan siswa yang tidak menggunakan modul melalui hasil posttest. Prosedurpengembanganmenggunakan model 4-D seperti yang disarankan oleh Thiagarajan, Semmel, dan Semmel (dalam Al-Tabany (2014:232-235)). Model 4-D terdiri dari empat tahap pengembangan, yaitu define, design, develop, dan desseminate, atau diadaptasikan menjadi model 4-P, yaitu pendefinisian, perancangan, pengembangan, dan penyebaran. Hasildaripenelitian pengembangan adalah modul Administrasi Humas dan Keprotokolan dengan menggunakan model guided inquiry. Kompetensi dasar yang dikembangkan ialah pengelolaan rapat dan penulisan laporan pertemuan. Berdasarkan penilaian dari validator diperoleh rata-rata sebesar 88.80% yang berarti modul ini sangat valid digunakan dalam proses pembelajaran. Perbedaan rata-rata hasil belajar kelas eksperimen dan kelas kontrol, yaitu 82,65 dan 72,36. Analisis uji t program SPSS,nilai signifikansi adalah 0,01 menunjukkan bahwa nilai signifikansi kurang dari 0,05. Artinya, ada perbedaan yang signifikan antara hasil belajar kelas eksperimen dengan kelas kontrol. Kesimpulan dari penelitian pengembangan ini adalah: (1) hasil dalam penelitian ini adalah modul pembelajaran Administrasi Humas dan Keprotokolan berbasis guided inquiry untuk kelas XI program studi Administrasi Perkantoran, (2) modul pembelajaran yang terdiri dari lima aspek dan sudah dilakukan validasi termasuk layak digunakan dalam proses kegiatan pembelajaran di kelas, (3) dan analisis uji t menyatakan bahwa ada perbedaan hasil belajar yang signifikan antara kelas eksperimen dengan kelas kontrol dimana hasil belajar kelas eksperimen lebih tinggi dibandingkan hasil belajar kelas kontrol.

Pengembangan perangkat ajar bercirikan realistic mathematics education pada materi matriks untuk kelas X SMK / Lutfia Marsalina

 

Marsalina, Lutfia. 2015. Pengembangan Perangkat Ajar Bercirikan Realistic Mathematics Education Pada Materi Matriks Untuk Kelas X SMK. Tesis. Jurusan Pendidikan Matematika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Ipung Yuwono, M.S. M.Sc., (II) Dr. Swasono Rahardjo, S.Pd. M.Si. Kata kunci: pengembangan perangkat ajar, Realistic Mathematics Education, matriks. Penelitian pengembangan ini didasarkan pada kondisi nyata di SMKN 1 Boyolangu Tulungagung, bahwa perangkat ajar materi matriks yang digunakan selama ini adalah Lembar Kerja Peserta Didik (LKPD) yang berasal dari luar sekolah. LKPD kebanyakan memuat ringkasan materi, contoh soal, dan latihan soal. Sehingga peserta didik hanya memperoleh ketrampilan prosedural dan belajar kurang bermakna. Oleh karena itu perlu dikembangkan perangkat ajar yang dapat membantu peserta didik untuk menemukan konsep dan belajar secara bermakna. Perangkat ajar yang dikembangkan adalah LKPD dan RPP yang berbasis Realistic Mathematics Education (RME) pada materi matriks untuk kelas X SMK. Tujuan penelitian ini adalah menghasilkan perangkat ajar berupa Lembar Kerja Peserta Didik (LKPD) dan Rencana Pelaksanaan Pembelajaran (RPP) bercirikan Realistic Mathematics Education (RME) pada materi matriks untuk kelas X SMK yang valid, praktis, dan efektif. Penentuan kriteria tersebut diperoleh melalui hasil validasi dan uji coba. Perangkat ajar ini dikembangkan dengan mengacu pada model pengembangan Four-D yang dikembangkan oleh Thiagarajan, Semmel, dan Semmel (1974). Model ini mempunyai empat tahap pengembangan yaitu Tahap Pendefinisian (Define), Tahap Perancangan (Design), Tahap Pengembangan (Develop), dan Tahap Penyebaran (Disseminate). Penelitian ini hanya sampai pada tahap pengembangan. Tahap penyebaran tidak dilakukan, karena tahap ini memerlukan kajian yang lebih luas dan lebih mendalam. Berdasarkan hasil validasi tiga validator, diperoleh hasil bahwa LKPD yang dikembangkan memenuhi kriteria valid, yaitu terletak pada rentang , dengan skor rata-rata seluruh aspek adalah 3,35 demikian juga skor penilaian RPP memenuhi kriteria valid, yaitu 3,27 sehingga dapat diujicobakan dalam kelas uji coba. Dari hasil uji coba lapangan diperoleh hasil observasi keterlaksanaan perangkat ajar dan observasi aktivitas guru dalam pembelajaran seluruh pertemuan diperoleh skor 87,5%. Sedangkan dari hasil wawancara, guru menyatakan bahwa produk hasil pengembangan dapat diterapkankan dan mudah digunakan dalam pembelajaran. Sehingga menurut kriteria, perangkat ajar dikatakan praktis. Pada uji keefektifan diperoleh hasil observasi keterlaksanaan perangkat ajar dan observasi aktivitas peserta didik dalam pembelajaran seluruh pertemuan diperoleh skor 85,6%. Dari hasil wawancara, peserta didik menyatakan bahwa produk hasil pengembangan dapat memberikan pengaruh yang positif dalam pembelajaran dan hasil ketuntasan belajar peserta didik setelah menggunakan perangkat ajar mencapai 88,24%. Sehingga menurut kriteria, perangkat ajar dikatakan efektif. Berdasarkan hasil penelitian ini, disarankan hal-hal sebagai berikut: (1) penggunaan LKPD perlu ditunjang dengan buku referensi lain sebagai sumber belajar, (2) dalam pembelajaran guru harus aktif sebagai fasilitator dengan mendampingi peserta didik saat mengerjakan LKPD, (3) guru yang akan menggunakan perangkat ajar ini seharusnya memahami tentang RME, (4) untuk pemanfaatan perangkat ajar secara luas, perlu dilakukan penelitian lanjutan pada tahap penyebaran (diseminate), (5) masalah sehari-hari yang disajikan memerlukan pengembangan lebih lanjut, agar lebih menantang bagi peserta didik untuk menyelesaikannya, dan (6) bagi para pengembang yang akan mengembangkan perangkat ajar bercirikan RME untuk materi matriks atau materi lain, sebaiknya berkolaborasi dengan ahli pembelajaran RME.

Pengaruh bauran pemasaran terhadap loyalitas melalui kepuasan pelanggan (studi kasus pada "1920 Ice" Kota Malang) / Robithul Umam

 

ABSTRAK Umam, Robithul. 2016. Pengaruh Bauran Pemasaran Terhadap Loyalitas Melalui Kepuasan Pelanggan (Studi Kasus Pada “1920 Ice” Kota Malang). Skripsi, Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Drs. H. Mohammad Arif, M.Si (II) Drs. H. Mohammad Hari M. Si Kata Kunci: bauran pemasaran, kepuasan pelanggan, dan loyalitas pelanggan Dalam hal persaingan usaha, loyalitas pelanggan adalah faktor mutlak dalam roda kehidupan suatu usaha. Dengan instrumen bauran pemasaran yang berupa produk, harga, promosi, tempat, orang, proses, dan bukti fisik diharapkan menjadi sebuah alat pendorong kepuasan pelanggan yang pada gilirannya akan menimbulkan loyalitas pelanggan. Tujuan dari penelitian ini ialah mengembangkan teori yang ada tentang bauran pemasaran yang mempengaruhi loyalitas melalui kepuasan pelanggan serta untuk mengetahui apakah teori yang dihunakan masih relevan dan sesuai dengan keadaan yang sebenarnya. Rumusan masalah dalam penelitian ini, diantaranya (1) Bagaimanakah keadaan pelaksanaan bauran pemasaran, kepuasan pelanggan, dan loyalitas pelanggan pada 1920 Ice Kota Malang, (2) Apakah Terdapat pengaruh langsung, positif, dan signifikan bauran pemasaran terhadap kepuasan pelanggan pada 1920 Ice Kota Malang, (3) Apakah terdapat pengaruh langsung, positif, dan signifikan bauran pemasaran terhadap loyalitas pelanggan pada 1920 Ice Kota Malang, (4) Apakah terdapat pengaruh langsung, positif, dan signifikan kepuasan pelanggan terhadap loyalitas pelanggan pada 1920 Ice Kota Malang, (5) Apakah terdapat pengaruh bauran pemasaran terhadap loyalitas melalui kepuasan pelanggan. Adapun hipotesis yang diajukan dalam penelitian ini adalah (1) Terdapat Pengaruh langsung, positif, dan signifikan bauran pemasaran terhadap loyalitas pelanggan pada 1920 Ice Kota Malang, (2) Terdapat pengaruh langsung, positif, dan signifikan bauran pemasaran terhadap kepuasan pelanggan pada 1920 Ice Kota Malang, (3) Terdapat Pengaruh langsung, positif, dan signifikan kepuasan pelanggan terhadap loyalitas pelanggan pada 1920 Ice Kota Malang, (4) terdapat pengaruh bauran pemasaran terhadap loyalitas melalui kepuasan pelanggan pada 1920 Ice Kota Malang. Dengan karakteristik populasi yang bersifat Infinite Population, peneliti menggunakan rumus dari Daniel dan Terrel dalam menentukan jumlah sampel. Dari penghitungan yang peneliti lakukan memalui rumus dari Daniel dan Terrel, didapatkan jumlah sampel sebanyak 100 responden dengan kriteria telah melakukan pembelian lebih dari satu kali. Adapun metode analisis penelitian ini adalah dengan menggunakan metode analisis path. Dimana variabel penelitiannya adalah: Bauran Pemasaran (X), Kepuasan Pelanggan (Z), dan Loyalitas Pelanggan (Y). Hasil dalam penelitian ini adalah (1) variabel bauran pemasaran berpengaruh secara langsung dan signifikan, positif, terhadap loyalitas pelanggan, (2) variabel kepuasan pelanggan berpengaruh secara langsung, positif, dan signifikan terhadap loyalitas pelanggan 1920 Ice Kota Malang, (3) variabel bauran pemasaran berpengaruh langsung, positif, dan signifikan terhadap kepuasan pelanggan 1920 Ice Kota Malang, dan (4) variabel bauran pemasaran berpengaruh secara tidak langsung terhadap loyalitas melalui kepuasan pelanggan pada 1920 Ice Kota Malang. Adapun saran bagi penelitian selanjutnya adalah dengan menambah salah satu variabel bebas yang tidak terbatas pada dua variabel bebas, yaitu variabel bauran pemasaran dan kepuasan pelanggan. yaitu dengan menambah variabel faktor pendapatan misalnya. Hal ini dikarenakan dengan memproyeksikan tingkat pendapatan masyarakat. Perusahaan dapat dengan mudah guna menyasar pelanggan yang tepat.

Pengaruh pembelajaran inkuiri terbimbing berbantuan edmoro terhadap pemahaman konsep termokimia dan motivasi siswa SMK / Dwi Ernawati

 

Ernawati, Dwi. 2015. Pengaruh Pembelajaran Inkuiri Terbimbing dengan Bantuan Edmodo Terhadap Pemahaman Konsep Termokimia dan Motivasi Siswa SMK. Tesis, Program Studi Pendidikan Kimia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dra Surjani Wonorahardjo, Ph.D., (II) Dra Sri Rahayu, M.Ed, Ph.D Kata kunci: inkuiri terbimbing, edmodo, motivasi belajar, pemahaman konsep, termokimia Termokimia merupakan salah satu materi kimia yang dipelajari siswa kelas XI Sekolah Menengah Kejuruan (SMK). Dalam pembelajaran termokimia, masalah yang timbul adalah rendahnya motivasi belajar siswa dan rendahnya pemahaman konsep siswa. Hal ini disebabkan oleh beberapa faktor diantaranya keterbatasan alokasi waktu, pembelajaran cenderung tidak dihubungkan dengan permasalahan siswa, kurangnya perolehan konsep melalui kegiatan praktikum, dan pembelajaran yang masih dipusatkan oleh guru atau ketidakmampuan guru menghadirkan metode pembelajaran yang tepat. Permasalahan ini diharapkan dapat diatasi dengan menerapkan pendekatan inkuiri terbimbing berbantuan edmodo. Penggunaan media edmodo dalam pembelajaran dilakukan untuk analisis data eksperimen, memberikan animasi dan pertanyaan penuntun dari guru. Tujuan penelitian ini adalah untuk membandingkan pengaruh penerapan pembelajaran inkuiri terbimbing dengan bantuan edmodo dan penerapan inkuiri terbimbing tanpa bantuan edmodo terhadap motivasi dan pemahaman konsep siswa pada pokok bahasan termokimia. Penelitian ini menggunakan rancangan eksperimental semu dengan rancangan post-test only control group design. Populasi dalam penelitian ini adalah siswa kelas XI program keahlian Teknologi dan Rekayasa SMKN 2 Trenggalek pada tahun ajaran 2014/2015. Sampel dalam penelitian ini sebanyak 68 siswa dibagi menjadi dua kelas yaitu kelas XI TGB (Teknik Gambar bangunan) B sebagai kelas eksperimen dan kelas XI TGB (Teknik Gambar bangunan) A sebagai kelas kontrol. Data penelitian adalah skor motivasi belajar dan skor pemahaman konsep. Motivasi belajar diukur dengan instrumen soal angket motivasi belajar yang terdiri dari 35 item. Pemahaman konsep diukur dengan tes pilihan ganda yang terdiri dari 25 butir soal. Data skor pemahaman konsep dan motivasi di analisis dengan uji-t. Hasil penelitian menunjukkan: (1) terdapat perbedaan tingkat pemahaman konsep termokimia antara siswa yang dibelajarkan dengan inkuiri terbimbing berbantuan edmodo dengan siswa yang dibelajarkan dengan inkuiri terbimbing tanpa bantuan edmodo; (2) terdapat perbedaan motivasi belajar a antara siswa yang dibelajarkan dengan inkuiri terbimbing berbantuan edmodo dengan siswa yang dibelajarkan dengan inkuiri terbimbing tanpa bantuan edmodo.

Potensi Candi Jago sebagai sarana wisata edukasi / Dwijayati Ari Novia Santi

 

ABSTRAK Santi, Dwijayati Ari Novia. 2016. Potensi Candi Jago sebagai Sarana Wisata Edukasi. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing (I) Deny Yudo Wahyudi, S.Pd., M.Hum. (II) Aditya Nugroho Widiadi, S.Pd., M.Pd Kata kunci: potensi, Candi Jago, wisata edukasi. Kebutuhan rohani manusia seperti kebutuhan rekreasi, sekarang ini menjadi kegiatan yang sering dilakukan oleh hampir seluruh masyarakat di Indonesia. Banyaknya tempat wisata sejarah di Indonesia memberikan dampak positif bagi kemajuan pariwisata di Indonesia. Wisata sejarah yang dilakukan masyarakat Indonesia adalah dengan mengunjungi tempat-tempat peninggalan bersejarah dan tempat yang memiliki nilai budaya tinggi. Seperti halnya yang terjadi di Kabupaten Malang, banyaknya wisatawan yang berkunjung ke Taman Nasional Bromo Tengger Semeru (TNBTS) mempengaruhi peningkatan kunjungan wisatawan ke Candi Jago. Namun, dari kunjungan wisatawan ke Candi Jago ini belum memaksimalkan potensi edukasi di Candi Jago, padahal Candi Jago memiliki potensi untuk dilakukannya pembelajaran sejarah sehingga dapat menjadikan Candi Jago sebagai wisata edukasi. Rumusan masalahpada penelitian ini adalah (1) bagaimana kondisi kepurbakalaanCandi Jago, dan (2) bagaimana potensi Candi Jago sebagai wisata edukasi.Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Metode pengumpulan data dalam penelitian ini dilakukan dengan teknik (1) observasi, (2) wawancara, dan (3) dokumentasi. Sumber data penelitian ini adalah sumber data utama yang diperoleh dari hasil observasi, hasil wawancara dengan informan, dan sumber data pendukung berupa dokumentasi. Pengolahan datanya menggunakan analisis reduksi data, sajian data, dan verifikasi. Hasil penelitian ini menunjukkan bahwa Candi Jago masih memiliki bangunan yang lengkap di antaranya kaki candi, tubuh candi, dan atap candi yang sudah tidak utuh. Candi Jago memiliki arca utama yaitu Arca Wisnuwardhana yang dikelilingi 4 arca pengiring yaitu Syamatara, Sudhanakumara, Hayagriva, dan Bhrekuti yang sekarang berada di Museum Nasional, Jakarta. Selain itu juga terdapat 3 arca muka kala dan arca padmasana yang terletak di depan kaki candi. Relief di Candi Jago cukup jelas dan cukup panjang karena terdiri dari cerita-cerita yang menarik. Lokasi Candi Jago berada di dekat pemukiman yang padat penduduk dan dikelilingi lembaga-lembaga sekolah sehingga membuat Candi Jago sudah sepatutnya digunakan sebagai tempat pembelajaran sejarah. Kalangan pelajar dan mahasiswa paling banyak berkunjung ke Candi Jago. Potensi wisata edukasi di Candi Jago dilihat dari bidang pendidikan dan bidang kesenian. Bidang pendidikan seperti pembelajaran sejarah dapat dikemas dalam bentuk diskusi, studi wisata, observasi, dan penelitian. Dengan pembelajaran di luar kelas, siswa dapat lebih aktif dalam menerima pelajaran. Pembelajaran di luar kelas dengan berkunjung ke Candi Jago, juga disesuaikan dengan materi pembelajaran yang berkaitan dengan Candi Jago. Sedangkan potensi wisata edukasi dalam bidang kesenian adalah pertunjukan sendratari yang bercerita tentang sejarah Candi Jago ataupun relief-relief yang ada di Candi Jago. Sehingga wisatawan yang melihat pertunjukan sendratari di Candi Jago tidak hanya menikmati pertunjukan, namun juga dapat memahami pesan moral dari sendratari tersebut. Potensi selanjutnya dalam bidang kesenian adalah folklor yang beredar di masyarakat. Dengan adanya petuah untuk tidak masuk ke dalam lubang yang berada di tengah bilik utama Candi Jago, secara tidak langsung masyarakat yang percaya turut menjaga kelestarian Candi Jago sebagai cagar budaya.

The failure in traslating humor: A case study in the Indonesian translation of humor graphic novel the Diary of a Wimpy Kid / Rizky Lutviana

 

Keywords: humor, failure in translating humor, translation strategies Technically, translating humor is a big challenge for a translator. This is due to three reasons. Firstly, humor is intended to produce funny effect, which is quite difficult to render. Secondly, although the translators understand the humor they may not be able to bring the funny effect to the target text. Thirdly, humor and fun are subjective. Other people may consider a joke is funny but others do not. The case is the humor novel, The Diary of a Wimpy kid. This is a popular humor graphic novel that the translator creatively combines the humorous story with the amusing graphic cartoon. This novel gains success as well as its Indonesian translated version, Diary Si Bocah Tengil. Despite its success, some readers argue the intended funny effect is well presented. This study aims at pointing at the failure in the translation of humor novel as well as suggesting strategy for better translation. The researcher takes the first volume of the translated series of The Diary of a Wimpy Kid as the object of this study. The data are analyzed qualitatively. The data found are 56 items, covering the failure in the three broad categories of humor, linguistic humor (4 data), cultural humor (25 data), and universal humor (27 data). Based on the analysis, four points can be concluded. Firstly, on the linguistic humor, the translator fails to transfers its aesthetical aspects that make the humor live up. Secondly, in the cultural humor, the translator does not provide the adequate cultural background information so that the readers will understand the humor and does not reveal the atmosphere and the nuances of the story in the target text. Thirdly, in universal humor, there are two factors that make the humor fails to deliver in target text, (1) errors and inappropriateness and, (2) the application of inappropriate translation strategy. Fourthly, in translating the humorous cartoon, the translator does not consider the special aspects of it, such as space and visual. To improve the translator’s work, the researcher suggests the tree alternative solutions. Firstly, in translating linguistic humor, the researcher suggests the translator to apply the semantic translation strategy in which it requires the translator to preserve the beauty aspects of linguistic humor. Secondly, to reveal the cultural elements of the humor in cultural humor, the translator can used the semantic cultural equivalent translation strategy in which it preserves the nuances and atmosphere of humor. Thirdly, for universal humor, since this type of humor is not bound by any language features or cultural elements, it is suggested that the translator apply communicative translation strategy. This strategy enables the translator to choose any words and language style that express the humorous discourse as long as the intended funny effect is delivered and can be understood by most readers.

Penerapan model pembelajaran project based learning untuk meningkatkan keaktifan dan hasil belajar siswa mata pelajaran instalasi sistem komputer dasar di kelas X SMKN 1 Kepanjen / Eka Intan Lestari Sudibyo

 

ABSTRAK Intan, Eka Lestari Sudibyo. 2016. Penerapan Model Pembelajaran Project Based Learning Untuk Meningkatkan Keaktifan dan Hasil Belajar Siswa Mata Pelajaran Instalasi Sistem Komputer di Kelas X SMKN 1 Kepanjen. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dr. H. Tri Atmadji Sutikno, M.Pd. (2) M. Zainal Arifin, S.Si., M.Kom. Kata kunci: Project Based Learning, keaktifan, hasil belajar. Penerapan model pembelajaran yang dilakukan oleh guru adalah model pembelajaran Student Team Archievement Divisions. Guru menerapkan metode pembelajaran ceramah dan metode pembelajaran langsung. Pada metode pembelajaran ceramah hanya ada 16 siswa yang memperhatikan penjelasan guru dan didapatkan 72% siswa tidak lulus KKM. Pada metode pembelajaran langsung, banyak siswa yang tidak dapat mengikuti proses pembelajaran dan siswa cenderung pasif pada proses pembelajaran. Penerapan model pembelajaran berbasis proyek diterapkan untuk meningkatkan keaktifan dan hasil belajar siswa dengan cara membuat karya atau proyek yang terkait dengan materi ajar dan kompetensi yang diharapkan dimiliki oleh siswa. Penelitan tindakan kelas merupakan kegiatan pembelajaran yang dilakukan oleh seorang guru dengan menggunakan metode pembelajaran yang baru atau berbeda dari biasanya untuk memperbaiki aspek pembelajaran di dalam kelas. Penelitian ini merupakan penelitian kualitatif. Metode penelitian yang dilakukan adalah penelitian tindakan kelas dengan model Kemmis & Taggart. Penerapan model pembelajaran berbasis proyek bertujuan untuk meningkatkan keaktifan dan hasil belajar siswa kelas X RPL 2 SMKN 1 Kepanjen yang memiliki nilai hasil belajar mata pelajaran Instalasi Sistem Komputer Dasar di bawah KKM. Instrumen penelitian yang digunakan dalam penelitian ini adalah lembar observasi dan lembar penilaian. Hasil dari penelitian ini menunjukkan bahwa model pembelajaran berbasis proyek dapat meningkatkan keaktifan dan hasil belajar siswa. Keaktifan siswa pada siklus I sebesar 19,8%, meningkat pada siklus II sebesar 42,8%, dan pada siklus III meningkat 90,6%. Hasil belajar siswa pada siklus I sebesar 2,8%, meningkat pada siklus II sebesar 65,6%, dan meningkat pada siklus III sebesar 87,8%. Secara umum, penerapan model pembelajaran berbasis proyek untuk meningkatkan keaktifan dan hasil belajar siswa pada mata pelajaran Instalasi Sistem Komputer Dasar di SMKN 1 Kepanjen telah berjalan dengan baik. Terbukti dengan peningkatan keaktifan dan hasil belajar siswa pada setiap siklusnya.

Nilai-nilai pribadi ideral konseli dalam Serat Wulangreh / Anisah Prafitralia

 

Prafitralia, Anisah. 2015. Nilai-Nilai Pribadi Ideal Konseli dalam Serat Wulangreh. Tesis, Program Studi Bimbingan dan Konseling, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Fattah Hanurawan, M.Si., M.Ed., (II) Dr. Muslihati, S.Ag., M.Pd. Kata Kunci: pribadi ideal konseli, Serat Wulangreh Kepribadian merupakan sifat hakiki yang tercermin pada sikap seseorang yang membedakannya dari orang lain. Setiap individu perlu memahami konsep pribadi ideal sebagai usaha untuk mencari kehidupan yang bermakna. Konsep pribadi ideal tersebut bisa digali dari nilai-nilai luhur suatu budaya berupa karya sastra kuno, yaitu serat Wulangreh. Penggalian dan pengenalan kembali nilai-nilai luhur budaya bisa digunakan sebagai wujud pengembangan ilmu bimbingan dan konseling indigenus (kearifan lokal). Tujuan penelitian ini ialah untuk mengenalkan nilai-nilai luhur budaya Jawa dalam Serat Wulangreh yang meliputi hakikat manusia, pribadi ideal konseli, serta metode untuk mengembangkan pribadi ideal konseli. Penelitian ini menggunakan pendekatan kualitatif dengan metode hermeneutika untuk menginterpretasi makna teks dalam Serat Wulangreh. Tahap-tahap penelitian meliputi: (1) penentuan sumber teks, (2) proses dialogis yaitu menegosiasikan dan merenegosiasikan penafsiran dengan teks sampai memahami teks secara utuh, dan (3) penulisan konsep. Hasil penelitian menunjukkan bahwa: (1) hakikat manusia adalah wujud dari penyatuan jasmani dan rohani, kemudian perilaku dikendalikan oleh jiwa manusia, (2) pribadi ideal konseli ialah konseli yang: (a) berketuhanan yaitu bertaqwa kepada Tuhan Yang Maha Esa, menggunakan Al Quran sebagai pedoman hidup, berperilaku sesuai dengan syariat dan menerima takdir Tuhan, (b) berkemanusiaan yaitu menyelaraskan kehidupan dunia dengan akhirat, rendah hati, memahami nasihat baik dan buruk, menghindari watak buruk dan melaksanakan nasihat baik, (c) berpersatuan yaitu hidup rukun, tenggang rasa, memperhatikan perilaku dan tutur kata, (d) berkerakyatan yaitu saling menghormati dan menyayangi, setia dan taat kepada pemimpin yang adil, saling mengingatkan, serta berguru kepada orang yang tepat, (e) berkeadilan sosial yaitu bertindak adil dan tidak mengambil hak milik orang lain, (3) metode untuk mengembangkan pribadi ideal konseli yaitu berbasis sastra (kisah) dan musik (tembang yakni Dhandanggula, Kinanti, Gambuh, Pangkur, Maskumambang, Megatruh, Durma, Wirangrong, Pucung, Mijil, Asmaradana, Sinom dan Girisa). Saran penelitian ialah: (1) hakikat manusia bisa digunakan oleh konselor sebagai dasar untuk memahami konseli dalam proses bimbingan dan konseling berbasis budaya, (2) pribadi ideal konseli bisa digunakan sebagai referensi tambahan bagi konselor untuk mengajarkan nilai-nilai pribadi ideal konseli yang bersumber pada salah satu kearifan lokal budaya Jawa, (3) metode melalui kisah dan tembang bisa digunakan sebagai salah satu alternatif pendekatan bagi konselor dalam melaksanakan bimbingan dan konseling indigenus di Indonesia.

Pembuatan program manajemen logistik untuk pencatatan material dengan metode Average di bengkel Teknik Mesin FT UM / Hadi Purnomo, Valentine Malvistulloh

 

Kata Kunci: program, manajemen logistik, pencatatan, bengkel mesin Manajemen logistik merupakan bagian dari proses supply chain yang berfungsi untuk merencanakan, melaksanakan, dan mengendalikan keefisienan dan keefektifan penyimpanan dan aliran barang, pelayanan dan informasi terkait dari titik permulaan hingga titik konsumsi dalam tujuannya untuk memenuhi kebutuhan para pelanggan. Manajemen logistik yang baik sangat diperlukan di gudang untuk pengaturan aliran material yang ada di gudang agar tidak kekurangan maupun kelebihan material serta pengecekan material jika dilihat dari garis besar fungsi manajemen logistik. Bengkel Teknik Mesin Universitas Negeri Malang merupakan salah satu bengkel mesin yang mempunyai gudang untuk penyimpanan material praktik. Tapi dalam perencanaan dan pencatatan material masih belum teratur. Hal ini dikarenakan pencatatan material masih menggunakan pencatatan manual sehingga sulit melihat jumlah material yang habis dipakai dalam waktu periode tertentu untuk perencanaan pengadaan material berikutnya. Selain itu, dampak dari pencatatan yang belum teratur yaitu sulitnya melihat sisa material yang ada. Program manajemen logistik yang memanfaatkan software yang ada di komputer adalah salah satu pemecahan masalah yang dihadapi bengkel Teknik Mesin Universitas Negeri Malang untuk memudahkan pencatatan dan perencanaan material yang ada. Program manajemen logistik dibuat dari software Microsoft access dan memanfaatkan fasilitas yang ada didalamnya seperti: tabel, query, form, report, VB access, serta fasilitas lain. Program dibuat dengan metode pencatatan average. Setelah masuk ke program, pengoperasian program dapat dilakukan dengan memilih jenis material yang ada pada tampilan utama. Pilihan material yang disediakan yaitu (1) material baku dan (2) komponen standard . yang dimaksud material baku disini yaitu material yang masih membutuhkan pengerjaan lanjut seperti: besi poros, besi kotak, dan lain-lain. Sedangkan yang dimaksud komponen standard disini yaitu material yang sudah tidak membutuhkan pengerjaan seperti: mur, baut, bantalan, dan lain-lain. Jika sudah memilih material, selanjutnya memilih proses yang akan dilakukan. Proses tersebut adalah (1) input data, (2) persediaan barang, dan (3) laporan berdasarkan kode. Dalam fasilitas input data dapat dilihat tabel rincian material, fasilitas memasukkan data material masuk dan memasukkan data material keluar, serta melihat sisa persediaan. Persediaan barang digunakan untuk melakukan print out persediaan material yang tersisa di gudang. Laporan berdasarkan kode digunakan untuk melihat dan melakukan print out data material berdasarkan kode material yang dimasukkan. i

Post Abortion Syndrome (PAS) pada remaja putri pelaku aborsi kehamilan pranikah (premarital pregnancy) di Kota Pare dan Kota Malang / Erlin Kurniawati

 

ABSTRAK Kurniawati, Erlin. 2016. Post Abortion Syndrome (PAS) Pada Remaja Wanita Pelaku Aborsi Kehamilan Pranikah (Premarital Pregnancy) di Kota Pare dan Kota Malang. Skripsi, Jurusan Psikologi, Fakultas Pendidikan Psikologi, Universitas Negeri Malang; Pembimbing (I) Dra. Hj. Sri Weni Utami, M. Si (II) Farah Farida Tantiani, S. Psi., M. Psi Kata Kunci: Post Abortion Syndrome (PAS), remaja wanita, aborsi kehamilan pranikah Kasus aborsi yang dilakukan oleh remaja di Indonesia semakin meningkat setiap tahunnya. Keputusan untuk melakukan aborsi seringkali menuai pro dan kontra, terlebih di Negara Indonesia yang sangat menjunjung nilai moral dan agama. Beberapa wanita yang melakukan aborsi menganggap bahwa aborsi merupakan cara terbaik mereka untuk menyelesaikan masalah, namun ternyata tidak demikian. Keputusan aborsi membawa remaja wanita ke dalam permasalahan baru yang diakibatkan karena trauma akan pengalaman aborsinya sehingga membuat mereka merasa sangat bersalah dan muncul emosi-emosi negative yang disebut Post Abortion Syndrome (PAS). Penelitian ini menggunakan pendekatan penelitian kualitatif dengan metode penelitian studi kasus (Case Study). Kehadiran Peneliti merupakan instrumen untuk mengumpulkan data atau mengukur status variabel yang diteliti. Subjek berjumlah 2 orang dengan kriteria berusia 15-24 tahun dan pernah melakukan aborsi kehamilan pranikah, lokasi penelitian berada di Kota Pare dan Kota Malang. Metode pengumpulan data yang dilakukan peneliti menggunakan wawancara kualitatif dan observasi. Pengecekan keabsahan temuan menggunakan teknik validasi responden dan triangulasi perspektif. Kesimpulan dari penelitian yang telah dilakukan adalah Subjek AA memiliki kemunculan gejala Post Abortion Syndrome yang lebih variatif dibandingkan dengan dengan subjek MD dimana antara subjek AA dan subjek MD terdapat beberapa gejala Post Abortion Syndrome yang muncul yaitu berulangnya mimpi yang menyedihkan dari aborsi atau janin , sama-sama memiliki pengalaman yang berkaitan dengan mistis, mengalami tekanan psikologis ketika melihat hal hal yang berkaitan dengan aborsi mereka misalnya melihat anak kecil, bayi, dan ibu hamil, memiliki ketakutan yang sama yaitu takut tidak dapat memiliki anak lagi, merasa seperti tidak memiliki masa depan pasca melakukan aborsi, dan memiliki pikiran untuk bunuh diri.

Dinamika pengelolaan balai penyelamatan Mpu Tantular Kotyya Malang tahun 2003-2014 dan kontribusinya dalam pendidikan / Edi Santoso

 

ABSTRAK Santoso, Edi. 2016. Dinamika Pengelolaan Balai Penyelamatan Mpu Purwa Kota Malang Tahun 2003-2014 dan Kontribusinya dalam Pendidikan. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: Deny Yudo Wahyudi, S.Pd, M.Hum Kata kunci: dinamika, balai penyelamatan, Mpu Purwa, Kota Malang. Balai penyelamatan merupakan tempat untuk menyimpan sekaligus merawat benda-benda koleksi yang mengandung nilai sejarah dan budaya. Kota Malang memiliki banyak benda-benda peninggalan sejarah berupa arca-arca batu yang keberadaannya tersebar di berbagai tempat. Untuk menyimpan dan merawat benda-benda tersebut didirikan Balai Penyelamatan Mpu Purwa yang berada di Jalan Soekarno Hatta No. 210, masuk ke dalam kompleks perumahan Griyasantha. Keberadaan Balai Penyelamatan Mpu Purwa penting karena menjadi salah satu bukti kepedulian pemerintah Kota Malang untuk menyimpan dan merawat benda-benda peninggalan yang mengandung nilai sejarah dan budaya, terutama yang berhubungan dengan pertumbuhan Kota Malang. Rumusan masalah dalam penelitian ini adalah (1) Bagaimanakah latar belakang berdirinya Balai Penyelamatan Mpu Purwa Kota Malang? (2) Bagaimanakah dinamika pengelolaan Balai Penyelamatan Mpu Purwa tahun 2003-2014 dan kontribusinya dalam pendidikan?. Penelitian ini menggunakan metode penelitian kualitatif. Pengumpulan data dalam penelitian ini menggunakan dua teknik, yaitu observasi, dan wawancara. Sedangkan cara untuk melakukan pengecekan keabsahan data adalah melalui perpanjangan pengamatan dan triangulasi. Hasil penelitian ini menunjukkan bahwa (1) rencana membuat suatu tempat untuk menampung benda-benda peninggalan sejarah sudah sejak tahun 1980. Untuk penyelamatan dan keamanannya, akhirnya benda-benda tersebut disimpan di DPU Jalan Halmahera, selanjutnya disimpan lagi di Taman Rekreasi Senaputera. Tahun 1997 disimpan di Rumah Makan Cahyaningrat. Namun baru pada tahun 2001 ditetapkan gedung bekas SDN Mojolangu 2 Malang sebagai tempat menampung benda-benda tersebut dan pada tahun 2004 diresmikan oleh Walikota Malang, Drs. Peni Suparto sebagai Balai Penyelamatan Mpu Purwa (2) dinamika pengelolaan Balai Penyelamatan Mpu Purwa dapat dilihat dari tiga sisi, yaitu fisik bangunan, jumlah pengunjung, dan jumlah koleksi. Guna meningkatkan peran dan fungsinya sebagai sumber belajar, maka pada tahun 2014 dilakukan revitalisasi. Keberadaan Balai Penyelamatan Mpu Purwa yang masih eksis hingga sekarang dikarenakan menjadi sasaran pengunjung Kota Malang dan daerah lainnya khususnya dari kalangan pendidikan.

Analisis pemahaman konsep titrasi asam basa siswa kelas XI IPA semester II SMAN 5 Malang tahun pelajaran 2011/2012 / Dyna Rahmawati

 

Kata Kunci: pemahaman konsep, titrasi asam basa. Ilmu kimia merupakan cabang ilmu pengetahuan alam yang mempelajari sifat–sifat materi, struktur materi, perubahan materi, hukum–hukum dasar perubahannya, dan konsep–konsep dan teori–teori yang mengartikannya. Sebagian besar guru kimia menemukan bahwa konsep kimia sulit untuk dipahami dan masih dianggap sulit oleh sebagian besar siswa karena sebagian besar ilmu kimia bersifat abstrak, bersifat kompleks, dan banyak bagian konsep yang dihubungkan dengan konsep–konsep lain, salah satu contohnya adalah konsep titrasi asam. Kemampuan untuk memahami konsep titrasi asam basa sangat dipengaruhi oleh konsep–konsep pokok yang mendasarinya. Berdasarkan hal tersebut, penelitian bertujuan untuk mengidentifikasi: (1) tingkat pemahaman konsep siswa terhadap indikator titrasi asam basa, (2) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi asam kuat–basa kuat, (3) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi asam lemah–basa kuat, (4) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi basa lemah–asam kuat, (5) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi asam lemah–basa lemah, dan (6) konsep titrasi asam basa yang sukar bagi siswa. Penelitian ini menggunakan rancangan penelitian deskriptif. Populasi penelitian adalah siswa kelas XI IPA SMAN 5 Malang tahun pelajaran 2011/2012, yang terdiri dari enam kelas yang kemampuannya homogen. Sampel penelitian adalah kelas XI IPA 4 dan XI IPA 6, sebanyak 68 siswa yang dipilih berdasarkan kelas yang terlebih dahulu diajarkan materi titrasi asam basa. Instrumen penelitian berupa tes objektif sebanyak 18 butir soal yang terdiri dari 10 soal berbahasa Inggris dan 8 soal berbahasa Indonesia dengan validitas isi sebesar 98,33% dan reliabilitas sebesar 0,67. Analisis data menggunakan teknik analisis statistik deskriptif. Hasil penelitian menunjukkan bahwa tingkat pemahaman konsep siswa terhadap: (1) indikator titrasi asam basa tergolong sedang (63,72%), (2) perubahan pH selama titrasi asam kuat–basa kuat tergolong rendah (40,81%), (3) perubahan pH selama titrasi asam lemah–basa kuat tergolong rendah (41,91%), (4) perubahan pH selama titrasi basa lemah–asam kuat tergolong rendah (38,23%), (5) perubahan pH selama titrasi asam lemah–basa lemah tergolong rendah (41,67%), dan (6) terdapat 8 sub konsep yang merupakan konsep titrasi asam basa yang sukar bagi siswa. Tingkat pemahaman konsep siswa tertinggi terdapat pada konsep indikator titrasi asam basa dan tingkat pemahaman konsep siswa terendah terdapat pada konsep perubahan pH selama titrasi basa lemah–asam kuat. Konsep yang paling sukar bagi siswa adalah perubahan pH selama titrasi asam lemah–basa kuat sebelum titik ekuivalen.

Kontribusi ergonomi yang berpengaruh terhadap produktivitas kerja di sentra industri / Peppy Mayasari

 

ABSTRAK Mayasari, Peppy. 2016.Kontribusi ErgonomiYang BerpengaruhTerhadap Produktivitas Kerja di Sentra Industri. Tesis. Program Studi Pendidikan Kejuruan, Pascasarjana Universitas Negeri Malang, Pembimbing: (I) Prof.Dr. Ir. H. Djoko Kustono, M.Pd, (II) Dr. Mazarina Devi, M.Si. Kata Kunci: faktor ergonomi, kelelahan, produktivitas kerja. Ergonomi merupakan suatu ilmu yang berkaitan dengan manusia sebagai elemen utama dalam suatu sistem kerja. Ergonomi dan keselamatan kerja harus diterapkan dengan baik terutama yang berkaitan dengan sikap, cara dan alat serta lingkungan kerja. Selain itu ergonomi juga berpengaruh besar terhadap faktor kelelahan yang terjadi pada saat bekerja. Kelelahan merupakan suatu kondisi menurunya efisiensi, performa kerja dan berkurangnya kekuatan dan ketahanan fisik tubuh. Kelelahan dapat dibedakan menjadi dua bagian, yaitu: (1) kelelahan fisik, dan (2) kelelahan non fisik. Kelelahan fisik biasanya berhubungan dengan anggota tubuh manusia, misalnya kelelahan otot, tangan, punggung. Sedangkan kelelahan non fisik biasanya ditandai dengan berkurangnya kemauan untuk bekerja yang disebabkan oleh monotoni: yaitu intensitas dan lamanya kerja fisik, keadaan lingkungan, sebab-sebab mental, status kesehatan dan keadaan gizi. Hal tersebut harus segera ditindaklanjuti guna mencegah menurunya produktivitas kerja di Sentra Industri. Produktivitas kerja merupakan suatu pencapaian kualitas dan kuantitas suatu proses kegiatan berkenaan dengan ilmu ekonomi. Penelitian ini bertujuan untuk mengetahui ada atau tidaknya hubungan ergonomi di sentra industri terutama menjahit dengan produktivitas kerja para penjahit yang ada di Sentra Industri Desa Punggul, Kecamatan Gedangan, Kabupaten Sidoarjo. Hubungan ergonomi tersebut diantaranya adalah (1) posisi kerja, (2) intensitas kerja, (3) jam kerja, (4) beban kerja, (5) kelelahan fisik, (6) kelelahan non fisik, dan (7) produktivitas kerja. Penelitian ini merupakan penelitian kuantitatif dengan rancangan penelitian survei. Populasi Penelitian ini adalah penjahit yang ada di Desa Punggul, Kecamatan Gedangan, Kabupaten Sidoarjo yang berjumlah 133 orang dan jumlah sampel sebanyak 100 responden. Data kuantitatif pada penelitian ini dianalisis dengan menggunakan SEM (Structural Equation Modelling) menggunakan Sofeware AMOS 21.0. Hasil penelitian ini menunjukkan bahwa: (1) posisi kerja berhubungan secara signifikan dengan kelelahan fisik , (2) posisi kerja berhubungan tidak signifikan dengan kelelahan non fisik, (3) intensitas kerja berhubungan tidak signifikan dengan kelelahan fisik, (4) intensitas kerja berhubungan secara signifikan dengan kelelahan non fisik, (5) jam kerja berhubungan secara signifikan dengan kelelahan fisik, (6) jam kerja berhubungan secara signifikan dengan kelelahan non fisik, (7) beban kerja berhubungan secara signifikan dengan kelelahan fisik, (8) beban kerja berhubungan secara signifikan dengan kelelahan non fisik, (9) kelelahan fisik berhubungan secara signifikan dengan produktivitas kerja, (10) kelelahan non fisik berhubungan secara signifikan dengan produktivitas kerja.

Perbedaan hasil belajar tekniki komputer dan jaringan melalui pemanduan model pembelajaran Problem Based Learning (PBL) dan Cooperative Tipe Teams Games Tournament (TGT) dengan Problem Based Learning (PBL) siswa kelas X SMK Negeri 2 Malang / Nur Chabibah Rahmawati

 

Kata Kunci : Problem Based Learning, Teams Games Tournament, Hasil Belajar, Teknik Komputer dan Jaringan. Pendidikan memegang peran penting dalam kehidupan suatu bangsa, salah satu faktor yang menentukan keberhasilan pembelajaran adalah model pembelajaran yang digunakan. Berdasarkan hasil observasi di SMK Negeri 2 Malang, model pembelajaran yang diterapkan oleh guru adalah pembelajaran berbasis masalah. Akan tetapi faktanya model pembelajaran ini tidak diterapkan secara tepat sesuai dengan langkah-langkahnya. Hal ini menyebabkan pembelajaran menjadi pasif, berpusat pada guru, dan berdampak pada hasil belajar siswa yang rendah. Salah satu alternatif untuk meningkatkan hasil belajar siswa yaitu dengan memadukan model pembelajaran Problem Based Learning (PBL) dan Teams Games Tournament (TGT). Penelitian ini bertujuan untuk mengetahui perbedaan hasil belajar siswa antara pemaduan model pembelajaran Problem Based Learning (PBL) dan Cooperative Tipe Teams Games Tournament (TGT) dengan yang menggunakan model pembelajaran Problem Based Learning (PBL). Penelitian ini dilakukan dengan menggunakan rancangan eksperimen semu (quosy experimental design). Variabel penelitian terdiri dari variabel bebas yaitu model pembelajaran, dan variabel terikat yaitu hasil belajar. Sampel penelitian yang digunakan dalam penelitian ini diambil secara teknik Purposive Sample (sampel bertujuan) teknik ini didasarkan karena adanya tujuan dan pertimbangan tertentu, yaitu kelas X TKJ 2 sebagai kelas eksperimen dan kelas X TKJ 1 sebagai kelas kontrol Instrumen yang digunakan yaitu instrumen perlakuan dan instrumen pengukuran. Hasil belajar siswa kelas kontrol dan kelas eksperimen diperoleh dari nilai kognitif, psikomotorik, afektif, dan nilai tugas. Hasil penelitian menunjukkan bahwa pada kelas eksperiemen memiliki rata-rata hasil belajar lebih tinggi daripada kelas kontrol yaitu 81,54 > 77,90. Hasil belajar antara kelas eksperimen dan kelas kontrol menunjukkan perbedaan yang signifikan yaitu dengan nilai Sig(p) 0,000 < 0,05 sehingga Ho ditolak, sehingga terdapat perbedaan hasil belajar yang signifikan antara kelas eksperimen yang diajar menggunakan pemaduan model pembelajaran Problem Based Learning (PBL) dan Cooperative Tipe Teams Games Tournament (TGT) dengan kelas kontrol yang diajar menggunakan model pembelajaran Problem Based Learning (PBL).

Peningkatan aktivitas dan hasil belajar siswa tema Indahnya Negeriku melalui problem based learning pada siswa kelas IV SDN Senggreng 04 Kecamatan Sumberpucung Kabupaten Malang / Marina Filayanti

 

Filayanti, Marina. 2015. Peningkatan Aktivitas dan Hasil Belajar Siswa Tema Indahnya Negeriku melalui Problem Based Learning pada Siswa Kelas IV SDN Senggreng 04 Kecamatan Sumberpucung Kabupaten Malang. Skripsi, Program Studi S1 PGSD, Jurusan KSDP, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Drs. Rumidjan, M.Pd (2) Drs. Achmad Taufiq, M.Pd Kata Kunci:Model PBL, Aktivitas, Hasil Belajar, SD     Berdasarkan wawancara dan obsevasi awal yang dilakukan peneliti dengan kepala sekolah dan wali kelas SDN Senggreng 04 ditemukan bahwa(1) Pembelajaran masih didominasi oleh guru, sumber informasi belajar pada saat pembelajaran yaitu guru dan buku teks pelajaran (2) Aktivitas siswa dalam pembelajaran masih rendah (3) Hasil Belajar yang diperoleh siswa belum mencapai standar ketuntasan minimal yang telah ditentukan. Untuk mengatasi masalah tersebut diperlukan perbaikan dalam pembelajaran dengan menerapkan model pembelajaran PBL.     Tujuan penelitian ini untuk mendeskripsikan: penerapan model PBL pada tema Indahnya Negeriku dan hasil belajar siswa kelas IV SDN Senggreng 04 .     Penelitian ini menggunakan pendekatan deskriptif kualitatif. jenis penelitian ini menggunakan rancangan Penelitian Tindakan Kelas yang dilaksanakan dalam 2 siklus, tiap siklus terdiri dari 2 pertemuan. Penelitian ini dilakukan di SDN Senggreng 04 Kecamatan Sumberpucung Kabupaten Malang pada semester genap tahun pelajaran 2014/2015 dengan subyek penelitian berjumlah 35 siswa.     Hasil penerapan PBL dalam pembelajaran tema Indahnya Negeriku sebagai berikut: (1) Aktivitas guru dalam menerapkan PBL telah terlaksana dengan baik (2) Aktivitas belajar siswa mengalami peningkatan siklus I aktivitas belajarsebesar (77,8%) meningkat menjadi (85,1%) pada siklus II. (3) Hasil belajar siswa juga meningkat, nilai rata-rata siswa pada tahap pra tindakan sebesar 60,4 dengan prosentase ketuntasan klasikal 25,7%. Pada siklus I hasil belajar siswa meningkat menjadi 68,6 dengan prosrosentase kentutasan klasika 52,9% dan meningkat lagi pada siklus II, nilai rata-rata siswa mencapai 74,5 dengan prosentase ketuntasan klasikal 81,5%.     Berdasarkan data tersebut dapat disimpulkan bahwa dengan digunakannya model pembelajaran PBL pada pembelajaran tema Indahnya Negeriku dapat meningkatkan pembelajaran. peningkatan tersebut dapat dilihat pada aktivitas guru, aktivitas siswa dan hasil belajar siswa. Disarankan dalam melaksanakan kegiatan pembelajaran dengan menggunakan PBL memperhatikan aspek-aspek yang harus dilakukan, seperti mengorientasikan siswa pada masalah, masalah yang diajukan berasal dari permasalahan sains, teknologi, lingkungan atau masyarakat dengan prosedur yang jelas sehingga dapat menciptakan pembelajaran yang menarik dan menantang siswa untuk berfikir kritis dalam memecahkan masalah yang terdapat di lingkungan sekitar.

Hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa di Sekolah Menengah Atas (SMA) Negeri 2 Batu / Dwi Yogo Heri Pamuji Utomo

 

Kata Kunci: Ketersediaan sumber belajar, motivasi belajar siswa Keberadaan sumber belajar di lembaga pendidikan adalah suatu keharusan, karena pendidikan tidak mungkin dapat terselenggara dengan baik bilamana para tenaga kependidikan maupun peserta didik tidak ditunjang dengan sumber belajar yang diperlukan untuk menyelenggarakan kegiatan pembelajaran yang bersangkutan. Dengan tersedianya sumber belajar yang lengkap diharapkan dapat membantu meningkatkan efektifitas dan efisiensi proses belajar-mengajar, semakin lengkap dan beragamnya sumber belajar yang tersedia, semakin besar jumlah siswa yang dapat dilayani kebutuhannya serta memudahkan siswa dalam berinteraksi dengan sumber belajar yang sesuai dengan minat dan kemampuanya sehingga akan menimbulkan motivasi untuk belajar. Rumusan masalah dalam penelitian ini, yaitu: (1) Seberapa cukup tingkat ketersediaan sumber belajar di SMA Negeri 2 Batu, (2) Seberapa tinggi tingkat motivasi belajar siswa di SMA Negeri 2 Batu, (3) Seberapa besar tingkat hubungan ketersediaan sumber belajar dan motivasi belajar siswa di SMA Negeri 2 Batu. Tujuan penelitian ini, yaitu: (1) Untuk mengetahui kecukupan sumber belajar di SMA Negeri 2 Batu, (2) Untuk mengetahui tingkat motivasi belajar siswa di SMA Negeri 2 Batu, (3) Untuk mengetahui hubungan ketersediaan sumber belajar terhadap motivasi belajar siswa di SMA Negeri 2 Batu. Rancangan penelitian digunakan sebagai dasar dari suatu penelitian yang akan dilaksanakan. Berdasarkan permasalahan yang diteliti, maka penelitian ini termasuk ke dalam jenis penelitian descriptive correlational. Jenis penelitian ini digunakan karena penelitian ini bertujuan untuk menemukan ada-tidaknya hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa. Penelitian ini dilakukan di SMA Negeri 02 Batu dengan populasi berjumlah 666 siswa dengan jumlah sampel 249 siswa. Teknik pengambilan sampel yang digunakan dalam penelitian adalah proportional random sampling. Teknik pengumpulan data dalam penelitian menggunakan instrumen angket, teknik analisis data yang digunakan adalah analisis deskriptif dan analisis korelasi. Berdasarkan hasil penelitian dapat disimpulkan, bahwa (1) Kondisi ketersediaan sumber belajar di SMA Negeri 2 Batu termasuk dalam kualifikasi tersedia, (2) Tingkat motivasi belajar siswa SMA Negeri 2 Batu termasuk dalam kualifikasi Tinggi, (3) Adanya hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa di SMA Negeri 2 Batu. Berdasarkan kesimpulan, dapat disarankan kepada (1) Kepala Dinas Pendidikan Kota Batu, dengan adanya hubungan antara ketersediaan sumber belajar dan motivasi belajar, hendaknya Dinas Pendidikan kota Batu dengan adanya penelitian ini dapat digunakan sebagai tolak ukur ketersediaan sarana dan prasarana belajar yang ada di sekolah di Kota Batu agar lebih meningkatkan motivasi belajar siswa, (2) Kepala SMA Negeri 2 Batu, dengan adanya hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa, hendaknya selalu berusaha untuk tetap memperhatikan dan meningkatkan ketersediaan sumber belajar, karena dengan tersedianya sumber belajar sekolah, maka akan meningkatkan motivasi belajar siswa, (3) Guru SMA Negeri 2 Batu, mengupayakan kegiatan pembelajaran yang memotivasi siswa agar memanfaatkan sumber belajar yang tersedia di sekolah maupun luar sekolah sehingga diharapkan dapat membantu secara optimal keberhasilan belajar siswa dalam melaksanakan pembelajaran, dan proses belajar-mengajar dapat berjalan dengan lancar dan tujuan pembelajaran yang ditetapkan sebelumnya dapat tercapai, (4) Siswa SMA Negeri 2 Batu, hendaknya dapat memanfaatkan semua sumber belajar yang tersedia dengan efektif dan efisien agar lebih termotivasi dalam membantu kegiatan belajarnya.

Validasi media pembelajaran tangga geometri di RA Perwanida Petungasri Pandaan Pasruan / Astri Aminatuz Zuhriyah

 

Penerapan pembelajaran Problem Based Instruction dengan teknik Two Stay Two Stray untuk meningkatkan kemampuan komunikasi dan prestasi belajar fisika siswa kelas VIIIC SMP Negeri 1 Talun Blitar / Ani Nur'aini

 

Kata Kunci: Pembelajaran Problem Based Instruction (PBI), Two Stay Two Stray (TSTS), Kemampuan komunikasi, prestasi belajar Salah satu tujuan mata pelajaran IPA jenjang SMP/MTs adalah melakukan inkuiri ilmiah untuk menumbuhkan kemampuan berkomunikasi. Dari hasil observasi awal di SMP Negeri 1Talun Blitar kemampuan komunikasi siswa kurang maksimal. Hal ini ditandai dengan kurangnya kemampuan siswa untuk mengungkapkan pendapat, membaca hasil pengamatan dan menyimpulkan pembelajaran. Hasil ulangan harian siswa menunjukkan nilai rata-rata kelas masih rendah. Hal ini menandai prestasi belajar siswa juga masih rendah. Penelitian ini bertujuan untuk meningkatkan kemampuan komunikasi dan prestasi belajar siswa melalui pembelajaran Problem Based Instruction (PBI) dengan teknik Two Stay Two Stray (TSTS). Data yang dikumpulkan adalah pelaksanaan pembelajaran PBI dengan teknik TSTS dan kemampuan komunikasi yang diukur menggunakan instrumen lembar observasi, serta prestasi belajar diukur dengan tes. Selain itu didukung dengan instrumen lain seperti wawancara, dokumentasi dan catatan lapangan. Rancangan penelitian yang digunakan adalah penelitian tindakan kelas (PTK). Melalui PTK ini dilaksanakan pembelajaran PBI dengan teknik TSTS. Dengan tahapan PBI yang dipadu dengan teknik TSTS, siswa dapat mengembangkan kemampuan komunikasi dalam kegiatan pembelajaran. Hal ini penting mengingat tidak semua siswa dapat mengembangkan kemampuan komunikasi yang merupakan aspek dari kecakapan hidup. Dalam penelitian ini, peneliti berkolaborasi dengan guru merencanakan tindakan pembelajaran yang berlangsung selama 2 siklus. Hasil penelitian menunjukan bahwa terjadi peningkatan kemampuan komunikasi dan prestasi siswa kelas VIII C SMP Negeri 1 Talun Blitar dari siklus 1 ke siklus 2. Yaitu ditunjukkan dari peningkatan pelaksanaan Pembelajaran PBI dengan teknik TSTS yakni 71,8% pada siklus 1 meningkat menjadi 85,6% pada siklus 2. Kemampuan komunikasi rata-rata siswa meningkat dari 58,2% pada siklus 1 menjadi 80,2% pada siklus 2. Prestasi belajar siswa juga mengalami peningkatan dilihat dari nilai rata-rata ujian siswa yang meningkat dari 72,4 pada siklus 1 dengan ketuntasan 66,7% menjadi 82,25 dengan ketuntasan belajar 87,5% pada siklus 2. Berdasarkan hasil penelitian dapat disimpulkan bahwa pembelajaran PBI dengan teknik TSTS dapat meningkatkan kemampuan komunikasi dan prestasi belajar siswa kelas VIII C SMP Negeri 1 Talun Kabupaten Blitar.

Hubungan penguasaan teori dan minat belajar dengan kompetensi praktikum pemasangan instalasi penerangan listrik bangunan sederhana pada siswa kelas X TITL di SMK Negeri 1 Blitar tahun ajaran 2014/2015 / Ayu Maxstio Rini

 

Rini, Ayu Maxstio. Hubungan Penguasaan teori dan Minat Belajar dengan Kompetensi Praktikum Pemasangan Instalasi Penerangan Listrik Bangunan Sederhana pada Siswa Kelas X TITL di SMK Negeri 1 Blitar Tahun Ajaran 2014/2015. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs Dwi Prihanto, S.S.T.,M.Pd, (2) Drs. Hari Putranto. Kata Kunci: hubungan, penguasaan teori, minat belajar, kompetensi praktikum Pendidikan merupakan faktor yang sangat penting dalam mewujudkan suatu negara yang berkualitas. Upaya tersebut salah satunya dengan meningkatkan kualitas lulusan SMK dalam menyiapkan tenaga kerja terampil agar dapat memasuki lapangan pekerjaan serta sanggup berkompetisi. Salah satunya dengan lebih memperhatikan faktor yang mempengaruhi belajar, seperti penguasaan teori maupun minat belajar. Tujuan dari penelitian ini adalah untuk mengungkap hubungan antara penguasaan teori (X1) dan minat belajar siswa (X2) dengan kompetensi praktikum pemasangan instalasi plistrik bangunan sederhana (Y) di SMKN 1 Blitar baik secara parsial maupun simultan, serta mendeskripsikan masing-masing variabel X1, X2, dan Y. Penelitian ini adalah penelitian korelasional. Sampel dari penelitian ini adalah seluruh siswa kelas X TITL blok produktif SMKN 1 Blitar. Pengumpulan data (X1) menggunakan tes dan (X2) menggunakan angket sedangkan data (Y) menggunakan dokumentasi. Uji persyaratan analisis penelitian ini telah memenuhi persyaratan. Untuk mengungkap X1 dan Y dan X2 dan Y menggunakan analisis korelasi parsial. Sedangkan untuk mengungkap X1 dan X2 secara simultan dengan Y menggunakan analisis regresi linier ganda dengan bantuan software SPSS 19.0. Hasil penelitian: (1) X1 kategori sedang (44%), (2) X2 dalam kategori sedang (37%), (3) Y dalam kategori tinggi (32%), (4) terdapat hubungan positif dan signifikan antara X1 dengan Y yang memiliki korelasi parsial sebesar 0,890, (5) terdapat hubungan positif dan signifikan antara X2¬ dan Y yang memiliki korelasi parsial sebesar 0,498, (6) terdapat hubungan yang positif dan simultan anatar X1 dan X2 dengan Y, dan (7) terdapat sumbangan prediktor sebesar 83% terhadap kriteriumnya. Kesimpulan dari penelitian ini adalah: (1) adanya hubungan yang signifikan antara penguasaan teori dengan kompetensi praktikum, (2) ada hubungan yang signifikan antara minat belajar siswa, dan (3) dan ada hubungan secara simultan antara penguasaan teori dan minat belajar siswa dengan kompetensi praktikum instalasi penerangan bangunan sederhana pada kelas X di SMKN 1 Blitar Tahun Ajaran 2014/2015.

Validasi media pembelajaran "Jamur fantasi" di TK Sunan Giri Yakin Tutur Pasuruan / Miftakhul Jannah

 

Pengaruh Cash, Insider Ownership, dan Long Term Liability terhadap Capital Expenditure (Studi empiris pada perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2008-2010) / Elia Triyunisanti

 

Kata kunci : cash, insider ownership, long term liability, capital expenditure, pecking order theory, agency theory. Capital expenditure adalah salah satu bagian dari investasi yang sangat penting dalam perusahaan. Capital expenditure biasanya dikaitkan dengan kinerja perusahaan, karena diharapkan semakin tinggi capital expenditure maka semakin baik pula kinerja keuangan perusahaan tersebut. Dana yang diperlukan untuk capital expenditure berasal dari berbagai sumber baik internal maupun eksternal. Alternatif pembiayaan internal adalah penggunaan saldo laba perusahaan dan penyusutan, sedangkan alternatif pembiayaan eksternal adalah melalui hutang dan melalui penerbitan saham. Penelitian ini merupakan jenis penelitian eksplanasi karena disesuaikan dengan rumusan hipotesis yang menduga bahwa cash, insider ownership, dan long term liability berpengaruh terhadap capital expenditure. Data yang digunakan dalam penelitian ini adalah data kuantitatif yang didapat dari data sekunder berupa jumlah ketersediaan kas, kepemilikan manajerial, hutang jangka panjang dan jumlah pengeluaran modal suatu perusahaan. Populasi dalam penelitian ini adalah seluruh perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2008-2010. Dari populasi tersebut kemudian digunakan metode purposive sampling agar kualifikasi sampel sesuai dengan kriteria yang dibutuhkan dalam penelitian. Hasilnya terdapat 54 perusahaan yang dijadikan sampel dalam penelitian ini. Penelitian ini menggunakan analisis regresi linier berganda dengan pengujian hipotesis secara parsial dan simultan. Hasil penelitian ini menunjukkan bahwa terdapat pengaruh antara variabel cash, insider ownership, dan long term liability terhadap capital expenditure, baik secara parsial maupun simultan. Hal ini berarti bahwa cash, insider ownership, dan long term liability memiliki pengaruh dalam pengambilan keputusan terkait capital expenditure pada perusahaan manufaktur yang listing di BEI periode 2008-2010. Berdasarkan hasil penelitian, disarankan agar penelitian selanjutnya menggunakan variabel lain yang dapat mempengaruhi capital expenditure, misalnya free cash flow dan saldo laba. Selain itu juga menggunakan data terbaru yaitu data pada tahun 2011 dan tahuntahun berikutnya. Dalam melakukan pengukuran capital expenditure hendaknya tidak hanya berdasarkan pada nilai buku aset tetap awal dan akhir periode tetapi juga memperhatikan ada tidaknya pelepasan aset tetap selama satu periode tersebut.

Perencanaan kabel dalam rangkaian klakson berdasarkan putaran mesin minimal 4500 rpm sebagai media pembelajaran / oleh Faruk Abdillah, M.

 

Pengaruh rasio profitabilitas, likuiditas, leverage dan pertumbuhan perusahaan terhadap return investasi (Pada perusahaan manufaktur di BEI periode 2006 - 2008) / Muhammad Anas Safii

 

ABSTRAK Syafii, Muhammad Anas. 2009. Pengaruh Profitabilitas, Likuiditas, Leverage dan Pertumbuhan Perusahaan Terhadap Return Investasi. Program SI Akuntansi Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I) Ika Putri Larasati, SE., M.Com, Pembimbing (II) Sawitri Dwi Prastiti, SE., M,Si., Ak. Kata Kunci : Dividen, Rasio Profitabilitas, Rasio Likuiditas, Leverage, Pertumbuhan Perusahaan. Kondisi perekonomian Indonesia selama tahun 2006 – 2008 yang tidak stabil menyebabkan investor menanggung resiko dalam melakukan investasi. Perdagangan saham perusahaan di BEI mengalami suspend karena terjadi penurunan harga saham selama masa perdagangan yang menyebabkan kerugian pada pihak perusahaan dan investor. Untuk melakukan investasi diperlukan analisis untuk menghindari kerugian dan memperoleh keuntungan investasi pada masa yang akan datang. Sehingga tujuan penelitian ini menguji kemampuan rasio profitabilitas, rasio likuiditas, rasio leverage dan pertumbuhan perusahaan terhadap return investasi berupa pendapatan dividen. Penelitian ini menggunakan sampel 21 perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia selama tahun 2006 – 2008. Sampel dipilih dengan metode purposive sampling. Data diperoleh dari Indonesia Capital Market Directory dan BEI. Pengujian Hipotesis menggunakan analisis regresi berganda. Hasil penelitian menunjukkan bahwa rasio likuiditas dan leverage berpengaruh terhadap tingkat pengembalian investasi. Sedangkan rasio profitabilitas dan Pertubuhan Perusahaan tidak berpengaruh terhadap tingkat pengembalian investasi. Berdasarkan hasil penelitian dapat disimpulkan bahwa tingkat pengembalian investasi berupa dividen bagi investor dapat diprediksi melalui rasio likuiditas dan leverage dari perusahaan. Tingkat likuiditas memiliki hubungan yang searah atau positif dengan kebijakan dividen, sehingga semakin tinggi tingkat likuiditas maka semakin besar dividen yang dibagikan oleh investee kepada investor. Sedangkan, tingkat leverage memiliki hubungan negatif atau tidak searah dengan kebijakan dividen sehingga semakin tinggi tingkat leverage maka dividen yang dibagikan semakin kecil. Bagi Investor diharapkan menjadi pertimbangan dalam pengambilan keputusan investasi terkait dengan return yang berupa dividen. Bagi perusahaan diharapkan menyajikan kinerja terbaik untuk memperbaiki profitabilitas, likuiditas, leverage dan pertumbuhan perusahaan, sehingga ketertarikan investor jangka panjang dapat meningkat pada saham perusahaan.

Pemasaran hasil produksi Pabrik Gula Kebon Agung di Malang
oleh Wahyu Sasongko

 

Kesalahan penggunaan ... biaodian fuhao oleh mahasiswa Pendidikan Bahasa Mandarin Universitas Negeri Malang / Lutfia Dewi Karomah

 

Karomah, Lutfia Dewi. 2015. Kesalahan Penggunaan标点符号biāodiǎn fúhào Oleh Mahasiswa Pendidikan Bahasa Mandarin Universitas Negeri Malang. Skripsi, Program Studi Pendidikan Bahasa Mandarin, Jurusan Sastra Jerman, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (1) Dudy Syafruddin, S.S, M.A. (2) M.Kharis, S.Pd, M.Hum. Kata Kunci: Kesalahan, 标点符号biāodiǎn fúhào, Universitas Negeri Malang Penelitian ini bertujuan untuk mendeskripsikan bentuk-bentuk kesalahan penggunaan 标点符号biāodiǎn fúhàoyang yang dilakukan oleh mahasiswa pendidikan bahasa Mandarin angkatan 2013 Universitas Negeri Malang dan faktor-faktor penyebab terjadinya kesalahan tersebut. Penelitianini menggunakan pendekatan kualitatif dan termasuk jenis penelitian deskriptif.Data dalam penelitian ini adalah kesalahan penggunaan 标点符号biāodiǎn fúhàoyang dilakukan mahasiswa pendidikan bahasa Mandarin angkatan 2013. Peneliti bertindak sebagai instrumen utama dengan instrumen pendukung berupa tabel analisis data dan pedoman wawancara. Hasil penelitian menunjukkan masih terdapat kesalahan penggunaan标点符号biāodiǎn fúhào. Adapun bentuk-bentuk kesalahannya adalah (1) pemilihan标点符号biāodiǎn fúhào yang tidak tepat,(2) penempatan标点符号biāodiǎn fúhào yang tidak sesuai, (3) penulisan标点符号biāodiǎn fúhào yang tidak sesuai, (4) penggunaan tanda baca yang tidak termasuk标点符号biāodiǎn fúhào,dan (5) tidak menggunakan标点符号biāodiǎn fúhào dalam kalimat. Sementara itu, ditemukan faktor-faktor yang menyebabkan terjadinya kesalahan tersebut,yaitu(1) mahasiswa tidak paham keseluruhan penggunaan标点符号biāodiǎn fúhào,(2) terlalu banyak标点符号biāodiǎn fúhàomenyebabkan mahasiswa bingung,(3) mahasiswa tidak memahami kalimat yang seharusnya diberi 标点符号biāodiǎn fúhào,(4) mahasiswa kurang paham penjelasan yang diberikan 老师lǎoshī,(5) mahasiswaterpengaruh dengan tanda baca bahasa Indonesia, (6)mahasiswa tidak mengerti arti kosakata yang terdapat dalam kalimat, dan (7) mahasiswa kurang belajar materi 标点符号biāodiǎn fúhào.

Sintesis dan karakterisasi senyawa kompleks dari ZnBr2 dan Znl2 dengan ligan 2,2'-bipiridina / Ningsih Wahyuni

 

Kata kunci: ZnBr2, ZnI2, 2,2’-bipiridina, Senyawa Kompleks 2,2´-Bipiridina (C10H8N2) merupakan ligan bidentat karena memiliki dua atom donor N. Dua atom donor tersebut cenderung berkoordinasi pada ion pusat yang sama sehingga terbentuk kompleks sepit. Senyawa kompleks dari ZnBr2 dan ZnI2 dengan 2,2´-bipy pada stoikiometri 1 : 2 belum disintesis dan dilaporkan strukturnya. Tujuan penelitian adalah untuk mengetahui 1) struktur senyawa kompleks hasil reaksi dari ZnBr2 dan ZnI2 dengan ligan 2,2´-bipy pada stoikiometri 1 : 2; 2) pengaruh perbedaan ion pengimbang bromida dan iodida terhadap jumlah ligan 2,2´-bipy yang terkoordinasi dalam senyawa kompleks hasil sintesis. Penelitian merupakan eksperimental laboratorium dengan dua tahap yaitu 1) sintesis senyawa kompleks; 2) karakterisasi dan identifikasi senyawa kompleks. Sintesis dilakukan dengan metode langsung dari garam ZnBr2, ZnI2 dengan ligan 2,2´-bipy perbandingan stoikiometri 1 : 2 dalam dua macam pelarut yaitu MeCN dan MeCN-EtOH. Kristal hasil sintesis dikarakterisasi dengan instrumentasi titik lebur, daya hantar listrik (DHL), uji kualitatif anion, dan kandungan unsur dengan EDX (Energy Dispersive X-Ray), struktur kompleks yang terbentuk diprediksi berdasarkan hasil EDX menggunakan software hyperchem. Hasil penelitian yang diperoleh adalah: 1) senyawa kompleks hasil reaksi dari ZnBr2 dan ZnI2 dengan ligan 2,2´-bipy pada stoikiometri 1 : 2 merupakan kompleks ionik, diprediksi memiliki rumus molekul [Zn(2,2´-bipy)2]X2 (X = Br-, I-) dengan geometri tetrahedral; 2) ion pengimbang bromida dan iodida tidak berpengaruh pada jumlah ligan 2,2´-bipy yang terkoordinasi dalam senyawa kompleks hasil sintesis.

Penerapan model pembelajaran kooperatif tipe Two Stay Stray (TSTS) untuk meningkatkan keaktifan dan hasil belajar siswa kelas X RPL 3 SMK Negeri 3 Pamekasan pada mata pelajaran basis data / Akhmad Maulidi

 

Maulidi, Akhmad. 2015. Penerapan Model Pembelajaran Kooperatif Tipe Two Stay Two Stray (TSTS) untuk Meningkatkan Keaktifan dan Hasil Belajar Siswa Kelas X RPL 3 SMK Negeri 3 Pamekasan pada Mata Pelajaran Basis Data. Skripsi, Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Drs. Puger Honggowiyono, M.T., (2) I Made Wirawan, S.T., S.S.T., M.T. Kata Kunci: Pembelajaran kooperatif, tipe two stay two sray, keaktifan, hasil belajar, basis data. Berdasarkan hasil wawancara peneliti bersama bapak Jauhar Shafari, S.Kom dan hasil observasi di kelas X RPL, ditemukan beberapa keluhan dan kelemahan khususnya di kelas X RPL 3 pada proses pembelajaran Basis Data. Keluhan dan kelemahan yang ditemukan tersebut diantaranya: (1) keaktifan siswa yang masih kurang, yang disebabkan karena siswa takut untuk menyampaikan pertanyaan dan pendapat secara langsung kepada guru, (2) kurangnya kemampuan guru untuk menciptakan pembelajaran yang menimbulkan diskusi kelas, (3) hasil belajar siswa yang rendah dan tidak mencapai KKM khususnya Rezky, Rusli, Sri Hidayati, Suhartini, dan Syaiful. Peneliti merencanakan penelitian tindakan kelas selama beberapa siklus menggunakan tindakan dari Kemmis dan Taggart yang meliputi perencanaan, pelaksanaan, pengamatan, dan refleksi. Pada penelitian ini peneliti menerapkan model pembelajaran kooperatif tipe Two Stay Two Stray (TSTS). Pemilihan tipe TSTS ini bertujuan untuk meningkatkan keaktifan dan hasil belajar siswa. Pada tipe TSTS, siswa di bagi menjadi kelompok yang terdiri dari 3-4 orang dalam satu kelompok. Adapun kegiatannya adalah berdiskusi baik diskusi bersama kelompok asal, maupun diskusi dengan kelompok tamu. Hasil penelitian yang diperoleh meliputi: (1) keaktifan siswa sebelum tindakan mencapai 75,15%, pada siklus I meningkat menjadi 82,29% dan meningkat pada siklus II menjadi 93,14%, (2) hasil belajar aspek sikap siswa sebelum tindakan mencapai 68,56%, pada siklus I meningkat menjadi 81,64% dan meningkat pada siklus II menjadi 91,86%, (3) hasil belajar aspek keterampilan siswa sebelum tindakan mencapai 66,78%, pada siklus I meningkat menjadi 84,76% dan meningkat pada siklus II menjadi 93,14%, dan (4) hasil belajar aspek pengetahuan siswa sebelum tindakan persentase ketuntasannya mencapai 48,57%, pada siklus I persentase ketuntasannya 91,43% dan meningkat pada siklus II menjadi 100%. Untuk hasil belajar siswa yang bermasalah, pada siklus I masih ada yang tidak tuntas antara lain Sri Hidayati, Suhartini, dan Syaiful, pada siklus II siswa yang bermasalah sudah tuntas semua melebihi KKM. Dengan hasil tersebut dapat disimpulkan bahwa penerapan model pembelajaran kooperatif tipe two stay two stray dapat meningkatkan keaktifan dan hasil belajar siswa kelas X RPL 3 SMK Negeri 3 Pamekasan pada mata pelajaran Basis Data.

Kreativitas guru pendidikan kewarganegaraan dalam proses pembelajaran pendidikan kewarganegaraan siswa kelas VIII B SMP Laboratorium UM / Leni Kurniawati

 

Kata kunci: Kreativitas Guru, Pendidikan Kewarganegaraan, Proses Pembelajaran. Kreativitas adalah kemampuan untuk membuat kombinasi baru, berdasarkan data, informasi, atau unsur-unsur yang ada, yaitu segala pengalaman yang diperoleh seseorang selama hidupnya, baik selama dibangku sekolah maupun yang dipelajarinya dalam keluarga dan masyarakat. Kreativitas guru akan terlihat pada kemandirian berpikirnya dalam arti terbuka menerima dan melepaskan gagasan-gagasan atau ide-ide. Namun dalam pelaksanaannya, pembelajaran cenderung terpusat kepada guru (teacher centered) yang membuat sebagian besar aktivitas pembelajaran dilakukan oleh guru, sedangkan siswa bersifat pasif (hanya sebagai penonton) menerima informasi dan kurang memiliki kesempatan untuk mengembangkan kemampuannya. Tujuan dari penelitian ini adalah (1) Mendeskripsikan tentang cara guru menerapkan metode pembelajaran PKn di SMP Labororatorium UM, (2) Mendeskripsikan tentang keterampilan mengadakan variasi mengajar dalam pembelajaran PKn di SMP Laboratorium UM, (3) Mendeskripsikan tentang pengembangan media pembelajaran pada pembelajaran PKn di SMP Laboratorium UM, (4) Mendeskripsikan tentang cara memotivasi siswa dalam pembelajaran PKn di SMP Laboratorium UM, (5) Mendeskripsikan tentang pengelolaan kelas dalam proses pembelajaran PKn di SMP Laboratorium UM. Penelitian ini menggunakan pendekatan kualitatif yang bersifat deskriptif dalam memaparkan data dari hasil penelitian di lapangan. Maka dari itu penelitian ini dapat disebut sebagai jenis penelitian deskriptif kualitatif. Lokasi penelitian yang dipilih adalah SMP Laboratorium Universitas Negeri Malang. Sedangkan Sumber data dari penelitian ini dapat digolongkan sebagai data primer dan data sekunder yang diperoleh melalui metode pengamatan, wawancara, dan dokumentasi (recording, catatan lapangan, dan dokumen) . Analisis data yang digunakan dalam penelitian ini adalah analisis data interaktif seperti yang dikemukakan oleh Miles dan Huberman. Dalam pengecekan keabsahan penemuan maka peneliti menggunakan teknik (1) Perpanjangan keikutsertaan, (2) Ketekunan/keajegan pengamatan, dan (3) Triangulasi. Berdasarkan hasil penelitian yang dilakukan di SMP Laboratorium Universitas Negeri Malang, maka dapat diperoleh lima kesimpulan sebagai berikut. (1) cara guru menerapkan metode pembelajaran PKn di SMP Labororatorium UM yaitu guru menjelaskan materi biasanya selalu menggunakan metode ceramah bervariasi. Metode ini dianggap dapat mempermudah siswa memahami materi yang sedang dipelajari karena guru menjelaskan materi secara mendalam. Metode yang digunakan selain metode ceramah yaitu metode diskusi, tanya jawab dan pemberian tugas belajar. (2) keterampilan mengadakan variasi mengajar dalam pembelajaran PKn di SMP Laboratorium UM yaitu dengan merencanakan penjelasan seperti menyusun secara sistemasis pokok-pokok materi pelajaran yang disertai dengan contohnya dan menyajikan penjelasan. (3) pengembangan media pembelajaran pada pembelajaran PKn di SMP Laboratorium UM yaitu guru mengembangkan media pembelajaran dengan membuat ringkasan materi yang akan dipelajari dari berbagai sumber yang diringkas menjadi satu dalam modul yang akan digunakan guru dan siswa dalam proses belajar mengajar. (4) cara memotivasi siswa dalam pembelajaran PKn di SMP Laboratorium UM yaitu dengan cara guru memberikan semangat kepada siswa dengan mengatakan bahwa semua siswa dapat berhasil dalam belajar asal berusaha keras, rajin, tekun, dan tidak mengenal kata putus asa akan menimbulkan semangat siswa un belajar. Siswa menjadi tidak takut untuk salah dalam belajar karena siswa yakin jika salah maka siswa akan beusaha lagi untuk memperoleh yang benar. (5) pengelolaan kelas dalam proses pembelajaran PKn di SMP Laboratorium UM dapat dilakukan dengan menciptakan dan memelihara kondisi belajar yang optimal serta pengendalian kondisi belajar mengajar. Keterampilan guru dalam menciptakan kondisi belajar maksudnya guru berupaya melibatkan siswa secara optimal dalam pembelajaran yang dikelolanya demi mempertahankan dan meningkatkan prestasi siswanya. Kesimpulan yang bisa diambil dari penelitian ini yaitu: (1) penggunaan metode pembelajaran juga dapat menentukan sukses tidaknya pencapaian tujuan pembelajaran, (2) guru menganalisis materi dengan cara mengidentifikasinya, (3) variasi mengajar guru dalam setiap kegiatan belajar mengajar di kelas harusnya menggunakan beberapa cara yang bisa menumbuhkan minat serta meningkatkan daya tarik siswa, (4) ada dua media pembelajaran yang digunakan oleh guru dalam proses pembelajaran yaitu media elektronik yang media cetak, (5) guru mengembangkan media pembelajaran yaitu dengan meringkas materi dalam modul, (6) motivasi siswa dipengaruhi oleh metode mengajar yang digunakan oleh guru untuk meningkatkan kegairahan siswa dalam belajar, (7) pelaksanaan hukuman dilakukan guru untuk menyadarkan siswa atas kesalahannya. Sedangkan saran yang diinginkan penulis yaitu agar guru bisa lebih kreatif lagi dalam proses pembelajaran serta memanfaatkan media pembelajaran yang tersedia disekolah dan sekitar sekolah untuk menambah wawasan serta pengetahuan siswa untuk bisa lebih mempermudah siswa dalam memahami materi yang sedang dan akan dipelajari.

Pengembangan materi suplemen melengkapi cerita secara terbimbing cerita dalam majalah anak untuk peserta didik SD kelas V / Ferril Irham Muzaki

 

Muzaki, Ferril Irham. 2014. Pengembangan Materi Suplemen Melengkapi Cerita secara Terbimbing Berbasis Cerita dalam Majalah Anak untuk Peserta Didik SD Kelas V. Tesis. Program Studi Magister Pendidikan Dasar, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Yuni Pratiwi, M.Pd. dan (II) Prof. Dr. Maryaeni, M.Pd. Kata Kunci: materi suplemen, menulis cerita pendek, majalah anak, sekolah dasar. Pembelajaran bahasa menggunakan dua materi dalam proses pengajaran di sekolah, yakni materi inti dan materi suplemen. Materi inti diambil dari materi-materi pokok dalam kurikulum sesuai dengan kompetensi dasar. Adapun materi suplemen merupakan materi tambahan sebagai pengayaan untuk mendukung keberhasilan materi inti. Penelitian ini difokuskan pada pengembangan materi suplemen dalam kurikulum. Peneliti menggunakan cerita pendek berbasis cerita anak dalam majalah anak sebagai materi suplemen. Penelitian ini bertujuan menghasilkan materi suplemen melengkapi cerita secara terbimbing berbasis cerita dalam majalah anak. Materi suplemen yang dikembangkan difokuskan pada pelatihan mengidentifikasi dan mengungkapkan kembali (1) perilaku dan sifat tokoh; (2) kegiatan tokoh; (3) dialog tokoh; dan (4) penokohan. Data berupa kata, frasa, dan kalimat diperoleh untuk menjelaskan pengidentifikasian dan pengungkapan kembali (1) perilaku dan sifat tokoh; (2) kegiatan tokoh; (3) dan dialog tokoh. Data berupa paragraf diperoleh untuk menjelaskan pengidentifikasian dan pengungkapan kembali penokohan. Subjek penelitian adalah 24 peserta didik kelas V SD Laboratorium UM tahun pelajaran 2013/2014. Penelitian pengembangan ini telah menghasilkan materi suplemen melengkapi cerita secara terbimbing berbasis cerita dalam majalah anak untuk peserta didik SD kelas v. Materi suplemen tersebut berupa pelatihan mengidentifikasi dan mengungkapkan kembali (1) perilaku dan sifat tokoh. (2) kegiatan tokoh, dialog tokoh, dan (4) penokohan. Hasil uji lapangan materi suplemen tersebut dapat disimpulkan berikut ini. Pertama, berdasarkan keselarasan hubungan semantisnya, penggambaran perilaku tokoh dengan pelabelan sifat atas perilaku tokoh Afa dapat dibedakan atas (1) penggambaran perilaku, pelabelan sifat, dan rujukan ke isi cerpen selaras; (2) penggambaran perilaku dan pelabelan sifat tidak selaras, dan (3) penggambaran perilaku dan pelabelan sifat selaras, tetapi rujukan ke isi cerpen tidak selaras. Kedua, penggambaran setiap kegiatan tokoh menggunakan potongan tuturan yang menjadi fokus perhatian tiap-tiap subjek. Secara keseluruhan, penggambaran kegiatan tokoh tampak utuh dan kronologis, tetapi penggambaran oleh individu subjek hanya menampakkan satu kegiatan saja. Hasil yang demikian itu diduga disebabkan oleh pelatihan dalam suplemen yang digunakan berupa slot terbuka untuk menggambarkan suatu kegiatan. vi vii Ketiga, pengidentifikasian dan pengungkapan kembali dialog tokoh dilakukan dengan menuliskan kembali kalimat dialog tokoh dan mengubah dialog tokoh dengan bahasa sendiri. (1) Menuliskan kembali kalimat-kalimat yang diucapkan tokoh dapat dilakukan dengan sangat mudah, yakni keseluruhan subjek menuliskan kembali dialog yang relatif sama dan tidak ada variasi yang berarti dari tuturan yang dihasilkan subjek. (2) Mengubah dialog dengan bahasa sendiri dengan hasil ubahan dari pernyataan dialog menjadi kalimat tanya. Hasil ini disebabkan oleh pelatihan yang digunakan adalah kalimat berita. Oleh karena pelatihan dalam suplemen hanya satu variasi, patut diduga subjek paling familiar dengan mengubah kalimat berita menjadi kalimat tanya. Sangat mungkin hasilnya akan bervariasi jika pelatihan yang digunakan juga bervariasi Keempat, pengungkapan kembali penokohan dapat diklasifikasi atas dua kategori (1) sesuai dengan rambu-rambu dan isi teks, dan (2) tidak atau kurang sesuai dengan rambu-rambu dan isi teks. Namun demikian, dapat dinyatakan bahwa kreativitas subjek tampak sekali dalam mengisi teks yang rumpang tersebut Berdasarkan simpulan tersebut, dikemukakan 4 (empat) saran berikut bagi pengguna materi suplemen ini dan peneliti selanjutnya. Pertama, perlu dikembangkan ragam pelatihan menyelaraskan nama tokoh, perilaku tokoh, dan pelabelan sifat tokoh atas perilau tokoh untuk melatih peserta didik mengembangkan identitas tokoh imajinatif yang dapat dideskripsikan secara jelas indikatornya, selaras relasi semantisnya, dan benar kandungan maknanya. Kedua, perlu dikembangkan variasi pelatihan menggambarkan kegiatan tokoh berupa “peta pikiran model kronologis atau serial.” Dengan pelatihan itu, subjek terarahkan secara jelas kegiatan tokoh yang dilalui secara kronologis atau serial, bukan hanya potongan tuturan yang hanya menggambarkan kegiatan tunggal. Ketiga, perlu dikembangkan pelatihan pengidentifikasian dan pengungkapan kembali dialog tokoh dengan mengubah dialog tokoh dengan bahasa sendiri dengan pelatihan ubahan berbagai jenis tuturan, misalnya, berita, tanya, perintah, langsung, dan tidak langsung. Keempat, perlu diperkaya pelatihan mengisi teks rumpang untuk mengungkapkan kembali penokohan yang memungkinkan peserta didik mengembangkan imajinasinya yang tetap sesuai dengan tema cerpen, misalnya, dengan pancingan kata-kata kunci, pancingan kalimat utama, dan/atau kombinasi gambar

Pengembangan instrumen penilaian autentik berbasis kinerja dalam pembelajaran produktif pemasaranmapel penataan barang dagangan (studi pada siswa kelas XI Pemasaran SMKN 1 Turen Kabupaten Malang) / Eka Heru Saputra

 

ABSTRAK Saputra, Eka Heru. 2016. Pengembangan Instrumen Penilaian Autentik Berbasis Kinerja pada Pembelajaran Produktif Pemasaran Mapel Penataan Barang Dagang (Studi pada XI Pemasaran SMKN 1 Turen Kabupaten Malang). Skripsi. Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (1) Dr.WeningPatmiRahayu, S.Pd.,M.M, (2) Dr.MadziatulChuriyah,S.Pd., M.M. Kata kunci:Instumenpenilaian, autentik, berbasiskinerja, pemasaran, penataanbarangdagang Tujuanpenelitiandanpengembanganiniadalahmenghasilkanprodukberupainstrumenpenilaianautentikberbasiskinerjauntukmempermudah guru dalammelakukanpenilaiansecaraautentikterhadap proses danhasilbelajarsiswapadaMata PelajaranPenataanBarangDagang. Penelitiandanpengembanganinstrumenpenilaianinimenggunakan model Model R & D menurut Borg dan Gall. Adapuntahap-tahapdalam model pengembangan model R & D menurut Borg dan Gall yaitu: (1)Penelitiandanpengumpulan data; (2) Perencanaan; (3) Pengembangandrafproduk; (4) Ujicobalapanganawal; (5) Revisihasilujicoba; (6) Ujicobalapangan; (7)Penyusunanprodukhasilujicobalapangan; (8) Ujipelaksanaanlapangan; (9) Penyempurnaanprodukakhir; (10) Desiminasidanimplementasi.Pengembanganinstrumenpenilaianinihanyasampaipadatahapkelima. Produkhasilpengembangandivalidasimelalui1 ahlivalidasiisi, 2 ahlivalidasikonstruk, danujicobaterbatasinstrumenpenilaianuntukmengetahuikepraktisandanketerbacaaninstrumenpenilaianterhadap 12 siswa SMK. Instrumenpengumpulan data menggunakanangket. Jenis data yang diperolehberupa data kuantitatifdankualitatif. Data kuantitatifberupaskorpenilaiandariangketdan data kualitatifberupakomentardan saran. Teknikanalisis data yang digunakanadalahperhitunganpersentase. Produkhasilpenelitiandanpengembanganberupainstrumenpenilaianautentikberbasiskinerjapadapembelajaranproduktifpemasaranmapelpenataanbarangdagangandalambentukcetak. Hasilvalidasiisimenunjukanbahwainstrumenpenilaianpengetahuanmemilikipersentase rata-rata 100% dengankriteriakelayakan “layak”, instrumenpenilaianketrampilanmemilikipersentase rata-rata 100% dengankriteriakelayakan “layak”, daninstrumenpenilaiansikapmemilikipersentase rata-rata 100% dengankriteriakelayakan “layak”. Sedangkanvalidasikonstrukmenunjukanbahwainstrumenpenilaianpengetahuanmemilikipersentase rata-rata 97,5% dengankriteriakelayakan “layak”, instrumenpenilaianketrampilanmemilikipersentase rata-rata 97,9% dengankriteriakelayakan “layak”, daninstrumenpenilaiansikapmemilikipersentase rata-rata 96,42% dengankriteriakelayakan “layak”.Hasilujicobaterbatasmenunjukanbahwatanggapanguru terhadapkeprakrisaninstrumenpenilaianmemilikipersentase 95% dengankriteria “mudahdigunakan” danketerbacaanlembarkerjasiswamemilikipersentase 92,2% dengankriteria “mudahdigunakan”.

Pengembangan lembar kerja siswa berbasis model pengajaran langsung pada materi trigonometri untuk siswa SMA/MA kelas X / Silvia Hasanah

 

Kata Kunci: Lembar Kerja Siswa, Model Pengajaran Langsung, Trigonometri. Dari survey yang dilakukan peneliti di lapangan, diperoleh bahwa beberapa guru matematika menggunakan model pembelajaran langsung di kelas namun belum menggunakan bahan ajar yang sesuai untuk diterapkan pada model pengajaran langsung. Lembar kerja siswa yang digunakan hanya berisi materi dan latihan soal, belum memberikan ruang untuk mengaktifkan siswa. Dari hasil wawancara dengan salah satu guru, juga diperoleh fakta bahwa siswa kelas X mengalami kesulitan untuk memahami konsep awal trigonometri yaitu menentukan nilai perbandingan trigonometri pada segitiga siku-siku. Oleh karena itu, dikembangkan lembar kerja siswa yang sesuai diterapkan pada model pengajaran langsung pada materi trigonometri. Lembar kerja siswa adalah lembar kerja yang berisi tugas-tugas terstruktur dan digunakan dalam sintak model pembelajaran langsung misalnya pada bagian demonstrasi, latihan terbimbing dan kerja mandiri. Model Pengajaran Langsung merupakan salah satu model pembelajaran inovatif yang langkah-langkah pembelajarannya meliputi, 1) persiapan, 2) demonstrasi guru, 3) umpan balik siswa, 4) latihan terbimbing, dan 5) kerja mandiri. Model pengembangan LKS pada penelitian ini mengacu pada model yang dikembangkan oleh Sugiyono (2009) yang telah dimodifikasi. Tahapan yang dilakukan yaitu penelitian pendahuluan, pengumpulan data, analisis SK/KD,indikator,penentuan rancangan LKS,mendesain LKS, penelaahan oleh dosen pembimbing,validasi, revisi I, uji coba, analisis hasil uji coba dan revisi II,kemudian dihasilkan produk berupa LKS. Berdasarkan hasil validasi seperti yang diuraikan pada Bab IV, secara keseluruhan produk RPP dan LKS yang dikembangkan dinyatakan valid menurut penilaian validator ahli dan praktisi serta validator user.

Perancangan buku biografi visual Dynand Fariz mendirikan Jember Fashion Carnaval berbasis ilustrasi watercolor / Laura Isarimba Sastriyo

 

ABSTRAK Sastriyo, Laura Isarimba. 2016. Perancangan Buku Biografi Visual Dynand Fariz Mendirikan Jember Fashion Carnaval Berbasis Ilustrasi Watercolor. Skripsi, Program Studi Desain Komunikasi Visual, Jurusan Seni dan Desain, Fakultas Sastra. Universitas Negeri Malang. Pembimbing: (1) Drs. Sumarwahyudi, M.Sn, (II) Drs. Andi Harisman. Kata Kunci : Perancangan, Buku, Biografi Visual, Ilustrasi, Watercolor, Dynand Fariz, Jember, Jember Fashion Carnaval Dynand Fariz adalah sosok inspiratif dibalik berdirinya Jember Fashion Carnaval (JFC) yang mengubah citra kota Jember sebagai kota santri menjadi kota karnaval fashion yang diakui hingga mancanegara. Kesuksesan JFC saat ini tidak lain berkat kerja keras dan kegigihan Fariz mewujudkan mimpinya menjadikan Jember sebagai kota yang terkenal. Dibalik kesuksesannya, belum ada buku biografi visual yang menceritakan perjuangan Dynand Fariz mendirikan JFC. Biografi berasal dari bahasa Yunani, yaitu bios yang berarti hidup, dan graphien yang berarti tulis. Secara singkat biografi dapat dikatakan sebagai tulisan mengenai riwayat hidup seseorang. Ilustrasi merupakan elemen visual utama yang digunakan dalam buku karena manusia lebih mudah untuk memahami dan mendalami teks yang diberi ilustrasi. Ilustrasi dalam buku menggunakan watercolor atau cat air. Cat air adalah salah satu media menggambar yang penggunaannya dengan medium air ilustrasi yang dihasilkan melalui teknik basah menggunakan cat air. Metode perancangan yang digunakan yaitu Model Perancangan 5D Yohanes Moeljadi Pranata yang telah dimofikasi sesuai kebutuhan perancangan. Teknik pengumpulan data dilakukan dari bulan April hingga Juni 2016 melalui wawancara tak langsung dengan Dynand Fariz dan orang-orang terdekatnya dan juga studi literatur. Buku biografi visual Dynand Fariz, Ide Gila Membawa Jember kepada Dunia berisi riwayat hidup Dynand Fariz mendirikan Jember Fashion Carnaval dari awal hingga kini. Buku ini mencakup ilustrasi dengan teknik watercolor yang menceritakan riwayat hidup Dynand Fariz. Buku ini terdiri dari 30 halaman dengan menggunakan kertas HVS 100 gram.  

Deconstructing emma / Ary Yudha

 

Kata Kunci: feminisme, dekonstruksi, representasi, hak-hak wanita, Emma Saat ini, orang terkesan tidak punya waktu untuk membaca karya klasik, terutama karya klasik Inggris. Salah satu penulis Inggris klasik yang paling terkenal adalah Jane Austen. Jane Austen diakui menjadi salah satu penulis besar Inggris, sehingga tidak mengherankan bahwa novel-novelnya tetap terus menerus di cetak dari hari itu hingga saat ini. Selanjutnya, ulasan kontemporer banyak ditemukan untuk memuji karya-karyanya. Skripsi ini menganalisis karya klasik sastra Inggris karangan Jane Austen: Emma. Membacanya dari perspektif dekonstruksi feminis, Emma yang dipandang oleh para pengkritik sastra sebagai karya feminis justru menyuarakan sebalikya. Secara khusus, skripsi ini melihat karakter utamanya, Emma Woodhouse, yang menegaskan bahwa ia bukan merupakan representasi dari seorang feminis. Dekonstruksi ini akan disajikan dalam empat bab—pertama dengan latar belakang studi; tinjauan studi terkait dan kerangka teori dalam bab kedua; bab ketiga menjabarkan diskusi dan bagaimana masalah ini adalah dijawab, dan kesimpulan berada dalam bab terakhir. Novel ini dianalisis menggunakan pendekatan dekonstruksi feminis dan teori representasi. Penggabungan dari feminisme dan dekonstruksi membantu untuk mencari tahu bahwa Emma gagal merepresentasi sebuah karya feminis. Dengan memeriksa beberapa poin yang membuktikan hal sebaliknya: kebiasaan Emma dalam kaitannya dengan Harriet, dan trauma Emma dengan ketiadaan ibunya. Untuk dapat mendiskusikan hal tersebut, ada empat parameter yang digunakan: advokasi untuk hak-hak dan perjuangan wanita; menentang subordinasi dan objektifikasi wanita. Kesimpulannya, beberapa poin tersebut dikaitkan dengan empat parameter. Selanjutnya, studi ini membuktikan bahwa Emma gagal untuk mengadvokasi hak-hak perempuan dan pemberdayaan, Emma gagal untuk melakukannya karena patriarkal masih memainkan perannya. Dia gagal untuk mendapatkan hak-haknya karena alasan untuk tidak menikah justru membuat Emma menjadi seorang pengurus rumah tangga dan tidak ada hak kepemilikan karena pernikahannya. Selanjutnya, Emma yang menyalahgunakan kekuasaannya justru bertentangan dengan parameter feminis—menentang subordinasi dan objektifikasi wanita. Dengan demikian, Emma tidak merepresentasi seorang wanita feminis, justru ia diatur oleh peran patriarkal.

Optimalisasi waktu dan biaya proyek dengan analisa time cost trade off akibat keterlambatan proyek (studi kasus: pembangunan rusunawa tipe 24 zona 3-4 Kota Pasuruan) / Rani Rizqi Mawardi

 

ABSTRAK Mawardi, Rani Rizqi. 2016. Optimalisasi waktu dan biaya proyek dengan analisa time cost trade off akibat keterlambatan proyek (Studi Kasus : Pembangunan Rusunawa Tipe 24 Zona 3 – 4 Kota Pasuruan). Skripsi, Program Studi S1 Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing : (I) Drs. Bambang Djatmiko, S.T., M.T. (II) Drs. Suparno, S.T., M.T Kata Kunci : Percepatan durasi, Time cost trade off, CPM, PERT, PDM, penambahan jam kerja, penambahan sumberdaya Proyek pembangunan Rusunawa Kota Pasuruan rencananya akan selesai dalam waktu 240 hari. Namun pada kenyataan di lapangan, pekerjaan proyek tidak dapat terlaksana sesuai rencana. Pembangunan rusunawa mengalami keterlambatan akibat adanya perbedaan elevasi tanah di lokasi proyek dengan perencanaan. Karena adanya masalah tersebut maka waktu pekerjaan pada tahap selanjutnya mengalami keterlambatan sehingga durasi penyelesaian proyek berjalan lebih lama. Akibat adanya keterlambatan dilakukan percepatan dengan optimalisasi waktu dan biaya proyek dengan menggunakan analisa time cost trade off (TCTO) untuk meminimalisir waktu dan biaya yang dikeluarkan akibat keterlambatan. Optimalisasi waktu dan biaya dengan Analisa TCTO dilakukan dengan alternatif cara menambahkan waktu kerja proyek (jam lembur) dan penambahan sumberdaya manusia untuk mempercepat penyelesaian pekerjaan proyek dengan asumsi sumberdaya manusia di proyek tidak dibatasi. Jaringan kerja disusun berdasarkan logika ketergantungan yang telah dibuat sebelumnya sehingga tersusun menjadi jalur awal proyek hingga penyelesaian proyek. Pada penelitian kali ini digunakan beberapa metode jaringan kerja yakni CPM, PERT dan PDM. Metode CPM memerlukan 195 hari untuk penyelesaian proyek. Dengan alternatif penambahan jam kerja (lembur) biaya total yang dikeluarkan sebesar Rp. 4.676.801.841,- sedangkan dengan penambahan sumberdaya manusia biaya total yang dikeluarkan sebesar Rp. 4.651.411.296,-. Metode PERT memerlukan 195 hari untuk penyelesaian proyek. Dengan alternatif penambahan jam kerja (lembur) biaya total yang dikeluarkan sebesar Rp. 4.676.801.841,- sedangkan dengan penambahan sumberdaya manusia biaya total yang dikeluarkan sebesar Rp. 4.651.411.296,-. Metode PDM dengan percepatan menggunakan analisa time cost trade off dan fast track memerlukan waktu penyelesaian proyek selama 169 hari. Dengan alternatif penambahan jam kerja (lembur) biaya total yang dikeluarkan sebesar Rp. 4.585.195.174,- sedangkan dengan penambahan sumberdaya manusia biaya total yang dikeluarkan sebesar Rp. 4.559.804.630,- Dari ketiga metode tersebut (CPM, PERT dan PDM) yang paling efektif adalah metode PDM dengan penyelesaian proyek lebih cepat 53 hari, sedangkan yang paling efisien adalah alternatif penambahan sumberdaya manusia yang dapat menghemat biaya sebesar Rp. 186.736.667,-

Manajemen pendidikan sistem ganda di Sekolah Menengah Kejuruan Bhakti Mulia Pare Kabupaten Kediri / Desi Anike Putri Setyowati

 

ABSTRAK Setyowati, Desi Anike Putri. 2016. Manajemen Pendidikan Sistem Ganda di Sekolah Menengah Kejuruan Bhakti Mulia Pare Kabupaten Kediri. Skripsi, Jurusan Administrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Mustiningsih, M.Pd., (II) Dr. Hj. Maisyaroh, M.Pd. Kata Kunci: manajemen, pendidikan sistem ganda, sekolah menengah kejuruan. Sekolah Menengah Kejuruan (SMK) merupakan salah satu lembaga pendidikan yang bersifat formal yang ada di Indonesia. SMK berperan penting dalam mendidik dan mencetak anak bangsa yang cerdas dan kompetitif. Mengingat salah satu sistem dari pendidikan di SMK yaitu pendidikan sistem ganda (PSG) maka perlu adanya manajemen yang baik mengenai PSG supaya berjalan dengan baik sesuai dengan tujuan yang diharapkan. Penelitian ini dilakukan dengan tujuan untuk mendeskripsikan dan menemukan penerapan beberapa hal antara lain: penerapan dan proses manajemen PSG di SMK Bhakti Mulia Pare Kabupaten Kediri, dan masalah yang terjadi dalam pelaksanaan PSG di SMK Bhakti Mulia Pare Kabupaten Kediri dan penanganannya. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus. Lokasi penelitian ini adalah SMK Bhakti Mulia Pare Kabupaten Kediri. Alasan peneliti memilih sekolah tersebut yaitu diadakannya klasifikasi untuk siswa sebelum siswa PSG. Klasifikasi ini digunakan untuk memetakan kemampuan siswa antara satu dengan yang lainnya. Pengumpulan data dalam penelitian ini menggunakan teknik wawancara, observasi dan dokumentasi. Hasil penelitian ini yaitu: pertama adalah penerapan manajemen PSG di SMK Bhakti Mulia Pare Kabupaten Kediri, kedua adalah masalah yang terjadi dalam pelaksanaan pendidikan sistem ganda di SMK Bhakti Mulia Pare Kabupaten Kediri dan penanganannya. Penerapan manajemen PSG di SMK Bhakti Mulia Pare kabupaten Kediri terdiri dari perencanaan, pengorganisasian, pelaksanaan, serta pengawasan. Perencanaan berupa menentukan kepanitiaan, menentukan tempat, menentukan biaya, menentukan alokasi siswa, mengklasifikasi calon peserta, tes urin dan narkoba, membuat peta kesesuaian, mengkalsifikasi dunia usaha dan dunia industri (DU/DI) sasaran sekaligus menentukan jumlah kebutuhan, melakukan memorandum of understanding (MoU) dengan DU/DI sasaran terkait dengan PSG baik menyangkut waktu, pembimbingan, dan sanksi atau hal lain bila terjadi sesuatu, menentukan jumlah pembimbing, menentukan waktu pelaksanaan dan lama pelaksanaan, menentukan rencana kerja di tempat PSG, menentukan kriteria penilaian, perencanaan sarana dan prasarana, perencanaan pembelajaran kurikulum produktif. Pengorganisasian dilakukan dengan cara menyusun struktur organisasi yang sesuai, menentukan orang-orang yang terlibat di dalamnya, dan mendistribusikan pekerjaan. Kegiatan pelaksanaan berupa kegiatan pada saat sebelum, saat PSG, dan setelah PSG. Hal ini dimulai dari pendidikan dan pelatihan (diklat) dan pembekalan, penempatan siswa PSG, pembimbingan, dan penjemputan kembali oleh sekolah. Pengawasan dilakuakan oleh kepala sekolah, wakil kepala bidang humas, ketua program keahlian, dan guru pembimbing. Pengawasan dapat dilakukan dengan cara datang langsung mengunjungi ke instansi ataupun melalui telepon. Masalah yang terjadi dalam pelaksanaan pendidikan sistem ganda di SMK Bhakti Mulia Pare Kabupaten Kediri berupa siswa yang tidak mau ditempatkan di instansi tertentu, masalah hati dan perasaan, jarang masuk atau membolos, saingan antara satu dengan yang lain atau gap-gap an, masalah antar guru, tukar shiff dengan sesama siswa PSG. Bentuk penanganannya yaitu orang tua didatangkan untuk diberitahu dan diberikan pengertian, penjemputan siswa PSG yang bermasalah ke sekolah, menasehati, dan mengomunikasikan dengan DU/DI. Jadi dapat disimpulkan dalam menangani masalah disesuaikan dengan masalah yang terjadi. Berdasarkan hasil temuan penelitian tersebut, peneliti memberikan saran sebagai berikut: (1) Kepala SMK Bhakti Mulia Pare Kabupaten Kediri hendaknya lebih ditingkatkan untuk tingkat partisipasinya dalam pengawasan PSG sehingga tidak hanya kaprog dan guru pembimbing saja yang aktif dalam kegiatan pengawasan; (2) Ketua program keahlian hendaknya hasil pengawasan dapat dijadikan bahan evaluasi untuk tahun berikutnya agar tidak ada lagi DU/DI yang memberikan pekerjaan ke siswa PSG yang tidak sesuai dengan kompetensinya; (3) Guru SMK Bhakti Mulia Pare Kabupaten Kediri hendaknya ikut berperan aktif dalam pencarian tempat PSG agar pada tahun-tahun selanjutnya banyak DU/DI berskala nasional yang menjalin kerjasama dengan sekolah; (4) Siswa SMK Bhakti Mulia Pare Kabupaten Kediri hendaknya lebih mematuhi segala peraturan yang berlaku dan bertindak sesuai prosedur yang berlaku agar kerjasama yang telah terjalin oleh sekolah dapat berjalan dengan baik di tahun-tahun berikutnya; serta (5) Bagi peneliti lain alangkah baiknya untuk memperdalam kajian mengenai manajemen pendidikan sistem ganda terutama pada fungsi pelaksanaan melalui penelitian di lokasi yang berbeda.

Pelstarian produk kerajinan Anyaman Pandan dan Bambu sebagai perwujudan cinta tanah air di Kampung Sentra Industri Kecil Anyaman Desa kauman Kecamatan Kabuh Kabupaten Jombang / Seffy Faramita Ningrum

 

Ningrum, Seffy Faramita. 2015. Pelestarian Produk Kerajinan Anyaman Pandan dan Bambu sebagai Perwujudan Cinta Tanah Air di Kampung Sentra Industri Kecil Anyaman Desa Kauman Kecamatan Kabuh Kabupaten Jombang. Skripsi, Program Studi Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) Dr. H. A. Rosyid Al Atok, M.Pd, M.H, (2) Drs. Suwarno Winarno. Kata Kunci: pelestarian, kerajinan anyaman pandan dan bambu, wujud cinta tanah air Rasa cinta tanah air terhadap bangsa dan Negara Indonesia wajib dimiliki oleh seluruh warga Negara Indonesia. Perwujudan rasa cinta tanah air dapat dilakukan dengan berbagai hal, salah satunya dengan mencintai dan bangga menggunakan produk dalam negeri. Selain mencintai dan bangga terhadap produk dalam negeri, rasa cinta tanah air dapat pula diwujudkan melalui pelestarian produk asli Indonesia. Anyaman merupakan salah satu produk asli Indonesia yang wajib dijaga kelestariannya. Desa Kauman dikenal sebagai kampung sentra industri kecil anyaman pandan dan bambu dengan slogan cinta tanah air itu bagian dari iman. Tujuan penelitian ini untuk mendeskripsikan pelestarian produk kerajinan anyaman pandan dan bambu sebagai perwujudan cinta tanah air di kampung sentra industri kecil anyaman Desa Kauman Kecamatan Kabuh Kabupaten Jombang. Penelitian ini menggunakan rancangan penelitian kualitatif dengan jenis penelitian kualitatif deskriptif, dalam mencari data dan informan yang berasal dari kepala Desa Kauman, kepala yayasan Sanussiyah, para pengrajin anyaman pandan dan bambu, serta dari pihak dinas koperasi dan usaha mikro kecil dan menengah Kabupaten Jombang. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, dan studi dokumentasi. Analisis data dilakukan dengan cara pengumpulan data, reduksi data, penyajian data, dan penarikan kesimpulan. Untuk menjaga keabsahan data yang diperoleh, peneliti melakukan pengecekan data dengan cara perpanjangan keikutsertaan, peningkatan ketekunan, dan triangulasi. Berdasarkan hasil analisis data, diperoleh kesimpulan penelitian sebagai berikut. Pertama, motivasi para pengrajin melestariakn kerajinan anyaman pandan dan bambu yang didasari rasa cinta tanah air para pengrajin yang berinisiatif mengolah pandan dan bambu menjadi barang yang memiliki nilai ekonomis serta ramah lingkungan. Selain itu para pengrajin prihatin melihat generasi muda yang lebih bangga menggunakan produk impor. Para pengrajin menginginkan agar dengan melestarikan kerajinan anyaman pandan dan bambu dapat membangun rasa cinta dan bangga masyarakat terutama generasi muda terhadap produk lokal khususnya kerajinan anyaman pandan dan bambu. Kedua, produk kerajinan anyaman pandan dan bambu Desa Kauman yang meliputi jenis, bahan dasar, serta pemasaran produk. Diperoleh kesimpulan jenis produk kerajinan Desa Kauman yaitu berbagai produk anyaman yang memiliki kegunaan seperti tas, tikar, nampan, bakul nasi, kipas, dan lain sebagainya. Untuk hiasan rumah meliputi pigura foto, hiasan dinding, kap lampu, dan lain sebagainya. Sementara itu bahan utama pembuatan anyaman adalah pandan dan bambu serta bahan tambahan lainnya. Cara memasarkan produk para pengrajin biasanya menjual sendiri produk hingga luar kota, selain itu produk kerajinan biasanya diambil oleh para tengkulak terkadang ada pula konsumen datang ke Desa Kauman untuk membeli ataupun memesan produk kerajinan anyaman pandan dan bambu secara langsung. Ketiga, kendala muncul dari warga Desa Kauman serta dari pemerintah daerah terkait upaya pelestarian kerajinan anyaman pandan dan bambu. Kendala yang dihadapi warga Desa Kauman dalam pelestarian kerajinan anyaman pandan dan bambu diantaranya adalah generasi muda Desa Kauman kurang berminat melestarikan kerajinan anyaman, jumlah pandan dan bambu semakin berkurang, minat konsumen terhadap produk anyaman menurun, serta kurangnya perhatian dari pemerintah. Sementara itu kendala dilihat dari sudut pandang pemerintah daerah Kabupaten Jombang (Dinas Koperasi dan Usaha Mikro Kecil dan Menengah (UMKM)) terkait upaya pelestarian kerajinan anyaman pandan dan bambu diantaranya adalah para pengrajin tidak membentuk kelompok kerja atau klaster, bentuk produk anyaman kurang bervariasi, para pengrajin kurang giat mengikuti pameran, generasi muda Desa Kauman kurang berminat melestarikan kerajinan anyaman, pengrajin hanya bergantung dari tindakan yang dilakaukan pemerintah, serta para pengrajin tidak menjalankan kewajiban sebagai warga Negara Indonesia dengan baik karena mereka tidak membayarkan pajak kepada daerah setelah usahanya sukses. Keempat, upaya warga Desa Kauman dalam mengatasi kendala dapat dilakukan dengan cara memberikan pembinaan dan pelatihan kepada generasi muda agar mereka memiliki kesadaran dan kemauan untuk melanjutkan usaha kerajinan anyaman, mengambil pandan dan bambu dengan sistem tebang pilih, menciptakan produk yang kreatif dan inovatif, serta pemerintah harus lebih memperhatikan perkembangan usaha kerajinan anyaman pandan dan bambu. Sementara itu upaya yang dapat dilakukan untuk mengatasi kendala dilihat dari sudut pandang pemerintah daerah yaitu para pengrajin harus membentuk klaster, menciptakan produk yang lebih kreatif, sering mengikuti pameran dalam rangka promosi, menumbuhkan minat generasi muda untuk turut serta melestarikan produk kerajinan anyaman dengan cara meberikan pembinaan dan pelatihan khusus tentang cara menjalankan usaha pelestarian kerajinan anyaman pandan dan bambu, para pengrajin tidak bisa bergantung pada pemerintah untuk mengatasi kendala yang muncul, hendaknya para pengrajin menjalankan kewajiban dengan membayar pajak kepada daerah yang masuk dalam dana anggaran pendapatan dan belanja daerah agar antara pemerintah daerah dan pengrajin terjalin hubungan yang saling menguntungkan serta usaha pengrajin mendapat dukungan positif dari pemerintah.

Validasi media pembelajaran karpet pengetahuan di TK Permata Bunda Sawojajar Malang/ Naning Ika Arifiana

 

Hubungan karakteristik individu, karakteristik kelompok, struktur, budaya, dan iklim organisasi dengen keefektifan organisasi perguruan tinggi swasta di Kota Malang / Arie Ambarwati

 

ABSTRAK ‘ Ambarwati, Arie. 2016 Hubungan Karakteristik Individu, Karakteristik Kelompok, Sturuktur, Budaya dan Iklim Organisasi Dengan Keefektifan Organisasi Perguruan Tinggi Swasta Di Kota Malang. Disertasi Program Studi Manajemen Pendidikan, Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Prof. H. A. Sonhadji K. H., M. A., Ph. D, (II) Prof. Dr. I Nyoman Sudana Degeng, M.Pd., (III) Prof. Dr. Bambang Budi Wiyono, M.Pd. Kata Kunci: karakteristik Individu, karakteristik kelompok, struktur organisasi, budaya organisasi, iklim organisasi, keefektifan organisasi Pendidikan merupakan salah satu aspek dalam kekayaan sumber daya manusia yang diyakini sebagai kunci strategis dan faktor dominan dalam menentukan kemajuan tingkat peradaban dan kebudayaan suatu bangsa. Kualitas penyelenggaraan pendidikan yang dilaksanakan sangat menentukan maju mundurnya Negara tersebut dalam menghadapi persaiangan global. Tidaklah berlebihan jika pendidikan dipandang sebagai barometer eksistensi sebuah negara. Keberadaan Masyarakat Ekonomi ASEAN dengan tujuan mewujudkan integritas ekonomi di kawasan Negara-negara Asia Tenggara yang bertujuan untuk meningkatkan daya saing ASEAN terhadap Cina dan India dalam menarik investasi asing akan memberikan konsekuensi bagi pertukaran barang dan jasa antar sesame anggota Negara di kawasan ASEAN. Perguruan tinggi sebagai agen perubahan pembaharuan dalam masyarakat mempunyai peran dan tanggung jawab yang besar dalam menghasilkan generasi muda dan sumber daya manusia yang mampu bersaing dalam menyediakan tenaga kerja professional di antara anggota ASEAN. Perguruan tinggi swasta (PTS) sebagai mitra Perguruan Tinggi Negeri (PTN) memiliki kedudukan yang setara sejak dikeluarkannya PP No 30 Tahun 1990 tentang Pendidikan Tinggi. Kesejajaran itu ditunjukkan dengan pemberlakuan peraturan tersebut tanpa membedakan PTS dan PTN. Dinamika yang ada dalam perguruan tinggi swasta akan mempengaruhi keefektifan dan keberhasilan pencapaian tujuan organisasi, hal ini apabila perguruan tinggi swasta dipandang sebagai sebuah organisasi dengan segala unsure-unsur yang membentuk dan membangun keberlangsungan organisasi. Tujuan penelitian ini adalah untuk mengetahui hubungan langsung dan tidak langsung antara karakteristik individu, karakteristik kelompok, struktur organisasi, budaya organisasi, serta iklim organisasi dengan keefektifan organisasi. Penelitian ini menggunakan pendekatan kuantitatif dengan kategori penelitian expost facto dan merupakan penelitian non eksperimental. Hipotesis dalam penelitian ini bertujuan untuk membuktikan hubungan antar variabel. Lokasi penelitian di lakukan di Malang Jawa Timur yang mencakup populasi dosen sebanyak 1.164 orang di 55 perguruan tinggi swasta yang tersebar di wilayah kota Malang. Adapun sampel dosen yang digunakan dalam penelitian ini sebanyak 349 orang dari 20 perguruan tinggi swasta yang ada di kota Malang. Teknik pengumpulan data dilakukan dengan menggunakan angket atau kuesioner yang dikirimkan melalui pos pada masing-msing responden yang terpilih secara acak. Analisis yang digunakan dengan metode PLS untuk membuktikan hipotesis penelitian yang dilakukan. Kesimpulan dari hasil permodelan hubungan keenam variabel yang diteliti yang dihasilkan dalam penelitian ini adalah: (1) Karakteristik individu dosen tidak berhubungan langsung terhadap keefektifan perguruan tinggi, (2) Karakteristik kelompok mempunyai hubungan langsung dengan keefektifan, dan struktur organisasi, serta mempunyai hubungan tidak langsung dengan keefektifan organisasi melalui struktur organisasi, (3) Struktur organisasi secara langsung mempengaruhi keefektifan organisasi tetapi tidak mempunyai hubungan langsung dengan budaya dan iklim organisasi, (4) Hubungan langsung yang signifikan adalah hubungan antara budaya dan iklim organisasi dengan keefektifan organisasi, serta selanjutnya hasil temuan dalam penelitian ini adalah (5) adanya hubungan langsung yang signifikan antara iklim organisasi dengan budaya organisasi. Saran dari hasil penelitian ini bagi pihak pimpinan perguruan tinggi dapat digunakan sebagai sarana evaluasi untuk kinerja dosen, pengelolaan dan tata pamong perguruan tinggi, serta pengembangan dan perkuatan budaya serta iklim perguruan tinggi yang konduksif bagi proses pembelajaran di pendidikan tinggi. Bagi pihak-pihak yang berwenang dalam mengembangkan dan meningkatkan mutu perguruan tinggi swasta. Bagi peneliti selanjutnya adalah masih banyaknya varian faktor dan konstruk penelitian yang belum diteliti pada penelitian ini.

Peningkatan kemampuan menulis mel;alui model pembelajaran discovery di kelas V SDN Turi 02 Kota Blitar / Suryani Taponsabi

 

Taponsabi, Suryani. 2013. Peningkatan Kemampuan Menulis Melalui Model Discovery di Kelas V SDN Turi 02 Kota Blitar. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Alif Mudiono, M.Pd, (II) Dra. Hj. Lilik Bintartik, M. Pd Kata Kunci: model pembelajaran discovery, menulis argumentasi di SD.     Berdasarkan hasil observasi di kelas IV SDN Turi 02 Kota Blitar ditemukan bahwa kemampuan menulis masih sangat rendah. Hal ini dilihat dari tugas-tugas dan nilai ulangan harian yang berkaitan dengan materi pelajaran menulis mencakup (1) penempatan huruf besar kecil tidak teratur dan penggunaan tanda bacapun belum maksimal, (2) siswa masih kurang mampu menggunakan dan memilih kata dalam menuangkan buah pikirnya, (3) siswa belum bisa menemukan hubungan sebab-akibat, (4) isi kalimat relatif tidak menggambarkan topik, dan (5) kalimat yang satu dengan kalimat yang lain tidak sinambung, paragraf yang satu dengan yang lain tidak kohoren.     Penelitian ini bertujuan untuk mendeskripsikan, penerapan model pembelajaran discovery di kelas IV SD, dan peningkatan kemampuan menulis melalui model pembelajaran discovery di kelas IV SD. Jenis penelitian yang digunakan dalam penelitian ini adalah Penelitian Tindakan Kelas (PTK). Data yang diperoleh dalam penelitian ini tentang aktivitas siswa dan guru dan sumber datanya berupa hasil belajar siswa. Pengumpulan data berupa tes, non tes, observasi, wawancara dan dokumentasi.     Berdasarkan penelitian diketahui bahwa penerapan model pembelajaran discovery yang dilakukan oleh guru sudah di terapkan sesuai dengan langkah-langkahnya dan kemampuan menulis siswa melalui model pembelajaran discovery di kelas IV mengalami peningkatan. Dari siklus I sampai dengan siklus II. Maka diperoleh rata-rata nilai dari pra tindakan 70,48 dengan persentase ketuntasan 53,84%. Pada siklus I pertemuan 1 nilai rata-rata 68 dengan persentase ketuntasan 33,33% sedangkan pada siklus I pertemuan 2 nilai rata-rata 90 dengan persentase ketuntasan 82,51%. Pada akhir siklus II nilai rata-rata 91,01 dengan persentase tuntas 92,30%.     Berdasarkan hasil analisis data tersebut, diperoleh dua kesimpulan. Pertama, penerapan model pembelajaran discovery di kelas IV SD Turi 02 dilaksanakan dengan baik. Kedua, dengan menggunakan model pembelajaran discovery terbukti dapat meningkatkan kemampuan menulis siswa. mengalami peningkatan. Peningkatan menulis siswa terjadi tiap siklus pada penelitian ini, mulai dari siklus I sampai dengan siklus II. Maka disarankan untuk guru agar menggunakan model pembelajaran discovery untuk meningkatkan keterampilan menulis siswa.

Analisis kontrastif dialek Amiyah Mesir dan bahasa Fusha dalam album lagu Ya Tabtab Wa Dalla (YTWD) karya Nancy Ajram / Intan Izzah Dwi Asti

 

ABSTRAK Dwiasti, Izzah.I. 2016. Analisis Kontrastif Dialek Amiyah Mesir dengan Bahasa Arab Fusha dalam Album Ya Tabtab wa Dalla Karya Nancy Ajram. Skripsi, Jurusan Pendidikan Bahasa Arab, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dr. H. Kholisin M.Hum, (II) Laily Maziyah S.Pd, M.Pd. Kata Kunci: Dialek Amiyah Mesir, Bahasa Arab Fusha, Fonetik Bahasa Arab dalam penggunaanya terbagi menjadi dua, yaitu Arab fusha dan amiyah. Bahasa Arab fusha digunakan sebagai bahasa tulis yang memperhatikan gramatikal kebahasaan maupun ilmu nahwi. Berbeda dengan bahasa amiyah yang digunakan sebagai bahasa lisan untuk percakapan sehari-hari tanpa memperhatikan gramatikal kebahasaan seperti dalam bahasa Arab fusha. Orang Arab sering menggunakan bahasa amiyah dalam kegiatan sehari-hari, dan bahasa amiyah yang sering digunakan adalah amiyah Mesir. Antara bahasa Arab fusha dengan bahasa amiyah Mesir ada beberapa perbedaan dari segi kosakata maupun dialek. Perbedaan dialek terjadi pada aspek fonetis, dan perbedaan kosakata terjadi pada pemilihan kata sehingga banyak dari pelajar bahasa Arab merasa kesulitan dengan adanya perbedaan tersebut. Penelitian ini bertujuan untuk (1) mendiskripsikan perbedaan kosakata antara Bahasa Amiyah Mesir dengan Bahasa Arab fusha dan (2) mendiskripsikan perbedaan fonetik dalam dialek amiyah Mesir dan Bahasa Arab fusha yang ada dalam lagu. Penelitian ini menggunakan pendekatan kualitatif dan menggunakan metode deskriptif. Sumber data dalam penelitian ini adalah album lagu ya tabtab wa dalla karya Nancy Ajram beserta videonya, sedangkan data ada 2 macam yaitu; data primer berupa 5 lirik lagu dalam album tersebut, dan data sekunder berupa hasil wawancara dengan native speaker dari Mesir. Instrumen utama dalam penelitian ini adalah peneliti sendiri dibantu dengan intrumen tabel-tabel. Hasil penelitian dikemukakan sebagai berikut: (1) perbedaan kosakta antara bahasa amiyah Mesir dan bahasa Arab fusha terdapat pada kata isim, fiil dan huruf. Ditemukan 26 kosakata tentang isim (kata benda) dalam keseluruhan album ya tabtab wa dalla yang merupakan bentuk pergantian kosakata dengan kosakta lain, 20 kosakata tentang fiil (kata kerja) dalam bentuk fiil mudhori’ dan pergantian kosakata dengan kosakata lain, kemudia 2 kosakata tentang huruf yang ditemukan di dalam salah satu bentuk huruf istifham dan huruf athof. Masing-masing kosakata tersebut adalah kosakata bahasa amiyah Mesir yang berbeda dengan bahasa Arab fusha, (2) dalam bahasa Arab dialek Mesir terdapat perubahan fonetik diantaranya pergantian bunyi konsonan [ي] menjadi [أ], konsonan [ق] menjadi [ء] , Bunyi konsonan [ط] menjadi [ت], bunyi konsonan [ذ] menjadi [ز], bunyi konsonan [ج] menjadi bunyi konsonan [g], bunyi konsonan [ظ] menjadi [ض], bunyi /ي/ dari [ȋ] menajdi [ê], dan bunyi vokal rangkap diganti dengan menyesuaikan harokat sebelumnya. Kemudian terjadi penambahan bunyi (apentesis dan paragog) pada kata حير dan ازاى ارضيه yang dibaca [hayyar] dan [za yardhih]. Juga terjadi pelesapan bunyi di awal, tengah dan akhir yang terdapat pada kata انا ازعل, بِبْقَي, , ما هو كل, dibaca [anâz’âl], [bib’â], [mahkul]. Dan yang terakhir terjadi metatesis atau penukaran tempat yang terjadi pada kata (مِنْهُ → مِنُهْ), (عَنْدُو →عِنْدَ ) dan (تَرْجِع→تِرْجَعْ). Beberapa saran yang dapat dikemukakan dalam penelitian ini adalah (1) untuk pengajar bahasa Arab, diharapkan dapat menggunakan media lagu dalam pembelajaran ilmu aswat (bunyi), sehingga pelajar dapat memahami perbedaan dialek antar daerah Arab lainnya. (2) untuk peneliti selanjutnya, diharapkan dapat menggunakan penelitian ini sebagai salah satu rujukan dalam penelitian yang serupa.

Eksistensi Radio Budaya Jawa FM Blitar sebagai alat komunikasi pelestarian budaya Jawa dalam memperkaya kebudayaan nasional di Wlingi / Zulfatul Arifianti

 

Arifianti, Zulfatul. 2015. Eksistensi Radio Budaya Jawa FM Blitar Sebagai Alat Komunikasi Pelestarian Budaya Jawa Dalam Memperkaya Kebudayaan Nasional Di Wlingi Skripsi, Program Studi Pendidikan Pancasila dan Kewarganegaraan, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Sukowiyono, S.H, M.Hum, (II) Drs. Suwarno Winarno. Kata Kunci: eksistensi, radio, budaya jawa, kebudayaan nasional Radio merupakan salah satu alat komunikasi yang mampu menjangkau masyarakat secara luas, baik yang berada di perkotaan maupun pelosok desa. Radio sebagai media massa mampu menumbuhkan dan mengembangkan suatu budaya. Sebuah budaya yang dipopuletkan oleh radio memungkinkan pelestarian dan pengembangan sebuah budaya untuk dicintai oleh masyarakat pendengarnya. Radio berpotensi menyampaikan pesan moral, ethic dan estetik secara baik karena lebih bebas mengekspresikan musik dan suara. Penelitian ini bertujuan untuk mendeskripsikan : (1) peran historis Radio Budaya Jawa FM sejak berdiri sampai sekarang sebagai alat komunikasi; (2) ciri spesifik kebudayaan jawa; (3) program pelestarian budaya jawa dalam siaran Radio Budaya Jawa FM dalam memperkaya kebudayaan nasional; (4) opini masyarakat pendengar setia Radio Budaya Jawa Fm dalam pelestarian budaya jawa Metode yang digunakan dalam penelitian adalah deskriptif dengan menggunkan pendekatan kualitatif dan jenis penelitian studi kasus. Prosedur pengumpulan data pada penelitian kualitatif yang dilakukan oleh peneliti menggunkan : (1) observasi; (2) dokumentaasi; (3) wawancara mendalam. Hasil penelitian yang dilakukan oleh peneliti, dapat diperoleh kesimpulan : (1) peran historis Radio Budaya Jawa sejak berdiri hingga saaat ini sebagai alat komunikasi adalah berperan serta dalam kepeduliannya untuk menjaga dan melestarikan budaya jawa dengan didasari cita-cita untuk memberikan hiburan dan informasi yang bersih, jujur, dan bertanggungjawab kepada semua elemen masyarakat di kabupaten Blitar dengan pendekatan-pendekatan budaya lokal; (2) program pelestarian budaya jawa dalam siaran Radio Budaya Jawa tercermin dalam format siaran yang menggunakan bahasa jawa ngoko dan bahasa krama inggil serta materi siaran yang hampir sebagaian besar mengenai kebudayaan jawa; (3) program pelestarian budaya jawa dalam siaran Radio Budaya Jawa Fm dalam memperkaya kebudayaan nasional tercermin dalam kategori lagu-lagu yang ada yaiti lagu jawa yang didalamnya ada gending jawa, campursari, dangdut serta hiburan jawa yang terdiri dari ludruk, wayag, ketoprak, dan jaranan; (4) opini masyarakat pendengar setia Radio Budaya Jawa FM dalam pelestarian budaya jawa berdasarkan hasil wawancara dan observasi didapati bahwa program siaran radio mampu memberikan pengetahuan tambahan tentang kebudayaa jawa serta khasanah bahasa jawa. Berdasarkan hasil penelitian, disarankan bagi Radio Budaya Jawa agar tetap mempertahankan keunggulannya akan konsep yang diciptakan oleh pihak radio serta lebih memperkaya segmentasi yang tidak hanya untuk para orang tua namun juga para anak muda sebagai penerus serta pewarasi kebudayan bangsa.

Validasi media pembelajaran gelas multi guna di Taman Kanak-kanak / Sunsaeni

 

Penerapan pembelajaran numbered heads together untuk meningkatkan hasil belajar mata pelajaran keselamatan, kesehatan kerja dan lingkungan hidup siswa SMK Wisnuwardhana Malang / Akhmad Syafii

 

Kata Kunci : Pembelajaran Kooperatif, Numbered Heads Together (NHT), Hasil Belajar. Berdasarkan studi pendahuluan yang telah dilakukan di SMK Wisnuwardhana Malang, diperoleh informasi bahwa pembelajaran Keselamatan, Kesehatan Kerja dan Lingkungan Hidup sudah mulai menggunakan variasi bentuk model pembelajaran, namun dalam pelaksanaannya masih belum maksimal. Hal ini karena model pembelajaran yang dilakukan tidak didukung dengan penggunaan media pembelajaran, cenderung mencatat dan penugasan saja. Salah satu model pembelajaran yang dapat memperbaiki proses belajar mengajar dikelas tersebut adalah pembelajaran kooperatif model Numbered Heads Together (NHT). Pembelajaran kooperatif model Numbered Heads Together adalah strategi pembelajaran dimana para siswa aktif bekerjasama dalam kelompok kecil yang dimulai dengan penomoran, pengajuan pertanyaan, berfikir bersama, dan pemberian jawaban. Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK) atau Classroom Action Research (CAR), karena dalam penelitian ini peneliti bekerja sama dan berkolaborasi dengan guru dalam proses pembelajaran di kelas. Penelitian Tindakan Kelas ini terbagi dalam dua siklus, masing-masing siklus terdiri dari 4 tahapan yaitu perencanaan (planning), tindakan (acting), pengamatan (observation) , dan refleksi (reflection). Hasil penelitian menunjukkan bahwa: (1) Pelaksanaan pembelajaran kooperatif model Numbered Heads Together (NHT) pada mata pelajaran Keselamatan, Kesehatan Kerja dan Lingkungan Hidup sudah berjalan dengan lancar, hal ini ditandai dengan adanya peningkatan hasil belajar siswa dengan ketuntasan individual 32 siswa (88,9 %) meningkat sebesar 27,8% dari siklus 1. Didalam pembelajaran kooperatif harus ada elemen yang terkandung didalam setiap pembelajaran antara lain: saling ketergantungan positif, interaksi tatap muka, pertanggung jawaban individu, keterampilan menjalin hubungan antar pribadi; (2) tanggapan siswa terhadap penerapan pembelajaran koperatif model Numbered Heads Together (NHT) secara umum positif yaitu antara lain siswa merasa bahwa model Numbered Heads Together (NHT) menyenangkan dan bisa dijadikan variasi kegiatan pembelajaran sehingga pembelajaran tidak monoton, hanya beberapa siswa yang merasa terbebani dengan penerapan pembelajaran ini; (3) tanggapan guru terhadap penerapan pembelajaran kooperatif model Numbered Heads Together (NHT) cukup positif, guru beranggapan bahwa model tersebut dapat membuat siswa aktif bekerja mengemukakan pendapat dalam diskusi; (4) hasil belajar siswa dilihat dari 2 ranah yaitu kognitif dan afektif. Dalam vii pelaksanaannya terdapat peningkatan dimana dari siklus 1 sampai siklus 2 terjadi kenaikan hal ini dapat dilihat bahwa hampir seluruh nilai siswa telah memenuhi standart kelulusan yang telah ditentukan yaitu 70. Berdasarkan hasil penelitian maka peneliti mengajukan saran: (1) Bagi sekolah SMK hasil penelitian diharapkan menjadi pertimbangan dalam upaya perbaikan penerapan strategi pembelajaran di SMK Wisnuwardhana Malang karena pembelajran model Numbered Heads Together (NHT) dapat meningkatkan hasil belajar siswa, (2) Bagi guru mata pelajaran Keselamatan, Kesehatan Kerja dan Lingkungan Hiadup di SMK Wisnuwardhana Malang, dianjurkan menggunakan pembelajaran kooperatif model Numbered Heads Together (NHT) untuk meningkatkan hasil belajar siswa. Selain itu juga siswa dapat dilatih saling bekerjasama dengan teman, melatih rasa percaya diri siswa dan dapat menerima pendapat orang lain. Dalam menerapkan pembelajaran kooperatif model Numbered Heads Together (NHT), (3) Bagi peneliti berikutnya, dapat melakukan penelitian tentang pembelajaran kooperatif model Numbered Heads Together (NHT) pada mata pelajaran lain sebagai salah satu model pembelajaran dalam meningkatkan hasil belajar yang valid. Seperti pada mata pelajaran berkomunikasi melalui telepon dan bekerjasama dengan kolega dan pelanggan, (4) Bagi siswa SMK hendaknya lebih meningkatkan kreatifitas mereka untuk berfikir lebih maju dan berani mengungkapkan pendapat. Selain itu siswa diharapkan dapat saling bekerjasama dalam suatu kelompok dan berusaha menghargai orang lain.

Penggunaan media film sejarah dalam meningkatkan motivasi belajar siswa pada mata pelajaran sejarah di kelas X PD-A SMK Negeri 4 Malang tahun 2015/2016 / Dwi Tedy Lestari

 

ABSTRAK Lestari, Dwi Tedy. 2016. Penggunaan Media Film Sejarah Dalam Meningkatkan Motivasi Belajar Siswa Pada Mata Pelajaran Sejarah Di Kelas X PD-A SMK Negeri 4 Malang Tahun 2015/2016. Skripsi. Program Studi Pendidikan Sejarah. Jurusan Sejarah. Fakultas Ilmu Sosial Universitas Negeri Malang. Pembimbing: (1) Drs. I Wayan Legawa, M.Si (2) Najib Jauhari, S.Pd., M.Hum Kata Kunci : Media Film Sejarah, Motivasi Belajar, Mata Pelajaran Sejarah Motivasi dalam kegiatan pembelajaran sangatlah dibutuhkan untuk mendukung suksesnya kegiatan belajar. Namun berdasarkan observasi awal pada 6 April 2016 di kelas X PD-A SMK Negeri 4 Malang bahwa dalam belajar sejarah siswa cenderung kurang tertarik atau kurang termotivasi disebabkan oleh tidak fokusnya siswa terhadap proses belajar tampak saat pembelajaran berlangsung siswa sibuk dengan kegiatannya melamun, mengobrol, bermain HP. Untuk meningkatkan motivasi belajar Sejarah, perlu dibutuhkan suatu media pembelajaran, seperti melalui pemutaran film sejarah. Media pembelajaran ini diharapkan untuk dapat menunjang tercapainya motivasi belajar yang tinggi karena media ini bisa langsung dilihat, didengar dan dipahami alur ceritanya. Rumusan masalah pada penelitian ini adalah (1) Bagaimana penggunaan media film sejarah dalam meningkatkan motivasi belajar siswa pada mata pelajaran Sejarah kelas X PD-A SMK Negeri 4 Malang? (2) Bagaimana motivasi belajar siswa kelas X PD-A dalam pembelajaran Sejarah menggunakan media film sejarah?. Tujuan dari penelitian ini adalah (1) Mendeskripsikan penggunaan media film sejarah dalam meningkatkan motivasi belajar siswa pada mata pelajaran Sejarah kelas X PD-A SMK Negeri 4 Malang. (2) Mengetahui motivasi belajar siswa kelas X PD-A dalam pembelajaran Sejarah menggunakan media film sejarah. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK). dengan menerapkan media film sejarah yang terdiri dari 2 siklus dengan subjek yang diteliti adalah siswa kelas X PD-A SMK Negeri 4 Malang yang berjumlah 31 siswa terdiri dari 28 siswa laki-laki dan 3 siswa perempuan. Penelitian ini difokuskan pada pengamatan terhadap motivasi belajar, aktivitas dan respon siswa dalam mengikuti pembelajaran menggunakan media film sejarah. Data motivasi siswa diperoleh dari angket. Aktivitas siswa dan peneliti diperoleh dari data observasi, catatan lapangan, wawancara dan dokumentasi. Data dianalisis secara deskriptif persentase. Hasil penelitian menunjukkan bahwa pembelajaran sejarah dengan menggunakan media film dokumenter dikelas X PD-A SMK Negeri 4 Malang sangat efektif dalam memberikan kedalaman makna materi dan pengertian kepada siswa berkenaan dengan topik yang menjadi bahan pelajaran. Pembelajaran tersebut berpengaruh pada perubahan motivasi yang tinggi oleh siswa ketika mengikuti pembelajaran, terbukti dari rata-rata motivasi siswa mencapai 73,80% pada siklus I. Pada siklus II Aktivitas siswa meningkat dengan rata-rata 82,09% dalam kategori tinggi. Siswa lebih aktif dalam bertanya, menjawab, memberikan pendapat, berinteraksi dengan kelompok dan bekerjasama kelompok. Berdasarkan hasil penelitian ini, dapat disarankan bahwa dalam pengelolaan pembelajaran di kelas, guru harus selalu memberi arahan dan memberikan motivasi kepada seluruh siswa dengan penggunaan media yang menarik, dan bagi peneliti berikutnya disarankan untuk mengembangkan media pada subyek penelitian yang berbeda agar tercipta suasana belajar yang menyenangkan dan menarik.

Using picture-based story-telling technique to improve the speaking skill of the eleventh graders of MAN Kisaran / Haru Irawan

 

Thesis, Graduate Program in English Language Education, State University of Malang. Advisors: (1) Dr. Hj. Arwijati W. Murdibjono, M.Pd, DipTESL, (2) A. Effendi Kadarisman, M.A, Ph.D. Key words: Picture-based, story-telling technique, speaking ability. Based on the researcher’s experience in teaching English and the preliminary study conducted, the students’ achievement in speaking skill was unsatisfactory. The students’ average score in speaking was 55.42, while the minimum mastery criterion (KKM/Kriteria Ketuntasan Minimum) was 65. It was so because (1) the students had difficulty when they wanted to speak English, (2) the student had less time for practicing using English, (3) the students had low motivation in speaking English. To overcome these problems, the researcher proposed one of the suitable technique in speaking English, that was using picture-based story-telling technique. This study was designed to improve the students’ speaking skill by using picture-based story-telling technique. The objective of this study was to describe how picture-based story-telling technique can improve the students’ speaking skill of the eleventh graders of MAN Kisaran. The study was collaborative action research in which the researcher and the collaborative teacher worked together in conducting this study. The researcher acted as the teacher while the English teacher became the researcher’s collaborator to observe the implementation of using picture-based story-telling technique. This study was conducted in cycles by following the procedures of the action research i.e. planning, implementing, observing, and reflecting. Each cycle consisted of three meetings. The data of the study were gathered through the following instruments: observation checklist, field notes, questionnaire and students’ performance in telling the story. The subjects of this study were 36 eleventh graders of MAN Kisaran of 2010/2011 academic. Implementing using picture-based story-telling technique in teaching speaking encompasses several procedures: (1) dividing the students into groups of four, (2) giving explanation about the narrative form in order that the students knew the construction of narrative form, (3) explaining the past tense form, (4) giving modeling to tell the story using pictures in front of the class, (5) distributing the pictures to the students so that the students would see the story that they would tell in front of the class, (6) giving vocabulary to the students related to the story, (7) giving description about the story of each picture, (8) asking the students to discuss the story in their group, (9) asking students to tell the story using pictures individually in front of the class, (10) asking the students to explain the construction of the narrative, (11) asking the students to give some comments about the story told by their friend, (12), correcting the students’ pronunciation. The finding of the study indicated that using picture-based story-telling technique was successful in improving speaking achievement. The improvement could be seen from the increase of students’ average speaking skill from 55.42 in the preliminary study, and 59.46 in the Cycle 1, to 75.92 in Cycle 2. Besides, the finding also indicated that using picture-based story-telling technique was effective in enhancing the students’ participation and motivation. It showed that there were 44% students participated actively in Cycle 1 and 93% students participated in Cycle 2. In addition, it was found that there were 80% students were motivated in implementing the story-telling technique. It can be concluded that using picture-based story-telling technique is effective to improve the students’ achievement and the students’ participation and students’ motivation. The English teachers are suggested that they implement the technique in their English class particularly in speaking class. In addition, the teachers in other subjects such as Indonesian, Arabic are suggested to apply picture-based story-telling technique in their classroom activities. The future researchers are recommended that they conduct research by implementing picture-based story-telling technique. Finally, the school principal is expected to facilitate the English teachers in improving their teaching quality in the classroom.

Valdidasi media pembelajaran "animal puzzle" di TK Pertiwi Sanan Kulon Blitar / Nurul Farida

 

Pengaruh hidup, iklan dan melek ekonomi (economic literacy) terhadap perilaku konsumsi siswa kelas XI IPS SMA Negeri 7 Malang / Fauzul Indah Lestari

 

ABSTRAK Aditama, Fauzul Indah. 2016. Pengaruh Gaya Hidup, Iklan dan Melek Ekonomi (Economic Literacy) Terhadap Perilaku Konsumsi Siswa Kelas XI IPS SMA Negeri 7 Malang . Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. Prih Hardinto, M.Si (II) Ro’ufah Inayati, S.Pd., M.Pd Kata Kunci: Gaya Hidup, Iklan, Melek Ekonomi (Economic Literacy) dan Perilaku Konsumsi. Adanya perkembangan zaman ke arah modernisasi atau globalisasi diikuti dengan berbagai dampak yang ditimbulkannya. Perkembangan ini juga turut mempengaruhi berabagai aspek kehidupan seperti gaya hidup masyarakat khususnya dalam hal konsumsi. Konsumsi ini juga dipengaruhi oleh adanya iklan yang semakin menarik minat untuk membeli barang yang ditawarkan khususnya pada kalangan remaja. Remaja merupakan salah satu kelompok yang menjadi sasaran dikarenakan tahap perkembangannya yang masih berada pada tahap transisi, sehingga diperlukan pengetahuan pada remaja agar dapat memperioritaskan kebutuhan dalam perilaku konsumsi. Dengan demikian, penelitian mengenai pengaruh gaya hidup, iklan, dan melek ekonomi terhadap perilaku konsumsi perlu untuk dilakukan. Penelitian ini bertujuan untuk mengetahui: (1) pengaruh gaya hidup terhadap perilaku konsumsi siswa, (2) pengaruh iklan terhadap perilaku konsumsi siswa, (3) pengaruh melek ekonomi (economic literacy) terhadap perilaku konsumsi siswa, (4) pengaruh gaya hidup, iklan dan melek ekonomi (economic literacy) terhadap perilaku konsumsi siswa SMA Negeri 7 Malang. Rancangan penelitian yang digunakan bersifat deskriptif kuantitatif. Penelitian ini menggunakan studi populasi dengan teknik pengambilan sampel proportional random sampling. Pengumpulan data dengan menggunakan angket dan tes. Hasil penelitian ini menunjukkan bahwa (1) Gaya hidup berpengaruh signifikan terhadap perilaku konsumsi. (2) Iklan tidak berpengaruh terhadap perilaku konsumsi. (3) Melek ekonomi (economic literacy) berpengaruh signifikan terhadap perilaku konsumsi. (4) Gaya hidup, iklan, dan melek ekonomi (economic literacy) secara bersama-sama berpengaruh terhadap perilaku konsumsi. Saran yang diajukan adalah: (1) Sekolah perlu mensosialisasikan kepada orang tua siswa tentang peran pendidikan orang tua, agar siswa bergaya hidup tidak berlebihan sesuai kebutuhan dan mengoptimalkan pembelajaran ekonomi dengan menanamkan sikap agar dapat diterapkan dalam kehidupan sehari-hari dalam melakukan kegiatan berkonsumsi yang rasional. (2) Guru menyampaikan ilmu ekonomi tidak hanya teori saja, melainkan juga memberikan pemahaman ekonomi yang kuat kepada siswa untuk melakukan tindakan berkonsumsi secara rasional.(3) Penelitian ini dapat dijadikan masukan maupun menambah bahan kajian untuk penelitian selanjutnya khususnya yang berkaitan dengan gaya hidup, iklan dan melek ekonomi terhadap perilaku konsumsi dan dapat memperluas variabel yang telah digunakan dalam penelitian ini, karena masih banyak faktor keputusan pembelian, kepribadian, konsep diri, teman sebaya dan lain-lain.

Using picture-sequence strategy to enhance the wrirting narrative skill of eight grade srtudents at Mts Maarif NU 2 Sutojayan / Azhizha Nilawardani

 

Nilawardani, Azhizha. 2014.Using Picture-sequence Strategy to Enhance The Writing Narrative Skill of Eight Grade Students at MTs Maarif NU 2 Sutojayan. Undergraduate Thesis, English Department, Faculty of Letters, State University of Malang. Pembimbing: Drs. Andi Muhtar, M.A. Kata Kunci: menulis, strategi picture-sequence, kemampuan menulis, teks naratif, sikap siswa     Tujuan penelitian ini adalah untuk mengetahui bagaimana strategi picture sequence meningkatkan kemampuan siswa dalam menulis teks naratif. Strategi Picture-sequence adalah kombinasi dari strategi dan media. Strategi ini membutuhkan 3 pertemuan untuk mengajar, memberi latihan menulis secara kelompok, dan tes menulis secara individu tanpa media. Media yang digunakan adalah gambar dan lembar kerja siswa. Siswa diharuskan untuk mengikuti instruksi yang ada di dalam lembar kerja siswa dan membaca teks naratif kemudian menyusun gambar berdasarkan teks. Siswa kemudian harus menuliskan teks naratif berdasarkan urutan gambar kurang lebih 200-300 kata.     Penelitian ini menggunakan desain PTK atau penelitian tindakan kelas dengan mengikuti empat langkah penelitian, yaitu: perencanaan, penerapan, observasi dan refleksi. Subyek dari penelitian ini adalah kelas 8D di MTs Maarif NU 2 Sutojayan pada semester kedua tahun akademik 2013/2014. Ada 30 siswa yang diteliti dalam kelas tersebut.     Temuan penelitian ini menunjukkan bahwa strategi picture-sequence meningkatkan kemampuan menulis siswa. Hal itu terbukti dari nilai siswa yang telah mencapai standar minimal kelulusan, yakni 75, pada akhir siklus pertama. Strategi ini juga membuat suasana kelas menjadi lebih menyenangkan sehingga motivasi siswa dalam menulis pun meningkat. Hal itu terbukti dari hasil pengamatan siswa di dalam kelas dan hasil pengisian angket.     Berdasarkan penemuan ini, guru bahasa Inggris diharapkan mengadopsi langkah-langkah atau instrumen yang digunakan dalam strategi picture-sequence sebab strategi ini telah terbukti dapat meningkatkan kemampuan menulis siswa secara signifikan. Para guru juga disarankan untuk menggunakan strategi ini dalam upaya meningkatkan motivasi siswa dalam menulis dengan beberapa modifikasi terutama untuk mengakomodasi kekurangan dari strategi ini dalam hal alokasi waktu. Peneliti selanjutnya diharapkan untuk meneliti penerapan strategi picture-sequence untuk meningkatkan kemampuan menulis siswa di jenis teks lainnya.

Penggunaan metode peramalan model intervensi dalam analisis laju inflasio ekonomi Kota Malang / A. Ali Syihabuddin

 

Kata Kunci: peramalan, model intervensi, inflasi ekonomi Inflasi adalah kecenderungan dari harga-harga untuk meningkat secara umum dan terus menerus. Kenaikan harga dari satu atau dua barang saja tidak dapat disebut sebagai inflasi kecuali bila kenaikan itu meluas (atau mengakibatkan kenaikan) kepada barang lainnya. Analisis intervensi merupakan salah satu analisis deret waktu untuk memodelkan data deret waktu yang dipengaruhi oleh adanya suatu kejadian atau intervensi. Secara umum, ada dua macam fungsi intervensi yaitu fungsi “step” dan “pulse”. Tujuan penulisan skripsi ini untuk mengetahui cara menentukan model intervensi laju inflasi ekonomi Kota Malang yang dipengaruhi oleh kenaikan harga BBM melalui fungsi step. Penentuan model intervensi dibentuk dengan menggabungkan respon intervensi dengan model ARIMA dari data sebelum intervensi. Permodelan ARIMA untuk data sebelum intervensi dilakukan melalui tahapan (1) Identifikasi model sementara. (2) Pendugaan parameter. (3) Diagnosis model. Identifikasi respon intervensi dilakukan dengan mengamati grafik residual dari model ARIMA dan menentukan orde , dan . Langkah selanjutnya adalah estimasi parameter model intervensi. Hasil analisis intervensi fungsi step pada data laju inflasi ekonomi Kota Malang periode Januari 2001 – Januari 2012 diperoleh model berikut: Hasil peramalan besarnya inflasi pada bulan Februari 2012 – Januari 2013 diperoleh nilai yang konstan yaitu 0.3925 untuk setiap bulan.

Efektivitas penggunaan media tebak gambar (TEGA) dalam pembelajaran example non-example untuk peningkatan motivasi belajar siswa pada mata pelajaran sejarah kelas XI IPS 3 SMAN 1 Ngraho-Bojonegoro / Lohayati

 

ABSTRAK Lohayati. 2016. Efektivitas Penggunaan Media Tebak Gambar (Tega) dalam Pembelajaran Example non-Example untuk Peningkatan Motivasi Belajar Siswa pada Matapelajaran Sejarah Kelas XI IPS 3 SMAN 1 Ngraho-Bojonegoro. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. Joko Sayono, M.Pd., M.Hum, (II) Drs. Slamet Sujud Purnawan Jati, M.Hum. Kata Kunci: pembelajaran sejarah, media tega, motivasi. Pembelajaran sejarah di SMAN I Ngraho diajarkan dengan metode ceramah, pengerjaan LKS, dan merangkum buku paket sejarah di kelas XI IPA dan IPS. Selama kegiatan pembelajaran siswa banyak yang mengantuk, bermain sendiri dan berbicara dengan teman sebangkunya hal tersebut menunjukkan rendahnya motivasi belajar siswa dalam pelajaran sejarah.Matapelajaran sejarah banyak terdapat konsep-konsep yang sulit dipahami oleh siswa tanpa bantuan media, oleh karena itu matapelajaran sejarah membutuhkan media dalam proses pembelajarannya.Salah satu media yang cocok dalam pembelajaran sejarah adalah media tebak gambar (tega). Tujuan dilaksanakan penelitian ini untuk meningkatkan motivasi belajar siswa pada matapelajaran sejarah dengan penggunaan media tega. Sesuai dengan fungsi media gambar dalam pembelajaran yaitu: pertama, gambar dapat merangsang motivasi, minat atau perhatian siswa. Kedua, Gambar-gambar yang dipilih dan diadaptasi secara tepat, membantu siswa memahami dan mengingat isi informasi bahan-bahan verbal yang menyertainya. Metode yang digunakan adalah metode penelitian eksperimen dengan menggunakanquasi experimental design. Bentuk desain yang digunakan adalah nonequivalent control group design. Teknik pengambilan sampel dalam penelitian ini,menggunakannonprobability sampling jenispurposive sampling.Instrumen yang digunakan adalah media tega dan angket motivasi. Pengumpulan data dilakukan dengan menggunakan kuisoner, observasi, dan wawancara. Analisis data menggunakan uji normalitas dan homogenitas data. Pengujian hipotesis diuji dengan uji-t. Berdasarkan hasil analisis hasil penelitian disimpulkan kelas kontrol yang tidak diajar menggunakan media tega motivasi belajar siswa meningkat 0,2%, sedangkan kelas eksperimen yang diajar menggunakan media tega meningkat 19,92%. Berdasarkan Hasil uji-t menunjukkan nilai signifikansi 0,014<0,05, maka Ho ditolak dan Ha diterima. Jadi dapat disimpulkan ada perbedaan motivasi belajar antara kelas yang diajar dengan media tega dengan kelas yang diajar tanpa media tega dengan demikian media tega efektif untuk meningkatkan motivasi belajar siswa pada matapelajaran sejarah. Hasil skor rata-rata motivasi belajar siswa kelas kontrol dari angket sebelum perlakuan adalah 38,64 dan skor rata-rata hasil angket sesudah perlakuan adalah 38,76. Data angket sebelum perlakuan adalah minat 64,25%, kosentrasi 65,42%, dan ketekunan 61,5% dengan demikian motivasi siswa kurang. Data angket sesudah perlakuan adalah minat 65,25, kosentrasi 66,58, dan ketekunan 65,3 dengan demikian motivasi siswa baik. Hasil skor rata-rata motivasi belajar siswa kelas eksperimen dari angket sebelum perlakuan adalah 31,46 dan skor rata-rata hasil angket sesudah perlakuan adalah 42,21. Data angket sebelum perlakuan adalah minat 55,5%, kosentrasi 48%, dan ketekunan 47,75%data tersebut menunjukkan motivasi siswa sangat kurang. Data angket sesudah perlakuan adalah minat 75,71, kosentrasi 79, dan ketekunan 75,61 dengan demikian motivasi siswa sangat baik.

Pengaruh model problem posing dipadu think pair share dan student team achievement divission terhadap kualitas proses, hasil belajar kognitif, dan prestasi siswa pada topik termokimia / Amar Atus Sholikah

 

Sholikah, Amar Atus, 2015. Pengaruh Model Problem Posing Dipadu Think Pair Share dan Student Team Achievement Divission terhadap Kualitas Proses, Hasil Belajar Kognitif dan Persepsi Siswa pada Topik Termokimia. Tesis, Program Studi Pendidikan Kimia Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dra. Srini M. Iskandar, M.Sc, Ph.D, (II) Dr. Siti Marfu’ah, M.S. Kata kunci: termokimia, model pembelajaran PP-TPS, model pembelajaran PP- STAD, kualitas proses, hasil belajar dan persepsi siswa Termokimia merupakan salah satu materi yang dianggap sulit oleh siswa SMAN I Parang. Hal ini didukung dengan rendahnya rata-rata nilai post test dan rendahnya persentase siswa yang mencapai kriteria ketuntasan belajar minimal pada materi termokimia. Fakta tersebut diduga karena siswa kurang mampu dalam memecahkan soal yang banyak melibatkan perhitungan matematika dan karena proses pembelajaran di sekolah pada saat ini masih kurang meningkatkan kreativitas dan aktivitas siswa. Penerapan model pembelajaran problem posing yang dipadu dengan kooperatif tipe TPS (Think Pair Share) dan problem posing yang dipadu dengan kooperatif tipe STAD dapat dijadikan sebagai salah satu alternatif untuk mengembangkan suasana belajar yang lebih menarik yang memberi kesempatan siswa untuk menemukan dan menerapkan ide-ide mereka sendiri dalam mempelajari materi yang banyak melibatkan perhitungan matematis seperti termokimia. Tujuan penelitian ini adalah untuk mengetahui: kualitas proses pembelajaran yang menggunakan model PP-TPS dan PP-STAD pada topik termokimia, perbedaan hasil belajar kognitif termokimia siswa yang dibelajarkan dengan kedua model tersebut dan persepsi siswa terhadap pembelajaran dengan menggunakan kedua model tersebut. Penelitian ini menggunakan rancangan kuasi eksperimen dengan “Postest Only Group Design”. Sampel penelitian ini adalah siswa kelas XI IPA1 dan kelas XI IPA2 SMAN I Parang tahun ajaran 2014/2015 yang masing-masing terdiri dari 21 orang. Kelas XI IPA1 sebagai kelas eksperimen yang dibelajarkan dengan model PP-TPS dan kelas XI IPA2 sebagai kelas eksperimen yang dibelajarkan dengan model PP-STAD. Data penelitian berupa hasil observasi kualitas proses pembelajaran, nilai post test dan angket persepsi siswa. Soal post test terdiri dari 30 soal pilihan ganda dengan validitas isi sebesar 88-100% dan koefisien reliabilitas yang dihitung dengan menggunakan rumus Kuder Richardson-20 sebesar 0,899. Data penelitian dianalisis menggunakan uji t. Hasil penelitian menunjukkan bahwa kualitas proses pembelajaran dengan menggunakan model PP-TPS maupun model PP-STAD termasuk dalam kategori baik. Hasil belajar kognitif siswa pada pembelajaran dengan model PP-TPS lebih tinggi dibandingkan pada pembelajaran dengan model PP-STAD. Persepsi siswa terhadap pelaksanaan kedua model pembelajaran yang digunakan adalah baik atau positif.

Analisis AMMI (Additive Main Effect and Multiplicative Interantion) untuk menentukan stabilitas genotipe tanaman kedelai terhadap lokasi / Sulhan Afandi

 

Kata Kunci : Stabilitas genotipe terhadap lokasi, analisis ragam tersarang, analisis AMMI, biplot AMMI Stabilitas genotipe terhadap lokasi diartikan sebagai kemampuan suatu genotipe untuk tetap menghasilkan hasil panen yang tinggi pada setiap lokasi yang berbeda (Stability of Genotipe) atau suatu genotipe hanya mampu menghasilkan hasil panen yang tinggi pada lokasi tertentu saja yang menunjukkan genotipe tersebut beradaptasi pada lokasi secara spesifik (adaptation of genotypes to specific environmental). Dalam skripsi ini respon yang digunakan untuk mengetahui stabilitas suatu genotipe kedelai terhadap lokasi adalah data hasil panen tanaman kedelai. Data ini merupakan data sekunder. Berdasarkan data ini kemudian dilakukan analisis dengan menggunakan metode AMMI untuk menentukan stabilitas suatu genotipe kedelai terhadap lokasi. Analisis AMMI adalah suatu teknik analisis data percobaan dua faktor perlakuan dengan pengaruh utama perlakuan bersifat aditif dan pengaruh interaksi yang dimodelkan dengan model bilinear ganda. Prosedur analisis AMMI terdiri dari, uji asumsi, analisis ragam tersarang, analisis ragam AMMI, biplot AMMI dan Interpretasi hasil . Hasil analisis ragam tersarang menunjukkan bahwa interaksi genotipe dan lokasi signifikan, sehingga bisa dilanjutkan dengan analisis ragam AMMI. Berdasarkan hasil analisis ragam AMMI diperoleh bahwa terdapat 3 komponen utama interaksi yang signifikan sehingga model AMMI yang terbaik adalah model AMMI-3. Karena terdapat lebih dari 2 komponen utama yang signifikan maka stabilitas genotipe terhadap lokasi dilihat dengan menggunakan biplot AMMI-2 dan diperoleh bahwa terdapat 8 genotipe yang stabil terhadap 16 lokasi yang diuji. Sedangkan sisanya, yaitu 2 genotipe hanya beradaptasi secara spesifik terhadap lokasi tertentu.

Hubungan kualitas penilaian dengan motivasi belajar siswa pada program keahlian teknik bangunan di SMKN 2 Jember / Achmad Ludfi Sulistiono

 

ABSTRAK Sulistiono, Ahmad Ludfi. 2016. Hubungan Kualitas Penilaian Dengan Motivasi Belajar Siswa Pada Program Keahlian Teknik Bangunan SMK Negeri 2 Jember. Skripsi, Program Studi S1 Pendidikan Teknik Bangunan, Jurusan Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. Sutrisno, S.T., M.Pd dan (II) Drs. Antelas Eka Winahyo, M.Pd Kata kunci: Kualitas Penilaian, Motivasi Belajar Siswa, SMK program keahlian teknik bangunan Sekolah Menengah Kejuruan sebagai salah satu lembaga pendidikan formal yang menyelenggarakan pendidikan untuk mengembangkan potensi peserta didik agar menjadi manusia yang beriman dan bertakwa kepada Tuhan Yang Maha Esa berakhlak mulia, kreatif, berilmu, dan menjadi warga negara yang demokratis serta bertanggung jawab. Berdasarkan pengamatan disekolah dan informasi dari para guru-guru, dari beberapa siswa masih banyak yang mengalami kesulitan belajar sehingga prestasi siswa program keahlian teknik bangunan masih dibawah standar kurikulum yang ditunjukkan dengan hasil tugas disekoah. Kemampuan dan pemahaman guru dalam penilaian serta motivasi belajar diindikasikan sebagai salah satu tidak tercapainya hasil belajar secara maksimal di SMK Negeri 2 Jember. Penelitian ini bertujuan untuk mengetahui: (1) kualitas penilaian yang dilakukan oleh guru Program Keahlian Teknik Bangunan SMK Negeri 2 Jember; (2) motivasi belajar siswa pada Program Keahlian Teknik Bangunan SMK Negeri 2 Jember; (3) ada tidaknya hubungan kualitas penilaian dengan motivasi belajar siswa Program Keahlian Teknik Bangunan SMK Negeri 2 Jember. Penelitian ini dilaksanakan di SMK Negeri 2 Jember Program Keahlian Teknik Bangunan, dengan rancangan penelitian deskriptif dengan menggunakan pendekatan kuantitatif. Data hasil penelitian diperoleh melalui angket berskala interval dari sampel penelitian siswa kelas X Program keahlian Bangunan. Data hasil penelitian dianalisis menggunakan korelasi Product Moment dengan berbantu software SPSS 16 for windows. Hasil penelitian (1) kualitas penilaian guru pada Program Keahlian Bangunan di SMK Negeri 2 Jember termasuk dalam kategori sangat baik, (2) motivasi belajar siswa pada pada Program Keahlian Bangunan di SMK Negeri 2 Jember termasuk dalam kategori baik, (3) tidak terdapat hubungan positif yang signifikan antara kualitas penilaian dengan motivasi belajar siswa pada Program Keahlian Bangunan di SMK Negeri 2 Jember, dengan 0,137 (lebih besar) dari 0,05 nilai signifikansi probabilitas. Berdasarkan hasil penelitian disarankan untuk meningkatkan motivasi belajar siswa agar minat belajar siswa semakin tinggi sehingga prestasi akan lebih baik, serta hasil penilaian yang sudah dicapai guru harap dipertahankan.

Analisis keterserapan dan relevansi kompetensi dengan kebutuhan dunia kerja lulusan SMK Program Studi Keahlian Teknik Bangunan (studi kasus di perusahaan jasa konstruksi) / Annisa' Carina

 

Carina, Annisa'. 2015. Analisis Keterserapan dan Relevansi Kompetensi dengan Kebutuhan Dunia Kerja Lulusan SMK Program Studi Keahlian Teknik Bangunan (Studi Kasus di Perusahaan Jasa Konstruksi). Tesis. Program Studi Pendidikan Kejuruan, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Mardji, M.Kes, (II) Dr. Ahmad Dardiri, M.Pd. Kata kunci: lulusan, kompetensi, dunia kerja. Penelitian ini bertujuan: (1) mengetahui keterserapan lulusan SMK program studi keahlian teknik bangunan di dunia kerja jasa konstruksi, (2) mengetahui relevansi kompetensi lulusan SMK program studi keahlian teknik bangunan di dunia kerja jasa konstruksi, (3) mengetahui kebutuhan dunia kerja dalam mempekerjakan lulusan SMK program studi keahlian teknik bangunan, dan (4) mengetahui hubungan antara relevansi kompetensi lulusan SMK program studi keahlian teknik bangunan dengan kebutuhan dunia kerja. Penelitian ini adalah penelitian kuantitatif ex-postfacto, dengan alat yang digunakan untuk mengumpulkan data yaitu dokumentasi dan angket. Populasi penelitian ini yaitu PT. Jagat Baja Prima Utama, PT. Murinda Iron Steel, CV. Abiseka, CV. Dimensi Konsultant, CV. Proyeksi, dan CV Pragmatis Engineering Konsultant. Teknik pengambilan sampel dalam penelitian ini adalah sampel total. hal ini dikarenakan jumlah pegawai di enam perusahaan jasa konstruksi tersebut hanya terdapat 28 pekerja dengan ijasah terakhir SMK, sehingga diambil semuanya sebagai sampel dari 121 pekerja. Analisis yang digunakan adalah analisis regresi linier sederhana, untuk mengetahui hubungan antar variabel relevansi kompetensi dengan kebutuhan dunia kerja. Hasil penelitian menunjukkan persentase keterserapan lulusan SMK program studi keahlian teknik bangunan di dunia kerja jasa konstruksi tergolong rendah dengan persentase sebesar 23,14%. Pada variabel relevansi kompetensi, lulusan SMK program studi keahlian teknik bangunan termasuk dalam kategori tidak baik dengan persentase sebesar 8,86%. Selanjutnya pada variabel kebutuhan dunia kerja, bahwa dunia kerja jasa konstruksi dalam mempekerjakan lulusan SMK program studi keahlian teknik bangunan dalam kategori tidak baik dengan persentase sebesar 11,38%. Terdapat hubungan signifikan antara relevansi kompetensi lulusan SMK Program Studi Keahlian Teknik Bangunan dan kebutuhan dunia kerja jasa konstruksi. Adapun saran yang diberikan diantaranya: (1) bagi Pemerintah/Dinas Pendidikan, diperlukan adanya pembangunan citra SMK di mata dunia kerja, (2) bagi Kepala Sekolah SMK, diperlukan adanya pemantapan program prakerin sekolah dengan memperkuat link and match antara dunia pendidikan dengan dunia kerja, (3) bagi dunia kerja, diperlukan adanya bimbingan dari pihak industri yang terarah (Prakerin), serta bagi lulusan yang sudah bekerja di jasa konstruksi dapat dilakukan seminar atau pelatihan terkait jasa konstruksi.

Peningkatan kemampuan membaca ekstensif cerita pendek dengan strategi penelitian kelompok siswa kelas VII D SMPN 1 Candipuro Kabupaten Lumajang semester genap 2014/2015 / Sofiatun

 

ABSTRAK Sofiatun. 2015. Peningkatan Kemampuan Membaca Ekstensif Cerita Pendek dengan Strategi Penelitian Kelompok Siswa Kelas VII D SMP N 1 Candipuro Kabupaten Lumajang Semester Genap 2014/2015. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra. Universitas Negeri Malang. Pembimbing: (I) Pror. Dr. H. A. Syukur Ghazali, M.Pd, (II) Indra Suherjanto, S. Pd, M.Sn. Kata kunci: peningkatan, membaca ekstensif, cerita pendek, strategi penelitian kelompok Membaca ekstensif merupakan kegiatan membaca yang berhubungan dengan kemahiran dalam memahami isi pokok-pokok bacaan. Membaca ekstensif merupakan kegiatan membaca yang dilaksanakan untuk memperoleh informasi sebanyak-banyaknya tentang persoalan tertentu dalam berbagai macam bacaan. Tujuan membaca ekstensif adalah memahami isi yang penting dari bahan bacaan dengan waktu yang cepat dan singkat. Berdasarkan hasil studi pendahuluan, diketahui bahwa kenmampuan siswa dalam membaca esktensif cerita pendek masih belum memenuhi standar ketuntasan yang ditentukan. Siswa yang mendapat nilai ≥ 75 hanya 4 siswa atau 11% untuk cerpen “Sumbangan”, 3 siswa atau 8% untuk cerpen “Si Cacat”, dan 0 siswa untuk cerpen “Pelajaran Mengarang”. Berdasar hasil tersebut siswa kesulitan menemukan unsur-unsur intrinsik cerita pendek dengan tepat. Perlu strategi khusus untuk mengatasi masalah tersebut. Salah satunya dengan menggunakan strategi penelitian kelompok. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK). Rancangan penelitian ini dilaksanakan dalam dua siklus yang memiliki empat tahapan, yaitu: 1) perencanaan, 2) pelaksanaan, 3) pengamatan, dan 4) refleksi. Penelitian ini dilakukan pada siswa kelas VII D SMP N 1 Candipuro Kabupaten Lumajang. Pelaksanaan penelitian dimulai tanggal 04 Januari 2015 sampai 04 Pebruari 2015. Data penelitian ini adalah tes hasil membaca ekstensif cerita pendek dengan strategi penelitian kelompok. Sumber data penelitian ini adalah 37 siswa di kelas VII D. Hasil penelitian pada siklus I, kemampuan membaca ekstensif cerita pendek dengan strategi peneltian kelompok belum mencapai SKM yang ditentukan yaitu ≥ 75. Hanya ada 18 siswa atau 49% yang berhasil mencapai SKM pada cerpen Si Cacat, 43% atau 16 siswa pada cerpen Sumbangan, 38% atau 14 siswa pada cerpen Pelajaran Mengarang. Kesulitan yang dialami siswa secara umum terletak pada unsur tema cerpen. Hasil penelitian pada siklus II, kemampuan membaca ekstensif cerita pendek dengan strategi peneltian kelompok sudah mencapai SKM yang ditentukan yaitu ≥ 75, ada 34 siswa atau 92% yang berhasil mencapai SKM pada cerpen Si Cacat, 89% atau 33 siswa pada cerpen Sumbangan, dan 86% atau 32 siswa pada cerpen Pelajaran Mengarang. Kesulitan yang terjadi pada siklus I sudah tidak terjadi pada siklus II. Hasil penelitian ini menunjukkan bahwa ada peningkatan kemampuan siswa dalam membaca ekstensif dari siklus I kesiklus II.   Berdasarkan penelitian tersebut diketahui bahwa kemampuan siswa dalam membaca ekstensif mengalami peningkatan setelah membaca cerita pendek dengan strategi peneltian kelompok. Walaupun ada peningkatan dari temuan yang ada, tetapi secara keseluruhan siswa masih mengalami kesulitan ketika menemukan tema cerpen melaui membaca ekstensif. Maka dari itu, disarankan kepada guru untuk memaksimalkan materi dan soal tes yang diberikan kepada siswa dalam kategori unsur tema pada teks cerpen. Memaksimalkan yang dimaksud ialah memberikan informasi yang padat dan tepat kepada siswa. Ketika melakukan kegiatan membaca ekstensif, disarankan guru menggunakan teks yang beragam dan berjenjang, artinya antara teks yang satu dengan teks yang lainnya memiliki tingkat kesulitan yang berbeda. Guru juga bisa menerapkan strategi penelitian kelompok pada kegiatan pembelajaran yang lain.

Efektivitas pembelajaran elektrokimia untuk siswa SMA dengan strategi inkuiri terbimbing berbantuan lumtimedia terhadap pemahaman konseptual dan algoritmik / Anik Widarti

 

Widarti, Anik. 2015. Efektivitas Pembelajaran Elektrokimia untuk Siswa SMA dengan Strategi Inkuiri Terbimbing Berbantuan Multimedia terhadap Pemahaman Konseptual dan Algoritmik. Tesis, Program Studi Magister Pendidikan Kimia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Subandi, M. Si; (II) Dr. Munzil, S. Pd, M.Si. Kata Kunci: pembelajaran elektrokimia, pemahaman konseptual, pemahaman algoritmik, inkuiri terbimbing Dalam pembelajaran elektrokimia, ada 3 level representasi yang harus dikuasai yakni makroskopik, submikroskopik dan simbolik. Disamping itu, topik ini juga memerlukan pemahaman konseptual dan pemahaman algoritmik yang pada tingkat submikroskopik bersifat abstrak. Hal ini yang menyebabkan siswa yang berada pada tahap berpikir konkret sering mengalami kesulitan belajar. Untuk itu, strategi inkuiri terbimbing berbantuan multimedia diduga dapat meningkatkan pemahaman konseptual dan algoritmik siswa dalam mempelajari topik ini. Tujuan dari penelitian ini adalah untuk menguji: (1) ada tidaknya perbedaan pemahaman konseptual antara siswa yang dibelajarkan dengan strategi inkuiri terbimbing dengan yang dibelajarkan dengan strategi verifikasi, (2) ada tidaknya perbedaan pemahaman algoritmik antara siswa yang dibelajarkan dengan strategi inkuiri terbimbing dengan yang dibelajarkan dengan strategi verifikasi. Penelitian ini menggunakan rancangan eksperimen semu, dengan subjek penelitian adalah siswa dari dua kelas XII IPA SMAN 1 Pacet Mojokerto, tahun ajaran 2014/2015, salah satu kelas yang terdiri dari 35 siswa sebagai kelas eksperimen, dan 37 siswa di kelas yang lain sebagai kelas kontrol. Kelas eksperimen dibelajarkan dengan dengan strategi inkuiri terbimbing dan kelas kontrol dibelajarkan dengan strategi verifikasi. Pembelajaran pada kedua kelas dibantu dengan multimedia. Data hasil belajar kognitif dijaring dengan menggunakan tes objektif yang terdiri dari 24 item, 12 item untuk pemahaman konseptual dan 12 item untuk pemahaman algoritmik. Tes objektif tersebut mempunyai validitas isi sebesar 92,4% dan reliabilitas tes sebesar 0,838. Uji t digunakan untuk membandingkan tingkat pemahaman konseptual dan tingkat pemahaman algoritmik hasil pembelajaran inkuiri terbimbing dan hasil pembelajaran verifikasi . Hasil penelitian menunjukkan bahwa : (1) tingkat pemahaman konseptual siswa yang dibelajarkan dengan strategi inkuiri terbimbing (skor rata-rata 59,06) lebih tinggi dibanding siswa yang dibelajarkan dengan strategi verifikasi (rerata 36,27), (2) tingkat pemahaman algoritmik siswa yang dibelajarkan dengan strategi inkuiri terbimbing (skor rata – rata 72,38) lebih tinggi dibanding siswa yang dibelajarkan dengan strategi verifikasi (rerata 44,36).

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |