Pengembangan media pembelajaran tune up motor bensin di SMK NU Miftahul Huda Kepanjen Malang / Eko Wahyuhono Pasmawan

 

Tesis Pembimbing: (I) Dr. H. Dwi Agus Sudjimat, S.T., M.Pd, (II) Dr. Waras Kamdi, M.Pd. Kata-kata kunci: pengembangan, media pembelajaran, tune up motor bensin. Pembelajaran di sekolah menengah kejuruan untuk program keahlian Teknik Mekanik Otomotif memerlukan pengetahuan teoritis yang cukup, disertai dengan pengetahuan praktis yang mudah dipahami. Selain itu, siswa juga harus memiliki skill yang khusus sebab lulusan sekolah menengah kejuruan harus memiliki kompetensi sesuai bidangnya. Oleh karena itu, mata diklat produktif merupakan mata diklat yang sangat memungkinkan untuk membekali siswa dengan kompetensi yang diperlukan sesuai bidang keahliannya. Kesulitan dalam pembelajaran Tune Up Motor Bensin adalah banyak prosedur yang harus dilakukan sehingga rawan menimbulkan kesalahan yang fatal. Agar siswa memahami dan tidak menimbulkan kekeliruan, maka diperlukan kehadiran instruktur yang benar-benar ahli dan tidak melewatkan informasi-informasi yang dibutuhkan oleh siswa. Proses pembelajaran Tune Up Motor Bensin di SMK NU Miftahul Huda guru tidak menyampaikan informasi tentang tujuan pembelajaran, remidi, pengayaan, sehingga kurang menarik dan interaktif. Guru belum memanfaatkan komputer sebagai media alternatif pelatihan. Guru sebagai instruktur memiliki sifat pelupa secara manusiawi. Ketika dalam proses pembelajaran instuktur memberi contoh ada beberapa hal yang terlupa. Kejadian semacam ini menjadikan proses belajar harus senantiasa memberikan instuksi lagi, memberi informasi lagi karena saat memberi contoh tadi lupa belum tersampaikan dan baru disadari saat siswa melakukan kesalahan. Atas dasar hal-hal tersebut perlu dikembangkan suatu media pembelajaran yaitu produk software media pembelajaran interaktif yang didasari penerapan teori pembelajaran. Produk software media pembelajaran ini disajikan dalam bentuk gambar bergerak yang diperjelas dengan teks tentang urutan langkah pengerjaan yang sempurna. Media pembelajaran ini bisa di putar berulang-ulang agar siswa dapat memahami materi sesuai dengan tujuan pembelajaran yang baik dan sempurna. Hal ini bisa dilakukan dengan mengembangkan media pembelajaran interaktif berbantuan komputer. Dalam pengembangan ini dititik beratkan pada hal-hal berikut 1) untuk menciptakan suasana dan lingkungan belajar yang menyenangkan tanpa terikat pada aturan-aturan, tempat, ruang dan waktu, 2) pembelajaran berpusat pada kebutuhan dan minat siswa serta memberdayakan penggunaan sumber belajar yang bisa diakses siswa, 3) dalam bahan pembelajaran, disajikan tantangan yang kompetitif, problematik, diaknostik dan futuristik, dan 4) siswa diberikan keleluasaan belajar secara individu dan kooperatif. Model pembelajaran Dick & Carey dijadikan dasar pengembangan media pembelajaran pada kompetensi Tune Up Motor Bensin pada program keahlian Teknik Mekanik Otomotif. Prosedur pengembangan media pembelajaran interaktif terdiri dari lima tahap, yaitu: tahap pertama menentukan kompetensi yang akan dikembangkan, tahap kedua mengidentifikasi silabus kompetensi yang akan dikembangkan, tahap ketiga pengembangan media pembelajaran, tahap keempat mengembangkan software media pembelajaran, tahap kelima sebagai tahapan ujicoba media pembelajaran yang terdiri dari tinjauan ahli dan siswa sebagai user. Hasil ujicoba kepada ahli mata diklat dan pembelajaran dijadikan dasar merevisi tahap pertama. Hasil ujicoba perorangan kepada siswa dijadikan dasar merevisi tahap kedua. Hasil ujicoba kelompok kecil dijadikan dasar merevisi tahap ketiga. Hasil ujicoba lapangan dijadikan dasar merevisi tahap terakhir. Dari hasil pengembangan ini: secara umum ahli isi dan pembelajaran memberikan penilaian (74%) dengan kriteria baik, uji coba perorangan memberikan penilaian (79,8%), uji coba kelompok kecil memberikan penilaian (78,6%), dan uji coba lapangan memerikan penilaian (81%). Hal ini berarti bahwa media ini telah memenuhi syarat dalam memenuhi kebutuhan siswa dalam proses pembelajaran. Kesimpulan pengembangan menunjukkan bahwa media pembelajaran Tune Up Motor Bensin ini sangat menarik, menambah motivasi belajar siswa, memudahkan belajar, dan dapat mengurangi dominasi guru di kelas. Guru dan siswa berpendapat bahwa pembelajaran dengan menggunakan media pembelajaran semacam ini dapat terlaksana secara efektif dan efisien. Hal ini terjadi karena siswa dapat melihat berbagai bentuk data baik gambar, teks, suara, gerak dan peragaan mengenai prosedur pelaksaan Tune Up Motor Bensin. Pada akhirnya, hal ini dapat memungkinkan siswa lebih menguasai materi pelajaran. Berdasarkan hasil pengembangan tersebut diajukan beberapa saran sebagai berikut 1) kepada guru SMK NU Miftahul Huda Kepanjen Malang yang mengajar mata diklat Tune Up Motor Bensin dalam memanfaatkan produk media pembelajaran ini agar pemanfaatannya bisa maksimal harus memperhatikan spesifikasi peralatan, dan program pendukung yang perlu disediakan, 2) kepada Sekolah Menengah Kejuruan lain yang hendak memanfaatkan media pembelajaran ini juga perlu memperhatikan bahwa peralatan praktik yang berbeda pada tiap sekolah maka kepada guru mata diklat perlu memberikan penjelasan kepada siswa tentang perbedaan peralatan yang ditampilkan.

Kekerabatan lutung Jawa (Trachypithecus auratus) di pusat konservasi lutung Jawa, Kecamatan Dau, Kabupaten Malang, berdasarkan sekuen gen cytochrome B / Miftahul Mushlih

 

Kata Kunci: Kekerabatan, Lutung Jawa (T. auratus), Gen Cytochrome-b, Pusat Konservasi Lutung Jawa. Lutung Jawa (Trachypithecus auratus) merupakan salah satu spesies endemik Indonesia yang keberadaannnya dinyatakan rentan (vurnerable) terhadap kepunahan oleh International Union for Conservation of Nature and Natural Resources (IUCN). Di Pusat Konservasi Lutung Jawa, Kecamatan Dau, Kabupaten Malang, diduga ada dua subspesies yaitu Trachypithecus auratus auratus (bernama Rus) dan Trachypithecus auratus mauritius (Bernama Ijem). Identifikasi kekerabatan Lutung Jawa yang selama ini dilakukan di Pusat Konservasi Lutung Jawa terbatas pada pengamatan morfologi dan daerah asalnya saja, sehingga menghasilkan informasi yang terbatas. Analisis menggunakan DNA dianggap mampu menghasilkan informasi yang lebih akurat. Identifikasi kekerabatan Lutung Jawa diperlukan untuk memetakan kelompok Lutung Jawa sebelum dikembalikan kehabitat asalnya. Dari hasil Polymerase Chain Reaction (PCR) menggunakan primer Forward hasil modifikasi dari (Wangchuk, 2005), 5’-CTTCC ATGAGGACAAATATC-3’ dan Primer Reverse Rmuc1, 5’-GTGGAGTATAGGT ATGATTGC-3’ diperoleh sekuen gen cyt-b sepanjang 500 bp pada Rus dan 501 bp pada Ijem. Hasil analisis topologi filogenetik dengan metode Maximum-likelihood (ML) dan pairwise distance dengan menggunakan software MEGA5 menunjukkan bahwa Rus dan Ijem berkerabat sangat dekat dan merupakan satu jenis T. a. auratus. Nilai pairwise distance kedua sampel 0,4% ± 0,0027. Topologi pohon filogenetik menggunakan metode ML menunjukkan kedua sampel berkerabat dekat dengan T. a. auratus haplotype aaJ ǀEF465117.1ǀ, T. a. auratus haplotype aaG ǀEF465115.1ǀ, dan T. a. auratus haplotype aaB ǀEF465110.1ǀ, serta berada dalam satu kelompok dengan anggota T. auratus lainnya.Kata Kunci: Kekerabatan, Lutung Jawa (T. auratus), Gen Cytochrome-b, Pusat Konservasi Lutung Jawa. Lutung Jawa (Trachypithecus auratus) merupakan salah satu spesies endemik Indonesia yang keberadaannnya dinyatakan rentan (vurnerable) terhadap kepunahan oleh International Union for Conservation of Nature and Natural Resources (IUCN). Di Pusat Konservasi Lutung Jawa, Kecamatan Dau, Kabupaten Malang, diduga ada dua subspesies yaitu Trachypithecus auratus auratus (bernama Rus) dan Trachypithecus auratus mauritius (Bernama Ijem). Identifikasi kekerabatan Lutung Jawa yang selama ini dilakukan di Pusat Konservasi Lutung Jawa terbatas pada pengamatan morfologi dan daerah asalnya saja, sehingga menghasilkan informasi yang terbatas. Analisis menggunakan DNA dianggap mampu menghasilkan informasi yang lebih akurat. Identifikasi kekerabatan Lutung Jawa diperlukan untuk memetakan kelompok Lutung Jawa sebelum dikembalikan kehabitat asalnya. Dari hasil Polymerase Chain Reaction (PCR) menggunakan primer Forward hasil modifikasi dari (Wangchuk, 2005), 5’-CTTCC ATGAGGACAAATATC-3’ dan Primer Reverse Rmuc1, 5’-GTGGAGTATAGGT ATGATTGC-3’ diperoleh sekuen gen cyt-b sepanjang 500 bp pada Rus dan 501 bp pada Ijem. Hasil analisis topologi filogenetik dengan metode Maximum-likelihood (ML) dan pairwise distance dengan menggunakan software MEGA5 menunjukkan bahwa Rus dan Ijem berkerabat sangat dekat dan merupakan satu jenis T. a. auratus. Nilai pairwise distance kedua sampel 0,4% ± 0,0027. Topologi pohon filogenetik menggunakan metode ML menunjukkan kedua sampel berkerabat dekat dengan T. a. auratus haplotype aaJ ǀEF465117.1ǀ, T. a. auratus haplotype aaG ǀEF465115.1ǀ, dan T. a. auratus haplotype aaB ǀEF465110.1ǀ, serta berada dalam satu kelompok dengan anggota T. auratus lainnya.

Penerapan pembelajaran kooperatif dengan teknik diagram roundhouse melalui diskusi panel untuk meningkatkan motivasi dan hasil belajar siswa pada materi ekosistem kelas X SMA Negeri 9 Malang / Arga Triyandana

 

Kata kunci: diagram Roundhouse, diskusi panel, motivasi belajar, hasil belajar Berdasarkan hasil observasi yang dilakukan di SMA Negeri 9 Malang, diketahui bahwa siswa kelas X4 memiliki motivasi belajar yang rendah. Motivasi belajar terdiri atas perhatian, irama perasaan, eksistensi, usaha, penampilan, dan waktu belajar. Rendahnya motivasi belajar siswa kelas X4 SMA Negeri 9 Malang tersebut dibuktikan dengan sering terlambatnya siswa dalam mengumpulkan tugas, umumya siswa mengandalkan Lembar Kerja Siswa yang diberikan oleh guru, beberapa siswa hanya mengandalkan hasil kerja siswa yang rajin, siswa sering ramai dan bercanda di dalam kelas ketika proses pembelajaran. Motivasi belajar yang rendah menyebabkan hasil belajar siswa rendah. Berdasarkan hasil wawancara dengan guru biologi siswa kelas X4 sampai dengan X 7 di SMA Negeri 9 Malang, dapat diketahui bahwa siswa kelas X4 memiliki hasil belajar biologi yang paling rendah di antara siswa kelas X. Upaya mengatasi rendahnya motivasi belajar belum pernah dilakukan oleh guru terhadap siswa kelas X4, khususnya guru biologi. Berdasarkan permasalahan yang telah dijabarkan tersebut, dilakukan penerapan pembelajaran inovatif yaitu pembelajaran kooperatif dengan teknik Diagram Roundhouse melalui Diskusi Panel. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang terdiri atas dua siklus, masing-masing siklus terdiri dari empat tahap, yaitu tahap Perencanaan, Tindakan, Observasi, dan Refleksi. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif kuantitatif. Subyek penelitian ini adalah siswa kelas X4 SMA Negeri 9 Malang, Tahun ajaran 2010/2011 berjumlah 35 orang siswa, yang terdiri atas 14 orang siswa laki-laki dan 21 orang siswa perempuan. Penelitian ini dilaksanakan pada semester genap tahun ajaran 2010/2011 mulai bulan Mei sampai dengan Juni 2011 di SMA Negeri 9 Malang. Pelaksanaan tindakan dilakukan pada bulan Mei 2011, dengan materi Ekosistem. Instrumen penelitian yang digunakan dalam penelitian ini adalah lembar keterlaksanaan sintaks pembelajaran, lembar catatan lapangan, lembar observasi motivasi belajar siswa, tes tulis hasil belajar kognitif, lembar penilaian Diagram Roundhouse secara kelompok, angket hasil belajar afektif, dan lembar penilaian hasil belajar psikomotor. Hasil penelitian ini menunjukkan bahwa penerapan pembelajaran kooperatif dengan teknik Diagram Roundhouse melalui Diskusi Panel dapat meningkatkan motivasi dan hasil belajar siswa. Pada Siklus I, ketuntasan klasikal motivasi belajar siswa adalah 65,70%, sedangkan pada Siklus II mengalami peningkatan menjadi 71,40%. Hasil analisis data penelitian mengenai hasil belajar kognitif siswa menunjukkan bahwa ketuntasan klasikal yang dicapai siswa pada Siklus I adalah 65,70%, dan pada Siklus II adalah 65,70%. Hasil analisis data ii penelitian mengenai hasil belajar afektif siswa menunjukkan bahwa ketuntasan klasikal yang dicapai siswa pada Siklus I adalah 34,30%, sedangkan pada Siklus II adalah 57,1%. Berdasarkan hasil analisis data penelitian mengenai hasil belajar psikomotor siswa, diketahui bahwa ketuntasan klasikal yang dicapai siswa pada Siklus I adalah 62,9%, sedangkan pada Siklus II adalah 100%. Berdasarkan hasil penelitian maka dapat disimpulkan bahwa penerapan pembelajaran kooperatif dengan teknik Diagram Roundhouse melalui Diskusi Panel dapat meningkatkan motivasi dan hasil belajar siswa kelas X4 SMA Negeri 9 Malang.

Pembiayaan program paket C di PKBM Tambo Kecamatan Pasirian Kabupaten Lumajang / Dedy Widiyanto

 

Kata Kunci: Pembiayaan, Paket C, PKBM, Komponen pembiayaan ini perlu dikelola sebaik-baiknya agar dana yang ada dapat dimanfaatkan secara optimal untuk menunjang tercapainya tujuan pendidikan. adalah sangat penting bagi PKBM untuk mencari dan memanfaatkan berbagai sumber dana sesuai dengan keperluan masing-masing program, karena pada umumnya dunia pendidikan selalu dihadapkan pada masalah keterbatasan dana. Dalam konteks penelitian tentang pembiayaan program pendidikan ini, peneliti akan mengkhususkan diri pada lembaga pendidikan masyarakat, yaitu, PKBM Tambo yang berada di Jalan Tegir No 5. RT 5 RW 5 Dusun Kebonan Desa Pasirian, Kecamatan Pasirian, Kabupaten Lumajang, Propinsi Jawa Timur. Hal yang melandasi peneliti melakukan penelitian di PKBM Tambo adalah dikarenakan PKBM Tambo merupakan Lembaga Masyarakat yang tergolong lembaga yang baru berdiri. PKBM Tambo berdiri pada tahun2006. Dari Hasil Peneltian ditemukan bahwa: 1) Pusat Kegiatan Belajar Masyarakat (PKBM) Tambo didirikan di Kecamatan Pasirian Kabupaten Lumajang, bertujuan untuk mengelola potensi pendidikan. 2) Program Paket C yang dikelola PKBM Tambo berasal dari Swadana yang berasal dari pemerintah desa dan Bantuan Operasional Penyelenggaraan (BOP) yang berasal dari mitra Kerja LPM UM dan Dinas Pendidikan. 3) Strategi penjaringan yang paling utama adalah menghimpun informasi mengenai calon pendonor terhadap program yang terkait dengan visi misi PKBM. 4) Komponen kepembiayaan program paket C PKBM Tambo terdiri dari: (1) Bahan. (2) Alat. (3) Tenaga. Dari Penelitian ini, ada beberapa saran yang dapat dijadikan masukan, antara lain : 1) Bagi Jurusan Pendidikan Luar Sekolah adanya tambahan informasi melalui kuliah atau seminar yang membahas tentang pembiayaan Lembaga Satuan Pendidikan Luar Sekolah yaitu Pusat Kegiatan Belajar Masyarakat dan mensosialisasikan pengembangan Pusat Kegiatan Belajar Masyarakat secara mandiri dalam menyelengarakan lembaga satuan Pendidikan Luar Sekolah. 2) Bagi Pusat Kegiatan Belajar Masyarakat (PKBM). Hendaknya Pusat Kegiatan Belajar Masyarakat (PKBM) Tambo bisa membantu PKBM di kecamatan lain untuk memberikan informasi terkait tentang sistem pelaksanaan program sesuai dengan prosedur yang dianjurkan oleh pemerintah. 3) Bagi Peneliti lain. Diharapkan bagi peneliti lain untuk dapat mengembangkan penelitian ini dengan metode serta fokus yang lain, sehingga dapat secara berkelanjutan berpartisipasi aktif dalam program-program Pendidikan Luar Sekolah. 4) Bagi Pemerintah Daerah. Diharapkan lebih berperan aktif dalam mendukung dan menjebatani program-program Pendidikan Luar Sekolah yang diselenggarakan oleh PKBM Tambo untuk kepentingan pemberdayaan masyarakat setempat.

Pengaruh varietas, kondisi, bentuk, dan waktu tunda giling tebu terhadap kualitas tebu giling / Fawait Afnani

 

Kata kunci: varietas tebu, kondisi tebu, bentuk tebu, waktu tunda giling, kualitas tebu. Tebu giling merupakan tebu yang siap atau segera digiling lalu diperas menjadi nira. Jika tebu giling dikenakan suatu perlakuan maka akan menimbulkan suatu pengaruh terhadap kualitas maupun kuantitas nira yang akan diproses menjadi gula. Nira tebu yang mengandung sukrosa diperoleh dari tebu yang diperah oleh unit penggilingan setelah melalui proses yang ada didalam unit pencacah tebu. Pada proses pembuatan gula, mutu nira harus diperhatikan agar diperoleh kualitas gula yang baik. Hal ini harus didukung oleh pemilihan varietas yang unggul untuk penyesuaian terhadap iklim, kesuburan tanah, dan topografi. Varietas tebu (PS 864, PSJT 941, dan PS 862) adalah varietas yang sering digunakan untuk pulau Jawa khususnya Jawa Timur. Dengan berkembangnya metode pemanenan tebu secara mekanis yang disertai dengan pembakaran tebu, tebu dipotong-potong dan waktu tunda penggilingan yang lama akan membentuk polisakarida antara lain dekstran yang diikuti dengan naiknya vikositas dan perubahan bentuk hablur sehingga menyulitkan pengelolahan dan analisis. Tujuan penelitian ini adalah untuk mengetahui pengaruh (1) varietas tebu (PS 864, PSJT 941, dan PS 862) terhadap kualitas tebu giling, (2) kondisi tebu (hijau dan dibakar) terhadap kualitas tebu giling, (3) bentuk tebu (lonjoran dan potongan) terhadap kualitas tebu giling, (4) waktu tunda giling (0, 5, dan 12 hari) terhadap kualitas tebu giling, (5) interaksi antar perlakuan (varietas tebu, kondisi tebu, bentuk tebu, waktu tunda giling) terhadap parameter (susut berat tebu, KNPP, brix, pol, sukrosa, gula reduksi, dan dekstran). Penelitian ini dilakukan di laboratorium Pusat Penelitian Perkebunan Gula Indonesia (P3GI) Pasuruan. Desain penelitian adalah eksperimental laboratories, dimana variabel bebas dalam penelitian ini adalah varietas tebu, kondisi tebu, bentuk tebu dan waktu tunda giling. Sedangkan variabel terikat yaitu (susut berat tebu, KNPP, brix, pol, sukrosa, gula reduksi, dan dekstran). Hasil penelitian menunjukkan bahwa (1) varietas PSJT 941 paling tahan terhadap susut berat dan kenaikan kadar dekstran, sedangkan PS 862 mempunyai KNPP, % brix, pol (% brix), sukrosa (% brix), dan gula reduksi (% brix) paling tinggi, (2) tebu bakar mengalami penurunan kualitas dibandingkan tebu hijau. Tebu bakar mengalami penurunan KNPP, % brix, pol (% brix), sukrosa (% brix), gula reduksi (% brix), dan dekstran (% brix), (3) tebu yang dipotong-potong mengalami penurunan susut berat tebu, KNPP, % brix, gula reduksi (% brix), tetapi mengalami kenaikan untuk pol (% brix), sukrosa (% brix), dan dekstran (% brix) dibanding tebu yang tidak dipotong (lonjoran), (4) semakin lama waktu tunda, maka tebu akan mengalami penurunan berat, KNPP, % brix, pol (% brix), sukrosa (% brix), dekstran (% brix), tetapi gula reduksi (% brix) yang semakin tinggi, (5) susut berat tebu dan dekstran (% brix) dipengaruhi oleh interaksi antara kondisi dan waktu tunda giling, kadar KNPP dipengaruhi oleh interaksi antara kondisi dan waktu tunda giling serta juga dipengaruhi oleh interaksi antara bentuk tebu dan waktu tunda giling, % brix, pol (% brix), dan sukrosa (% brix) dipengaruhi oleh interaksi antara kondisi dan varietas tebu. Kadar gula reduksi (% brix) dipengaruhi oleh interaksi antara kondisi dan varietas tebu serta juga interaksi antara varietas dan waktu tunda giling.

Pengembangan media pembelajaran interaktif materi gymnospermae di kelas X SMA Negeri 1 Jombang / Roisatulainiyah

 

Kata Kunci: Pengembangan Media Pembelajaran, Media Pembelajaran Interaktif, Gymnospermae Proses belajar mengajar hakikatnya adalah proses komunikasi, yaitu proses penyampaian pesan dari saluran/sumber pesan melalui media tertentu kepada penerima pesan. Proses belajar mengajar merupakan tahap terpenting dalam kegiatan pembelajaran untuk mencapai tujuan pembelajaran yang telah ditentukan. Kegiatan pembelajaran harus dirancang sedemikian rupa sehingga proses belajar dapat berjalan optimal. Dalam perancangan kegiatan pembelajaran seorang guru perlu menerapkan metode pembelajaran yang tidak terlepas dari media pembelajaran. Pengadaan media pembelajaran dapat dilakukan dengan berbagai cara, misalnya dengan bantuan komputer. Komputer membantu mengoptimalkan kegiatan pembelajaran dengan cara memvisualisasikan objek yang sulit diamati secara langsung. Komputer memiliki kemampuan multimedia, yaitu kemampuan memadukan prinsip audio dan visual secara bersamaan dalam satu sistem. Dengan kemampuan ini komputer dimanfaatkan untuk mengembangkan media pembelajaran interaktif. Berdasarkan hasil wawancara dengan guru biologi kelas X SMA Negeri I Jombang menunjukkan bahwa beberapa materi mata pelajaran biologi sulit untuk disampaikan kepada siswa termasuk materi gymnospermae. Hal ini dikarenakan sulit menemukan tumbuhan yang tergolong gymnospermae karena termasuk tumbuhan langka, proses reproduksinya lama dan sulit diamati secara langsung. Dari uraian diatas pengembang mencoba melakukan penelitian pengembangan dengan tujuan mengembangkan media pembelajaran interaktif materi gymnospermae di kelas X SMA Negeri I Jombang. Penelitian ini tergolong penelitian pengembangan yang dikembangkan dengan model prosedural yang didasarkan pada tahapan pengembangan media pembelajaran oleh Sadiman (2008) dengan langkah-langkah: (1) analisis Kebutuhan dan karakteristik siswa; (2) merumuskan tujuan instruksional dengan operasional dan khas; (3) merumuskan butir-butir materi secara terperinci yang mendukung tercapainya tujuan; (4) mengembangkan alat evaluasi; (5) menulis naskah media; dan (6) mengadakan tes dan revisi. Hasil pengembangan media pembelajaran interaktif ini secara keseluruhan memenuhi kriteria valid dengan prosentase penilaian validator ahli media 97,06%, validator ahli materi 100%, dan hasil uji coba produk 94,55%. Sedangkan berdasarkan analisis data hasil pretes dan postes dengan uji t menunjukkan nilai signifikansi 0.00 < 0.05 yang berarti media interaktif ini efektif digunakan dalam kegiatan pembelajaran. Media pembelajaran interktif ini dapat digunakan oleh siswa untuk belajar secara individual, mampu meningkatkan motivasi dan perhatian siswa, hemat ii waktu, dan sebagai media pembelajaran alternatif ketika kegiatan pembelajaran yang semestinya tidak dapat dilakukan. Tetapi media interaktif ini juga memiliki kekurangan, seperti hanya bisa diterapakan di sekolah yang memiliki laboraturium komputer atau ruang multimedia yang memadai dan memungkinkan siswa tidak melakukan pengamatan terhadap tumbuhan yang tergolong gymnospermae secara langsung (pembelajaran kontekstual yang seharusnya dilakukan). Adapun saran yang diajukan dari pengembangan media interaktif ini adalah hendaknya media ini hanya digunakan sebagai media alternatif ketika kegiatan pembelajaran yang semestinya tidak dapat dilakukan, kegiatan validasi dilakukan kepada lebih dari satu ahli, uji coba produk dapat dilakukan dengan skala yang besar, dapat menggunakan observer, dilakukan sekaligus bersamaan dengan penerapannya dalam kegiatan pembelajaran dipadukan dengan sintak metode pembelajaran tertentu, dan pretes dan postes dalam media pembelajaran interaktif tidak hanya digunakan untuk mengukur efektivitas media tetapi juga digunakan untuk menilai hasil belajar kognitif siswa.

Pengembangan media pembelajaran audiovisual pada pokok bahasan laporan keuangan perusahaan jasa di SMA Negeri 3 Blitar / Bisrul Miftachul Asror

 

Kata kunci: Media pembelajaran, AudioVisual Media ] pembelajaran digunakan untuk meningkatkan pembelajaran dalam kelas. Siswa belajar dengan senang sehingga dapat mengetahui, dan memahami ilmu yang ditransformasikan oleh guru. Penggunaan media yang variatif akan meningkatkan motivasi pembelajaran dan akan meningkatkan hasil pembelajaran siswa. Pokok bahasan laporan keuangan perusahaan jasa merupakan materi yang harus dikuasai siswa baik konsep maupun praktek penyusunan atau sistematika. Materi tersebut dianggap sulit oleh siswa sehingga memerlukan media pendukung untuk mengatasi masalah tersebut. Visi sekolah dan sarana prasarana sekolah yang dapat mendukung dalam pengembangan media sehingga dapat meningkatkan pembelajaran di sekolah. Dengan demikian, pengembangan ini mengangkat judul pengembangan media pembelajaran audiovisual pada pokok bahasan laporan keuangan perusahaan jasa. Adapun tujuan pengembangan 1) untuk menghasilkan bentuk pengembangan media audiovisual yang baik dan menarik untuk mempermudah pembelajaran akuntansi dalam pokok bahasan laporan keuangan di Kelas XI IPS SMAN 3 Blitar, 2) mengetahui proses pembelajaran dengan Media audiovisual pada Pokok Bahasan Laporan Keuangan Perusahaan Jasa di Kelas XI IPS SMAN 3 Blitar, 3) mendiskripsikan hasil belajar siswa XI IPS yang memanfaatkan media audiovisual pada pokok bahasan laporan keuangan di SMAN 3 Jenis penelitian ini merupakan penelitian pengembangan dengan model Dick and Carey. Tahapan yang digunakan meliputi 1) analisis situasi awal, 2) pengembangan rancangan bahan ajar, 3) membuat bahan ajar, 4) uji kelayakan, 5) revisi bahan ajar dan 6) produk akhir. Validasi media audiovisual dilakukan oleh tiga subyek yaitu ahli materi, ahli media dan pengguna (siswa). Hasil validasi oleh ahli materi, Media dan pengguna (siswa) secara keseluruhan memperoleh rata-rata73,86% . Hal ini menunjukkan media audiovisual yang dikembangkan layak digunakan dalam pembelajaran akuntansi. Hasil tersebut juga didukung rata-rata nilai kelas eksperimen lebih besar dari pada kelas kontrol, yakni 90.17 kelas eksperimen dan 82.40 kelas kontrol. Hasil analisis uji T-test independent sample memperoleh nilai 0,000 lebih kecil daripada 0,05. Berdasarkan hasil validasi dan uji T-test independent sample bahwa media audiovisual yang dikembangkan layak digunakan dan dapat meningkatkan hasil belajar siswa. Berdasarkan hasil penelitian ini disarankan kepada guru khususnya,untuk memanfaatkan media audiovisual dalam proses pembelajaran. Sarana dan prasarana di kelas hendaknya memadai untuk menunjang proses pemanfaatan media secara optimal. Lebih jauh, agar dapat dikembangkan media audiovisual pada materi lain dan inovasi baru agar dapat meningkatkan pembelajaran.

Penerapan Realistic Mathematic Education (RME) untuk meningkatkan hasil belajar segitiga dan segiempat siswa kelas VII MTs. Surya Buana Malang / Benny Banyu Nan Nirmala

 

Kata kunci: Realistic Mathematics Education (RME), Segitiga dan Segiempat, Hasil Belajar Berdasarkan hasil observasi awal yang dilakukan di MTs. Surya Buana Malang, diketahui bahwa siswa kelas VII B cenderung kesulitan dalam memahami materi segitiga dan segiempat, hal ini ditunjukkan dengan adanya fakta yaitu rata-rata ujian matematika siswa pada tahun sebelumnya yang rendah yaitu 69,85 dan presentase ketuntasan belajar klasikal hanya mencapai 55,44%. Lebih lanjut diperoleh informasi bahwa pembelajaran yang dilakukan di kelas masih berpusat pada guru, sehingga siswa cepat merasa bosan dan kurang antusias saat mengikuti pembelajaran, bahkan siswa lebih fokus menghafalkan rumus secara instan daripada proses pembelajaran itu sendiri. Memahami adanya masalah tersebut, perlu kiranya dilakukan perubahan dalam pelaksanaan pembelajaran sehingga siswa lebih aktif dan senang dalam belajar serta tidak hanya memahami materi sebatas rumus yang tertulis di buku teks saja, dalam hal ini peneliti menerapkan Realistic Mathematics Education (RME). RME merupakan suatu pendekatan yang memfasilitasi siswa dengan kegiatan-kegiatan yang mengarahkan siswa untuk menemukan ide matematika melalui permasalahan sehari-hari. Tujuan penelitian yang dilakukan adalah mendeskripsikan pendekatan pembelajaran Realistic Mathematic Education untuk meningkatkan hasil belajar segitiga dan segiempat siswa kelas VII MTs. Surya Buana Malang. Penelitian dilaksanakan pada tanggal 11 April 2011 hingga 19 April 2011 dengan subyek penelitian adalah kelas siswa kelas VII B MTs. Surya Buana Malang. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK) Penerapan RME pada pembelajaran bangun ruang prisma dan limas dilaksanakan dalam dua siklus. Siklus I terdiri dari 3 pertemuan dan dilakukan pembelajaran luas permukaan prisma dan limas. Setelah dilakukan refleksi dari pembelajaran pada Siklus I, dilaksanakan Siklus II (2 pertemuan) dengan materi yaitu segitiga dan segiempat. Hasil penelitian menunjukkan bahwa pembelajaran segitiga dan segiempat menggunakan RME telah dapat meningkatkan hasil belajar siswa. Hal ini ditunjukkan oleh rata-rata nilai tes dan ketuntasan klasikal pada siklus II yaitu berturut-turut adalah 81,13 dan 90,32%. Respon siswa terhadap pembelajaran segitiga dan segiempat menggunakan RME adalah positif. Siswa senang dan antusias dalam belajar. Saran yang dapat diberikan adalah RME layak dipertimbangkan untuk diterapkan pada pembelajaran matematika di sekolah dan dalam pelaksanaannya hendaknya guru/peneliti memperhatikan pengelolaan waktu.

Kontribusi objek wisata air merambat Roro Kuning terhadap kondisi sosial ekonomi masyarakat Desa Bajulan Kecamatan Loceret Kabupaten Nganjuk / Gandar Listya Tristiana

 

Kata Kunci: konstribusi, kondisi sosial, kondisi ekonomi. Pengembangan objek wisata di Kabupaten Nganjuk hingga kini dilaksanakan secara terpadu, menyeluruh dan berkesinambungan. Salah satu objek wisata yang sedang dikembangkan yaitu objek wisata Air Merambat Roro Kuning, masyarakat sekitar objek wisata Air Merambat Roro Kuning mempunyai pekerjaan sebagai petani. Tingkat penghasilan masyarakat sekitar tergolong rendah, hal ini disebabkan masyarakat sekitar mayoritas hanay bekerja pada sektor pertanian, sebagian besar lahan yang ada di Desa Bajulan digunakan sebagai lahan pertanian. Dengan dikembangkannya objek wisata Air Merambat Roro Kuning dapat membuka peluang kerja dan usaha masyarakat sekitar sehingga dapat memberi konstribusi sosial ekonomi masyarakat Desa Bajulan Kecamatan Loceret. Penelitian ini bertujuan untuk 1) Mendiskripsikan konstribusi objek wisata Air Merambat Roro Kuning terhadap kondisi sosial masyarakat Desa Bajulan Kecamatan Loceret. 2) Mendiskripsikan konstribusi objek wisata Air Merambat Roro Kuning terhadap kondisi ekonomi masyarakat Desa Bajulan Kecamtan Loceret. Metode penelitian yang digunakan yaitu metode survei. Populasi dalam penelitian ini adalah seluruh kepala keluarga yang terkait langsungdengan objek wisata Air Merambat Roro Kuning. Teknik penganbilan data dengan menggunakan pedoman wawancara. Analisis data yang digunakan dalam penelitian ini adalah analisis data statistik deskriptif dengan menggunakan tabel persentase. Hasil penelitian menunjukkan 1) Masyarakat Desa Bajulan yang tamat SD sebanyak 32,5%, tisak tamat SD 8,1%, tamat SMP 23%, tidak tamat SMP 2,7%, tamat SMA 27%, tidak tamat SMA 6,2%, 2) Objek wisata Air Merambat Roro Kuning dapat membuka lapangan pekerjaan baru sebagai pedagang, tukang ojek, tukang parkir, keamanan, dan penjaga kolam renang dengan penghasilan tambahan Rp. 250.000 sampai Rp. 1.050.000. Bersadarkan hasil penelitian ini diharapkan Besa Bajulan membentuk pengelolah wisata tingkat desa untuk berkerjasama dengan Dinas Pariwisata dan Kebudayaan Kabupaten Nganjuk mengadakan sosialisasi kepada pengelolah dan masyarakat tentang mengelolah, cara berinteraksi, dan mempromosikan dengan harapan dapat mengembangkan objek wisata Air Merambat Roro Kuning untuk meningkatkan pendapatan masyarakat dan desa.

Analisis perbedaan tingkat kesehatan bank sebelum dan sesudah merger dengan metode Camel / Niken Wulandari

 

Kata Kunci : Tingkat Kesehatan, Merger, CAMELS Lembaga perbankan masih memegang peranan penting dalam suatu sistem perekonomian negara. Namun krisis ekonomi yang melanda indonesia pada tahun 1990 an membuat banyak bank-bank menjadi tidak sehat. Pemerintah mengambil kebijakan restrukturisasi dengan cara penggabungan bank atau sering disebut dengan istilah merger bank. Diharapkan dengan adanya merger bank-bank hasil penggabungan akan lebih sehat. Kesehatan bank diukur dengan peraturan yang sesuai dengan Bank Indonesia meliputi penilaian terhadap kecukupan modal, kualitas aset, manajemen bank, rentabilitas, likuiditas dan resiko pasar, atau yang dikenal dengan istilah analisis CAMELS. Subyek penelitian ini, adalah bank-bank yang melakukan merger. Jenis penelitian ini adalah event study dengan menggunakan metode purposive sampling, terdapat 5 bank sebagai sampel. Periode penelitian selama 4 tahun sebelum dan sesudah merger. pengujian hipotesis dilakukan dengan menggunakan uji normalitas data dan teknik pengujian statistik non parametrik dengan menggunakan Wilcoxon Rank Test. Dari hasil penelitian ini terbukti bahwa (1) Dalam permodalan bank sebelum dan sesudah merger tidak menampakkan perbedaan yang signifikan. (2) Dalam kualitas aset bank sebelum dan sesudah merger tidak menampakkan perbedaan yang signifikan. (3) Dalam manajemen bank sebelum dan sesudah merger tidak berbeda secara signifikan. (4) Dalam rentabilitas bank sebelum dan sesudah merger tidak jauh berbeda secara signifikan. (5) Dalam likuiditas bank sebelum dan sesudah merger tidak menampakkan perbedaan yang signifikan. (6) Dalam kesehatan bank sebelum dan sesudah merger tidak menampakkan perbedaan yang signifikan. Dalam penelitian ini dapat disarankan bagi pemerintah agar diperhatikan bank yang akan diperhatikan bank yang akan dimerger,kepada bank yang sudah dimerger agar dapat mengoptimalkan aset yang telah dihasilkan, dan bagi pihak investor agar menganalisis dengan menggunakan metode CAMELS

Hubungan antara status sosial ekonomi orang tua dengan pengembangan kecerdasan spiritual anak di PAUD Restu Bunda Lawang Kabupaten Malang / Kristina Yuliani

 

Kata Kunci: Status Sosial Ekonomi, Kecerdasan Spiritual Kualitas kehidupan bangsa ditentukan oleh faktor pendidikan, karena melalui pendidikan tercipta sumber daya manusia yang cerdas, kreatif, beriman, dan memiliki daya saing tinggi. Untuk meningkatkan sistem pendidikan nasional, pemerintah telah melakukan banyak usaha, antara lain peningkatan mutu pendidikan formal, nonformal, dan informal. Dampak dari upaya pengembangan sistem pendidikan nasional itu telah dirasakan baik secara kuantitatif maupun kualitatif, namun disisi lain masih terdapat permasalahan antara lain menyangkut pemerataan, relevansi, efisiensi dan kualitas pendidikan yang memerlukan solusi pemecahan. untuk membentuk calon generasi penerus bangsa yang berkualitas, maka cara pembinaan pada anak usia dini harus ditempuh melalui multi cara yaitu pembinaan di sekolah, di rumah, dan lingkungan masyarakat. Salah satu pembinaan anak usia dini adalah dirumah dan aspek ini tidak akan lepas dari peranan orang tua. Orang tua dapat melakukan melakukan pembinaan dari kebiasaan anak beribadah secara berjamaah, tata karma dengan orang yang lebih tua, sopan santun, dan cara beretika yang baik. Tujuan penelitian ini adalah: (1) hubungan antara tingkat pendidikan orang tua dengan spiritual keagamaan anak, (2) hubungan antara tingkat pendidikan orang tua dengan sosial keagamaan anak, (3) hubungan antara tingkat pendidikan orang tua dengan etika sosial anak, (4) hubungan antara jenis pekerjaan orang tua dengan spiritual keagamaan anak, (5) hubungan antara jenis pekerjaan orang tua dengan sosial keagamaan anak, (6) hubungan antara jenis pekerjaan orang tua dengan etika sosial anak, (7) hubungan antara jumlah penghasilan orang tua dengan spiritual keagamaan anak, (8) hubungan antara jumlah penghasilan orang tua dengan sosial keagamaan anak, (9) hubungan antara jumlah penghasilan orang tua dengan etika sosial anak. Rancangan penelitian yang digunakan dalam penelitian ini adalah korelasional. Populasi dalam penelitian ini adalah sebanyak 30 responden. Hasil penelitian ini adah (1) terdapat hubungan yang signifikan antara tingkat pendidikan orang tua dengan spiritual keagamaan anak usia dini dengan r hitung 0.610 (2) terdapat hubungan yang signifikan antara Tingkat pendidikan orang tua dengan sosial keagamaan pada anak usia dini dengan r hitung = 0.527, (3) Terdapat hubungan yang signifikan antara Tingkat pendidikan orang tua dengan etika sosial pada kecerdasan spiritual anak usia dini r hitung = 0.638, (4) jenis pekerjaan orang tua dengan spiritual keagamaan anak usia dini terdapat hubungan yang signifikan dengan t empirik= 23,38 (5) jenis pekerjaan orang tua dengan sosial keagamaan anak usia dini terdapat hubungan yang signifikan dengan t empirik 43,065 (6) jenis pekerjaan orang tua dengan etika sosial anak usia dini terdapat hubungan yang signifikan dengan t empirik 35,179 (7) Terdapat hubungan yang signifikan antara jumlah penghasilan orang tua dengan spiritual keagamaan anak usia dini dengan r hitung = 0.582 (8) Terdapat hubungan yang signifikan antara penghasilan orang tua dengan sosial keagamaan anak usia dini dengan r hitung = 0.524 (9) Terdapat hubungan yang signifikan antara penghasilan orang tua dengan etika sosial anak usia dini r hitung = 0.551. Berdasarkan hasil penelitian ini, saran yang peneliti ajukan adalah: (1) Diharapkan orang tua lebih memperhatikan pengembangan kecerdasan spiritual anak. Tidak ada kemungkinan orang tua yang status sosial ekonomi tinggi keserdasan spiritual anak tinggi pula. Atau orang tua yang status sosialnya rendah kecerdasan spiritual anak bias tinggi pula. Semua itu bisa terjadi karena faktor lingkungan juga, (2) Lingkungan sekolah sangatlah mempengaruhi semua itu dilihat dari segi pembelajaran, tutor. Dan media belajar. Oleh sebab itu diharapkan lembaga dapat memberikan fasilitas yang bagus, seperti menyediakan media yang lengkap untuk memenuhi kebutuhan belajar, standar tutor yang setara dengan ahli dibidang PAUD, serta memberikan situasi pembelajaran yang nyaman, aman, serta tidak membuat anak bosan atau jenuh, (3). Hal ini diharapkan dapat meningkatkan mutu PAUD salah satunya mengoreksi, memperkaya, bahkan memperkuat teori tentang status sosial ekonomi dengan kecerdasan spiritual yang ada pada lingkungan masyarakat, (4) Diharapkan peneliti selanjutnya untuk melengkapi kekurangan yang ada untuk mengembangkan ilmu tentang Pendidikan Anak Usia Dini khususnya tentang pengembangan kecerdasan spritual anak usia dinisegi status sosial orang tua dan dapat digunakan untuk penelitia-penelitian lanjutan.

Pengaruh kepuasan kerja dan motivasi karyawan terhadap kinerja karyawan (studi kasus pada karyawan Bagian Produksi PR. Djagung Padi) / Ratih Febrianti

 

Kata kunci : kepuasan kerja, motivasi, kinerja. Kepuasan kerja merupakan salah satu faktor yang sangat penting untuk mendapat hasil kerja yang optimal. Ketika seseorang merasakan kepuasan dalam bekerja tentunya ia akan berupaya semaksimal mungkin dengan segenap kemampuan yang dimilikinya untuk menyelesaikan tugas yang dibebankan kepadanya. Motivasi yang ada pada setiap karyawan tidaklah sama, berbeda-beda antara yang satu dengan yang lain. Untuk itu, diperlukan pengetahuan mengenai pengertian dan hakikat motivasi, serta kemampuan teknik menciptakan situasi sehingga menimbulkan motivasi/dorongan bagi mereka untuk berbuat atau berperilaku sesuai dengan apa yang dikehendaki oleh karyawan dalam organisasi. Kinerja karyawan yang prima secara langsung akan meningkatkan kinerja perusahaan dalam menghasilkan produk rokok yang berkualitas. Penelitian ini bertujuan untuk mengetahui kondisi kepuasan kerja dan motivasi kerja karyawan kinerja karyawan di PR. Djagung Padi, mengetahui kepuasan kerja dan motivasi kerja karyawan berpengaruh secara parsial terhadap kinerja karyawan di PR. Djagung Padi, mengetahui kepuasan kerja dan motivasi kerja berpengaruh secara simultan terhadap kinerja karyawan di PR. Djagung Padi, dan mengetahui variabel manakah yang berpengaruh dominan terhadap kinerja karyawan di PR. Djagung Padi. Penelitian ini penelitian eksplanasi, karena bermaksud untuk menjelaskan kedudukan variabel-variabel yang diteliti serta hubungan antara satu variabel dengan variabel yang lain. Dalam penelitian ini populasinya adalah pada seluruh karyawan bagian produksi di PR. Jagung Padi yang berjumlah 180 karyawan, sedangkan sampelnya berjumlah 64 orang. Pengukuran variabel menggunakan skala likert. Teknik analisis yang digunakan yaitu analisis regresi berganda, uji F dan uji t. Berdasarkan hasil analisis menunjukkan bahwa kondisi deskripsi kepuasan kerja karyawan tergolong dalam kriteria puas, kondisi deskripsi motivasi kerja tergolong dalam kategori cukup tinggi, dan kondisi deskripsi kinerja karyawan tergolong dalam kategori tinggi. Ada pengaruh kepuasan kerja dan motivasi kerja terhadap kinerja karyawan secara parsial dan signifikan. Ada pengaruh kepuasan kerja dan motivasi kerja terhadap kinerja karyawan secara simultan dan signifikan. Berdasarkan hasil analisis regresi linier berganda kepuasan kerja merupakan variabel yang paling dominan mempengaruhi kinerja karyawan. Guna lebih meningkatkan kinerja karyawan, sebaiknya pimpinan PR. Djagung Padi tetap memotivasi karyawan, karena terbukti bahwa dengan motivasi kerja berpengaruh signifikan terhadap kinerja karyawan, hal ini diharapkan agar motivasi kerja dan kinerjanya tinggi, serta sebaiknya perusahaan tetap mempertahankan dan meningkatkan motivasi yang sudah baik agar kinerja karyawan dapat meningkat. Selain itu untuk lebih meningkatkan kinerja dan kepuasan dari para karyawan hendaknya pimpinan perusahaan memperhatikan apa yang menjadi penyebab kepuasan dan kinerja karyawan menurun, kemudian mencari solusi terbaik untuk kelancaran kerja dari para karyawan.

Efektivitas pelatihan self-management untuk meningkatkan motivasi berprestasi siswa SMP / Nurul Qomariyah

 

Kata kunci: Self-Management, Motivasi berprestasi Motivasi berprestasi merupakan salah satu kondisi psikologis yang positif. Oleh karena itu, perlu diperhatikan oleh setiap individu termasuk para siswa di sekolah. Proses belajar siswa yang dilandasi motivasi berprestasi yang rendah kurang menunjukkan hasil yang maksimal bagi siswa itu sendiri, Namun jika dilakukan berdasarkan motivasi berprestasi yang tinggi, maka siswa akan memperoleh hasil belajar yang maksimal atau menggembirakan. Berkaitan dengan hal motivasi berprestasi, terdapat salah satu kondisi internal siswa yang dipandang berpengaruh terhadap tinggi-rendahnya motivasi berprestasi siswa yakni faktor self-management. self-management merupakan kemampuan individu mengelola diri untuk memenuhi harapan, keinginan dan kebutuhannya. Siswa diharapkan mampu mengelola diri agar dapat memiliki “motivasi berpretasi” yang tinggi dalam proses belajarnya. Berkaitan dengan hal ini, konselor dapat berperan memfasilitasi siswa agar dapat memilki motivasi berprestasi yang tinggi. Upaya peningkatan motivasi berprestasi para siswa dapat dilakukan antara lain melalui penerapan self-management. Dalam penelitian ini, self-management merupakan salah satu faktor internal siswa yang dapat meningkatkan motivasi berprestasi siswa. Permasalahan penelitian ini yaitu apakah self-management efektif meningkatkan motivasi berprestasi siswa di sekolah? Penelitian ini dilakukan berdasar pada hipotesis bahwa “motivasi berprestasi siswa ‘tinggi’ atau meningkat disebabkan oleh faktor Self-Management”. Variabel penelitian ini terdiri atas variabel bebas (X): Self-Management, terdiri dari tiga sub variabel meliputi: (a) Self-Monitoring atau pencatan diri secara rutin, (b) Self-Instruction atau mengarahkan diri sendiri, (c) Self-Reinforcement atau memberi reward pada diri sendiri; dan variabel terikat (Y): Motivasi Berprestasi, terdiri atas tiga sub variabel yakni (a) konsentrasi (b) Kerja keras dalam belajar dan (c) Menyukai Tantangan. Pengujian efektivitas Self-Management terhadap peningkatan Motivasi Berprestasi siswa, berdasar pada rancangan penelitian eksperimen kasus tunggal atau Single Subject Design, model A-B. Hal ini berarti terdapat dua kondisi atau fase penelitian yakni fase atau kondisi ”A” baseline (tanpa perlakuan) dan fase “B” treatment (ada perlakuan). Observasi yang dilakukan pada fase “A” atau baseline selama tiga sesi menunjukkan adanya “motivasi berprestasi” yang rendah. Hal ini terlihat pada indikator rendah atau kurang pada unsur konsentrasi, kerja keras dan menyukai tantangan. Berdasarkan kondisi tersebut diberikan treatment berupa penerapan Self-Mangement dengan tujuan membantu siswa untuk meningkatkan motivasi berprestasi dalam proses belajarnya di sekolah. Penerapan Self-Management berupa memfasiltasi siswa agar dapat melakukan pencatatan diri secara rutin (Self-Monitoring), mengarahkan diri (Self-Instruction) serta memberi reward pada diri sendiri (Self-Reinforcement) secara tepat dan benar. Treatment berupa penerapan Self-Management dilakukan selama 9 (Sembilan) sesi.

Perbedaan hasil belajar model jigsaw dan grup investigasi dengan model konvensional (studi pada mata pelajaran ekonomi siswa kelas IX SMP Negeri 2 Kademangan Blitar) / Roberto Fajar Gita Arisandi

 

Kata kunci: metode pembelajaran, teknik jigsaw, grup investigasi, konvensional. Pembelajaran konstruktivis adalah suatu pembelajaran yang terdiri atas tahap pendahuluan, tahap aktivitas dan tahap konsolidasi. Pembelajaran kooperatif adalah salah satu bentuk pembelajaran yang berdasarkan faham konstruktivis. Metode Jigsaw dan Grup Investigasi merupakan beberapa model dari pembelajaran kooperatif. Metode ceramah atau konvensional merupakan suatu cara untuk menyampaikan idea tau memberikan informasi dengan berbicara. Penelitian bertujuan mengetahui perbedaan hasil belajar model Jigsaw dan Grup Investigasi dengan model Konvensional. Penelitian bersifat eksperimental yang dilakukan di SMP Negeri 2 Kademangan Blitar. Pemberlakuan pembelajaran dilakukan pada tiga kelas yang berbeda untuk mengetahui sejauh mana perbedaan hasil belajar akibat dari pembedaan metode pembelajaran. Kelas IX A diberikan treatment metode teknik Jigsaw, kelas IX B diberikan treatment metode Grup Investigasi dan kelas IX C diberikan metode pembelajaran Konvensional yakni ceramah. Hasil penelitian menunjukkan bahwa antara metode pembelajaran model Jigsaw dengan metode pembelajaran model Grup Investigasi tidak terjadi perbedaan yang signifikan. Dari hasil uji-t hitung untuk yang diajar dengan Jigsaw dan Grup Investigasi dengan equal variance assumed (diasumsikan kedua varians sama) adalah -0,084. Perbandingan antara metode pembelajaran model Jigsaw dengan metode pembelajaran model Konvensional terjadi perbedaan yang signifikan. Bahwa t hitung untuk yang diajar dengan Jigsaw dan Konvensional dengan equal variance assumed adalah 3,363 dengan probabilitas 0,001. Perbandingan antara model Grup Investigasi dengan model Konvensional terjadi perbedaan signifikan. t hitung untuk metode Grup Investigasi dan Konvensional dengan equal variance assumed adalah 3,818 dengan probabilitas 0,000. Oleh karena probabilitasnya <0,05, maka H0 ditolak, dalam artian nilai rata-rata ekonomi yang diajar dengan metode Grup Investigasi dan Konvensional berbeda secara signifikan.

Strategi implementasi Standar Kompetensi Lulusan Mata Pelajaran (SKL-MP) biologi dalam usaha perbaikan pembelajaran biologi kelas X semester 2 di SMA Negeri 1 Kepanjen / Muhamad Khoirul Anwar

 

Kata kunci: strategi implementasi SKL-MP biologi, hasil refleksi siswa, SMA Negeri 1 Kepanjen. Berdasarkan pembelajaran yang dilakukan oleh peneliti di SMA Negeri 1 Kepanjen, diketahui bahwa peneliti kurang menerapkan SKL-MP biologi. Hal ini terlihat dari kemunculan keterampilan proses yang terdapat di dalam SKL-MP biologi butir 1 yaitu mengamati, mengolah data, menafsirkan data, dan mengkomunikasikan data dalam kegiatan pembelajaran yang digunakan untuk mencapai SKL-MP butir 2 dan 3 sangat sedikit sehingga pembelajaran hanya mengacu pada isi dari materi dan mengabaikan proses belajar siswa. Dalam usaha perbaikan pembelajaran, peneliti menggunakan strategi implementasi SKL–MP biologi untuk menerapkan SKL-MP biologi. Penelitian ini bertujuan untuk mendeskripsikan strategi implementasi SKL-MP biologi dan refleksi siswa terhadap penerapan strategi tersebut dalam pembelajaran biologi kelas X semester 2 di SMA Negeri 1 Kepanjen. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang terdiri dari 4 siklus pembelajaran dengan subjek penelitian adalah siswa kelas X. 5 SMA Negeri 1 Kepanjen. Jumlah siswa sebanyak 30 orang dengan rincian siswa lakilaki sebanyak 9 orang dan siswa perempuan sebanyak 21 orang. Pembelajaran menerapkan keterampilan proses yang terdapat pada SKL-MP butir satu. Hasil penelitian menunjukkan bahwa strategi implementasi SKL-MP biologi dapat dilaksanakan dengan baik. Strategi pembelajaran yang digunakan untuk menerapkan keterampilan proses yang terdapat pada SKL-MP butir 1 untuk mencapai isi yang terdapat SKL-MP butir 2 dan 3 tercapai. Strategi implementasi SKL-MP biologi dalam setiap pembelajaran dapat berjalan baik jika siswa dibimbing dalam setiap kegiatan yang dilakukan, mulai dari kegiatan mengamati, mengolah data, menafsirkan data, dan mengkomunikasikan data. Peneliti juga melakukan perhitungan hasil refleksi siswa. Hasil refleksi siswa adalah kecenderungan siswa untuk memberikan tanggapan terhadap setiap kegiatan pembelajaran yang mencerminkan SKL-MP butir 1 yaitu kegiatan mengamati, mengolah data, menafsirkan data, dan mengkomunikasikan data untuk memahami isi dari pembelajaran biologi yang terdapat pada SKL-MP butir 2 dan 3, serta dilakukan langsung setelah pembelajaran. Selama siklus I hasil refleksi siswa terhadap strategi implementasi SKL-MP biologi pada kegiatan mengamati (kegiatan 1) 90%, mengolah data I (kegiatan 2) 70%, mengolah data II (kegiatan 3) 73,33%, menafsirkan data (kegiatan 4) 83,33%, dan mengkomunikasikan data (kegiatan 5) 86,66%. Hasil refleksi siswa pada kegiatan mengolah data yaitu kegiatan 2 dan 3 dikatagorikan cukup. Perbaikan yang dilakukan adalah peneliti membimbing siswa dalam melakukan kegiatan mengolah data. Pada siklus II, hasil refleksi siswa terhadap strategi implementasi SKL-MP biologi pada kegiatan ii mengamati (kegiatan 1) 82,75%, mengolah data I (kegiatan 2) 86,20%, mengolah data II (kegiatan 3) 86,20%, menafsirkan data (kegiatan 4) 86,20%, dan mengkomunikasikan data (kegiatan 5) pada kegiatan 1 (a), kegiatan 2 (b), kegiatan 3 (c), dan kegiatan 4 (d) sebesar 65,51%. Hasil refleksi siswa yang cukup pada siklus I yaitu pada kegiatan mengolah data dapat ditingkatkan, sedangkan pada kegiatan mengamati dan mengkomunikasikan data, hasil refleksi siswa mengalami penurunan dan dikatagorikan cukup. Pada siklus III, hasil refleksi siswa terhadap strategi implementasi SKL-MP pada setiap kegiatan mengamati (kegiatan 1) 100%, mengolah data I (kegiatan 2) 100%, mengolah data II (kegiatan 3) 89,65%, menafsirkan data (kegiatan 4) 96,55%, dan mengkomunikasikan data (kegiatan 5) pada kegiatan 1 (a), kegiatan 2 (b), kegiatan 3 (c), dan kegiatan 4 (d) sebesar 93,10%, dapat dikatakan hasil refleksi siswa meningkat pada setiap kegiatan. Pada kegiatan siklus IV peneliti dapat mempertahankan hasil refleksi siswa yang baik yaitu pada kegiatan mengamati (kegiatan 1)100 %, mengolah data I (kegiatan 2) 100%, mengolah data II (kegiatan 2) 92,59%, menafsirkan data (kegiatan 4) 96,29%, dan mengkomunikasikan data (kegiatan 5) pada kegiatan 1 (a), kegiatan 2 (b), kegiatan 3 (c), dan kegiatan 4 (d) sebesar 96,29%.

Pengaruh hasil belajar ekonomi, status sosial ekonomi orang tua, dan respon pada iklan terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang / Lucien Meytasari

 

Kata kunci : Hasil Belajar Ekonomi, Status Sosial Ekonomi Orang Tua, Respon pada Iklan, Sikap Perilaku Konsumtif. Di dalam memenuhi kebutuhannya, konsumen seringkali didorong oleh motif tertentu di dalam mendapatkan produk/jasa yang dibutuhkannya. Motif konsumsi yang berkembang pada masyarakat modern saat ini adalah lebih banyak berdasarkan emosional motif daripada rasional motif. Fenomena yang dihadapi masyarakat modern dalam kehidupan sehari-hari adalah diwarnai dengan maraknya kegiatan konsumsi. Fenomena ini nyatanya tidak hanya dialami oleh masyarakat dewasa saja, melainkan juga dialami oleh para remaja. Remaja memiliki sifat diantaranya mudah terbujuk rayuan iklan, suka ikut-ikutan teman, tidak realistis, dan cenderung boros dalam menggunakan uangnya. Adanya hal-hal tersebut maka dapat mendorong siswa berperilaku konsumtif. Penelitian ini bertujuan untuk mengetahui pengaruh secara parsial maupun simultan hasil belajar ekonomi, status sosial ekonomi orang tua dan respon pada iklan terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang. Hasil penelitian ini menunjukkan bahwa: (1) terdapat pengaruh negatif hasil belajar ekonomi terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang, (2) terdapat pengaruh positif status sosial ekonomi orang tua terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang, (3) terdapat pengaruh positif respon pada iklan terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang dan (4) terdapat pengaruh secara simultan hasil belajar ekonomi, status sosial ekonomi orang tua dan respon iklan terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang. Sumbangan efektif dari masing-masing variabel yang memiliki pengaruh paling besar terhadap sikap perilaku konsumtif siswa adalah variabel respon pada iklan. Kesimpulan penelitian ini adalah: (1) semakin tinggi hasil belajar ekonomi maka semakin rendah sikap perilaku konsumtif siswa, (2) semakin tinggi status sosial ekonomi orang tua maka semakin tinggi sikap perilaku konsumtif siswa, (3) semakin tinggi respon pada iklan maka semakin tinggi sikap perilaku konsumtif, (4) hasil belajar ekonomi, status sosial ekonomi, dan respon pada iklan berpengaruh secara simultan terhadap sikap perilaku konsumtif siswa kelas X IPS SMA Negeri 2 Malang. Adapun saran yang dapat diberikan peneliti adalah siswa disarankan dapat mengendalikan kecenderungan dalam berperilaku konsumtif. Sebaiknya perlu diberikan penghargaan bagi siswa yang dapat meminimalisir sikap perilaku konsumtif, dan diberikan penyadaran bagi siswa yang berperilaku konsumtif.

Pengukuran kinerja menggunakan balanced scorecard (BSC) (studi pada PDAM Kota Kediri) / Suprayitno

 

Kata Kunci : Kinerja, Balanced Scorecard, Good Governance. PDAM Kota Kediri merupakan salah satu instansi pemerintah daerah yang bergerak di bidang sektor publik dalam hal jasa air. Kegiatan usahanya bersifat sosial dan ekonomi yang mengutamakan pelayanan bagi masyarakat dan sebagai salah satu instansi pemerintah harus mampu memberikan pertanggungjawaban baik secara keuangan maupun non keuangan kepada pemerintah daerah dan masyarakat sebagai pengguna jasa. Maka perlu adanya suatu pengukuran kinerja yang mencakup semua aspek. Maka digunakanlah balanced scorecard sebagai pilihan yang tepat untuk melakukan pengukuran kinerja, baik dari aspek keuangan maupun non keuangan, untuk melihat hasil yang maksimal dari pengukuran kinerja dari kedua aspek tersebut maka diperlukan suatu tata kelola perusahaan yang baik (good governance). Penelitian ini bertujuan menjelaskan (1) Capaian kinerja perspektif keuangan diukur dengan BSC, (2) Capaian perspektif keuangan terhadap tujuan, visi, dan misi, (3) Capaian perspektif keuangan terhadap penerapan prinsip good governance. Penelitian ini menggunakan rancangan deskriptif dengan objek PDAM Kota Kediri. Tolok ukurnya terdiri dari: (1) Perspektif Keuangan; Current ratio, Quick ratio, ROI, dan ROE, (2) Perspektif Pelanggan; Customer retention, Customer acquisition, dan Growth rate in revenue, (3) Perspektif Proses Internal Bisnis; Yield rate, dan Manufacturing cycle effectiveness, (4) Perspektif Pembelajaran dan Pertumbuhan; Employee turnover, Employee absenteeism. Pengukuran kinerja dilakukan dengan mendeskripsikan hasil perhitungan tolok ukur selama tahun. Adapun untuk mengetahui tingkat kinerja menggunakan time series analysis yaitu membandingkan hasil pengukuran selama tahun 2007, 2008, 2009, 2010 dan hasil tersebut disesuaikan dengan standar penilaian PDAM dan disesuaikan dengan masing-masing tujuan penelitian. Hasil capaian kinerja perspektif keuangan diukur dengan BSC menunjukkan nilai ROE mengalami fluktuasi yang dikarenakan penggunaan modal yang kurang optimal. Kesesuaian capaian perspektif keuangan terhadap tujuan, visi dan misi PDAM menunjukkan kenaikan laba (ROI/ROE) masih di bawah standar penilaian sedangkan dalam mempertahankan kelangsungan hidup perusahaan, PDAM telah melaksanakannya, yaitu bisa dilihat dalam nilai current ratio yang sesuai dengan standar penilaian. Kesesuian capaian perspektif keuangan terhadap penerapan prinsip good governance, dapat dilihat dari prinsip akuntabilitas, transparansi, dan responsibility yang telah dijalankan yaitu adanya audit independen dan kejelasan kewenangan tanggungjawab kepada pihak yang berkepentingan dalam perusahaan PDAM Kota Kediri disarankan menggunakan balanced scorecard sebagai sarana dalam melaksanakan proses perencanaan strategis perusahaan. Untuk itu perlu dukungan dan komitmen yang baik dari seluruh komponen perusahaan agar sistem pengukuran kinerja dengan BSC dapat terlaksana dengan baik.

Pengembangan paket IPA terpadu berbasis konstruktivisme tema udara untuk SMP/MTs kelas VIII / Nilasari

 

Kata Kunci : Paket IPA Terpadu, Tema Udara, Konstruktivisme, Peraturan Menteri Pendidikan Nasional Nomor 22 Tahun 2006 tentang Standar Isi menyebutkan bahwa substansi mata pelajaran IPA pada jenjang SMP/MTs merupakan IPA terpadu. Melalui pembelajaran IPA terpadu, peserta didik dapat memperoleh pengalaman langsung, sehingga dapat menambah kekuatan untuk menerima, menyimpan, dan memaknai hal-hal yang dipelajari. Pada penelitian sebelumnya oleh Handayanto dkk, tahun 2009 menyatakan bahwa berdasarkan pelaksanaan pembelajaran IPA di SMP Negeri Wilayah Malang Raya, menunjukkan bahwa hampir semua guru (96,2%) memiliki kemampuan mengajar materi IPA terutama materi seputar KD yang dibelajarkan. Sebagian besar guru (76,9%) jarang mengaitkan materi yang dibahas dengan cabang IPA lain yang relevan. Sebagian besar guru IPA (35 dari 37 orang atau 94,6%) menyatakan bahwa guru IPA membutuhkan paket IPA terpadu untuk pembelajaran IPA SMP. Paket IPA terpadu yang dimaksud meliputi buku siswa dan buku panduan guru. Berdasarkan hasi observasi di empat sekolah di kota Malang yaitu SMP Sriwedari pada bulan Oktober 2010, SMP Negeri 5 Malang pada bulan Oktober 2010, SMP Brawijaya Smart School pada bulan Januari 2011 dan SMP Negeri 12 Malang pada bulan Februari 2011, pembelajaran IPA yang dilakukan masih secara terpisah. Berdasarkan pengamatan yang telah dilakukan oleh penulis, buku IPA terpadu untuk SMP/MTs yang dijual di toko-toko buku Kota Malang (Dian Ilmu, Toga Mas, Wilis, Gramedia) isinya belum menunjukkan adanya IPA terpadu. Berdasarkan kenyataan tersebut, penulis melaksanakan penelitian pengembangan. Paket IPA terpadu yang terdiri atas buku siswa dan buku panduan guru. Pendekatan konstruktivisme adalah pendekatan pembelajaran yang memandang bahwa siswa belajar sains dengan cara mengkonstruksi pengertian atau pemahaman baru tentang fenomena dari pengalaman yang dimiliki sebelumnya. Penelitian ini merupakan penelitian pengembangan dengan tahap-tahap yang telah disesuaikan dengan kebutuhan peneliti yaitu, (1) tahap pengumpulan informasi dan penelitian,(2) perencanaan,(3) pengembangan produk awal, (4) uji lapangan awal,(5) revisi produk pokok. Instrumen penelitian yang digunakan berupa angket uji kelayakan buku siswa dan uji kelayakan buku panduan guru dilakukan oleh validator guru dan dosen. Uji keterbacaan buku siswa yang dilakukan oleh siswa. Data hasil uji kelayakan diperoleh dari validator-validator yang telah ditetapkan. Jenis data yang diperoleh yaitu (1) skor hasil penilaian kelayakan yang berupa data ordinal selanjutnya diubah menjadi persentase serta ii dianalisis secara deskriptif; (2) data deskripsi yang berupa saran, kritik, dan tanggapan dari validator serta hasil uji keterbacaan siswa. Berdasarkan data hasil uji kelayakan paket IPA terpadu yang dilakukan oleh lima validator diperoleh hasil bahwa buku siswa mendapatkan rata-rata persentase 88.19% menunjukkan kriteria layak. Kelayakan isi 86.94% dan kelayakan penyajian 89.44%. Buku panduan guru mendapatkan rata-rata persentase kelayakan sebesar 86.66% menunjukkan kriteria layak. Kelayakan kesesuaian uraian materi dengan kebutuhan guru 85%, kelayakan penyajian 85%, kelayakan kelengkapan penyajian 90%. Paket IPA terpadu telah direvisi sesuai dengan hasil uji kelayakan oleh tim validator dan uji keterbacaan siswa oleh siswa SMP Negeri 12 Malang. Disarankan kepada pengembang selanjutnya agar melakukan penelitian dan pengembangan lebih lanjut dengan melakukan kajian eksperimen atau penelitian tindakan kelas dan uji coba yang lebih luas sehingga diperoleh paket IPA terpadu yang teruji secara empiris. Disarankan untuk mengembangkan paket IPA terpadu dengan tema yang lain dengan berbasis konstruktivisme sehingga dapat memperkaya sumber belajar siswa.

Manajemen SMP Terbuka dalam rangka wajib belajar sembilan tahun (studi multi-situs pada tiga Smp Terbuka Teratai, Tulip, Mawar di Kota Malang) / Soetyono Iskandar

 

Disertasi Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Hendyat Soetopo, M.Pd, (II) Prof. Dr. Marthen Pali, M. Psi, (III) Prof. Dr. Willem Mantja, M. Pd. Kata Kunci: manajemen SMP Terbuka wajib belajar sembilan tahun. Dalam rangka pemerataan akses pendidikan bagi penduduk Indonesia dengan memperluas dan pemerataan kesempatan pendidikan di jalur formal, khususnya tingkat SMP Terbuka. Disamping itu, untuk memperluas akses bagi penduduk usia 13-15 tahun, dikembangkan SMP Terbuka melalui optimalisasi daya tampung dan pengembangan sekolah melalui model layanan pendidikan alternatif yang inovatif. Untuk manajemen program wajib belajar sembilan tahun SMP Terbuka, tentunya kepala sekolah selaku manajer pendidikan di sekolah dituntut keuletan dan keterampilan dalam penyelenggaraan pendidikan di sekolah. Penelitian ini menggunakan pendekatan penelitian kualitatif, dengan rancangan multisitus dan menggunakan teknik pengumpulan data wawancara mendalam, observasi berpartisipasi dan dokumentasi. Sesuai dengan tujuan penelitian, fokus penelitian ini adalah: (a) perencanaan sekolah tentang pengelolaan SMP Terbuka dalam program wajib belajar sembilan tahun. (b) pengorganisasian penyelenggaraan SMP Terbuka dalam program wajib belajar sembilan tahun. (c) pengembangan sumber daya dalam pelaksanaan dan penyelenggaraan SMP Terbuka dalam program wajib belajar sembilan tahun. (d) Sistem Audit manajemen SMP Terbuka dalam program wajib belajar sembilan tahun. Hasil penelitian menunjukkan sebagai berikut: Pertama, perencanaan manajemen pada seluruh staf terlaksana sesuai dengan rencana yang ditetapkan, maka perencanaan berjalan dan meningkat dalam sistem pengembangan dan penempatan guru/pamong. Kepala sekolah menciptakan iklim kondusif, yaitu guru/pamong termasuk dalam perumusan pelaksanaan manajemen dan mereka secara proaktif ikut serta memberikan masukan operasionalisasi manajemen sekolah. Kedua, pengorganisasian pada dasarnya sudah berjalan baik, berfungsi, dan penataan sistem prosedur kerja yang lebih baik sehingga koordinasi antara kepala sekolah dengan guru/pamong baik secara internal maupun eksternal dapat ditingkatkan. Kepala sekolah perlu menyusun acuan/SOP sekolah, sehingga dapat mengeliminasi fragmentasi yang terjadi. Ketiga, pengembangan sumber daya dalam perencanaan, pemanfaatan dan pengembangan yang lebih baik, sehingga pelaksanaan manajemen menjadi lebih efektif dan efisien. Setiap kepala sekolah meyakinkan guru/pamong untuk melakukan reformasi manajemen demi keberadaan dan kelangsungan sekolah di masa yang akan datang. Kegiatan-kegiatan bimbingan, supervisi pengajaran, pelatihan dan lain-lain dirasakan sangat bermanfaat oleh semua pihak, sehingga hubungan antara kepala sekolah dengan guru/pamong secara periodik dan terus menerus meningkatkan hubungan fungsionalisasi guna lebih ekstensitas dalam melayanani secara berkelanjutan. Pemanfaatan hasil pelatihan perlu didukung oleh sistem rekrutmen dan pengangkatan guru/pamong, sehingga kepala sekolah dan guru/pamong mempunyai acuan/SOP yang jelas dalam menyeleksi guru/pamong yang dibutuhkan sesuai dengan bidang keahliannya masing-masing. Keempat, Sistem audit manajemen meningkatan kualitas dan kompetensi guru/pamong di masing-masing sekolah, serta kepala sekolah meningkatkan kualitas pesan yang disampaikan kepada guru/pamong melalui pemahaman “what, why, who, when, where, and how” tentang manajemen. Kepala sekolah memformulasikan langkah-langkah strategis dalam meningkatkan efektivitas komunikasi manajemen kepada semua guru/pamong. Selanjutnya guru/pamong secara proaktif memberikan umpan balik untuk penyempurnaan substansi pesan yang disampaikan kepala sekolah kepada mereka masing-masing. Manajemen penyelenggaraan pendidikan pada lintas sekolah dalam memberdayakan dan memanfaatkan modal yang dimiliki oleh “stakeholders,” dengan pola rotasi perpindahan seperti yang dilaksanakan oleh kantor Dinas Pendidikan Kota Malang akhir-akhir ini. Hal ini bisa juga dijadikan sebagai upaya penyegaran dan sekaligus pengembangan akademik guru/pamong menjadi lebih bergairah. Selanjutnya manajemen penyelenggaraan pendidikan dengan cara reguler dan segera terlaksana. Menyarankan, yaitu: (1) Bagi Pemerintah Daerah Kota Malang, dalam hal ini dinas pendidikan Kota Malang khususnya Instansi Pemerintah yang terkait dengan pendidikan dasar merupakan pendidikan sembilan tahun. Melakukan monitoring dan evaluasi perencanaan terhadap pengelolaan SMP Terbuka dalam rangka program wajib belajar sembilan tahun pada daerah-daerah terpencil. Agar dapat dilakukan perbaikan dan pengembangan kearah yang lebih baik guna mencapai tujuan sesuai dengan harapan warga sekolah, masyarakat maupun pemerintah. (2) Bagi Dinas Pendidikan Provinsi dan Kemdiknas melakukan pengorganisasian yang sesuai dengan teori organisasi dalam pengembangan ilmu, temuan penelitian ini dapat menambah khasanah dan pengembangan keilmuan bidang pendidikan, khususnya ilmu kebijakan dan pengembangan pendidikan untuk pendidikan dasar sembilan tahun. (3) Bagi Kepala Sekolah, hendaknya selalu meningkatkan kemampuan sumber daya terhadap pelaksanaan pengelolaan SMP Terbuka sehingga dapat memacu peningkatan pencapaian tujuan kebijakan program wajib belajar sembilan tahun yang maksimal. (4) Bagi Peneliti lain, diharapkan melakukan dengan mengkaji hal-hal lain sebagai temuan fakta (empirik) maupun teoritik sebagai bahan rujukan bagi yang ingin melakukan penelitian lanjut dengan menggunakan pendekatan rancangan (design) penelitian yang sejenis, dan/atau pendekatan penelitian yang berbeda.

Penerapan pembelajaran kooperatif model jigsaw untuk meningkatkan aktivitas dan prestasi belajar siswa pada mata pelajaran kewirausahaan (study pada siswa kelas XI Program Keahlian Permesinan SMK PGRI 1 Magetan) / Merlyn Kelvinca Paradise

 

Kata kunci : Jigsaw, Aktivitas dan Prestasi Belajar Pendidikan merupakan komponen terpenting dalam pembangunan bangsa dan negara, kegiatan pendidikan berupa proses belajar mengajar/proses pembelajaran merupakan hal yang sangat penting, sebab keberhasilan sebuah pendidikan sangat dipengaruhi dan ditentukan oleh pelaksanaan pembelajaran. Keberhasilan program pendidikan melalui proses belajar mengajar di sekolah sebagai lembaga pendidikan formal sangat di pengaruhi oleh beberapa faktor yaitu : siswa, kurikulum, tenaga kependidikan, biaya, sarana dan prasarana serta faktor lingkungan. Tujuan penelitian ini adalah (1) Untuk mendeskripsikan penerapan metode pembelajaran kooperatif model Jigsaw pada siswa kelas XI Permesinan di SMK PGRI 1 Magetan. (2) Untuk mengetahui peningkatan aktivitas belajar siswa setelah diterapkannya pembelajaran kooperatif model Jigsaw pada siswa kelas XI Permesinan di SMK PGRI 1 Magetan. (3 )Untuk mengetahui peningkatan prestasi belajar siswa setelah diterapkannya metode pembelajaran kooperatif model jigsaw pada siswa kelas XI Permesinan di SMK PGRI 1 Magetan. (4) Megetahui faktor pendukung dan penghambat penerapan metode pembelajaran kooperatif model jigsaw pada siswa kelas XI Permesinan di SMK PGRI 1 Magetan. Berdasarkan permasalahan dan tujuan penelitian maka penelitian ini bersifat deskriptif dan menggunakan analisis pendekatan kualitatif. Jenis penelitian yang digunakan adalah penelitian tindakan kelas. Alat pengumpulan data menggunakan soal tes, lembar observasi, catatan lapangan, dokumentasi dan pedoman wawancara. Sumber data yang digunakan dalam penelitian ini adalah siswa kelas XI Permesinan SMK PGRI 1 Magetan tahun ajaran 2010/2011. Data prestasi belajar siswa ditinjau dari dua aspek yakni aspek koqnitif dan afektif, aspek koqnitif dapat dilihat dari hasil belajar siswa yang ditunjukkan dengan meningkatnya hasil post tes siswa. Sedangkan aspek afektif dapat dilihat melalui setiap indikator elemen kooperatif mengalami peningkatan keaktifan. Kesimpulan yang dapat diperoleh adalah penerapan Pembelajaran Kooperatif model Jigsaw dapat meningkatkan aktivitas dan prestasi belajar siswa. Beberapa saran yang dapat peneliti sampaikan, yaitu: (1) Guru mata pelajaran kewirausahaan, diharapkan dalam menerapkan pembelajaran model Jigsaw mengatur waktu, mempersiapkan rencana kegiatan dan media yang tepat, sehingga kegiatan pembelajaran dapat berlangsung secara optimal dan efesien. (2) Guru mata pelajaran kewirausahaan, diharapkan dalam menerapkan pembelajaran model Jigsaw menyiapkan soal-soal diskusi secara matang.

Pelaksanaan strategi produk untuk menarik konsumen pada divisi Fresh Department Fruit and Vegetable di Giant Gajayana Malang / Endriyani Suprihatin

 

Kata Kunci: Strategi Produk, Divisi Fresh Departemen Fruit and Vegetable. Giant Malang adalah Hypermarket terbesar di kota Malang yang bergerak dalam perdagangan retail atau eceran dan pasar sasaran masyarakat menengah ke atas. Giant Gajayana Malang memiliki beberapa divisi, salah satunya adalah Divisi Fresh atau bagian yang menangani produk segar yang terdiri dari Departemen Seafood, Meat and Chicken, dan Fruit and Vegetables, di mana dalam divisi ini segala macam kegiatan penjualan dituntut untuk menjaga tingkat keleyakan konsumsi pada konsumen sehingga konsumen menjadi puas akan produk yang ditawarkan. Penerapan strategi produk yang tepat merupakan salah satu kunci seorang pemasar dalam menentukan pangsa pasar, dan citra perusahaan. Sedangkan bagi konsumen kelayakan akan produk merupakan hal yang sangat penting yang pada akhirnya mereka memutuskan untuk membeli atau tidaknya produk tersebut. Praktik ini bertujuan untuk (1) Menjelaskan strategi produk yang dilakukan oleh Divisi Fresh Departemen Fruit and Vegetable di Giant Gajayana Malang, (2) Menjelaskan tentang permasalahan-permasalahan yang dapat menghambat strategi produk pada Divisi Fresh Departemen Fruit and Vegetable di Giant Gajayana Malang, (3) Menjelaskan tentang pemecahan masalah yang ada pada Divisi Fresh Departemen Fruit and Vegetable di Giant Gajayana Malang. Dari hasil pengamatan selama melakukan PKL dua bulan yang dimulai tanggal 3 Januari- 3 Maret, menunjukkan bahwa strategi produk meliputi (klasifikasi produk, barang, kemasan, pemajangan, pelabelan, pelayanan, dan jaminan). Sedangkan masalah-masalah yang timbul diantaranya (kondisi produk, luas cold storage, anggapan konsumen), dan pemecahan yang dilakukan antara lain (menyeleksi pegawai, memperluas area cold storage, kletelitian karyawan, menerapkan strategi produk yang lain, misalnya: lebih menggencarnya promosi)

Pengaruh kemampuan logika dan kebiasaan belajar terhadap prestasi belajar akuntansi siswa kelas XI i.s SMA Negeri 1 Malang / Firdausi Palila Yolandari

 

Kata kunci: Kemampuan Logika, Kebiasaan Belajar, dan Prestasi Belajar. Memiliki prestasi yang membanggakan merupakan harapan setiap siswa. Dan untuk mencapai kesuksesan dalam belajar, siswa tidak hanya dituntut memiliki kemampuan logika yang baik, tetapi juga harus memiliki kebiasaan belajar yang baik pula. Penelitian ini membahas tentang pengaruh kemampuan logika dan kebiasaan belajar yang dimiliki oleh siswa terhadap prestasi belajar yang telah dicapai oleh siswa. Penelitian ini bertujuan untuk mengetahui pengaruh kemampuan logika dan kebiasaan belajar secara parsial terhadap prestasi belajar. Penelitian ini dilakukan di SMAN 1 Malang. Populasi penelitian ini berjumlah 90 siswa dengan jumlah sampel sebanyak 70 siswa. Pengambilan sampel dilakukan menggunakan teknik accidental sample. Sedangkan metode analisisnya menggunakan analisis regresi berganda. Berdasarkan hasil analisis data menyatakan bahwa ada pengaruh yang signifikan antara kemampuan logika terhadap prestasi belajar siswa pada mata pelajaran akuntansi. Dari hasil analisis menunjukkan hasil t_hitung=6,683 dan t_tabel= 2,00 dengan probabilitas (0,000) < 0,05. Nilai koefisien regresi parsial variabel kebiasaan belajar bernilai positif sebasar 0,204 berarti kenaikan satu satuan variabel kebiasaan belajar akan meningkatkan prestasi belajar mata pelajaran akuntansi sebesar 0,204. Kesimpulan yang diperoleh dari penelitian ini adalah (1) kemampuan logika yang dimiliki oleh siswa kelas XI i.s. SMA Negeri 1 Malang tergolong rendah, (2) kebiasaan belajar siswa kelas XI i.s. SMA Negeri 1 Malang tergolong kebiasaan belajar yang baik. (3) ada pengaruh yang signifikan antara kemampuan logika terhadap prestasi belajar siswa kelas XI i.s. SMA Negeri 1 Malang, (4) ada pengaruh yang signifikan antara kebiasaan belajar terhadap prestasi belajar siswa SMA Negeri 1 Malang. Saran yang diajukan dalam penelitian ini adalah (1) bagi Kepala Sekolah agar memberikan arahan bagi para siswa agar selalu meningkatkan tingkat kemampuan logika dan kebiasaan belajar untuk meningkatkan prestasi belajar, (2) bagi guru akuntansi agar dijadikan pertimbangan dalam menggunakan metode pembelajaran yang tepat dalam rangka meningkatkan kemampuan logika dan kebiasaan belajar untuk meningkatkan prestasi belajar, (3) bagi siswa agar dapat lebih meningkatkan kemampuan logikanya dan lebih membiasakan diri untuk belajar teratur agar dapat meningkatkan prestasi belajarnya, (4) bagi peneliti bahwa peneliti menyadari dalam penelitian ini masih ada banyak kekurangan-kekurangan yang harus diperbaiki. Untuk itu diharapkan ada penelitian lain yang dapat mengembangkan penelitian ini dengan melihat variabel yang berbeda.

Pengaruh pembiayaan mudharabah, musyarakah dan murabahah terhadap profitabilitas bank umum syariah di Indonesia / Dwi Fany Wicaksana

 

Kata Kunci: Mudharabah, Musyarakah, Murabahah, Profitabilitas Produk pembiayaan pada bank syariah merupakan earning asset yang memiliki peranan besar dalam kenaikan profitabilitas. Mudharabah, musyarakah, murabahah merupakan bagian dari produk pembiayaan yang dimiliki oleh bank syariah. Kegagalan dan kesalahan dalam pengelolaan pembiayaan akan sangat berpengaruh terhadap pendapatan yang berpengaruh terhadap laba bank yang selanjutnya dapat mempengaruhi tingkat profitabilitas dari bank secara keseluruhan. Penelitian ini bertujuan untuk menguji pengaruh pembiayaan mudharabah, musyarakah, murabahah secara parsial dan simultan terhadap profitabilitas yang diproksikan dengan Return On Asset (ROA). Populasi dalam penelitian ini adalah seluruh bank umum syariah yang terdaftar di Bank Indonesia. Penentuan sampel di pilih dengan teknik purposive sampling dengan kriteria bank umum syariah yang beroperasi sesuai dengan prinsip syariah dan bukan merupakan unit penyertaan syariah yang memiliki laporan keuangan triwulan lengkap selama periode tahun 2006-2010. Data yang digunakan adalah data sekunder yang berupa laporan keuangan triwulanan teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi linier berganda. Hasil analisis menunjukkan bahwa secara parsial variabel pembiayaan mudharabah, musyarakah, murabahah berpengaruh secara signifikan terhadap profitabilitas. Secara simultan variabel pembiayaan mudharabah, musyarakah, murabahah berpengaruh secara signifikan terhadap profitabilitas. Manajemen kredit atau pengelolaan pembiayaan perlu dilaksanakan dengan baik dan tepat untuk mencegah pembiayaan bermasalah, dengan manajemen pembiayaan yang bagus maka perbankan syariah dapat memberikan pembiayaannya kepada debitur yang tepat dan dengan jenis usaha yang produktif. Pengelolaan kredit adalah kunci utama bagi perbankan nasional untuk tetap bertahan dalam persaingan yang ketat, serta akan memberikan pendapatan yang berpengaruh terhadap keuntungan (laba) yang diharapkan sehingga akan berpengaruh terhadap profitabilitas. Dari hasil analisis pembiayaan mudharabah, musyarakah, dan murabahah berpengaruh terhadap profitabilitas. Disarankan bagi penelitian selanjutnya untuk menambahkan variabel yang lain dan menambah periode penelitian serta menambah sampel penelitian, saran bagi perbankan umum syariah untuk lebih memperhatikan pembiayaan yang mampu meningkatkan profitabilitas, bagi nasabah diharapkan berhati-hati dalam mengambil suatu keputusan pembiayaan.

Kepercayaan sebagai pemediasi gaya kepemimpinan transformasional terhadap kepuasan kerja (studi pada Hotel Pelangi Malang) / Widya Tri Purnamasari

 

Kata Kunci : Gaya Kepemimpinan Transformasional ,Kepercayaan dan Kepuasan Kerja. Kepemimpinan memerankan peranan yang sangat dominan sebagai penentu suatu keberhasilan organisasi atau perusahaan. Dalam menjalankan kepemimpinannya, seorang pemimpin tentu mempunyai sifat, kebiasaan, watak dan kepribadian yang berbeda-beda. Perbedaan karakter ini tentu akan berpengaruh juga terhadap gaya kepemimpinan dalam memimpin suatu perusahaan. Gaya kepemimpinan ini akan berpengaruh juga terhadap kepercayaan karyawan. Kepercayaan merupakan suatu hal sangat penting, karyawan yang percaya kepada pimpinan mereka akan merasakan kenyamanan kerja sehingga terwujudnya suasana dan lingkungan kerja yang kondusif. Pada akhirnya akan tercapai suatu kepuasan kerja yang akan meningkatkan proses kerja yang lebih efektif sehingga dapat berjalan sesuai dengan visi dan misi perusahaan. Penelitian ini bertujuan untuk mengetahui pengaruh perilaku kepemimpinan transformasioanal terhadap kepuasan kerja, pengaruh perilaku kepemimpinan transformasional terhadap kepercayaan kepada pemimpin, pengaruh kepercayaan kepada pemimpin terhadap kepuasan kerja, serta peran mediasi kepercayaan kepada pemimpin dalam pengaruh perilaku kepemimpinan transformasional kepada kepuasan kerja karyawan. Populasi yang digunakan dalam penelitian ini adalah seluruh karyawan Hotel Pelangi Malang yang berjumlah 77 orang karyawan. Teknik sampling yang digunakan dalam penelitian ini adalah simple random sampel. Berdasarkan teknik sampling yang digunakan sampel penelitian yang diambil dari karyawan Hotel Pelangi yang berjumlah 77 orang adalah 65 pada kelonggaran ketidaktelitian (e) sebesar 5%. Hasil penelitian ini dapat diketahui : (1) Gaya kepemimpinan transformasional berpengaruh positif dan signifikan terhadap kepuasan kerja karyawan pada Hotel Pelangi Malang (2) Kepercayaan berpengaruh positif dan signifikan terhadap kepuasan kerja pada Hotel Pelangi Malang (3) Terdapat pengaruh tidak langsung gaya kepemimpinan transformasional terhadap kepuasan kerja pada Hotel Pelangi Malang. (4) terdapat pengaruh langsung gaya kepemimpinan transformasional terhadap kepuasan kerja karyawan lebih besar daripada pengaruh gaya kepemimpinan transformasional terhadap kepuasan kerja secara tidak langsung pada Hotel Pelangi Malang. Saran bagi Hotel Pelangi Pimpinan perusahaan sebaiknya dapat menyesuaikan perilakunya atau gaya kepemimpinannya dengan faktor-faktor situasional karena tidak ada gaya kepemimpinan yang efektif untuk semua situasi atau kondisi. Agar karyawan merasakan kepuasan kerja, tentunya perusahaan sebaiknya menyediakan, memenuhi dan memelihara secara terus-menerus faktor-faktor yang dapat meningkatkan kepuasan kerja karyawannya. Langkah yang bisa dilakukan perusahaan untuk meningkatkan kepuasan adalah dengan memberikan tanggung jawab memberikan kesempatan yang sama pada seluruh karyawan untuk dipromosikan, besarnya gaji harus sesuai dengan beban kerja karyawan, menciptakan hubungan yang harmonis antara karyawan dengan karyawan lainnya dan karyawan dengan perusahaan.

Kesalahan pembentukan finalsatz bahasa Jerman oleh mahasiswa angkatan 2009 Jurusan Sastra Jerman Universitas Negeri Malang / Taufan Reza Achmadi

 

Kata kunci: kalimat, Finalsatz, kesalahan pembentukan Aturan tata bahasa merupakan hal yang penting dalam mempelajari bahasa Jerman. Aturan tata bahasa ada agar komunikasi antara satu dengan yang lain dapat terjalin dengan baik dan benar. Tata bahasa menunjukkan dan mendeskripsikan sebuah struktur bahasa dan bagaimana orang melakukannya. Pembelajar atau mahasiswa sebaiknya menggunakan tata bahasa dengan baik dan benar dalam usaha mereka menuangkan ide-ide baik dalam wacana tulis maupun wacana lisan. Tata bahasa bahasa Jerman memberikan aturan-aturan bagaimana seseorang membentuk kalimat aktif maupun kalimat pasif, kalimat tanya, kalimat perintah, kalimat langsung dan tidak langsung, kalimat final (Finalsatz), dan masih banyak lagi. Finalsatz memiliki makna keinginan, maksud, maupun tujuan mengenai sesuatu. Bila dicermati,secara teoritis untuk membentuk sebuah Finalsatz relatif mudah, akan tetapi tidak demikian dengan yang terjadi di lapangan. Mahasiswa masih merasa kesulitan dalam membentuk Finalsatz dengan baik dan benar. Hal tersebut terbukti dengan ditemukannya banyak kesalahan dalam tes yang dikerjakan mahasiswa ketika diminta menyusun Finalsatz. Penelitian ini bertujuan untuk mendeskripsikan kesalahan yang dibuat mahasiswa Jurusan Sastra Jerman angkatan 2009 dan faktor-faktor penyebab terjadinya kesalahan pembentukan Finalsatz. Metode yang digunakan peneliti dalam penelitian ini adalah deskriptf kualitatif. Data penelitian ini digunakan untuk mendeskripsikan kemampuan mahasiswa dalam membentuk Finalsatz bahasa Jerman. Instrumen penelitian ini adalah tes yang diberikan pada mahasiswa berupa sepuluh soal pembentukan Finalsatz dan angket. Berdasarkan hasil tes yang telah dilakukan dapat diketahui mahasiswa masih kesulitan dalam pembentukan Finalsatz. Terdapat empat macam kesalahan pembentukan Finalsatz yang dilakukan mahasiswa yaitu (1) kesalahan pembentukan Finalsatz dengan bentuk yang terbalik antara damit-Satz maupun Infinitifkonstruktion, terdapat dua puluh lima macam kesalahan. (2) Kesalahan peletakan kata kerja dalam Nebensatz, tujuh kesalahan. (3) kesalahan berupa pengulangan subjek dalam Nebensatz, tujuh kesalahan. (4) sepuluh kesalahan. Kesalahan yang paling banyak dibuat mahasiswa adalah kekeliruan dalam membentuk Finalsatz dengan menggunakan bentuk damit-satz maupun Infinitivkonstruktion. Mahasiswa tidak mengerti apakah kalimat sebaiknya dibentuk menggunakan damit-Satz atau Infinitivkonstruktion. Kata kerja yang tedapat dalam Nebensatz harus diletakkan di akhir kalimat, akan tetapi banyak mahasiswa yang lupa terhadap aturan tersebut. Hal inilah yang menjadi kesalahan kedua. Selain itu mahasiswa mengulang subjek dalam Nebensatz pada Finalsatz yang menggunakan Infinitivkonstruktion. Berdasarkan hasil angket dapat diketahui mahasiswa kesulitan dalam membedakan dua jenis Finalsatz. Berasarkan hasil penelitan disarankan pada pengajar agar menyampaikan materi Finalsatz lebih detail disertai dengan latihan-latihannya. Untuk mahasiswa sebaiknya mencari materi Finalsatz dari sumber lain dan banyak berlatih di rumah.

Analisis potensi penerimaan pajak bumi dan bangunan dalam pelaksanaan otonomi daerah di Kota Malang / M. Fuadil Karim

 

Kata kunci: Otonomi daerah, Potensi, Pajak Bumi dan Bangunan Untuk lebih mengoptimalkan potensi keuangan daerah dalam rangka penyelenggaraan pemerintah, maka pemerintah daerah diharapkan untuk mampu menggali segenap potensi yang dimiliki oleh daerah tersebut. Salah satu tolok ukur finansial yang dapat digunakan untuk melihat kesiapan daerah dalam pelaksanaan otonomi adalah dengan mengukur seberapa jauh suatu daerah menggali sumber-sumber pendapatan daerah yang dimiliki. Salah satunya adalah dengan mengoptimalkan potensi dari Pajak Bumi dan Bangunan di Kota Malang sendiri. Peneliti merumuskan masalah sebagai berikut. (1) Bagaimana Penerimaan Pajak Bumi dan Bangunan di Kota Malang tahun anggaran 2005 sampai 2009?(2) Bagaimana Potensi penerimaan Pajak Bumi dan Bangunan di Kota Malang? (3) Bagaimana upaya yang dapat dilakukan untuk memaksimalakan Potensi Penerimaan Pajak Bumi dan Bangunan di Kota Malang? Untuk menjawab pertanyaan tersebut, penelitian ini dirancang dengan jenis penelitian deskriptif dengan menggabungkan metode kualitatif dan metode kuantitatif. Teknik analisis data menggunakan Linier Programming dan teknik analisis SWOT. Penelitian ini dilakukan di Dinas Pendapatan Daerah (Dispenda) dan Kantor Pelayanan Pajak Pratama Kota Malang dengan teknik survei lapangan dan dokumentasi. Dari hasil penelitian ini ditemukan bahwa (1) Penerimaan Pajak Bumi dan Bangunan dilihat dari jumlah nominal realisasi penerimaannya dari tahun 2005 sampai 2009 selalu mengalami kenaikan. (2) Potensi Pajak Bumi dan Bangunan di Kota Malang cukup besar, hal ini dapat dilihat dengan nominal realisasi penerimaan PBB yang mengalami kenaikan kurang lebih Rp 4.000.000.000 dari tahun ketahun dari tahun 2005 sampai 2009. (3) upaya yang dilakukan untuk memaksimalkan potensi PBB adalah Diversifikasi strategi, artinya penerimaan PBB dalam kondisi baik namun menghadapi sejumlah tantangan berat sehingga harus dilakukan upaya mobilisasi sumberdaya yang merupakan kekuatan penerimaan PBB untuk memperkecil ancaman tersebut Adapun saran yang dapat dijadikan pertimbangan dalam mengoptimalkan potensi penerimaan Pajak Bumi dan Bangunan adalah: (1) Bagi Lembaga yang menjalankan administrasi PBB hendaknya harus melakukan upaya-upaya untuk memaksimalkan potensi Pajak Bumi dan Bangunan (2) Bagi peneliti lain: maka penelitian selanjutnya disarankan mengambil data yang lebih rinci dan lengkap agar dapat mendeskripsikan berbagai kondisi yang terjadi dalam hal pengelolaan Pajak Bumi dan Bangunan secara lebih mendalam untuk mendapatkan hasil penelitian yang lebih baik

Studi tentang sarana dan prasarana pada bengkel mekanik otomotif berdasarkan ketentuan BSNP di SMK Negeri 12 Malang / Mojibur Rohman

 

Kata kunci: Sarana dan Prasarana, BSNP Sarana dan prasarana merupakan salah satu komponen yang sangat penting dalam penyelenggaraan sebuah sekolah kejuruan (SMK). Kelengkapan s arana praktikum di sebuah bengkel mekanik otomotif dapat dijadikan salah satu indikator tentang seberapa jauh keefektifan kegiatan pembelajaran dalam kompetensi keahlian tersebut, khususnya pada kegiatan praktikum di dalamnya. Penelitian ini bertujuan untuk mengetahui kondisi dari sarana dan prasarana yang terdapat dalam bengkel mekanik otomotif di SMK Negeri 12 Malang, mengingat sekolah ini adalah salah satu sekolah kejuruan yang baru terbentuk dari yang sebelumnya berupa sebuah SMA. Penelitian difokuskan pada 4 area kerja bengkel meliputi, area kerja mesin otomotif, area kerja chasis dan pemindah tenaga, area kerja kelistrikan otomotif, dan juga ruang penyimpanan dan instruktur. Hasil penelitian menunjukkan bahwa tingkat kesesuaian sarana pada masing-masing area kerja belum mancapai 100% . Pada area kerja mesin otomotif tingkat kesesuaiannya hanya 62,1%, area kerja chasis dan pemindah tenaga 50,4%, dan area kerja kelistrikan otomotif juga hanya 50,4%, sedangkan untuk ruang penyimpanan dan instruktur mencapai 87,5 %. Tingkat kesesuaian yang masih rendah tersebut sebagian besar dikarenakan tidak tersedianya jenis perabotan pada masing-masing area kerja, dan selain itu juga dikarenakan jumlah peralatan praktek yang masih sangat minim dan tidak mencukupi untuk m emenuhi kebutuhan sejumlah peserta didik dalam 1 kelas yang mencapai 40 orang . Begitupun juga dengan prasarana ruang pada masing -masing area kerja bengkel mekanik otomotif tersebut belum memenuhi standar, dimana pada area kerja mesin otomotif tingkat kesesuaiannya hanya 38%, area kerja chasis dan pemindah tenaga 25%, dan area kerja kelistrikan otomotif juga hanya 33,2%, sedangkan untuk ruang penyimpanan dan instruktur mencapai 85 %. Dari hasil penelitian tersebut, dapat ditarik beberapa kesimpulan bahwa sarana dan prasarana yang terdapat dalam bengkel mekanik otomotif SMK Negeri 12 Malang, masih belum memenuhi standar yang telah ditentukan BSNP . Selain dikarenakan jumlah peserta didik yang melebihi kapasitas normal dalam setiap kelas, hal ini juga dikarenakan sekolah ini masih merupakan SMK yang baru terbentuk, sehingga diperlukan waktu untuk memenuhi segala kebutuhannya dalam penyelenggaraan sebuah sekolah kejuruan, khususnya dalam hal pemenuhan sarana praktikum pada masing-masing kompetensi keahlian di dalamnya.

Persepsi siswa terhadap pengembangan video tutorial untuk menunjang pembelajaran pada materi jurnal umum dan buku besar perusahaan jasa pada mata pelajaran akuntansi kelas XI IPS SMAN 1 Tenggarang Kabupaten Bondowoso / Agung Bakti Saputra

 

Kata kunci: persepsi, pengembangan, media video tutorial, jurnal umum dan buku besar, akuntansi SMA. Pengembangan video tutorial memiliki potensi yang besar untuk dimanfaatkan dalam pembelajaran. Seringkali siswa mengalami kesulitan memahami materi siklus akuntansi, karena siswa harus mengerjakan soal ke dalam tahapan-tahapan dalam siklus akuntansi. Hal ini yang mendasari pengembang untuk mengembangkan video tutorial untuk menunjang pembelajaran siklus akuntansi jurnal umum dan buku besar. Dengan media ini, siswa dapat melihat langsung cara menyelesaikan soal dengan tahapan penyelesaian dalam bentuk video. Tujuan penelitian adalah (a) Mengetahui proses pengembangan video tutorial untuk menunjang pembelajaran siklus akuntansi jurnal umum dan buku besar (b) Mengetahui persepsi siswa terhadap pengembangan video tutorial untuk menunjang pembelajaran siklus akuntansi jurnal umum dan buku besar. Penelitian ini termasuk penelitian deskriptif. Deskripsi variabel minat belajar diperoleh melalui angket kemudian data diolah menjadi data distribusi frekuensi untuk variabel minat belajar selanjutnya dapat kita ketahui jumlah dan siswa persentase siswa yang minat belajarnya tergolong sangat baik, baik, kurang baik dan tidak baik. Untuk menguji kelayakan media dilakukan proses validasi oleh ahli media dan ahli materi sebagai penguji ahli. Media yang dihasilkan adalah berupa DVD video tutorial. DVD tersebut menampilkan materi proses pembuatan jurnal umum dan posting ke dalam buku besar akuntansi perusahaan jasa. File video dipisah menurut sub materi agar dapat dipilih video yang hendak dimainkan. Jumlah transaksi terdiri atas 13 item yang dapat mempengaruhi berbagai jenis akun. Berdasarkan hasil analisis angket yang diberikan pada 20 siswa SMAN 1 Tenggarang setelah mereka menyaksikan video tutorial diketahui 70 % siswa memiliki minat yang sangat baik, dan 30 % siswa memiliki minat yang baik setelah mereka menyaksikan video tutorial. Dapat disimpulkan penggunaan media video tutorial untuk menunjang pembelajaran jurnal umum dan buku besar perusahaan jara mata pelajaran akuntansi SMA dapat meningkatkan minat belajar siswa SMAN 1 Tenggarang. Disarankan media video tutorial untuk menunjang pembelajaran jurnal umum dan buku besar perusahaan jara mata pelajaran akuntansi SMA dapat dijadikan sebagai salah satu media dan model pembelajaran akuntansi bagi siswa di sekolah dan untuk belajar mandiri di rumah. Untuk peneliti selanjutnya, disarankan untuk mengembangkan materi berikutnya serta mengambangkan produk penunjang pembelajaran akuntansi berupa media yang lain.

Penerapan model pembelajaran permainan scrabble untuk meningkatkan kualitas pembelajaran IPS siswa kelas IV SDN Karangbesuki 4 Kota Malang / Muhammad Sulton

 

Kata kunci: permainan scrabble, pembelajaran, IPS SD Bedasarkan hasil observasi yang dilakukan pada siswa kelas IV di SDN Karangbesuki 4 ditemukan beberapa masalah pembelajaran yaitu, (1) rendahnya minat belajar siswa pada mata pelajaran IPS, (2) sebagian besar siswa belum menguasai konsep materi pembelajaran IPS, (3) sebagian besar siswa merasa jenuh dalam pembelajaran klasikal yang identik dengan metode ceramah. Oleh karena itu dalam penelitian ini peneliti menerapkan permainan scrabble dalam pembelajaran yang bertujuan untuk meningkatkan aktivitas dan hasil belajar siswa. Permainan scrabble merupakan permainan kosakata bahasa inggris yang dipasang pada sebuah papan media. Model permainan dirancang sesuai materi yang akan dibelajarkan yakni perkembangan teknologi . Rancangan penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) Arikunto yang juga mengacu pada model siklus Kemmis Tanggart. Penelitiaan terdiri dari dua siklus. Setiap siklus terdiri dari perencanaan, pelaksanaan, observasi, dan refleksi. Adapun instrumen penelitian ini menggunakan lembar/pedoman observasi, angket wawancara, lembar tes/penilaian. Sedangkan sumber data penelitian adalah siswa kelas IV SDN Karangbesuki 4 yang berjumlah 33 siswa terdiri dari 17 laki-laki dan 16 perempuan. Hasil penelitian menunjukkan bahwa penerapan model permainan scrabble berjalan dengan kompetitif. Aktivitas belajar siswa meningkat dari 85% pada siklus I meningkat menjadi 94 % pada siklus II. Hasil belajar siswa juga mengalami peningkatan yang ditunjukkan dengan peningkatan ketuntasan belajar klasikal siswa mulai pada saat pra tindakan sampai pembelajaran siklus II. Pada saat pra tindakan ketuntasan belajar klasikalnya 30% meningkat menjadi 70% pada siklus I. dan pada saat pembelajaran siklus II ketuntasan belajar meningkat menjadi 85%. Penerapan model permainan scrabble mampu menciptakan suasana belajar yang kondusif. Aktivitas belajar siswa cenderung meningkat seiring permainan berlangsung. Hasil belajar siswa juga mengalami peningkatan yang ditandai naiknya nilai rata-rata siswa dari 53 saat pra tindakan menjadi 79 saat siklus II. Berdasarkan hasil penelitian di atas disimpulan bahwa penerapan model permainan scrabble berjalan dengan lancar sehingga mampu meningkatkan aktivitas dan hasil belajar siswa kelas IV khususnya pada materi “Perkembangan Teknologi”. Penelitian ini dapat disarankan agar dilakukan penelitian lebih lanjut untuk merancang pembelajaran yang variatif dan inovatif sehingga dapat menghasilkan ketuntasan belajar yang maksimal.

Pengaruh penerapan model pembelajaran kooperatif Group Investigation (GI) terhadap kemampuan berpikir kritis dan hasil belajar siswa kelas VII di SMP Negeri 5 Malang pada pokok bahasan peran manusia dalam pengelolaan lingkungan / Siti Fatimah

 

Kata kunci: model pembelajaran kooperatif, GI, kemampuan berpikir kritis, hasil belajar Pengalaman belajar yang seringkali hanya mengandalkan kegiatan proses mendengarkan dan menghafal serta menjawab pertanyaan-pertanyaan dari guru dan menjawab pertanyaan dari LKS dengan tingkat pertanyaan kognitif yang masih rendah belum mampu meningkatkan kemampuan berpikir kritis siswa. Selain itu, pembelajaran yang belum merangsang aktivitas siswa untuk mencari dan menemukan sendiri konsep pembelajaran melalui investigasi juga masih belum mampu membuat siswa aktif serta mandiri dan tertarik pada pelajaran. Group Investigation (GI) merupakan salah satu model pembelajaran kooperatif sebagai alternatif dalam menciptakan pembelajaran yang bermakna bagi siswa serta mampu membuat siswa lebih aktif. Diharapkan dengan pembelajaran ini siswa mampu menemukan suatu masalah serta memikirkan solusi yang tepat untuk memecahkan permasalahan tersebut. Tujuan penelitian ini adalah untuk mengetahui pengaruh penerapan model pembelajaran kooperatif Group Inves-tigation terhadap kemampuan berpikir kritis dan hasil belajar siswa kelas VII di SMP Negeri 5 Malang. Penelitian ini merupakan penelitian eksperimen semu (quasy experiment). Rancangan penelitian ini adalah Pretest-Postest Control Group Design. Subjek penelitian ini adalah siswa kelas VII SMP Negeri 5 Malang, 1 kelas eksperimen (kelas VII- 6) yang berjumlah 27 siswa dan 1 kelas kontrol (kelas VII-3) yang berjumlah 29 siswa. Data penelitian ini berupa kemampuan berpikir kritis dan hasil belajar kognitif, afektif dan psikomotor yang diperoleh dari hasil tes yang dilakukan pada awal dan akhir pembelajaran, sedangkan data hasil belajar psi-komotor diperoleh dari hasil pengamatan. Indikator kemampuan berpikir kritis meliputi 1) merumuskan masalah, 2) memberikan argumen, 3) melakukan deduksi, 4) melakukan induksi, 5) mengevaluasi, 6) mengkreasi, 7) memutuskan dan melaksanakan. Data tentang kemampuan berpikir kritis dan hasil belajar siswa dianalisis melalui 3 tahap yaitu: uji normalitas, uji homogenitas, dan uji hipotesis. Berdasarkan hasil penelitian pada data kemampuan berpikir kritis, uji hipotesis menunjukkan nilai probabilitas (Sig) 0,000 < nilai tingkat kepercayaan (ά=0,05) maka H0 ditolak dan H1 diterima. Sehingga dapat disimpulkan bahwa terdapat pengaruh model pembelajaran kooperatif Group Investigation (GI) terhadap kemampuan berpikir kritis siswa kelas VII SMP Negeri 5 pada pokok bahasan peran manusia dalam pengelolaan lingkungan. Hasil uji hipotesis hasil belajar kognitif menunjukkan nilai probabilitas (sig) 0,000 < nilai α = 0,05. Demikian juga pada hasil belajar afektif menunjukkan nilai Probabilitas (Sig) 0,000 < nilai tingkat kepercayaan (ά=0,05), maka H0 ditolak dan H1 diterima. Hal ini dapat disimpulkan bahwa terdapat pengaruh model pembelajaran kooperatif Group Investigation (GI) terhadap hasil belajar kognitif dan afektif siswa kelas VII SMP Negeri 5 Malang pada pokok bahasan peran manusia dalam pengelolaan lingkungan. Tetapi tidak ada pengaruh model pembelajaran kooperatif Group Investigation (GI) terhadap hasil belajar psikomotor siswa kelas VII SMP Negeri 5 Malang pada pokok bahasan peran manusia dalam pengelolaan lingkungan, karena hasil uji hipotesis menunjukkan nilai probablitas (sig) 0,118 > α = 0,05, sehingga hipotesis penelitian (H1) ditolak dan hipotesis nol (H0) diterima. Berdasarkan hasil penelitian diketahui bahwa model pembelajaran koo-peratif Group Investigation (GI) berpengaruh terhadap kemampuan berpikir kritis siswa dan hasil belajar kognitif dan afektif siswa pada pokok bahasan peran manusia dalam pengelolaan lingkungan, maka disarankan kepada guru untuk menggunakan metode pembelajaran ini pada materi-materi yang lain. Namun tidak ada pengaruh pada hasil belajar psikomotor siswa, karena dalam penelitian ini hasil belajar psikomotor pada kelas kontrol ataupun kelas eksperimen sama-sama diperoleh dari hasil pengamatan pada siswa melalui praktikum secara kelompok.

Pengaruh larutan kedelai (Glycine max L.) terhadap fertilitas mencit (Mus musculus) betina galur balb C / Aries Wibisono

 

Kata Kunci: Kedelai, Isoflavon, Dosis, Fertilitas Kedelai mengandung senyawa isoflavon yang mempunyai kemampuan untuk menimbulkan efek estrogenik karena kemiripan strukturnya dengan hormon estrogen. Mengkonsumsi kedelai dalam jumlah tinggi dapat meningkatkan panjang siklus menstruasi, menurunkan FSH (follicle-stimulating hormone) dan LH (luteinizing hormone) (Ahira, 2009). Tujuan penelitian adalah untuk mengetahui pengaruh larutan kedelai (Glycine max) terhadap fertilitas mencit (Mus musculus) betina galur Balb C Penelitian dilakukan di laboratorium Zoologi Bio 214 dan kandang Biologi FMIPA UM pada bulan Juni 2010 - Maret 2011. Jenis penelitian merupakan penelitian eksperimen dengan menggunakan Rancangan Acak Kelompok (RAK). Perlakuan berupa larutan kedelai yang diberikan selama 12 hari dengan 4 perlakuan yaitu dosis 0 g/kg bb; 0.369 g/kg bb; 0.738 g/kg bb; 1.47 g/kg bb masing-masing diulang sebanyak 6 kali. Setelah perlakuan, mencit betina dikawinkan dengan pejantan. Mencit yang bunting kemudian dibedah pada hari kebuntingan ke-18 untuk dihitung jumlah fetus hidup, jumlah fetus mati, jumlah plasenta, jumlah resorpsi, dan jumlah korpus luteum. Data hasil pengamatan kemudian dihitung menggunakan rumus Manson dan Kang (1989) untuk menentukan fertilitas pada mencit betina. Data selanjutnya dianalisis menggunakan ANAVA dan dilanjutkan dengan uji LSD jika ada pengaruh. Berdasarkan hasil analisis data, larutan kedelai berpengaruh terhadap fertilitas mencit betina. Hal ini ditunjukkan dengan adanya perbedaan yang signifikan pada rata-rata persentase implantasi dan persentase telur praimplantasi yang hilang. Rata-rata kematian intrauteri, embrio yang diresorpsi, dan fetus mati cenderung mengalami peningkatan pada perlakuan larutan kedelai dosis 0.738 g/kg bb dan 1.47 g/kg bb. Rata-rata fetus hidup mengalami penurunan pada perlakuan larutan kedelai dosis 0.738 g/kg bb dan 1.47 g/kg bb. Dapat disimpulkan bahwa larutan kedelai (Glycine max) berpengaruh terhadap fertilitas mencit (Mus musculus) betina galur Balb C yaitu pada persentase implantasi dan persentase kematian telur praimplantasi. Larutan kedelai dosis 0.738 g/kg bb dan 1.47 g/kg bb menurunkan persentase implantasi dan meningkatkan persentase telur praimplantasi yang hilang.

Pengaruh good corporate governance terhadap Return on Asset (ROA) perusahaan manufaktur yang listing di Bursa Efek Indonesia tahun 2007-2008 / Lidwina Septiningsih

 

Kata Kunci: Mekanisme GCG, Return On Asset Salah satu tujuan penting pendirian suatu perusahaan adalah untuk meningkatkan kesejahteraan dan memaksimalkan kekayaan pemegang saham melalui peningkatan nilai perusahaan. Dengan nilai perusahaan yang tinggi akan mendorong para investor untuk menanamkan investasi sebanyak-banyaknya pada perusahaan. Salah satu hambatan dalam pencapaian tujuan perusahaan aadalah perbedaan kepentingan antara pemilik perusahaan dan manager yang disebut masalah keagenan (agency problem). Konflik tersebut terjadi karena pemilik perusahaan menginginkan agar perusahaaan mendapatkan laba yang tinggi untuk meningkatkan kemamuran pemilik perusahaan, sedangkan manajemen cenderung mengejar kepentingan diri sendiri dan tidak berdasar pada arah tujuan maksimalisasi nilai perusahaan. Namun, tindakan tersebut dapat dikendalikan dan diminimumkan dengan menerapkan GCG yang konsisten dalam perusahaan yang didukung dengan dua teori utama yaitu stewardship theory dan agency theory. Penelitian ini bertujuan untuk menjelaskan pengaruh dari mekanisme GCG berupa kepemilikan manajerial, kepemilikan institusional, ukuran dewan komisaris, dan ukuran dewan direksi terhadap kinerja perusahaan yang diproksikan dengan ROA. Penelitian ini menggunakan populasi perusahaan manufaktur yang listing di BEI tahun 2007-2008 yang tercantum dalam Indonesian Capital Market Directory, sehingga diperoleh sampel 20 perusahaan yang dipilh dengan purposive sampling. Dengan pooled data didapatkan sebanyak 40 data observasi (20 x 2). Analisis data menggunakan regresi linear berganda dengan uji hipotesis t secara parsial. Hasil penelitian ini menunjukkan bahwa kepemilikan manajerial, kepemilikan institusional, ukuran dewan komisaris, dan ukuran dewan direksi tidak berpengaruh terhadap ROA. Hal ini dimungkinkan terjadi karena rendahnya kesadaran penerapan GCG dan GCG bukan satu-satunya faktor pembentuk ROA. Saran untuk penelitian selanjutnya adalah menambah jumlah sampel yang tidak terbatas pada perusahaan manufaktur yang listing di BEI saja, serta dapat menggunakan variabel independen lain yang dapat mempengaruhi ROA misalnya ukuran perusahaan atau struktur aktiva perusahaan. Bagi perusahaan diharapkan menginformasikan keadaan keuangan perusahaan dengan sebenar-benarnya agar laporan keuangan dapat mencerminkan keadaan perusahaan yang sesungguhnya. Selain itu, perusahaan hendaknya memaksimalkan fungsi dari website perusahaan agar tidak menyesatkan investor dalam mengambil keputusan berinvestasi. Bagi investor diharapkan mempertimbangkan kinerja keuangan perusahaan lainnya ketika akan berinvestasi dengan mengamati variabel lain selain variabel fundamental perusahaan sebagai dasar ketika akan berinvestasi.

Identifikasi dan isolasi jenis mikroalga planktonik di Ranu Klindungan Grati Kabupaten Pasuruan Jawa Timur / Musa'adah

 

Kata kunci: Ranu Klindungan, Mikroalga, Identifikasi, Isolasi Ranu Klindungan merupakan salah satu danau yang terletak di desa Ranu Klindungan, Kecamatan Grati Kabupaten pasuruan. Air di Ranu Klindungan berwarna kehijauan yang menandakan adanya mikroalga di dalamnya. Mikroalga memiliki banyak manfaat antara lain di bidang pangan, industri maupun kesehatan misalnya: Scenedesmus sp. sebagai sumber biofuel, Chlorella sp untuk antibiotik dan Protein Sel Tunggal (PST). Identifikasi dan isolasi merupakan langkah awal untuk membudidayakan mikroalga sehingga dapat diambil manfaatnya. Penelitian ini bertujuan untuk memberikan informasi jenis mikroalga plantonik yang teridentifikasi dan terisolasi dari Ranu Klindungan Grati. Penelitian ini termasuk penelitian deskriptif eksploratif. Identifikasi menggunakan buku The Freshwater Algae of The United States karangan Gilbert M. Smith (tahun 1950), buku How To Know The Freshwater Algae karangan G.W. Prescott (tahun 1978) dan buku Freshwater Algae Identification and Use as Bioindicators karangan Edward G. Bellinger & David C. Sigee (tahun 2010). Metode isolasi menggunakan metode isolasi goresan pada medium Walne. Mikroalga planktonik yang berhasil diidentifikasi dari Ranu Klindungan grati ada 41 spesies yang terdiri dari: 4 divisi (Chrysophyta, Chlorophyta, Chyanophyta, dan Pyrrophyta), 5 kelas, 22 famili, dan 37 genus. Spesies mikroalga tersebut yaitu: Palmella miniata, Hormidium subtile, Protococcus viridis, Oedogonium sp., Palmellococcus protothecoides, Oocystis elliptica, Selenastrum gracile, Scenedesmus dimorphus, Spyrogira protecta, Staurastrum fucigerum, Cosmarium circulare, Staurastrum natator, Gonium sp, Chlorococcum sp., Scenedesmus ornatus, Synechocytis aquatilis, Chroococcus turgidus, Gleocapsa magma, Gleocapsa punctata, Synechococcus aeruginosus, Merismopedia punctate, Spirulina princeps, Borzia trilocularis, Pluto caldarius, Hyella Fontana, Navicula rhynchocephala, Nitzchia palea, Navicula gracilis, Anomoeoneis serians, Stauroneis anceps, Brebissonia boeckii, Gyrosigma sp., Cymbella cistula, Diatoma hyemalis, Synedra acus, Aulacoseria granulate, Botrydiopsis arhiza, Goniochloris sculptra, Leuvenia natans, Mischococcus confervicola, Gloeodinium montanum. Mikroalga plamktonik yang terisolasi ada 10 spesies yaitu: Scenedesmus dimorphus, Cosmarium circulare, Protococcus viridis, Gonium sp., Nitzcschia palea, Selenastrum gracile, Oedogonium sp., Chlorococcum sp., Pluto caldarius, Scenedesmus ornatus. Berdasarkan hasil penelitian disarankan untuk penelitian selanjutnya agar memperhatikan sterilitas pada proses isolasi agar mikroalga dapat terisolasi. Nutrisi media kultur dan faktor lingkungan di ruang kultur sebaiknya lebih disesuaikan dengan kebutuhan mikroalga yang diinginkan agar dapat terisolasi dengan baik.

Pengembangan modul pendidikan jasmani dan olahraga dan kesehatan untuk kelas VII semester genap di SMP Negeri 18 Kota Malang / Anita Dili S.

 

Kata Kunci: Pengembangan, Modul, Pendidikan Jasmani, Olahraga dan Kesehatan. Pendidikan jasmani, olahraga dan kesehatan merupakan salah satu mata pelajaran yang tercantum dalam kurikulum pendidikan. Pendidikan jasmani, olahraga dan kesehatan juga harus memiliki buku ajar lain yang menunjang aktivitas belajar. Buku ajar untuk mata pelajaran pendidikan jasmani, olahraga dan kesehatan yang diperlukan harus sesuai dengan sarana dan prasarana yang terdapat di sekolah dan sesuai dengan KTSP sekolah tersebut. Modul pendidikan jasmani, olahraga dan kesehatan merupakan salah satu sumber belajar yang dapat digunakan baik siswa maupun guru kelas VII di SMP Negeri 18 Malang untuk membantu proses pembelajaran. Modul ini dikembangkan sesuai dengan karakteristik pada SMP Negeri 18 Malang. Tujuan dari penelitian ini adalah mengembangkan modul pendidikan jasmani, olahraga dan kesehatan untuk kelas VII semester Genap di SMP Negeri 18 Malang yang diharapkan dapat membantu dalam pembelajaran. Dalam penelitian ini mengacu pada metode penelitian dan pengembangan dari Borg and Gall (1983:775). Dari sepuluh langkah yang dikemukakan oleh Borg & Gall, penelitian dan pengembangan ini tidak menggunakan keseluruhan tetapi hanya menggunakan 7 langkah saja. Hal ini disebabkan karena langkah-langkah yang diambil disesuaikan dengan kebutuhan penelitian dan pengembangan. Adapun 7 langkah yang dipilih oleh peneliti untuk pengembangan buku ajar pendidikan jasmani, olahraga dan kesehatan adalah sebagai berikut: 1) riset dan pengumpulan informasi dalam melakukan penelitian awal atau analisis kebutuhan dengan angket yang ditujukan kepada 2 orang guru pendidikan jasmani, olahraga dan kesehatan dan 1 orang wakasek kurikulum 2) pengembangan rancangan produk, 3) evaluasi para ahli dengan menggunakan 1 ahli media dan 2 ahli pembelajaran pendidikan jasmani, olahraga dan kesehatan yang menghasilkan berupa produk awal, 4) revisi rancangan produk berdasarkan evaluasi para ahli (hasil rancangan produk berupa produk awal) dan uji coba kelompok kecil, 5) revisi hasil uji coba lapangan kelompok kecil, 6) uji coba kelompok besar, 7) revisi hasil uji coba lapangan kelompok besar. Berdasarkan hasil analisis data uji coba kelompok kecil terhadap 7 orang siswa dan uji coba kelompok besar terhadap 35 orang siswa kelas VII SMP Negeri 18 Malang, dapat disimpulkan bahwa 89,85 % siswa menyatakan bahwa modul pendidikan jasmani, olahraga dan kesehatan untuk VII semester genap SMP Negeri 18 Malang sangat jelas dan sangat membantu dalam belajar. Diharapkan modul tersebut menjadi referensi oleh guru pendidikan jasmani dalam memberikan materi pendidikan jasmani.

Pengaruh budaya organisasi dan leader-member exchange terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan SDM dan umum PT PG Krebet Baru Bululawang) / Aulia Nisaa Haula

 

Kata kunci : budaya organisasi, Leader-member Exchange, kepuasan kerja, komitmen organisasi Sumber daya manusia memiliki peran sentral dalam pencapaian tujuan organisasi. Beberapa hal perlu diperhatikan untuk dapat mempertahankan karyawan yang berpotensi untuk bisa merasa betah dan senang bekerja pada perusahaan. Untuk bisa meningkatkan komitmen organisasi karyawan maka budaya organisasi dan leadermember exchange serta kepuasan kerja perlu diperhatikan. Setiap individu yang bekerja membutuhkan budaya organisasi yang kuat dan hubungan atasan bawahan yang mendukung agar perilaku karyawan dapat terarah sehingga tujuan perusahaan dapat cepat tercapai. Dengan tercapainya tujuan perusahaan dan terpenuhinya kebutuhan karyawan, maka kepuasan kerjapun akan mereka dapatkan. Apabila ketiga variable tersebut, yaitu budaya organisasi, Leader-member Exchange, dan kepuasan kerja telah mereka dapatkan, maka akan terciptalah komitmen organisasi dalam diri karyawan. Penelitian ini dilaksanakan di PT PG Krebet Baru Bululawang. Subyek penelitian ini adalah karyawan SDM dan Umum PT PG Krebet Baru yang berjumlah 61 orang. Dalam pengambilan sampel dilakukan dengan menggunakan teknik proportional random sampling sehingga menghasilkan jumlah sampel sebanyak 53 orang. Analisis data yang dipakai adalah analisis jalur (path analysis) yang merupakan suatu bentuk terapan dari analisis regresi berganda (multiple regression analysis). Tujuan dari analisis jalur adalah untuk mengetahui pengaruh langsung dan pengaruh tidak langsung. Tujuan peneltian ini untuk mengetahui pengaruh langsung maupun tidak langsung budaya organisasi dan leader-member exchange terhadap komitmen organisasi melalui kepuasan kerja pada karyawan SDM dan Umum PT PG Krebet Baru. Hasil yang didapat dari penelitian ini adalah: (1) Budaya organisasi secara positif dan signifikan berpengaruh terhadap kepuasan kerja karyawan SDM dan Umum PT Krebet Baru; (2) Leader-member exchange secara positif dan signifikan berpengaruh terhadap kepuasan kerja karyawan SDM dan Umum PT PG Krebet Baru; (3) Kepuasan kerja secara positif dan signifikan berpengaruh terhadap komitmen organisasi karyawan SDM dan Umum PT PG Krebet Baru; (4) Budaya organisasi secara positif dan signifikan berpengaruh terhadap komitmen organisasi karyawan SDM dan Umum PT PG Krebet Baru; (5) Leader-member exchange secara positif dan signifikan berpengaruh terhadap komitmen organisasi karyawan SDM dan Umum PT PG Krebet Baru; (6) Budaya organisasi secara tidak langsung berpengaruh terhadap komitmen organisasi melalui kepuasan kerja pada karyawan SDM dan Umum PT PG Krebet Baru; (7) Leader-member exchange secara tidak langsung berpengaruh terhadap komitmen organisasi melalui kepuasan kerja pada karyawan SDM dan Umum PT PG Krebet Baru. Sehingga dari hasil penelitian tersebut dapat disarankan bagi perusahaan untuk tetap meningkatkan budaya organisasi, kualitas hubungan antara pemimpin dan bawahan agar kepuasan kerja karyawan dapat ditingkatkan. Jika karyawan merasa puas maka akan tercipta komitmen organisasi dalam diri karyawan tersebut.

Pengembangan kurikulum muatan lokal pertanian mangga Probolinggo untuk SD kelas 4 di SDN Patokan 1 Kraksaan / Ananda Dwi H.K.

 

Kata Kunci: Pengembangan, Kurikulum Muatan Lokal, Pertanian Mangga Probolinggo Kurikulum adalah seperangkat rencana dan pengaturan mengenai tujuan, isi, dan bahan pelajaran serta cara yang digunakan sebagai pedoman penyelenggaraan kegiatan pembelajaran untuk mencapai tujuan pendidikan tertentu. Muatan Lokal merupakan kegiatan kurikuler untuk mengembangkan kompetensi yang disesuaikan dengan ciri khas dan potensi daerah, termasuk keunggulan daerah, yang materinya tidak dapat dikelompokkan ke dalam mata pelajaran yang ada. Substansi mata pelajaran muatan lokal ditentukan oleh satuan pendidikan, tidak terbatas pada mata pelajaran keterampilan Dapat diamati pada saat ini masih belum ditemukannya kurikulum muatan lokal yang memberikan pengetahuan tentang ciri khas ataupun potensi suatu daerah. Meskipun sangat disadari bahwa kurikulm muatan lokal yang mengangkat tentang ciri khas atau potensi suatu daerah sangat diperlukan bagi peserta didik untuk lebih mengenal tentang daerah masing-masing. Adanya kecenderungan tersebut menggugah hati pengembang untuk membuat suatu kurikulum muatan lokal yang mengangkat potensi yang ada di daerah Probolinggo yakni pertanian mangga. Muatan lokal ini bertujuan untuk tetap melestarikan dan mengenalkan salah satu potensi pertanian yang ada di Probolinggo kepada para peserta didik yang selama ini hanya mengetahui hasil buahnya saja tapi mereka tidak tahu proses yang dilakukan sampai akhirnya menjadi sebuah mangga yang siap dikonsumsi. Hasil penelitian kurikulum muatan lokal “pertanian mangga Probolinggo” ini dinyatakan valid dengan hasil perhitungan dari ahli kurikulum diknas kabupaten Probolinggo sebesar 90% dan hasil perhitungan dari dosen ahli kurikulum jurusan teknologi pendidikan sebesar 95%. Hal ini menunjukkan bahwa kurikulum muatan lokal “pertanian mangga Probolinggo” dapat dikembangkan dan diterapkan pada sekolah-sekolah yang berada di Probolinggo sebagai terobosan baru dalam pembelajaran yang mengangkat tentang potensi dan ciri khas daerah Probolinggo. Kesimpulan dari pengembangan ini adalah kurikulum muatan lokal “pertanian mangga Probolinggo” yang dikembangkan termasuk valid dan layak untuk diterapkan pada sekolah-sekolah dasar yang berada di daerah Probolinggo sebagai terobosan baru dalam dunia pembelajaran di Probolinggo yang mengangkat tentang suatu ciri khas dan potensi dari Probolinggo. ii Berdasarkan hasil penelitian ini saran dari pengembangan ini adalah: (1) bagi Diknas, diknas harus lebih bisa mengembangkan potensi dan ciri khas yang ada di daerah kedalam suatu kurikulum muatan lokal yang nantinya dapat dipelajari oleh siswa siswi sebagai suatu pembelajaran yang baru, (2) bagi Sekolah Dasar Negeri Patokan 1 Kraksaan dapat digunakan sebagai bahan pertimbangan untuk menerapkan kurikulum muatan lokal “pertanian mangga Probolinggo”, (3) bagi pengembang berikutnya, mengkaji lebih dalam pada saat pemilihan isi materi yang akan dikembangkan, sehingga nantinya materi yang akan dikembangkan selanjutnya dapat lebih lengkap dan jelas tentunya sesuai dengan kebutuhan masyarakat daerah setempat.

Penerapan Pembelajaran Berbasis Masalah (PBM) untuk mengetahui kemampuan representasi siswa kelas VIII pada materi panjang garis singgung persekutuan dua lingkaran / Lina Purnamasari

 

Kata Kunci: Pembelajaran Berbasis Masalah (PBM), Kemampuan Representasi, Panjang Garis Singgung Persekutuan Dua Lingkaran Di sekolah, penyajian materi panjang garis singgung persekutuan dua lingkaran berdasarkan pengalaman peneliti dimulai dengan mengajarkan teori atau definisi terlebih dahulu, kemudian diberikan contoh-contoh dan latihan. Dari pembelajaran seperti itu, peneliti hanya menghafal rumusnya saja tanpa mengetahui asal rumus tersebut. Kegiatan pembelajarannya juga tidak mengaitkan kehidupan nyata yang berkaitan dengan materi panjang garis singgung persekutuan dua lingkaran. Guru juga tidak melibatkan siswa secara aktif dalam menemukan konsep dari suatu materi. Kondisi ini membuat proses pembelajaran menjadi pasif karena siswa hanya mendengarkan apa yang dijelaskan oleh guru, siswa masih takut untuk mengemukakan pendapat, dan menjawab ketika guru bertanya. Pembelajaran Berbasis Masalah (PBM) membantu siswa mengembangkan kemampuan berpikir, keterampilan memecahkan masalah, dan membantu siswa menjadi pembelajar yang mandiri. PBM ini diharapkan akan membantu atau mempermudah guru dalam melaksanakan pembelajaran matematika. Untuk mengetahui seberapa jauh siswa memahami matematika yang dipelajari, guru perlu mengungkapnya agar siswa mempresentasikan mentalnya tentang konsep matematika yang telah ada di benaknya. Dengan demikian representasi sebagai gambaran mental memungkinkan matematika menjadi transparan. Karena itu dalam penelitian ini akan dilaksanakan Pembelajaran Berbasis Masalah untuk mengetahui kemampuan representasi siswa. Tujuan dari penelitian ini adalah untuk mengetahui kemampuan representasi geometri dan kemampuan aljabar siswa pada materi panjang garis singgung persekutuan dua lingkaran dalam PBM. Penelitian ini adalah penelitian deskriptif (school survey) dengan subyek penenlitian siswa kelas VIII B SMP 6 Negeri 8 Malang tahun ajaran 2010/2011. Penelitian dilaksanakan pada bulan Januari 2011 dalam dua pertemuan. Hasil penelitian ini dapat disimpulkan bahwa kemampuan representasi geometri dan kemampuan aljabar siswa pada materi panjang garis singgung persekutuan dua lingkaran dalam PBM masih kurang. Namun dengan PBM siswa bisa mengembangkan kemampuan berpikirnya meskipun belum maksimal. Dengan PBM juga siswa bisa berkolaborasi dengan siswa lain dan belajar untuk bertukar pikiran. Kemampuan representasi geometri dan kemampuan representasi aljabar siswa akan semakin baik jika terdapat langkah-langkah penyelesaian masalah. Hasil pengerjaannya akan lebih runtut jika dibandingkan dengan masalah yang tidak ada langkah-langkah penyelesaiannya. Selain itu, siswa juga masih kesulitan mentransformasikan representasi gambar (geometri) ke simbol aljabar.

Pengaruh ekuitas merek terhadap loyalitas konsumen pengguna kartu seluler Indosat M3 (studi kasus pada mahasiswa Akuntansi Fakultas Ekonomi Universitas Negeri Malang) / Bagus Wiyanta Sukma B.A.

 

Kata Kunci: Ekuitas Merek, Kesadaran Merek, Asosiasi Merek, Persepsi Kualitas, Loyalitas Merek, Loyalitas Konsumen Pada era yang sarat teknologi seperti sekarang, membutuhkan kecerdasan lebih dalam rangka merebut hati konsumen. Untuk menghadapi tantangan pemasaran barang atau jasa yang sangat tinggi dan semakin kompleks, ekuitas merek yang terdiri dari kesadaran merek, asosiasi merek, persepsi kualitas serta loyalitas merek mampu menjawab persaingan yang ada jika dilakukan dengan tepat dan terarah. Hasil akhir yang diharapkan adalah terbentuknya loyalitas konsumen sehingga adanya penggunaan yang berkelanjutan. Penelitian ini bertujuan untuk mengetahui pengaruh ekuitas merek yang terdiri dari kesadaran merek, asosiasi merek, persepsi kualitas, dan loyalitas merek baik secara parsial maupun simultan terhadap loyalitas konsumen pengguna kartu seluler Indosat M3 (studi kasus pada Mahasiswa Akuntansi 2008 Fakultas Ekonomi Universitas Negeri Malang). Populasi dalam penelitian ini adalah mahasiswa pengguna kartu seluler Indosat M3 Akuntansi 2008 Fakultas Ekonomi Universitas Negeri Malang. Menggunakan sampel sebanyak 100 responden dengan teknik pengambilan sampel proportionate random sampling, teknik pengumpulan data dengan kuesioner tertutup, serta teknik analisis data dengan menggunakan teknik analisis statistik deskriptif dan teknik analisis regresi linier berganda. Hasil penelitian ini menyimpulkan bahwa mahasiswa Akuntansi 2008 Fakultas Ekonomi Universitas Negeri Malang memiliki kesadaran merek, asosiasi merek, persepsi kualitas, loyalitas merek, serta loyalitas konsumen yang tinggi terhadap produk kartu seluler Indosat M3. Kedua adalah ekuitas merek yang terdiri dari kesadaran merek, asosiasi merek, persepsi kualitas, dan loyalitas merek secara parsial dan simultan berpengaruh postif signifikan terhadap loyalitas konsumen pengguna kartu seluler Indosat M3 pada Mahasiswa Akuntansi 2008 Fakultas Ekonomi Universitas Negeri Malang. Saran berdasarkan temuan dalam penelitian ini adalah untuk membangun ekuitas merek yang tinggi dengan harapan adanya loyalitas konsumen yang tinggi dapat dilakukan perusahaan Indosat khususnya produk Indosat M3 dengan cara meningkatkan kesadaran merek melalui kegiatan promosi, meningkatkan asosiasi merek dengan memberikan tarif yang lebih inovatif, meningkatkan persepsi kualitas dengan cara memberikan jaminan sinyal kuat, serta meningkatkan loyalitas merek dengan cara memberikan pelayanan prima pada konsumen. Saran kedua bagi penelitian selanjutnya untuk menambah subvariabel ekuitas merek dengan harapan memperluas hasil penelitian sehingga dapat berperan dalam pengembangan ilmu pengetahuan.

Keanekaragaman arthropoda permukaan tanah pada lahan pertanian wortel (Daucus carota) sebagai indikator lingkungan / Hesteria Aritalitha

 

Kata Kunci : keanekaragaman, arthropoda permukaan tanah, pertanian wortel (Daucus carota), indikator lingkungan. Arthropoda permukaan tanah memiliki peranan yang penting dalam ekosistem pertanian, Arthropoda permukaan tanah berperan dalam jaring makanan yaitu sebagai herbivor, karnivor, dan detrivor. Selain berperan dalam jaring makanan, Arthropoda permukaan tanah juga berperan dalam proses dekomposisi tanah. Arthropoda permukaan tanah akan mengahancurkan substansi yang ukurannya lebih besar menjadi ukuran yang lebih kecil sehingga proses dekomposisi dapat dilanjutkan oleh fauna tanah yang lain. Teknik budidaya pertanian umumnya menurunkan jumlah individu dan deversitas fauna tanah termasuk Arthropoda permukaan tanah. Selain itu, kegiatan budidaya pertanian dapat merubah kondisi tanah. Oleh karena itu, penelitian dibutuhkan untuk memperoleh informasi tentang keanekaragaman dan kemerataan Arthropoda permukaan tanah sehingga dapat diketahui tingkat kestabilan ekosistem pada lahan pertanian wortel dan faktor abiotik yang paling mempengaruhi keanekaragaman Arthropoda permukaan tanah pada lahan pertanian wortel. Jenis penelitian ini bersifat deskriptif dengan pendekatan kuantitatif untuk penghitungan indeks keanekaragaman pada lahan pertanian wortel. Pengambilan data dilakukan pada bulan Maret sampai dengan April 2011. Tempat penelitian dilakukan pada lahan pertanian wortel di Desa Pandesari Kabupaten Pujon. Identifikasi jenis Arthropoda permukaan tanah dilakukan sampai tingkat spesies. Penghitungan indeks keanekaragaman dengan menggunakan indeks keanekaragaman Shanon-Wienner, Sedangkan untuk mengetahui faktor abiotik yang paling mempengaruhi keanekargaman jenis Arthropoda permukaan tanah menggunakan analisis Regresi Ganda Bertahap. Hasil penelitian untuk jenis Arthropoda permukaan tanah yang ditemukan sebanyak 15 famili yang terdiri dari 17 taksa Arthropoda permukaan tanah. Indeks keanekaragaman Arthropoda permukaan tanah pada lahan pertanian wortel berkisar antara 0,678 sampai dengan 1,574. Sedangkan indeks kemerataannya mendekati 1. pH tanah, suhu tanah, kelembaban tanah dan bahan organik tanah merupakan faktor abiotik yang mempengaruhi keanekaragaman Arthropoda permukaan tanah. Berdasarkan hasil indeks keanekaragaman Arthropoda permukaan tanah lahan pertanian wortel pada lokasi penelitian tergolong dalam lingkungan yang tidak stabil sampai dengan stabil.

Perancangan mesin penetas telur full otomatis untuk meningkatkan kualitas dan produktivitas penetasan telur ayam buras di Kabupaten Blitar / Rahmat Hidayat

 

Kata Kunci : perencanaan, mesin penetas telur, ayam buras, otomatis, Kabupaten Blitar. Saat ini masih banyak usaha kecil di masyarakat yang belum tersentuh teknologi maju, padahal teknologi produksi yang ada terus berkembang. Oleh karena itu kami sebagai Mahasiswa Fakultas Teknik berusaha menjembatani antara masyarakat yang haus akan teknologi dan dunia perguruan tinggi yang melimpah dengan ilmu dan teknologi. Masyarakat membutuhkan sebuah teknologi yang bisa menyelesaikan permasalahan yang sedang mereka hadapi. Salah satu cara yang bisa ditempuh adalah melalui penelitian dan pengembangan teknologi di bidang peternakan, khusunya penetasan telur ayam. Ayam merupakan suatu komoditi yang permintaanya semakin meningkat dari tahun ke tahun. Hal ini terus berkembang seiring dengan pertumbuhan jumlah penduduk dunia, khususnya Indonesia. Sebagaimana data dari Kementrian Pertanian, bahwa pertumbuhan kebutuhan telur mencapai 10% per tahunnya. Sedangkan daging ayam buras dan ayam ras 4% dan 13%. Begitu pula diungkapkan Ketua Umum Ikatan Sarjana Peternakan Indonesia (ISPI) Yudhi Guntara, tahun 2011 produksi telur nasional diperkirakan sebesar 1,2 juta ton - 1,5 juta ton. Sebagai perbandingan, tahun 2010 lalu produksi telur nasional mencapai 1,4 juta ton. Untuk memenuhi kebutuhan tersebut dibutuhkan banyak dukungan dari berbagai sector. Dalam upaya memacu usaha peternakan unggas perlu adanya sentuhan teknologi yang tepat dan mudah diterapkan. Kabupaten Blitar merupakan salah satu daerah sentra peternakan berbagai jenis ayam yang ada di Jawa Timur. Sistem penetasan yang ada di masyarakat saat ini (khususnya di Blitar dan kebanyakan di daerah lain) masih menggunakan teknologi manual yang membutuhkan banyak tenaga dalam pengoperasiannya. Berdasarkan uraian masalah di atas dirasakan perlu adanya sebuah terobosan untuk mengatasinya, sehingga penulis ingin mengangkat permasalah tersebut kedalam skripsi dengan judul “Perancangan Mesin Penetas Telur Full Otomatis untuk Meningkatkan Kualitas dan Produktivitas Penetasan Telur Ayam Buras di Kabupaten Blitar”. Tujuan dari penelitian ini adalah: (1).Merancang mesin penetas telur full otomatis yang dilengkapi sensor suhu, sensor kelembaban dan juga pemutar telur otomatis yang bisa dioperasikan dengan mudah. (2). Perancangan dan pembuatan mesin penetas telur full otomatis ini juga bertujuan mengetahui uji kinerja mesin yang akan dibuat. Uji kinerja lebih difokuskan pada kinerja kontrol otomatis ketiga variabel utama yang terdiri dari pengendali suhu, pengendali kelembaban, dan juga pemutar telur otomatis. Metode yang digunakan untuk pengembangan mesin ini adalah dengan metode diskriptif. Adapun langkah-langkahnya adalah sebagai berikut: (1). Perencanaan desain mesin penetas yang meliputi dimensi mesin untuk kapasitas 216 butir telur, mekanisme rak kabinet, pemilihan motor penggerak, dan perhitungan daya motor penggerak engkol peluncur offset yang dimodifikasi untuk mendorong rak telur. Bahan yang digunakan juga harus memenuhi syarat ringan, tahan lama, serta mudah dikerjakan dan dibongkar pasang. (2). Pembuatan bagian mekanik mesin. Mekanik mesin terdiri dari kotak penetasan, rangkaian rak penetasan yang dibuat bertingkat, dan instalasi listrik. Mekanik mesin bisa diibaratkan sebagai tubuh, yang merupakan salah satu bagian utama dari mesin ini. (3). Pembuatan perangkat keras dan perangkat lunak. Perangkat keras terdiri dari rangakaian elektronik power supply, rangkaian pengendali suhu, dan rangkaian pengendali kelembaban. Sedangkan perangkat lunak disusun dengan bahasa C. Perangkat lunak merupakan nyawa dari keseluruhan sistem yang mengendalikan keseluruhan sistem. Untuk mendukung sistem, digunakan mikrokontroller ATmega 16. (4). Pengujian mesin hasil pengembangan. Pengujian terdiri dari 2 tahap besar yang terdiri dari uji teknis dan uji kinerja. Uji teknis terdiri dari pengujian system pengatur suhu ruangan, system pengatur kelembaban, dan sistem pemutar telur otomatis. Pengujian dilakukan dalam waktu beberapa jam untuk memastikan system bekerja dengan baik. Sedangkan uji teknis dilakukan dengan menjalankan mesin selama 23 hari tanpa henti untuk menetaskan telur ayam. Dari pengujian ini bisa diketahui hasil kinerja mesin yang sebenarnya. Mesin penetas ini memiliki beberapa kelebihan dibanding generasi mesin sebelumnya. Kelebihan tersebut meliputi:(1).Dengan sistem full otomatis, operator tinggal menekan tombol “enter” dan sistem penetasan sudah bisa berjalan. Tidak perlu melakukan berbagai pengaturan lagi. (2).Bagi pengguna yang ingin melakukan eksperimen, bisa keluar dari menu otomatis, dan mengatur kondisi lingkungan sesuai yang diinginkan. (3). Sistem pemutar telur otomatis dengan gerakan halus yang frekuensi putarannya bisa diatur hingga tiap 30 menit sekali. (4). Pengaturan suhu dan kelembaban secara digital, hanya dengan memasukkan angka melalui tombol yang disediakan. Kontrol suhu bisa diatur hingga 40oC. Sedangkan kontrol kelembaban relatif bisa dinaikkan hingga 90% RH. (5). Sistem pemrograman yang menggunakan mikrokontroller memberi sejumlah kemudahan untuk operasional. Sistem ini juga sangat fleksibel untuk pengembangan lebih lanjut. (6). Kapasitas mesin maksimal adalah 216 butir telur sehingga sesuai untuk skala produksi.

Analisis buku ajar pendidikan kewarganegaraan (PKn) kelas V Sekolah Dasar (SD) / M. Fahrizal Nurdiansyah

 

Kata Kunci: Analisis Buku Ajar, Kesesuaian Pendekatan Penulisan, Materi, Sistem Evaluasi Dengan Kurikulum KTSP. Buku ajar adalah salah satu sarana dalam proses belajar mengajar. Untuk mendukung proses belajar mengajar diperlukan buku ajar. Buku ajar membantu siswa memahami pelajaran. Oleh karena itu diperlukan buku ajar yang baik, yang melibatkan siswa dan menuntun siswa berpikir kreatif. Buku ajar digunakan sebagai buku penunjang dalam proses pembelajaran. Namun saat ini masih ada beberapa buku yang belum sesuai dengan kurikulum KTSP baik dari segi pendekatan penulisan, kompetensi maupun sistem evaluasi Oleh karena itu, untuk mengatasi kondisi seperti itu, para guru atau calon guru harus memiliki kemampuan menelaah buku ajar. Dalam penelitian ini merumuskan masalah sebagai berikut. (1) Apakah terdapat kesesuaian antara pendekatan penulisan dalam kurikulum KTSP dengan naskah yang tertuang dalam buku ajar PKn SD Kelas V terbitan Tiga Serangkai Pustaka Mandiri? (2) Apakah terdapat kesesuaian antara kompetensi dalam kurikulum KTSP dengan naskah yang tertuang dalam buku ajar PKn SD Kelas V terbitan Tiga Serangkai Pustaka Mandiri? (3) Apakah terdapat kesesuaian antara sistem evaluasi dalam kurikulum KTSP dengan naskah yang tertuang dalam buku ajar PKn SD Kelas V terbitan Tiga Serangkai Pustaka Mandiri? Untuk memecahkan masalah tersebut, penelitian dirancang dengan model analisis isi. Sumber data penelitian ini adalah buku ajar PKn SD/MI Kelas V yang ditulis oleh Ruliana Kuswartinah, penerbit Tiga Serangkai Pustaka Mandiri tahun terbit 2009. Data hasil analisis dikumpulkan menggunakan instrumen. Data yang dikumpulkan sebagai berikut: pertama, kesesuaian pendekatan penulisan pada pelajaran 1, 2, dan 3 sesuai dengan pendekatan filosofis konstruktivisme namun pada akhir pembahasan belum ada konfirmasi jawaban yang tepat, sedangkan pelajaran 4 sesuai dengan pendekatan filosofis kognitivisme. Sudah tertulis pendekatan kurikuler yang berupa SK, KD dan tidak sesuai dengan pendekatan pembelajaran terpadu; kedua, kesesuaian materi dari 4 SK dan 10 KD dijabarkan menjadi 36 indikator, tetapi 16 indikator pembelajaran tidak dibahas; ketiga, kesesuaian sistem evaluasi terdapat 380 sistem evaluasi aspek kognitif, 10 sistem evaluasi aspek afektif dan tidak terdapat sistem evaluasi aspek psikomotor. Berdasarkan data tersebut dapat disimpulkan: pertama, Pendekatan penulisan buku ajar tidak sesuai dengan pendekatan dalam kurikulum KTSP; kedua, Materi dalam buku ajar kurang sesuai dengan kompetensi dalam kurikulum KTSP; ketiga, Sistem evaluasi dalam buku ajar cenderung pada aspek kognitif, sedangkan untuk aspek afektif hanya terdapat afektif yang bersifat kognitif saja, dan tidak terdapat aspek psikomotor. Saran-saran dari hasil penelitian: pertama, ii penulis hendaknya melakukan revisi pada buku ajar PKn kelas V; kedua, bagi guru atau calon guru, sebelum mempergunakan buku ajar, guru dapat menelaah kesesuaian materi buku ajar dengan kurikulum KTSP dan guru bisa mengembangkan sendiri materi jika indikator belum dicantumkan atau memanfaatkan sumber belajar yang lain. Ketiga, bagi peneliti lain hendaknya dapat meneliti materi buku ajar PKn sesuai dengan kurikulum yang berlaku dan karakteristik siswa SD.

Penerapan model pembelajaran problem posing untuk meningkatkan minat dan hasil belajar biologi siswa kelas X SMA Negeri 1 Purwosari / Muflihatul Lailiyah

 

Berdasarkan hasil observasi dan wawancara awal di SMA Negeri I Purwosari, dapat diketahui minat siswa dalam pelajaran Biologi masih kurang. Hal ini dapat diketahui dari kurangnya perhatian, keingintahuan, dan keaktifan siswa ketika proses belajar mengajar. Siswa masih banyak yang ngantuk, tidak memperhatikan penjelasan guru, mencontek pekerjaan teman, dan tidak berani bertanya ataupun berpendapat. Metode yang digunakan guru ketika proses belajar mengajar adalah ceramah dan tanya jawab, sehingga dapat membuat siswa bosan dan kurang berminat terhadap pelajaran Biologi. Selain minat belajar, berdasarkan hasil observasi menunjukkan hasil belajar Biologi juga rendah yaitu 69.4 dan persentase ketuntasan kelas 42.5% pada materi Animalia. Dengan demikian perlu diterapkan suatu model pembelajaran yang dapat meningkatkan minat dan hasil belajar Biologi, salah satuya dengan menggunakan model pembelajaran problem posing. Problem posing merupakan suatu model pembelajaran yang mengharuskan siswa untuk membuat pertanyaan. Pengajuan pertanyaan/soal merupakan suatu kegiatan yang menantang bagi siswa sehingga dapat memacu minat siswa dalam belajar, selain itu dengan problem posing siswa akan mengkonstruksi pikiran-pikirannya dalam rangka pemahaman baru berdasarkan informasi yang tersedia sehingga terbentuk suatu pemahaman konsep dan mendorong siswa untuk lebih bertanggung jawab dalam belajar. Jenis penelitian ini adalah penelitian tindakan kelas (PTK) yang terdiri dari 2 siklus. Masing-masing siklus terdiri dari 4 tahapan yaitu perencanaan, pelaksanaan, observasi dan refleksi. Subyek yang digunakan dalam penelitian ini adalah siswa kelas X-5 SMA Negeri I Purwosari semester genap dengan jumlah 26 siswa perempuan dan 14 siswa laki-laki. Materi yang digunakan adalah Ekosistem, Kerusakan Lingkungan, dan Limbah. Instrumen yang digunakan terdiri atas lembar observasi keterlaksanaan pembelajaran guru, lembar observasi keterlaksanaan pembelajaran siswa, catatan lapangan, lembar observasi minat belajar, tes hasil belajar kognitif dan tes hasil belajar afektif. Hasil penelitian menunjukkan bahwa (1) Penerapan model pembelajaran problem posing dapat meningkatkan minat belajar Bologi siswa kelas X SMA Negeri I Purwosari. Minat belajar meliputi tiga aspek yaitu perhatian, keingintahuan, dan keaktifan. Aspek perhatian meningkat dari 81.9% pada siklus I menjadi 95.6% pada siklus II, keingintahuan meningkat dari 74.7% pada siklus I menjadi 83.9% pada siklus II, keaktifan meningkat dari 62.2% pada siklus I menjadi 81.1% pada siklus II. (2) Penerapan model pembelajaran problem posing dapat meningkatkan hasil belajar Biologi siswa kelas X SMA Negeri I Purwosari. Hasil belajar yang diukur meliputi hasil belajar kognitif dan hasil belajar afektif. Persentase ketuntasan hasil belajar kognitif menurun dari 42.5% sebelum tindakan, menjadi 40% pada siklus I, dan meningkat menjadi 72.5% pada siklus II. Hasil belajar afektif diukur menggunakan sikap yang meliputi tiga komponen yaitu kognisi, afeksi, dan konasi. Komponen kognisi meningkat dari 95% pada siklus I menjadi 100% pada siklus II, komponen afeksi meningkat dari 97.5% pada siklus I menjadi 100% pada siklus II, dan komponen konasi meningkat dari 87.5% pada siklus I menjadi 97.5% pada siklus II. Berdasarkan analisis dan pembahasan yang telah dilakukan dapat disimpulkan bahwa penerapan model pembelajaran problem posing dapat meningkatkan minat dan hasil belajar Biologi siswa kelas X SMA Negeri I Purwosari. Saran untuk pembelajaran selanjutnya sebaiknya guru menyuruh siswa untuk membuat pertanyaan di rumah dan pertanyaan yang dibuat siswa boleh lebih dari satu pertanyaan supaya keingintahuan siswa dalam bertanya dapat tersalurkan dengan baik, selain itu diharapkan guru lebih memberikan perhatian kepada siswa mengenai keterampilan mengajukan pertanyaan sekaligus pemecahannya supaya siswa tidak hanya mampu dalam membuat pertanyaan tetapi juga mampu dalam pemecahannya.

Analisis faktor-faktor yang menentukan preferensi belanja online oleh konsumen pada produk fashion (studi pada mahasiswa Fakultas Ekonomi, Universitas Negeri Malang) / Aprian Ramadhani

 

Kata Kunci: Analisis Faktor, Preferensi Belanja Online, Produk Fashion. Internet perlahan-lahan telah menggeser budaya pembelian produk dari cara konvensional menjadi lebih praktis dan modern melalui suatu cara yang disebut sebagai belanja online (online shopping), tak terkecuali pada produk fashion. Produk fashion yang meliputi berbagai produk seperti pakaian, sepatu, tas dan berbagai aksesoris lainnya sudah sering dijumpai di layar monitor komputer pribadi setiap orang yang mengakses internet, yang memungkinkan seseorang untuk tertarik membeli produk fashion secara online. Ketertarikan seseorang dalam berbelanja produk fashion secara online tersebut dapat ditentukan oleh faktor-faktor yang meliputi harga, pelayanan, waktu, dan alternatif, yang pada akhirnya menimbulkan suatu kegiatan transaksi jual beli melalui internet. Tujuan dari penelitian ini adalah untuk mengetahui apakah variabelvariabel yang meliputi faktor harga (X1), pelayanan (X2), waktu (X3), dan alternatif (X4) menentukan preferensi belanja online produk fashion, serta untuk mengetahui faktor apa yang paling dominan diantara keempat faktor tersebut dalam menentukan preferensi belanja online produk fashion. Tidak ada variabel bebas maupun variabel terikat dalam penelitian ini, tetapi variabel satu dengan yang lainnya saling berketergantungan (interdependent variable). Jenis penelitian yang digunakan adalah penelitian deskriptif. Populasi yang dipilih adalah mahasiswa Fakultas Ekonomi, Universitas Negeri Malang yang pernah berbelanja produk fashion secara online sebanyak 180 responden. Pengambilan sampel penelitian ini dilakukan dengan metode accidental sampling, dan metode analisis yang digunakan adalah analisis faktor. Hasil analisis yang didapat dari penyebaran kuesioner menunjukkan bahwa: (1) Harga, pelayanan, waktu, dan alternatif merupakan faktor-faktor yang menentukan preferensi belanja online produk fashion; (2) Waktu merupakan faktor yang paling dominan dalam menentukan preferensi belanja online produk fashion. Saran yang dapat direkomendasikan terkait hasil penelitian yang didapatkan adalah: (1) Melihat waktu merupakan faktor paling dominan, hendaknya penjual online harus memperhatikan jumlah waktu yang dibutuhkan konsumen selama proses transaksi; (2) Penjual online harus memperhatikan tingkat harga yang masuk akal, meningkatkan pelayanan, serta ragam pilihan produk; (3) Konsumen harus lebih selektif memperhatikan dan memahami secara cermat mengenai informasi yang diberikan penjual sebelum berbelanja online; (4) Penelitian lanjutan perlu dilakukan dengan analisis kausal terhadap penelitian ini, atau dengan memperluas variabel maupun pengembangan indikator serta item lain yang diduga juga sebagai faktor yang menentukan preferensi belanja online.

Studi tentang kompetensi profesional guru mata diklat produktif teknik komputer jaringan SMK Bertaraf Internasional di Malang / Slamet Winarto

 

Tesis, Program Studi Pendidikan Kejuruan, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. Haris Anwar Syafrudie, M.Pd, (2) Hakkun Elmunsyah, ST, M.T. Kata kunci : kompetensi profesional, guru mata diklat prokdukti tkj Kompetensi profesional guru diperlukan untuk meningkatkan kualitas pendidikan, pembinaan profesional guru perlu dilakukan secara terus menerus melalui berbagai bentuk kegiatan, di antara adalah pembinaan penguasaan landasan pendidikan, merancang pembelajaran, melaksanakan proses pembelajaran, mengevaluasi hasil belajar, pengembangan keilmuan dan penguasaan substansi keilmuan. Penelitian ini bertujuan mendeskripsikan kompetensi profesional guru mata diklat produktif teknik komputer dan jaringan SMK bertaraf internasional di Malang. Populasi penelitian adalah 50 guru. Rancangan penelitian adalah deskriptif. Pengumpulan data menggunakan kuesioner setelah melaluai uji validitas dan reliabilitas, pengolahan data menggunakan statistik deskriptif . Hasil penelitian menunjukkan: (1) kompetensi profesional guru mata diklat produktif teknik komputer dan jaringan kategori cukup baik (66%), (2) terdapat guru yang kompetensi profesionalnya jauh di bawah rata-rata atau jauh dari standar kualifikasi yang dipersyaratkan dan ada yang mendekati ideal, serta belum berorientasi pada kualitas dan cita-cita profesi. Berdasarkan temuan penelitian disarankan: (1) perlunya peningkatan kompetensi guru mata diklat produktif teknik komputer dan jaringan oleh instansi terkait dalam hal ini pemerintah dan fihak sekolah, (2) segera dilakukan identifikasi kompetensi profesional guru dengan melibatkan lembaga profesional untuk pemerataan tingkat kompetensi guru mata diklat teknik komputer dan jaringan, serta diharapkan guru selalu berorientasi pada kualitas dan cita-cita profesi.

Pengaruh corporate social responsibility disclosure terhadap kinerja pasar perusahaan (studi empiris pada perusahaan manufaktur yang tercatat di Bursa Efek Indonesia pada tahun 2007-2009) / Nadiyah Akbariyah

 

Kata Kunci : Corporate Social Responsibility Disclosure, Kinerja Pasar Perusahaan Corporate Social Responsibility (CSR) merupakan klaim agar perusahaan tak hanya beroperasi untuk kepentingan para pemegang saham (shareholders), tapi juga untuk kemaslahatan pihak stakeholders dalam praktik bisnis, yaitu para pekerja, komunitas lokal, pemerintah, LSM, konsumen, dan lingkungan. Pengambilan keputusan ekonomi hanya dengan melihat kinerja keuangan suatu perusahaan, saat ini sudah tidak relevan lagi. Investor kini juga memperhatikan kinerja lingkungan perusahaan yang berdampak pada kinerja pasar perusahaan. Kinerja pasar diproksikan dengan menggunakan Akumulasi Return Tidak Normal (ARTN) atau Cumulative Abnormal Return (CAR).CAR merupakan penjumlahan return tidak normal hari sebelumnya di dalam periode peristiwa untuk masingmasing sekuritas. Penelitian ini bertujuan untuk mengetahui pengaruh CSR disclosure terhadap kinerja pasar perusahaan. Berdasarkan metode purposive sampling, telah diperoleh 47 sampel dari 421 populasi perusahaan manufaktur yang tercatat di Bursa Efek Indonesia pada tahun 2007-2009. Penelitian ini dilakukan dengan menggunakan uji regresi sederhana. Pada pengujian hipotesis diperoleh hasil bahwa CSR disclosure berpengaruh terhadap CAR. Hasil analisis juga menunjukkan bahwa CSR disclosure berpengaruh positif terhadap kinerja pasar perusahaan. Penjelasan tersebut memiliki makna bahwa semakin tinggi CSR disclosure maka semakin tinggi juga CAR perusahaan. Berdasarkan hasil penelitian ini disarankan untuk memperbanyak jumlah sampel untuk dapat menggambarkan kondisi pasar yang sesungguhnya dan memperpanjang rentang waktu data penelitian yang digunakan agar dapat memprediksikan hasil penelitian dalam jangka panjang.

Pengukuran kalor jenis zat padat / Lefia Tiven

 

Kata kunci : Kalor, Kalor Jenis, Zat padat. Kalor adalah energi yang berpindah apabila benda yang suhunya lebih tinggi bersentuhan dengan benda yang suhunya lebih rendah. Pengukuran kalor dilakukan untuk menentukan kalor jenis suatu zat. Salah satu cara yang digunakan ialah cara mencampurkan dua zat yang suhunya berbeda sehinggga terjadi pertukaran kalor di antara kedua zat itu sampai kedua suhu zat sama. Tugas akhir ini menentukan kalor jenis zat padat (tembaga). Diperoleh hasil 0,0993 .

Pengembangan rancangan pelaksanaan pembelajaran dan lembar kerja mata kuliah praktik kayu menggunakan pendekatan pembelajaran model Training Within Industry (TWI) pada Program Studi Pendidikan Teknik Bangunan Universitas Negeri Malang / Sugiharto

 

Kata Kunci: rancangan pelaksanaan pembelajaran, lembar kerja, TWI Beberapa permasalahan yang terjadi dalam pelaksanaan perkuliahan Praktik Kayu di Jurusan Teknik Sipil Universitas Negeri Malang, yaitu (1) metode mengajar konvensional masih menjadi kebiasaan dosen dalam mengajar praktik, dan (2) tidak selalu ada pegangan Rancangan Pelaksanaan Pembelajaran (RPP) dan Lembar Kerja (Job Sheet). Permasalahan tersebut ternyata memiliki dampak pada efektifitas pelaksanaan perkuliahan yang masih belum maksimal. Untuk memecahkan permasalahan pelaksanaan perkuliahan praktik kayu tersebut perlu diterapkan pendekatan dengan model pembelajaran Training Within Industry (TWI), yang berupa pengembangan Rancangan Pelaksanaan Pembelajaran (RPP) dan Lembar Kerja (Job Sheet). Uji coba pengembangan produk dilakukan di Jurusan Teknik Sipil Fakultas Teknik Universitas Negeri Malang. Adapun langkah-langkah pada penelitian dan pengembangan untuk RPP dan Job Sheet antara lain, (1) kajian model pembelajaran TWI, (2) telaah mata kuliah praktik kayu, (3) pengamatan dosen mengajar praktik, (4) melakukan diskusi dengan dosen mata kuliah praktik kayu, (5) mengembangkan RPP dan Job Sheet, (6) melakukan validasi RPP dan Job Sheet oleh validator, (7) melakukan analisis data, (8) revisi draft, dan (9) menyelesaikan produk bahan ajar. Subjek uji coba yang dipakai adalah 1 orang dosen Teknik Sipil sebagai pakar/ahli bidang penelitian pengembangan dan bidang studi, 3 dosen mata kuliah Praktik Kayu, dan 12 mahasiswa angkatan 2008 yang sedang menempuh perkuliahan Praktik Kayu. Analisis data menggunakan skala pengukuran Rating Scale. Hasil analisis validitas untuk Rancangan Pelaksanaan Pembelajaran 78,5% dan Lembar Kerja 87,2%. Dari hasil validitas tersebut, dapat diambil kesimpulan bahwa kedua produk yang dikembangkan dinyatakan valid. Penelitian pengembangan ini diharapkan dapat memiliki manfaat dalam usaha perbaikan efektifitas perkuliahan Praktik Kayu dalam strategi pembelajaran Training Within Industry (TWI) di Jurusan Teknik Sipil. Berdasarkan penelitian dan pengembangan ini, disarankan (1) untuk keperluan pemanfaatan produk: produk pengembangan berupa RPP dan Job Sheet perlu diuji cobakan pada pelaksanaan perkuliahan Praktik Kayu, (2) untuk diseminasi produk ke sasaran yang lebih luas: penelitian pengembangan ini perlu lebih diperluas cakupannya untuk seluruh mata kuliah praktik, (3) untuk keperluan pengembangan lebih lanjut: perlu segera dilakukan uji di lapangan dan hasilnya dapat digunakan sebagai acuan untuk pengembangan produk mata kuliah praktik yang lain.

Analisis Faktor-Faktor yang Mempengaruhi Tingkat Pendapatan Petani Jagung di Kabupaten Blitar (Studi Kasus Desa Wates Kecamatan Wates Kabupaten Blitar).

 

Kata Kunci: Faktor Produksi, Pendapatan Petani Keberhasilan usaha tani, dipengaruhi oleh berbagai macam faktor yang merupakan, faktor pendapatan petani yang diperoleh dari usaha bertani. Faktor yang terlihat dari usaha tani jagung, mempunyai sumbangan yang paling terbesar adalah modal, luas tanah, tingkat pendidikan dan tenaga kerja yang digunakan. Dari keempat hal tersebut sangatlah berpengaruh besar terhadap pendapatan petani jagung. Tujuan penelitian ini untuk mengetahui: (1) Faktor – faktor apa yang mempengaruhi pendapatan petani jagung (2) Pengaruh variabel yang paling dominan berpengaruh terhadap pendapatan petani. Rancangan penelitian yang digunakan adalah rancangan deskriptif korelasional. Analisis data penelitian yang dipakai adalah analisis regresi linier berganda dengan menggunakan uji t dan uji F dalam menguji hipotesisnya. Data penelitian diperoleh dengan memberikan kuesioner kepada 75 responden yang merupakan Petani Jagung di Desa Wates Kecamatan Wates Kabupaten Blitar. Hasil analisis data menunjukkan bahwa secara parsial dan simultan, terdapat pengaruh positif yang signifikan modal, luas tanah, pendidikan dan jumlah tenaga kerja terhadap pendapatan petani jagung di Desa Wates Kecamatan Wates Kabupaten Blitar. Dari keempat variabel yang digunakan, yang dominan pengaruhnya adalah luas tanah dengan nilai β2 = 0,544 dengan taraf kepercayaan 5% signifikan t = 0,000, modal dengan nilai β1 = 0,440 dengan taraf kepercayaan 5% signifikan t = 0,000, pendidikan dengan nilai β3 = 0,154 dengan taraf kepercayaan 5% signifikan t = 0,000 dan tenaga kerja nilai β4 = 0.179 hasil uji F menunjukkan nilai F hitung sebesar 78.374 dengan taraf kepercayaan 5% signifikan F = 0,000, ini menunjukkan secara simultan modal, luas tanah, pendidikan, dan jumlah tenaga kerja berpengaruh terhadap pendapatan petani jagung di Desa Wates Kecamatan Wates Kabupaten Blitar. Dalam model summary pada R Square sebesar 80% pendapatan petani pada Desa Wates Kecamatan Wates Kabupaten Blitar dapat di jelaskan secara simultan oleh variabel modal,luas tanah, pendidikan dan jumlah tenaga kerja sedangkan sisanya sebesar 20% dijelaskan oleh variabel lain yang tidak diteliti dalam penelitian ini. Berdasarkan hasil penelitian, maka penulis menyarankan (1) apabila sektor pertanian jagung bisa meningkatkan kesejahteraan hendaknya pemerintah dapat memaksimalkan kebijakan di bidangpertanian (2) pemanfaatan teknologimyang berkembang hendaknya dapat dimanfaatkan guna menambah nilai hasil pertanian (3) untuk penelitian selanjutnya agar dapat menambah variabel agar penelitian selanjutnya lebih bagus dan dapat memberikan informasi lebih maksimal

Pengaruh strategi pembelajaran reciprocal teaching dipadu dengan jigsaw terhadap kemampuan metakognitif, hasil belajar dan retensi siswa kelas X di SMA Negeri 7 Malang / Azizul Ghofar Candra Wicaksono

 

Kata Kunci: Reciprocal Teaching, Jigsaw, metakognitif, hasil belajar, retensi. Kualitas pendidikan tercermin dari pembelajaran yang berlangsung di dalam lembaga pendidikan (sekolah). Secara umum, pembelajaran yang berlangsung di Indonesia belum menunjukkan perkembangan yang signifikan, kondisi ini berdampak pada banyaknya siswa yang memiliki kemampuan metakognitif, hasil belajar, dan retensi yang rendah. Permasalahan tersebut dapat diatasi dengan menerapkan strategi pembelajaran reciprocal teaching (RT) dalam metode jigsaw. Strategi RT berpotensi untuk mengembangkan kemampuan metakognitif dan hasil belajar siswa. Selain itu, tingginya aktivitas siswa dalam metode jigsaw, termasuk membelajarkan materi kepada siswa lain mampu meningkatkan daya ingat atau retensi siswa. Dengan demikian kombinasi RT dan jigsaw menjadi strategi yang berpotensi untuk meningkatkan keberhasilan belajar siswa, termasuk dalam aspek kemampuan metakognitif, hasil belajar, dan retensi. Tujuan penelitian ini ialah: 1) Mengetahui pengaruh strategi Reciprocal teaching dipadu dengan Jigsaw terhadap kemampuan metakognitif, 2) Mengetahui pengaruh strategi Reciprocal teaching dipadu dengan Jigsaw terhadap hasil belajar kognitif, dan 3) Mengetahui pengaruh strategi Reciprocal teaching dipadu dengan Jigsaw terhadap retensi. Rancangan penelitian yang digunakan ialah quasi eksperimen dengan Pretest-Postest Nonequivalent Control Group Design. Variabel bebas adalah strategi pembelajaran (reciprocal teaching-jigsaw). Variabel terikat adalah kesadaran metakognitif, keterampilan metakognitif, hasil belajar, dan retensi. Populasi penelitian ialah seluruh siswa kelas X SMAN 7 Malang. Sampel penelitian adalah siswa kelas X-2 sebagai kelas kontrol dan X-10 sebagai kelas perlakuan. Kemampuan metakognitif diukur menggunakan MAI (metacognitive awareness inventory) dan rubrik metakognitif. Hasil belajar diukur dengan menggunakan tes essay. Retensi diukur dengan menggunakan tes essay dua minggu setelah perlakuan. Instrumen tes terlebih dahulu diuji validitas dan reliabilitas. Data diambil pada saat pretes, postes dan retensi (dua minggu setelah postes). Uji hipotesis menggunakan anakova dengan taraf signifikansi 0,05 (P < 0,05). Sebelum uji anakova, dilakukan uji normalitas data dengan uji kormogolovsmirnov dan uji homogenitas data dengan levene tes. Hasil penelitian menunjukkan: 1) Strategi pembelajaran berpengaruh terhadap kemampuan metakognitif, 2) Strategi pembelajaran berpengaruh terhadap hasil belajar, dan 3) Strategi pembelajaran berpengaruh terhadap retensi. Strategi gabungan reciprocal teaching-jigsaw terbukti dapat meningkatkan proses dan hasil belajar, dan disarankan bagi guru untuk mencoba mengimplementasikan strategi reciprocal teaching-jigsaw dalam pembelajaran Biologi.

Pengaruh jaminan keselamatan dan kesehatan kerja terhadap produktivitas kerja karyawan (studi pada karyawan PB. PAKU BUMI Sukolilo, Jabung-Malang) / Rafly Firdaus

 

Kata kunci: Keselamatan Kerja, Kesehatan Kerja, Produktivitas Kerja Keberadaan SDM dalam suatu organisasi memegang peranan yang sangat penting karena merupakan aset utama dalam organisasi. SDM merupakan sumberdaya yang digunakan untuk menggerakkan dan menyinergikan sumberdaya lainnya untuk mencapai tujuan perusahaan dan keberadaan SDM juga akan menentukan tingkat produktivitas dalam suatu perusahaan. Produktivitas tenaga kerja adalah salah satu ukuran perusahaan dalam mencapai tujuannya. Sumber daya manusia merupakan elemen yang paling strategik dalam organisasi, harus diakui dan diterima oleh manajemen. Oleh karena itu tenaga kerja merupakan faktor penting dalam mengukur produktivitas. Salah satu faktor yang mempengaruhi produktivitas kerja adalah keselamatan dan kesehatan kerja. Adanya program keselamatan dan kesehatan kerja yang baik akan menguntungkan para karyawan secara material, karena mereka akan lebih jarang absen bekerja dengan lingkungan yang menyenangkan, sehingga secara keseluruhan akan mampu bekerja lebih produktif. Data yang diambil adalah Jawaban kuesioner dari 65 responden yaitu karyawan PB. PAKU BUMI Malang. Ada tiga variabel yang digunakan yaitu keselamatan kerja dan kesehatan kerja sebagai variabel bebas sedangkan produktivitas kerja sebagai variabel terikat. Analisis yang digunakan adalah analisis linear berganda sedangkan teknik pengambilan sampel menggunakan sampling jenuh. Berdasarkan pada hasil analisis regresi linier berganda yang telah dilakukan pada penelitian ini, didapat persamaan regresi sebagai berikut. Y = 14,449 + 0,141 X1 + 0,299 X2 + 0,05 Hasil penelitian ini juga menunjukkan bahwa secara parsial dan simultan variabel keselamatan kerja dan kesehatan kerja berpengaruh signifikan terhadap variabel produktivitas kerja. Sedangkan variabel yang paling dominan mempengaruhi produktivitas adalah keselamatan kerja.

The effect of the mind mapping strategy on MTS students' reading ability / Yahmun

 

Key words: Mind mapping, Reading Comprehension This study is to investigate whether Mind Mapping Strategy can improve the students’ ability in comprehending reading passages. In other words, the main objective of this study is to find out whether the students who have been taught using Mind Mapping Strategy achieve better reading comprehension than those who have been taught using non Mind Mapping Strategy. To be more specific, this study is conducted to find out: (1) whether the low achieving students in the experimental group who have been taught using Mind Mapping Strategy significantly achieve higher score than the low achieving students in the control group, (2) whether the high achieving students in the experimental group who have been taught using Mind Mapping Strategy significantly achieve higher score than the low achieving students in the control group. The design of this study is a Quasi-experimental or Nonrandomized Control Group, Pretest-Postest Design. The subjects of this study were students of Madrasah Tsanawiyah Malang which is located on Jalan Arjuno. They were the second semester students. The choice of the second semester was made because of the following reasons: (1) students never utilize the Mind Mapping Strategy; (2) they have the same background, meaning that they have accepted English subject, so, their competence in English is relatively the same; (3) their age is relatively the same. Furthermore, they were given a task of five texts of English after they accepted treatment to investigate the students’ ability in understanding the reading passages. In order to get the result of the mean difference between the control and the experimental group, t-test for independent samples was applied. The result of the test showed that the mean score of the experimental group was 54.91 whereas the mean score for the control group was 54.73. After applying t-test formula for independent sample for 44, it indicates that the t value was 0.057. Since the t-value indicates 1.684 at .05 % level of significance, it can be concluded that there was not enough evidence to reject the null hypothesis. It means that the means of the two groups are not significantly different. In other words, it can be inferred temporarily that the Mind Mapping Strategy could not help the students to gain a better achievement in reading comprehension of English texts. Furthermore, the end result of t-test showed that the mean score of high achieving students of experimental group was 66.00 and the mean score of the high achieving students of control group was also 67.56. In as much as the mean score of the two groups were not significantly different, it can be inferred that there was no significant distinguishing achievement between the high achieving students in the experimental group and the high achieving students in the experimental group, who got the Mind Mapping Strategy and non Mind Mapping Strategy. Different from the high achieving students, it was found that the mean score of the low achieving students in the experimental group was 58.40 whereas the mean score in the control one was 49.23. Having consulted to the t-test formula, it turned out that the t value was 9.05 which indicated it was higher than t- table at 5 % level of significance. So, it can be inferred that the Mind Mapping Strategy is effective to be used in teaching reading for the low achieving students at MTs in comprehending reading passages. In other words, this study indicates that Mind Mapping Strategy can be applied to help or to improve students’ comprehension ability for low achieving students.

Studi tentang kemampuan membaca tabel sebagai salah satu keterampilan generik sains pada siswa SMA Negeri 2 Pasuruan tahun pelajaran 2010/2011 / Tina Mayasari

 

Kata Kunci: membaca tabel, keterampilan generik Berbagai upaya telah dilakukan pemerintah untuk meningkatkan kualitas pendidikan, salah satu upaya tersebut yaitu melalui penyempurnaan dalam bidang kurikulum. Saat ini telah diberlakukan Kurikulum Tingkat Satuan Pendidikan (KTSP). Melalui KTSP ini dilakukan penyempurnaan kurikulum pada tingkat satuan pendidikan, termasuk pada pelajaran kimia. Adanya sebagian konsep kimia yang bersifat abstrak akan menyebabkan siswa cenderung mengalami kesulitan untuk mengkonstruksi pemahaman secara tepat. Kebanyakan siswa harus belajar sendiri melalui buku-buku atau sumber lain untuk menemukan suatu konsep. Oleh karena itu pemilihan media yang tepat sangat diperlukan untuk membantu siswa dalam memperoleh pemahaman konsep kimia dengan baik. Salah satu media yang dapat membantu siswa dalam mengkonstruk pemahamannya adalah media tabel. Penyajian informasi atau materi dalam bentuk tabel memiliki beberapa kelebihan antara lain: (1) penyajian datanya ringkas dan jelas; (2) mendorong siswa berpikir kritis dan analisis karena siswa diharapkan dapat menemukan informasi pembelajaran dari tabel yang disajikan; (3) merangkum keterangan secara sederhana; (4) memperlihatkan hubungan antara data yang satu dengan data yang lain sehingga membantu siswa mengadakan analisis, interpretasi dan perbandingan data-data yang disajikan. Membaca tabel juga dapat meningkatkan keterampilan generik sains siswa, diantaranya: (1) pengamatan langsung dan tak langsung; (2) kesadaran tentang skala dan besaran; (3) bahasa simbolik; (4) kerangka logika taat-asas dari hukum alam; (5) interfensi logika; (6) hukum sebab akibat; (7) pemodelan matematis; dan (8) membangun konsep. Oleh karena itu, penting untuk mengetahui kemampuan siswa membaca tabel karena berhubungan dengan mengetahui kemampuan berpikir tingkat tinggi (berpikir kritis dan logis) untuk memecahkan suatu masalah. Penelitian ini merupakan penelitian deskriptif yang bertujuan mendeskripsikan kemampuan siswa SMA Negeri 2 Pasuruan tahun pelajaran 2010/2011 dalam hal membaca tabel. Dalam hal ini sampel yang digunakan berjumlah 6 kelas, yang terdiri dari 2 kelas siswa kelas X, 2 kelas siswa kelas XI dan 2 kelas siswa kelas XII, masing-masing berjumlah 32 siswa. Untuk mengetahui tingkat kemampuan siswa dalam membaca tabel digunakan tes kemampuan (ability test), yang berupa soal uraian obyektif, terdiri dari 30 butir soal yang berkaitan tabel-tabel. Berdasarkan validitas instrumen, diperoleh persentase soal yang sesuai atau valid sebesar 96,7%. Sedangkan berdasarkan uji reliabilitas, instrumen yang valid memiliki koefisien reliabilitas sebesar 0,787. Persentase kemampuan siswa membaca tabel dilihat dari nilai siswa mengerjakan soal test yang meliputi kemampuan menghubungkan data tabel, menemukan suatu pola dari data dalam tabel dan membuat suatu kesimpulan dari data tabel. Hasil penelitian ini menunjukkan bahwa kemampuan siswa kelas X, XI dan XII berturut-turut 67,9%, 74,1% dan 78,3%. Dengan kata lain kemampuan rata-rata siswa SMA Negeri 2 Pasuruan dalam hal membaca tabel adalah cukup (73,4%). Siswa kelas XII memiliki persentase kemampuan yang paling tinggi karena siswa kelas XII telah memiliki pengalaman belajar lebih banyak daripada siswa kelas X dan kelas XI.

Identifikasi konsep sukar dan salah konsep materi hukum kekekalan massa pada siswa SMA Negeri 5 Malang / Umi Hanik

 

Kata kunci: konsep sukar, salah konsep, hukum kekekalan massa. Salah satu sifat dari konsep kimia adalah bertingkat dimulai dari sederhana menuju kompleks. Apabila konsep yang paling awal belum dipahami maka akan menimbulkan konsep sukar. Konsep sukar adalah persepsi siswa terhadap konsep yang dianggap sukar dan diukur oleh soal diagnostik dengan persentase jawaban (PJS) ≥ 61% . Ketidakpahaman yang terjadi terus menerus dapat mengakibatkan salah konsep. Salah satu materi kimia yang dapat menimbulkan konsep sukar dan salah konsep adalah hukum kekekalan massa. Tujuan penelitian untuk mengetahui deskripsi jawaban salah siswa, konsep sukar dan salah konsep yang dialami siswa pada materi hukum kekekalan massa. Penelitan merupakan penelitian deskriptif kuantitatif. Sampel penelitian adalah siswa kelas X dan XI SMA Negeri 5 Malang tahun ajaran 2010/2011 semester genap terdiri dari 47 siswa kelas X (27 siswa kelas X-6 dan 20 siswa kelas X-8) dan 57 siswa kelas XI (28 siswa kelas XI-IPA 2 dan 29 siswa kelas XI-IPA 5). Teknik pengambilan sampel penelitian menggunakan simple random sampling. Instrumen penelitian berupa tes diagnostik berbentuk soal pilihan ganda dengan empat pilihan jawaban dan 1 jawaban sendiri yang disertai dengan alasan jawaban. Soal disusun berdasarkan peta konsep dan kisi-kisi soal. Hasil wawancara digunakan sebagai triangulasi data. Hasil penelitian menunjukkan bahwa: (1) Deskripsi jawaban salah siswa yang berupa hasil mean, median, modus, jawaban salah siswa minimal (Xmin) dan jawaban salah siswa maksimal (Xmax) berturut-turut untuk kelas X adalah 28; 32; 20; 0; 45 sedangkan untuk kelas XI berturut turut 34; 34; 0; 3 dan 53. (2) Jenis konsep sukar yang dimiliki siswa kelas X dan XI berdasarkan hasil PJS adalah konsep persamaan reaksi (mengidentifikasi persamaan reaksi setara) dan hukum kekekalan massa (mengidentifikasi hukum kekekalan massa pada reaksi yang menghasilkan endapan, mengidentifikasi hukum kekekalan massa pada reaksi yang menghasilkan gas pada sistem terbuka, mengidentifikasi hubungan hukum kekekalan massa dengan pereaksi berlebih, dan mengidentifikasi hubungan hukum kekekalan massa dengan pereaksi pembatas). Salah konsep yang dialami siswa kelas X dan XI berdasarkan konsistensi jawaban adalah (a) menganggap koefisien produk sebagai jumlah molekul yang dihasilkan; (b) massa produk yang terbentuk sama dengan massa total reaktan mula-mula; (c) massa pereaksi sisa adalah selisih antara massa terbesar dan terkecil reaktan; (d) jumlah mol produk sama dengan jumlah mol reaktan mula-mula; (e) pereaksi yang jumlah atom berkurang merupakan pereaksi pembatas; (f) semua pereaksi akan habis bereaksi. Salah konsep yang hanya terjadi pada kelas X adalah massa produk yang terbentuk sama dengan massa total reaktan mula-mula dan semua pereaksi akan habis bereaksi.

Penggunaan kotak minuman untuk memahamkan siswa tentang pertidaksamaan linier melalui pembelajaran discovery learning di SMKN 2 Singosari / Imrona Hayati

 

Identifikasi dan isolasi jenis mikroalga planktonik di waduk Lahor Kabupaten Malang Jawa Timur / Fita Lutfiana

 

Kata Kunci: Identifikasi, Isolasi, Mikroalga planktonik, Waduk Lahor. Waduk Lahor merupakan waduk air tawar yang dialiri oleh tiga buah sungai yaitu sungai Lahor, sungai Leso dan sungai Dewi. Air waduk Lahor dapat dijadikan indikator kondisi kualitas perairan. Penelitian ini bertujuan untuk mengetahui spesies mikroalga yang berhasil diidentifikasi dan diisolasi. Mikroalga yang digunakan dalam penelitian ini adalah mikroalga planktonik yang diambil dari Waduk Lahor dengan cara mengambil air dengan botol pada 3 bagian perairan yaitu bagian permukaan, kedalaman 1 meter, dan kedalaman 2 meter. Metode isolasi mikroalga menggunakan medium Walne dengan metode isolasi goresan. Penelitian ini termasuk dalam penelitian deskriptif eksploratif. Data tentang jenis mikroalga yang ditemukan diidentifikasi dan diisolasi kemudian dianalisis secara deskriptif dan dibuat kunci identifikasinya. Identifikasi menggunakan buku The Freshwater Algae of The United States oleh Gilbert M. Smith (1950), buku How To Know The Freshwater Algae oleh G.W. Prescott (1978), The Plant Kingdom oleh Bold, C. Harold (1987), Introduction to The Algae oleh Bold, C. Harold (1985), dan Freshwater Algae Identification and Use as Bioindicators oleh Bellinger, Edward G. & Sigee, David C (2010). Mikroalga planktonik yang berhasil diidentifikasi ada 29 spesies dari 4 divisi yaitu Chlorophyta, Chrysophyta, Pyrophyta dan Cyanophyta. Spesies tersebut adalah Pandorina morum, Chlorococcum humicola, Chlorella sp., Treubaria triappendiculata, Crucigenia tetrapedia, Scenedesmus quadricauda, Actinotaenium sp., Netrium digitus, Palmella miniata, Staurastrum natator, Chladophora sp., Pseudotetraspora gainii, Protococcus sp., Palmellococcus miniatus, Scenedesmus dimorphus, Scenedesmus bijuga, Ourococcus bicaudatus, Gonium pectorale, Glenodinium cinctum, Fragilaria crotonensis, Meridion circulare, Synedra ulna, Navicula gracilis, Pinnularia sp., Nitzschia palea, Diatoma sp., Gloeothece linearis, Merismopedia, Borzia trilocularis. Mikroalga yang berhasil terisolasi ada 9 spesies dari 2 divisi adalah Chlorococcum humicola, Pandorina morum, Fragilaria crotonensis, Nitzschia palea, Protococcus sp., Diatoma sp., Chlorella sp., Scenedesmus bijuga dan Gonium pectorale. Penelitian ini diharapkan dapat memberikan informasi pada mahasiswa, masyarakat dan pemerintah khususnya pengelola Waduk Lahor terkait dengan potensi mikroalga yang ada di Waduk Lahor. Mikroalga planktonik yang berhasil diisolasi sebaiknya tetap dijaga kelembapannya agar tidak kering dan bisa diuji lebih lanjut untuk mengetahui potensi dan manfaatnya.

Investasi sumber daya manusia dan pertumbuhan ekonomi (studi kawasan Indonesia dan negara Asean 5 lainnya) / Nunung Nurastuti Utami

 

Disertasi, Program Studi Pendidikan Ekonomi, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. J.G.Nirbito, MPd. (II) Prof. Dr.Wahjoedi, ME. (III) Dr. Sunaryanto, MEd. Kata kunci: investasi sumber daya manusia, pertumbuhan ekonomi, pengangguran terdidik. Rendahnya produktivitas tenaga kerja dapat disebabkan rendahnya akses untuk memperoleh pendidikan dan kesehatan. Jika tenaga kerja memiliki produktivitas yang tinggi maka akan dapat memperoleh kesejahteraan, yang dicerminkan dari pendapatan atau pertumbuhan ekonomi yang lebih tinggi. Hal ini berarti kenaikan produktivitas tenaga kerja bisa dengan meningkatkan investasi di bidang pendidikan dan kesehatan. Disisi lain, pengangguran pendidikan merupakan hasil dari investasi pendidikan yang tidak terserap dalam pasar tenaga kerja. Hal ini akan menghambat pengaruh investasi sumber daya manusia terhadap pertumbuhan ekonomi. Penelitian ini menganalisis pengaruh investasi sumber daya manusia terhadap pertumbuhan ekonomi, dengan adanya peran pengangguran berdasarkan tingkat pendidikan primer, sekunder dan tersier kawasan Indonesia dan negara-negara ASEAN 5. Dari hasil penelitian ini diharap bisa diperoleh input kebijakan dalam investasi pendidikan yang dilakukan pemerintah, agar investasi tersebut dapat meningkatkan pertumbuhan ekonomi. Rancangan penelitian menggunakan penelitian korelasional dan kausal komparasi, dengan menggunakan data sekunder time series. Metode analisis yang digunakan adalah regresi time series dan panel data serta uji kausalitas Granger (Causality Granger), dengan bantuan alat analisis statistika Eview’s. Sampel negara yang digunakan adalah Indonesia dan negara-negara ASEAN 5 (Indonesia, Malaysia, Singapura, Thailand dan Philipina) dengan rentang waktu tahun 1974 sampai 2009. Hasil penelitian menunjukkan bahwa: 1. Negara ASEAN 5 secara panel memiliki: (a). Investasi sumber daya manusia dan literasi berpengaruh positif sig-nifikan terhadap pertumbuhan ekonomi. (b). Fertilitas dan pengangguran total berpengaruh negatif signifikan terhadap pertumbuhan ekonomi. (c). Pengangguran berdasar tingkat pendidikan primer tidak berpengaruh signifikan terhadap pertumbuhan ekonomi serta pengangguran tingkat pendidikan sekunder dan tersier berpengaruh negatif signifikan terhadap pertumbuhan ekonomi. 2. Analisis secara terpisah masing-masing negara diperoleh hasil bahwa: investasi sumberdaya manusia Indonesia dan Philipina berpengaruh positif signifikan terhadap pertumbuhan ekonomi, sedang Malaysia, Singapura dan Thailand tidak berpengaruh signifikan terhadap pertumbuhan ekonomi, hal ini disebabkan ke tiga negara memiliki: (a) arah pengaruh hubungan dari pertumbuhan ekonomi terhadap investasi sumber daya manusia, bukan sebaliknya (b) memiliki pengeluaran pendidikan tertinggi di ASEAN 5, sehingga pengeluaran pendidikan akan membutuhkan tenggang waktu yang lebih lama untuk berpengaruh terhadap pertumbuhan ekonomi (c) memiliki Indeks Pembangunan Manusia tertinggi di ASEAN5, mengindikasikan siswa akan lebih lama di bangku sekolah, sehingga tenggang waktu pengembalian hasilnya akan lebih lama. (3) Hasil Uji kausalitas Granger adalah Indonesia dan Philipina memiliki hubungan satu arah (univariate) investasi sumber daya manusia terhadap pertumbuhan ekonomi, sebaliknya Singapura dan Thailand memiliki satu arah hubungan (univariate) pertumbuhan ekonomi terhadap investasi sumber daya manusia.(4) Dengan masuknya pengangguran pendidikan primer, sekunder dan tersier pada hubungan investasi sumber daya manusia dan pertumbuhan ekonomi, diperoleh hasil bahwa investasi sumber daya manusia Indonesia berpengaruh positif signifikan terhadap pertumbuhan ekonomi, sedang Singapura dan Thailand berpengaruh negatif terhadap pertumbuhan ekonomi, hal ini berlaku diminishing return to human capital. Malaysia dan Philipina memiliki investasi sumber daya manusia yang tidak berpengaruh signifikan terhadap pertumbuhan ekonomi. Perlu dikaji lebih lanjut komparasi peran pengangguran pendidikan pada investasi sumber daya manusia dan pertumbuhan ekonomi, untuk negara maju, berkembang dan sedang berkembang, agar diperoleh kebijakan yang relevan untuk masing-masing kriteria negara.

Analisis penggunaan analogi dalam buku kimia SMA / Andry Septiono

 

Kata kunci: Analisis, Analogi, Buku Kimia SMA Dalam mengajarkan konsep kimia yang bersifat abstrak pada siswa, maka konsep tersebut akan lebih mudah dipahami jika dihubungkan atau dibandingkan dengan pengetahuan yang sudah ada dan hal ini dapat ditemukan dalam analogi yang sesuai. Sumber analogi guru sangat bervariasi, diantaranya buku kimia SMA. Tujuan penelitian ini adalah untuk: (1) mengidentifikasikan konsep dalam buku teks kimia SMA yang menggunakan analogi; (2) mengidentifikasikan gambaran analogi dan tipe analogi yang digunakan untuk menjelaskan konsep-konsep dalam buku teks kimia SMA; (3) menganalisis bagaimana buku teks memetakan sifat antara domain analog dan domain target untuk konsep-konsep kimia. Penelitian ini adalah penelitian deskriptif-kualitatif. Objek penelitian adalah lima buku kimia yang paling banyak digunakan di wilayah malang, yaitu; buku kimia terbitan Esis; buku kimia terbitan Erlangga; buku kimia terbitan Ganeca Exact; buku kimia terbitan Phibeta; buku kimia terbitan Yudhistira. Buku tersebut telah memenuhi syarat kelayakan untuk digunakan dalam proses pendidikan sesuai dengan Standar Nasional Pendidikan. Data yang berupa deskripsi konsep-konsep dianalisis sesuai dengan tujuan penelitian. Hasil yang diperoleh dari penelitian ini adalah: (1)konsep dalam buku kimia SMA yang berpotensi menggunakan analogi antara lain: Materi; Teori atom Thomson; Teori Atom Bohr; Tabel periodik; Sifat Periodik; Ikatan kimia; Ikatan kovalen: Ikatan logam; Ikatan ion; Hukum perbandingan tetap; Konsep mol; Pereaksi pembatas; Reaksi eksoterm-endoterm; Perubahan entalpi; Teori tumbukan; Katalis; Kesetimbangan dinamis; Tetapan kesetimbangan; Perhitungan kimia. (2)Tipe analogi yang ditemukan: Analogi bergambar sebanyak 2,6%; Analogi verbal sebanyak 50,0%; Analogi verbal bergambar sebanyak 47,4%; Pengayaan sederhana sebanyak 71,1%; Pengayaan diperkaya sebanyak 13,2%; Pengayaan diperluas sebanyak 15,7%; Target dan analog terhubung secara struktural sebanyak 31,6%; Target dan analog terhubung secara fungsional sebanyak 60,5; Target dan analog terhubung secara struktural struktural-fungsional sebanyak 7,9%. (3) Hasil analisis pemetaan sifat antara analog dan target pada buku Erlangga, Esis, Ganeca, Phibeta, dan Yudhistira diperoleh kesimpulan bahwa terdapat ketidaktepatan analogi pada konsep: unsur, persamaan kimia, partikel senyawa, pereaksi pembatas, tumbukan antar partikel, kesetimbangan dinamis, tetapan kesetimbangan, sistem dan lingkungan, katalis model atom Bohr, ikatan kimia, ikatan kovalen, reaksi katalis.

Pengembangan perangkat pembelajaran keterampilan membaca model pembelajaran kontekstual untuk mahasiswa S-1 PGSD FKIP Unej / Muji

 

. Disertasi, Program Studi Pendidikan Bahasa Indonesia, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Imam Syafi’ie, (II) Dr.Mudjianto, dan (III) Dr. Djoko Sariyono. Kata kunci: modul, membaca, model belajar kontekstual, perangkat pembelajaran Pembelajaran membaca pada program studi S-1 Pendidikan Guru Sekolah Dasar (PGSD) memiliki peran yang penting. Keterampilan membaca dapat menunjang prosfesi mahasiswa sebagai calon pengajar, membantu mahasiswa untuk maju, dan menjadikan dirinya pribadi yang berkualitas.Tujuan pembelajaran membaca yang ingin dicapai pada program studi S-1 PGSD, yaitu agar mahasiswa (1) memiliki wawasan dan pengetahuan yang luas, (2) memiliki pondasi yang kuat untuk dapat mempelajari dan memahami berbagai disiplin ilmu, (3) meningkatkan kecerdasan, serta meningkatkan daya kreasi dan imajinasi, (4) meningkatkan kecerdasan verbal, (5) memperbaiki rasa percaya diri, mengembangkan kemampuan manajemen emosi, dan meningkatkan kemampuan melakukan interaksi sosial positif di mana pun dan kapan pun, dan (6) menjadikan seseorang lebih dewasa, arif, dan bijaksana dalam menjalani kehidupan. Salah satu upaya untuk merealisasikan tujuan itu adalah dengan mempelajari, memilih, menentukan, dan mengembangkan secara tepat perangkat pembelajaran untuk memberikan layanan belajar kepada mahasiswa. Perangkat itu berupa, silabus, bahan ajar dengan modul, dan instrumen asesmen. Penelitian ini dilakukan bertujuan untuk menghasilkan: (1) silabus, (2) bahan ajar dengan modul, dan (3) instrumen asesmen keterampilan membaca yang dikembangkan berdasarkan Pembelajaran Kontekstual. Manfaat hasil penelitian adalah hasil belajar lebih bermakna, dapat meningkatkan prestasi belajar mahasiswa, dan mempunyai dampak dapat meningkatkan efektivitas perkuliahan. Metode pengembangan yang digunakan dalam penelitian adalah model Borg dan Gall. Data yang dibutuhkan penelitian ini adalah data hasil tanggapan/penilaian dari tim ahli dan dosen, data hasil tanggapan/penilaian dari mahasiswa, data hasil tes uji kompetensi keterampilan membaca, dan data analisis hasil uji efektivitas dampak penggunaan perangkat pembelajaran. Instrumen yang digunakan untuk mengumpulkan data dalam penelitian ini adalah angket, wawancara, dan tes. Data hasil penilaian/tanggapan dari uji kelompok ahli, kelompok kecil, dan kelompok uji lapangan dianilisis dengan menggunakan teknik analisis deskriptif. Data tentang hasil tes uji kompetensi membaca mahasiswa terhadap peningkatan prestasi belajar, dianalisis dengan menggunakan teknik analisis korelasi. Data tentang analisis hasil dampak pengembangan perangkat pembelajaran keterampilan membaca terhadap efektivitas pelaksanaan pembelajaran dianalisis dengan menggunakan teknik analisis nonparametris. Hasil penelitian menunjukkan, berdasarkan analisis data hasil tanggapan/penilaian dari tim ahli, kelompok dosen, dan mahasiswa, perangkat pembelajaran keterampilan membaca yang dikembangkan berdasarkan Pembelajaran Kontekstual dinilai layak untuk sumber belajar pada matakuliah Peningkatan Keterampilan Berbahasa Indonesia. Berdasarkan analisis data hasil tes uji kompetensi keterampilan membaca, tiap unit modul keterampilan membaca dinilai dapat meningkatkan prestasi belajar mahasiswa. Berdasarkan analisis data tentang dampak pengembangan perangkat pembelajaran keterampilan membaca terhadap efektivitas perkuliahan, perangkat pembelajaran yang dikembangkan dapat membuat proses perkuliahan berjalan lebih efektif.

Dampak pemeliharaan ikan dalam keramba terhadap kualitas perairan ranu Pakis Kecamatan Klakah, Kabupaten Lumajang / Ferdian Andy Yus Setiantono

 

Kata kunci : keramba ikan, kualitas perairan, parameter fisika, parameter kimia, parameter biologi. Pemeliharaan ikan dalam keramba dapat mempengaruhi faktor fisik dan kimia perairan. Kegiatan budidaya ikan dalam keramba secara terus menerus juga menyebabkan terjadinya degradasi lingkungan, yang ditandai dengan menurunnya kualitas air. Oleh karena itu penelitian diperlukan untuk memperoleh informasi dampak pemeliharan ikan dalam keramba terhadap kualitas perairan Ranu Pakis, Kecamatan Klakah, Kabupaten Lumajang. Penelitian ini bersifat deskriptif eksploratif. Pengambilan data dilakukan mulai bulan Februari 2011 sampai dengan bulan Maret 2011, dengan selang waktu pengambilan sampel 2 minggu sekali. Tempat penelitian Ranu Pakis, Laboratorium Lingkungan Hidup Kabupaten Lumajang dan Laboratorium Mikrobiologi Universitas Negeri Malang. Penelitian dilakukan dengan mengukur parameter fisika, kimia dan biologi perairan. Parameter tersebut antara lain bau, suhu, konduktifitas, turbiditas, pH, DO, TSS, BOD5, Nitrit, total Coliform dan total Fecal coliform. Hasil pengukuran kemudian dibandingkan dengan baku mutu menurut peruntukannya, berdasarkan Peraturan Pemerintah No. 82 Tahun 2001 tentang pengelolaan kualitas air. Untuk perairan danau standart baku mutu yang digunakan yaitu baku mutu golongan I dan baku mutu golongan II Hasil penelitian menunjukkan bahwa dari sebelas parameter lingkungan yang diuji beberapa parameter telah melampaui standar maksimum baku mutu yang telah diperbolehkan. Parameter yang melebihi standart maksimum baku mutu yang diperbolehkan antara lain: TSS, BOD5, Nitrit dan total Coliform. Parameter yang lain seperti bau, suhu, konduktivitas dan turbiditas tidak ada standart baku mutu yang ditetapkan dikarenakan parameter tersebut tidak berpengaruh langsung, tetapi dapat mempengaruhi parameter perairan yang lain. Parameter perairan seperti pH masih dalam rentangan yang diperbolehkan dan DO setelah dilakukan pengukuran ternyata kandungannya masih memenuhi standart minimum yang diperbolehkan. Mengacu pada parameter yang di ukur menunjukkan bahwa pemeliharaan ikan dalam keramba membawa dampak terhadap kualitas perairan Ranu Pakis. Menurunnya kualitas perairan disebabkan oleh sisa pakan ikan dan akumulasi kotoran ikan yang menyebabkan kandungan bahan organik dalam perairan semakin tinggi.

Estimasi parameter distribusi Weibull yang dipangkatkan menggunakan metode maximum likelihood estimation / Riza Laili Wardhani Putri

 

Wardhani, Riza Laili. 2013. Estimasi Parameter Distribusi Weibull yang dipangkatkan Menggunakan Metode Maximum Likelihood Estimation. Skripsi. Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing :  Dr. Swasono Rahardjo, S.Pd, M.Si Kata Kunci: estimasi parameter, distribusi weibull yang dipangkatkan, Maksimum Likelihood      Terdapat permasalahan yang tidak dapat diselesaikan dengan mudah menggunakan distribusi-distribusi yang sudah ada sebelumnya. Oleh karena itu, diperlukan perluasan dari distribusi yang sudah ada. Distribusi-distribusi hasil perluasan digunakan sebagai alternatif untuk menyelesaikan masalah-masalah reliabilitas yang tidak dapat diselesaikan dengan baik oleh distribusi Weibull dan distribusi Gamma. Mudholkar dan Srivastava memperkenalkan sebuah perluasan dari keluarga distribusi Weibull dan eksponensial yang dipangkatkan yang dinamakan dengan distribusi Weibull dipangkatkan. Distribusi Weibull dipangkatkan mempunyai tiga parameter yaitu dan .      Estimasi parameter merupakan suatu metode untuk mengetahui karakteristik dari suatu populasi. Sehingga pengetahuan dari parameter sangat penting. Parameter dari distribusi weibull yang dipangkatkan akan diestimasi menggunakan metode Maksimum Likelihood. Karena pdf dari distribusi weibull yang dipangkatkan merupakan fungsi kontinu dan eksistensi dari Maximum Likelihood estimator dijamin selalu ada. Selanjutnya akan diterapkan pada data kekuatan putus serat karbon.   Hasil estimasi distribusi weibull yang dipangkatkan dengan menggunakan perangkat lunak Matlab 7.6 pada data kekuatan putus pada serat karbon adalah dan dengan nilai yaitu , nilai yaitu , dan nilai . Dan diperoleh daerah nilai awal agar secara numerik konvergen adalahdan Penguji Utama     Dr. Hery Susanto, M.Si NIP 19671202 1991031002 Dosen Penguji I Dosen Penguji II  Trianingsih Eni Lestari, S.Si, M.Si Dr. Swasono Rahardjo, S.Pd, M.Si NIP 19830101 2005012001 NIP 1966 1010 1992031004

Pengembangan panduan pembelajaran teknik dasar "serangan" pencak silat untuk siswa kelas VII SMP Negeri 10 Malang / Aniek Nurhayati

 

Kata kunci: pembelajaran, teknik dasar “serangan”, pencak silat Berdasarkan observasi awal dan wawancara yang dilakukan peneliti pada guru penjasorkes dan siswa kelas VII SMP Negeri 10 Malang, tanggal 3 Maret 2011, pembelajaran pencak silat yang dilakukan masih sebatas teori. Pada penelitian awal melalui penyebaran angket analisis kebutuhan (need assessment) mendapatkan hasil dari 40 siswa kelas VII yang menyatakan 66% siswa merasa pencak silat kurang menarik karena pembelajaran yang diberikan sebatas teori dari lembar kerja siswa (LKS) dengan penjelasan konsep minim. Sementara itu 100% siswa kelas menyatakan membutuhkan sumber belajar dalam bentuk panduan yang menarik dan mudah dipahami. Hal ini mendapat dukungan dari guru penjasorkes yang menyatakan sangat perlu pengembangan panduan pembelajaran pencak silat, terutama teknik dasar serangan tangan pukulan dan serangan kaki tendangan untuk dipelajari siswa. Tujuan penelitian ini adalah untuk menemukan jalan keluar dari permasalahan yang ada, yaitu dengan mengembangkan panduan teknik dasar serangan pencak silat yang menarik dan mudah dipahami untuk pembelajaran pencak silat dalam penjasorkes. Diharapkan, pengembangan ini dapat membantu guru dalam pembelajaran pencak silat dengan cara yang mudah dan menarik. Metode yang digunakan penelitian ini adalah pengembangan Borg dan Gall yang diadaptasi menjadi lebih sederhana yaitu: (1) mengumpulkan informasi: (a) mengkaji bahan pustaka, (b) analisis kebutuhan; (2) mendesain produk; (3) validasi desain; (4) revisi I; (5) uji coba tahap I (kelas VII siswa) ; (6) revisi II; (7) uji coba tahap II (25 siswa); (8) produk akhir. Analisis data yang digunakan adalah analisis deskriptif yang diperoleh dari hasil penyebaran angket. Dari hasil evaluasi ahli pencak silat diperoleh presentase 82%, ahli pendidikan jasmani 72%, ahli media 75% dan uji tahap I (7 siswa) diperoleh persentase 84% , dan pada uji tahap II (25 siswa) diperoleh persentase 88% sehingga panduan pembelajaran teknik dasar serangan pencak silat untuk siswa kelas VII SMP Negeri 10 Malang dapat digunakan. Berdasarkan hasil penelitian tersebut, peneliti menyarankan bagi guru untuk menggunakan dan mempraktekkan isi panduan ini dalam mengajarkan materi pencak silat kelas VII, bagi siswa digunakan sebagai pedoman belajar teknik dasar serangan, dan bagi sekolah digunakan sebagai sumber belajar pencak silat dalam penjasorkes kelas VII sehingga harus diberikan, serta bagi peneliti lain dapat digunakan sebagai sumber referensi untuk melakukan penelitian yang berkaitan dengan materi pada skripsi ini.

Pengaruh good corporate governance terhadap kinerja keuangan perbankan (studi kasus pada perusahaan perbankan yang listing di BEI tahun 2008-2010) / Wahyu Wardana Putra

 

Kata Kunci: Good Corporate Governance, Teori Keagenan, Kepemilikan Institusional, Dewan Komisaris, Dewan Direksi, Proporsi Komisaris Independen, Komite Audit, CFROA. Corporate governance merupakan sebuah mekanisme yang mampu mengatasi konflik-konflik antara pihak-pihak yang berkepentingan. Dalam agency theory, hubungan agensi muncul ketika prinsipal mempekerjakan agen untuk memberikan suatu jasa dan kemudian mendelegasikan wewenang pengambilan keputusan kepada agen. Pemisahan kepemilikan dan pengelolan perusahaan ini akan memunculkan perbedaan kepentingan antara prinsipal dan agen yang dapat menumbuhkan konflik kepentingan. Corporate governance muncul untuk mengendalikan perilaku dan mengatasi konflik antar pihak-pihak dalam perusahaan. Hasil penelitian terdahulu terhadap corporate governance menunjukkan hasil yang tidak konsisten, sehingga dilakukan penelitan serupa dengan obyek yang berbeda. Penelitian ini dilakukan dengan tujuan untuk menemukan bukti empiris pengaruh penerapan good corporate governance terhadap kinerja keuangan perbankan di Indonesia. Populasi penelitian ini adalah 27 perusahaan perbankan yang terdaftar di Bursa Efek Indonesia (BEI) tahun 2008-2010, metode purposive sampling digunakan untuk menghasilkan sampel sebanyak 21 perusahaan. Analisis data dilakukan dengan menggunakan SPSS for Windows 16,0. Analisis regresi berganda digunakan untuk mengetahui pengaruh good corporate governance terhadap kinerja keuangan. Hasil penelitian ini membuktikan bahwa secara parsial dewan komisaris dan komite audit berpengaruh signifikan terhadap kinerja keuangan. Sedangkan kepemilikan institusional, dewan direksi, dan proporsi komisaris independen tidak berpengaruh. Secara simultan komponen pembentuk good corporate governance ini berpengaruh terhadap kinerja keuangan. Saran bagi peneliti selanjutnya adalah menambah sampel perusahaan dan memperpanjang periode pengamatan. Menambahkan mekanisme good corporate governance yang lebih spesifik misalnya pengelolaan risiko, kualitas audit, jumlah rapat dewan direksi, karakteristik dewan direksi, dan variabel lain seperti leverage, manajemen laba dan ukuran perusahaan. Variabel bebas yang lebih kompleks seperti Tobin’s Q dan Economic Value added (EVA) dapat ditambahkan untuk mendapatkan hasil yang lebih konsisten.

Pengembangan paket layanan informasi dampak dan pencegahan free sex bagi siswa SMP Lab. UM / Eko Nurhayati

 

Kata Kunci: Layanan Informasi, Dampak Free Sex, Pencegahan Free Sex. Fenomena free sex di kalangan remaja semakin mengkhawatirkan. Hal tersebut mempengaruhi perilaku remaja yang berada dalam masa transisi. Bimbingan dan Konseling sebagai bagian integral dari pendidikan dapat memberikan pemahaman yang memadai kepada para remaja mengenai dunia remaja, terutama penghindaran diri dari free sex dan bahayanya. Namun, BK di SMP Lab. UM belum memiliki media dalam bentuk paket layanan informasi dampak dan pencegahan free sex yang memenuhi syarat akseptabilitas untuk menunjang pemberian informasi dampak dan pencegahan free sex yang termasuk dalam layanan informasi bidang pribadi. Tujuan pengembangan paket layanan informasi dampak dan pencegahan free sex adalah untuk menghasilkan paket layanan informasi dampak dan pencegahan free sex siswa SMP yang memenuhi syarat akseptabilitas dari aspek ketepatan, kegunaan, kemudahan, kemenarikan, kejelasan dan kelayakan. Produk yang dihasilkan dari pengembangan ini adalah paket layanan informasi dampak dan pencegahan free sex yang terdiri atas (1) paket layanan informasi dampak dan pencegahan free sex untuk siswa, yang terdiri atas 4 topik yaitu (a) mengenal siapa remaja; (b) free sex di kalangan remaja; (c) dampak free sex; (d) dan pencegahan terhadap free sex, (2) panduan paket layanan informasi dampak dan pencegahan free sex untuk konselor. Penelitian ini merupakan penelitian pengembangan yang menggunakan langkah-langkah pengembangan dari Borg and Gall (1983) yang terdiri atas tahap (1) identifikasi kebutuhan; (2) perumusan tujuan bimbingan; (3) pembuatan produk; (4) uji coba produk; (5) revisi; (6) dan produk akhir. Subyek uji coba ahli adalah ahli materi bimbingan dan konseling, ahli kesehatan dan ahli media. Subyek calon pengguna produk adalah konselor dan 10 orang siswa SMP Lab.UM. Instrumen yang digunakan untuk mengumpulkan data adalah angket. Angket dianalisis dengan menggunakan mode kemudian dideskriptifkan. Hasil Penelitian dan Pengembangan berdasarkan uji ahli dan uji calon pengguna produk menunjukkan bahwa paket layanan informasi dampak dan pencegahan free sex memenuhi syarat akseptabilitas dari aspek ketepatan, kegunaan, kemudahan, kemenarikan, kejelasan dan kelayakan. Paket dapat digunakan sebagai media dalam pemberian layanan informasi mengenai dampak dan pencegahan free sex untuk siswa SMP. Saran yang diberikan untuk Konselor SMP Lab. UM adalah (1) paket ini hendaknya digunakan dalam memberikan layanan informasi dampak dan pencegahan free sex; (2) Konselor harus memahami prosedur penggunaan paket dan materi bimbingan agar siswa dapat mencapai tujuan yang dikehendaki; (3) konselor dapat melengkapi penggunaan paket layanan informasi dampak dan pencegahan free sex dengan menggunakan tampilan power point, cerita, film ataupun berita di media cetak yang mendukung topik bimbingan; (4) hendaknya konselor menindaklanjuti hasil evaluasi diri siswa dengan melakukan konseling individu atau konseling kelompok apabila diperlukan. Saran yang diberikan untuk peneliti selanjutnya adalah (1) Perlu diadakan uji lapangan dalam skala besar sehingga paket layanan informasi ini benar-benar sesuai dan bermanfaat untuk siswa; (2) agar diteliti lebih lanjut mengenai efektifitas penggunaan paket layanan informasi dampak dan pencegahan free sex terhadap pemahaman siswa atau tindakan bimbingan, (3) Peneliti selanjutnya dapat menambahkan kompetensi ranah psikomotorik pada paket layanan informasi dampak dan pencegahan free sex untuk siswa SMP.

Penerapan pendidikan karakter pada kompetensi keahlian teknik alat berat (studi kasus pad SMK Negeri 1 Singosari Malang bekerjasama dengan PT. Trakindo Utama) / Achmad Djuliadi

 

Tesis. Program Studi Pendidikan Kejuruan, Program Pascasarjana Universitas Negeri Malang, Pembimbing: (I) Dr. H. Dwi Agus Sudjimat, ST, M.Pd, (II) Dr. Waras Kamdi, M.Pd. Kata-kata kunci: penerapan, pendidikan karakter , teknik alat berat Penelitian Penerapan Pendidikan Karakter Teknik Alat Berat (selanjutnya disingkat PKTAB) pada Kompetensi Keahlian Teknik Alat Berat (selanjutnya disingkat KKTAB) SMK Negeri 1 Singosari Malang ini bertujuan untuk mengungkap dan mendeskripsikan tentang penerapan PKTAB pada KKTAB SMK Negeri 1 Singosari Malang. Ada empat fokus penelitian ini, yaitu: (1) bagaimanakah penerapan PKTAB pada KKTAB SMK Negeri 1 Singosari Malang?; (2) karakter apa yang ditumbuhkembangkan dalam diri peserta didik pada KKTAB SMK Negeri 1 Singosari Malang?; (3) bagaimanakah model penilaian terhadap penerapan PKTAB?; dan (4) bagaimana persepsi peserta didik terhadap penerapan PKTAB pada KKTAB SMK Negeri 1 Singosari Malang?. Penelitian ini dijalankan menggunakan pendekatan penelitian kualitatif dengan rancangan studi kasus, dengan dasar pertimbangan adalah: (1) penelitian ini dilakukan pada latar alamiah; (2) penelitian ini menggunakan manusia sebagai instrumen utama; dan (3) penelitian ini lebih memperhatikan proses daripada hasil. Dan berikutnya teknik pengumpulan data dilakukan melalui: (1) wawancara; (2) observasi (pengamatan); (3) dan dokumentasi atau arsip. Data penelitian yang terkumpul diuji kredibilitas, menggunakan tiga teknik pengecekan, yaitu: (1) triangulasi, baik sumber data maupun metode pengumpulan data; (2) reduksi data, untuk menyaring data yang memang benar-benar diperlukan; dan (3) diskusi dengan guru bidang produktif, tim pengembang kurikulum dan industri PT.Trakindo Utama. Dari penelitian ini diperoleh temuan-temuan sebagai berikut : Pertama, penerapan PKTAB pada KKTAB SMK Negeri 1 Singosari Malang diawali dengan melakukan kegiatan sosialisasi tentang Pendidikan Karakter kepada seluruh komunitas/warga sekolah, Kedua, jenis karakter yang ditumbuh-kembangkang adalah pendidikan karakter secara teknis yaitu mengacu pada kekhususan pengajarannya sesuai dengan kompetensi alat berat, dan secara non teknis adalah mengacu pada tujuh kebiasaan manusia yang efektif, yaitu “The 7 Habits of Highly Effective People”. Ketiga, metode penilaian pendidikan karakter dipantau dengan Skill Profeciency Book (SPB); dan Keempat, menggali persepsi peserta didik tentang penerapan PKTAB pada KKTAB SMK Negeri 1 Singosari Malang. Dan secara umum telah menunjukkan kecenderungan positif, diantaranya peserta didik merasakan bahwa pendidikan karakter yang diperolehnya dapat meningkatkan kepercayaan diri yang kuat dalam melakukan suatu tindakan tertentu. Berdasarkan temuan penelitian tersebut, diajukan saran sebagai berikut: (1) dalam penerapan PKTAB diperlukan konsistensi serta perbaikan terhadap komponen-komponen kurikulum oleh stakeholder SMK Negeri 1 Singosari; (2) perlu pemantauan (monitoring) terhadap penerapan PKTAB secara berkesinambungan serta dilakukan supervisi berkala terhadap pelaksanaan pendidikan karakter ini; (3) metode untuk meningkatkan pemahaman guru dan operasional tentang PKTAB bisa dilaksanakan melalui berbagai kegiatan seperti: sosialisasi kurikulum; lokakarya (workshop); pendidikan dan latihan (diklat), serta pertemuan dalam forum kompetensi keahlian sejenis, yang harusnya difasilitasi oleh Sub. Dit. Kurikulum PSMK, Jakarta; dan (4) bagi peneliti lain, dimungkinkan untuk melakukan pengembangan lebih lanjut secara mendalam dalam kaitannya dengan penelitian ini.

Pengembangan sumber belajar pembelajaran jarak jauh berbasis website, materi adobe photoshop CS2 siswa kelas XI IPA MAN Bangil / Zamy Abdulloh Malikul Alam

 

Kata kunci: sumber belajar, pendidikan jarak jauh, Adobe Photoshop Teknologi Internet dapat menjadi terobosan yang efektif untuk mengatasi masalah hubungan antara guru dan peserta didik dalam mengolah informasi bahan pelajaran. Penggunaan fasilitas Internet dalam dunia pendidikan sangat besar manfaatnya, khususnya bagi kaum intelektual dalam rangka meningkatkan kualitas sumber daya manusia secara mudah dan murah. Keberadaan sumber belajar yang terkoneksi dengan internet dapat menjadi solusi terbaik bagi guru yang mempunyai jam mengajar yang padat dan lama. Media ini juga dapat mengurangi kebosanan siswa di dalam kelas. Dengan bantuan internet, kegiatan pembelajaran dapat dilaksanakan tanpa batasan waktu dan tempat. Siswa maupun guru dapat mengakses media tersebut kapanpun dan dimanapun mereka berada. Pembelajaran jarak jauh ini sebagai alternatif pemerataan kesempatan belajar yang memungkinkan peserta didik dapat mengakses sendiri materi atau bahan yang dibelajarkan. Tujuan penelitian ini adalah mengembangkan sumber belajar adobe photoshop cs2 berbasis website menggunakan software Moodle yang memiliki berbagai fitur yang menarik, efisien, interaktif, mudah dipahami oleh peserta didik. Model pengembangan yang digunakan dalam penelitian ini adalah model pengembangan media yang diadaptasi dari model pengembangan Sugiyono. Instrumen pengumpulan data yang digunakan pada pengembangan ini berupa angket yang disebarkan kepada ahli media, ahli materi, dan siswa. Data yang diperoleh berupa data kuantitatif dan data kualitatif. Objek penelitian ini adalah siswa kelas XI IPA Madrasah Aliyah Negeri Bangil tahun pelajaran 2010-2011. Hasil validasi sumber belajar dari ahli media mendapat persentase 81,8%, dari ahli materi mendapat persentase 93%, dan dari responden 90%. Berdasarkan hasil validasi tersebut, sumber belajar berbasis website pada materi adobe photoshop dapat disimpulkan valid/layak dan efektif digunakan sebagai sumber belajar untuk pembelajaran jarak jauh (PJJ). Pengembangan sumber belajar lebih lanjut dapat ditambahkan materi lain dan dapat dikemas secara offline.

Pengaruh penerapan model direct instruction dibandingkan dengan quantum teaching berbantuan media interaktif terhadap hasil belajar menggunakan program pengolah database pada siswa kelas XI di SMA Negeri 6 malang / Ameliza Apriliana

 

Kata kunci: Direct intruction, Quantum Teaching, Media Interaktif, hasil belajar Keaktifan siswa dalam proses pembelajaran sangat diperlukan guna meningkatkan pemahaman siswa terhadap materi. Proses pembelajaran yang meriah dengan segala nuansanya, menyertakan segala kaitan, interaksi dan perbedaan yang memaksimalkan momen belajar yang berfokus pada hubungan yang dinamis dalam lingkungan kelas, interaksi yang mendirikan landasan dan kerangka untuk berfikir. Model pembelajaran Quantum Teaching merupakan salah satu solusi yang dapat digunakan untuk meningkatkan hasil belajar siswa dalam proses pembelajaran. Model pembelajaran Quantum Teaching dapat menciptakan suasana belajar yang menyenangkan dengan segala nuansanya, demokrasi, penanaman konsep yang diperoleh dari hasil penyelidikan, penyimpulan serta meningkatkan motivasi siswa dalam belajar, membangkitkan minat dan partisipasi, serta meningkatkan pemahaman materi. Sedangkan penggunaan media interaktif adalah sebagai bantuan untuk siswa agar lebih mudah menyerap apa yang diajarkan oleh guru. Media yang interaktif mampu menarik keinginan siswa untuk belajar secara lebih menyenangkan dan tidak membosankan. Menerapkan apa yang ada di media dan mengembangkannya sesuai dengan apa yang telah dipelajari. Penelitian ini bertujuan untuk mengetahui perbedaan hasil belajar siswa kelompok eksperimen dan kontrol serta untuk mengetahui pengaruh penerapan Quantum Teaching terhadap hasil belajar menggunakan program pengolah database siswa kelompok eksperimen. Rancangan penelitian menggunakan desain eksperimen semu. Variabel bebas yaitu metode pembelajaran dan variabel terikat yaitu hasil belajar. Sampel penelitian ditentukan dengan teknik purposive sampling, yaitu kelas XI IPA 2 sebagai kelompok eksperimen dan kelas XI IPA 3 sebagai kelompok kontrol. Instrumen yang digunakan adalah silabus, RPP, lembar angket, lembar afektif, lembar observasi praktek siswa, dan tes tulis. Uji hipotesis menggunakan uji t dan regresi linear sederhana. Hasil uji t menghasilkan nilai Sig (p) = 0,000 < 0,05, sehingga Ho ditolak. Jadi, terdapat perbedaan yang signifikan hasil belajar TIK antara kelompok eksperimen dan kontrol. Hasil uji regresi linear sederhana diperoleh nilai Sig (p) = 0,000 < 0,05, sehingga Ho ditolak. Jadi, terdapat pengaruh yang signifikan antara penerapan model Quantum Teaching berbantuan media interaktif terhadap hasil belajar menggunakan program pengolah database pada kelompok eksperimen yang pengaruhnya dapat diprediksi melalui persamaan regresi Y = 443,30 + 0,441 X.

Enhancing reading comprehension of first grade students of SMKN 2 malang through the cooperative integrated reading and composition (CIRC) strategy / Wahyunengsih

 

hesis. Graduate Program in English Language Education State University of Malang. Advisors: (I) Dr. Gunadi Harry Sulistyo, M.A.,(II) Drs. Fachrurrazy, M.A, Ph.D. Keywords: cooperative integrative reading and composition, reading comprehension Based on problems found in the preliminary study, the objective of this study is to figure out how Cooperative Integrative Reading and Composition (CIRC) Strategy enhance the students' reading comprehension of first grade at SMKN 2 Malang. By using this strategy, it is expected the students' ability in reading comprehension could be enhanced. This study is classroom action research (CAR) which consists of four major steps: planning, implementation, observation, and reflection. The subjects of the study are first grade students of SMK N 2 Malang, class XKPR3 (Nursing) comprising of 40 students. This study was conducted in one cycle consisting of five meetings for teaching and learning activities and one meeting for test. The instruments used for collecting data are: reading test, questionnaires and field notes. The result of the study shows that (1) the use of the CIRC strategy in teaching reading could enhance the students' ability in reading comprehension. The improvement is indicated by the achievement of the students' result in reading scores. From 40 students, 12.5% or 5 students in got 10.0 in reading comprehension test, 5% or 2 students got 9.5, 12.5% or 5 students got 9, 15% or 6 students got 8.5, 22.5% or 9 students got 8, and 30% or 12 students got 7.5. One student could not pass because the student did not follow two meetings in the teaching learning process. Therefore, the student was not categorized into the failure of the all of the study. The result of the questionnaires also shows that each student of 40 students in the class (100%) answered "Yes/Agree" for at least 5 or more questions in the questionnaires, and the students felt comfortable and felt that the CIRC is easy to implement and did not cause depressed or stress. Based on the findings described above, the study concludes that (1) the use of CIRC strategy is effective to enhance the students' ability in reading comprehension by reading aloud, group responses, short composition, and individual and group presentations; (2) the implementation of the CIRC strategy is able to provide comfortable and joyful learning atmosphere. In addition, the researcher also suggests several things. First, English teachers are suggested to employ this strategy when they face the same problems in teaching reading in other grades, second and third grade of SMK . Second, for the future researchers, further study could be conducted at public high school level (SMA) or at the level of university students. By using CIRC strategy further researchers are also suggested to solve other reading comprehension problems in the other reading comprehension level.

Pendeteksi plagiarisme dokumen akademik mahasiswa di Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang / Iva Asma'ul Khusna

 

Kata kunci: Plagiarisme, dokumen akademik, Information Retrieval Praktek plagiarisme dapat mengancam keaslian suatu dokumen akademik seperti tugas akhir, skripsi, tesis, dan disertasi sehingga pendeteksi plagiarisme sangat dibutuhkan di lingkungan akademik terutama di lingkup universitas, salah satunya adalah Universitas Negeri Malang (UM). Universitas Negeri Malang merupakan salah satu lembaga perguruan tinggi pendidikan di Indonesia yang sudah lama berdiri. Penyimpanan dokumen akademik di UM sudah didokumentasikan dengan baik. Namun, deteksi plagiasi hanya dilakukan secara manual yaitu pada judul karya dokumen akademik. Sistem pendeteksi plagiarisme pada dokumen akademik mahasiswa Jurusan Teknik Elektro Fakultas Teknik Universitas Negeri Malang menerapkan information retrieval (IR) dan menggunakan model pengembangan waterfall sehingga perancangan dilakukan tahap demi tahap, mulai dari tahap kebutuhan sistem lalu menuju ke tahap analisis, tahap desain, tahap implementasi, dan tahap pengujian. Pengujian dilakukan secara perhitungan manual dan dibandingkan dengan program. Penerapan IR pada pendeteksi plagiarisme dihasilkan perhitungan yang mendekati asumsi. Pada dokumen yang diasumsikan tingkat kemiripan 0%, perhitungan IR (manual maupun sistem) adalah 0%. Pada dokumen yang telah diasumsikan tingkat kemiripan 75% , perhitungan IR (manual maupun sistem) adalah 83% dan 69,56%. Galat dari dokumen yang di asumsikan 75% dengan dokumen yang telah dihitung menggunakan IR (manual maupun sistem) adalah 13.44%. Pada dokumen yang telah diasumsikan tingkat kemiripan 25%, perhitungan IR (manual maupun sistem) adalah 31% dan 29,93% . Galat dari dokumen yang di asumsikan 25% dengan dokumen yang telah dihitung menggunakan IR (manual maupun sistem) adalah 1,07%. Pada dokumen yang telah diasumsikan tingkat kemiripan 50%, perhitungan IR (manual maupun sistem) adalah 54% - 54,31% . Kemunculan galat 0,31% dari dokumen yang di asumsikan 50%. Dokumen yang telah diasumsikan tingkat kemiripan 100%, perhitungan IR (manual maupun sistem) adalah 100% dan 95% . Kemunculan galat adalah 5%.Rata-rata galat dari dokumen yang telah diperiksa adalah 3,96%

Pengembangan sistem tutor cerdas untuk pembelajaran remidial / Gilang Kurniaji

 

Kata Kunci : Sistem Tutor Cerdas, Remidial, Website Pengajaran Remidial merupakan salah satu aspek penunjang pembelajaran dengan sistem pembelajaran tuntas (Mastery Learning).Pengajaran Remidial memberikan bantuan, penguatan dan perbaikan terhadap siswa yang belumtuntas Standar Kompetensi Materi (SKM).Namun kondisi di lapangan proses pengajaran remedial seringkal diabaikan. Proses pembelajaran dianggap sudah terwakilidenganadanyatesulang. Berkaitan dengan haltersebut, makap eneliti merasa bahwa proses pembelajaran remidiald imungkinkan untuk disubstitusi dengan teknologi komputer. Media yang dikembangkanu ntuk mensubtitusi proses pembelajaran remedial mencakupempatfitur utama.Fiturtersebutantaral ain, 1) Diagnosis kesulitan belaja rsiswa, 2) Penyampaian materi sesuaid engan topik yang tidakdikuasais iswaserta dengan teknik penyampaian yang sesuai dengan karakteristikataukesukaansiswa, 3) Tessertabalikan terhadap proses belajar menggunakan media, serta 4) Learning Management System (LMS) untuk mempermudah dalam menyusunmateri.Sistemdikembangkandenganmengadopsisistem tutor cerdas. Tujuan utamapenggunaanteknologi tutor cerdaske dalam media adalah untuk apatme nduplikasi peran guru dalam proses pembelajaran remedial. Media dikembangkan berbasis Website, jadis iswad apatmengakses media inidenganmudahdanleluasa. Media dikembangkandenganmenggunakanpendekatanpengembangan media danbahan ajar yang dikemukakanoleh PUSTEKKOM.Tahapan yang dilakuka untuk pengembangan media meliputi, perancangan, produksi, danevaluasi. Penelitian ini menggunaakan dua macam instrument. Instrumen pertama berupa kuesioner dengantipeter buka dan tertutup. Peneliti menggunakan instrument iniuntuk mendapatkan data tentang kelayakan media pembelajaran.Instrumen keduaadalahdokumentas ihasilbelajarsiswa. Instrumenini digunakan pada uji lapanganuntuk mendapatkan informasi tentangp erbedaan hasil belajardari siswa yang menggunakan media dansiswa yang tidakmenggunakan media. Dari hasilpenelitiandanpengembangan yang dilakukandidapatkanhasil rata-rata nilaihasiluji kelayakan media olehahli media, ahlimateri, ujikelompokkecil siswadanuji kelompok besar adalah 85,60 %. Sehinggadapatdinyatakan media yang dikembangk anlayakuntuk digunakansebagai media pembelajaran berdasarkan seluruhpenilaian. Hasil ujicoba apangan menunjukkan adanya perbedaanhasilbelajarpadasiswa yang menggunakan media dan yang tidak menggunakan media sebesar 7,4poin. Jadi, siswadapatmenggunakan media untukmensubtitusi guru pada proses pembelajaran remedial.

Variasi genetik kerbau lokal (Bubalus bubalis) di wilayah Madiun dan Malang berdasarkan prodil dan polimorfisme protein darah sebagai bahan ajar teknik analisis biologi molekuler / Marheny Lukitasari

 

Tesis, Program Studi Pendidikan Biologi, Program Pasca Sarjana, Universitas Negeri Malang, Pembimbing (I) : Dr. agr. Mohamad Amin, M.Si., (II) Dr. Umie Lestari, M.Si. Kata kunci : variasi genetik, profil, polimorfisme, protein, bahan ajar Populasi ternak kerbau di Indonesia sebanyak 40% terdapat di Pulau Jawa, khususnya di Jawa Timur. Data menunjukkan bahwa populasi kerbau terus mengalami penurunan jumlah selama kurun waktu lima tahun terakhir. Penurunan jumlah kerbau disebabkan karena masyarakat lebih menyukai beternak sapi karena nilai jual yang lebih tinggi dibanding kerbau. Selain itu seleksi negatif juga dilakukan peternak saat menjual dan memotong kerbau, sehingga yang tertinggal untuk pembibitan adalah kerbau dengan kualitas rendah. Langkah awal untuk meningkatkan kualitas indukan adalah dengan melakukan identifikasi variasi genetik melalui pendekatan molekuler berdasarkan pola profil protein darah. Proses ini dapat dilakukan karena protein yang terdapat pada darah adalah protein fungsional yang merupakan produk dari ekspresi gen. Tujuan dari penelitian ini adalah 1) untuk mengetahui profil protein darah dan jarak genetik populasi kerbau di wilayah Madiun dan Malang, 2) untuk mengetahui perbandingan profil protein darah pada populasi kerbau yang ada di Madiun dan Malang, 3) untuk mengetahui polimorfisme protein darah (Haemoglobin, transferrin dan albumin) dapat menunjukkan keragaman genetik dan heterosigositas populasi kerbau yang ada di ada di Kabupaten Madiun dan Malang dan 4) untuk mengaplikasikan hasil penelitian tentang profil dan polimorfisme protein darah (Haemoglobin, transferrin dan albumin) sebagai bahan untuk pengembangan bahan ajar Teknik Analisis Biologi Molekuler (TABM). Metode penelitian dilaksanakan dengan pendekatan deskriptif melalui observasi laboratorik. Penelitian dilakukan dengan pencandraan secara sistematis, faktual dan akurat mengenai profil protein, jarak genetik, keragaman genetik dan tingkat heterosigositas populasi kerbau di Madiun dan Malang melalui analisis profil dan polimorfisme protein dengan metode elektroforesis SDS PAGE. Hasil penelitian menunjukkan bahwa protein eritrosit Madiun yang beragam terlihat pada BM 211 kDa, 86 kDa, 80 kDa, 68 kDa, 35 kDa, 27 kDa, 25 kDa, 16 kDa, 19 kDa dan 12 kDa. Protein serum yang beragam terlihat pada BM 207 kDa, 130 kDa, 68 kDa dan 55 kDa. Dendogram berdasar eritrosit dua populasi menunjukkan persentase similaritas 0,496. Sedangkan dendogram berdasarkan serum menunjukkan persentase similaritas sebesar 0,557. Hal ini berarti hubungan kekerabatan kedua populasi memiliki kesamaan yang relatif dekat berdasarkan serum dibandingkan eritrositnya. Nilai heterozigositas lokus transferrin pada populasi Malang lebih rendah dibanding populasi Madiun berarti heterosigositas lokus transferrin lebih tinggi di populasi Malang dibandingkan di populasi Madiun. Hasil penelitian dipergunakan untuk menyusun dan mengembangkan modul mata kuliah Teknik Analisis Biologi Molekuler.

Representasi penanaman perilaku dalam bahasa majalah taman kanak-kanak / Nurchasanah

 

Disertasi Program Studi Pendidikan Bahasa Indonesia, Program Pascasarjana, Universitas Negeri Malang. Pembimbing I: Prof. Dr. H. Dawud, M.Pd; Pembimbing II: Dr. H. Nurhadi, M.Pd; dan Pembimbing III: Prof. Dr. H. Ah. Rofi’uddin, M.Pd Kata-kata kunci: perilaku, penanaman perilaku, representasi penanaman perilaku, majalahanak, dan anak usia prasekolah. Masa Taman Kanak-kanak (TK) adalah masa peka bagi anak. Mereka mulai sensitif menerima berbagai upaya pengembangan potensi yang dimilikinya. Pada saat ini, terjadi pematangan fungsi-fungsi fisik dan psikis yang siap merespon stimulus yang diberikan lingkungannya. Stimulus dapat diwujudkan dalam bentuk penyediakan majalah anak sebagai media belajar berbagai kompetensi yang dibutuhkan. Agar majalah yang disiapkan untuk anak memiliki fungsi yang memadai, langkah awal yang dilakukan di antaranya adalah menelaah representasi penanaman perilaku dalam bahasa majalah anak. Representasi penanaman perilaku dalam bahasa majalah anak akan lebih bermakna jika dilihat kesejajarannya dengan perilaku anak dan tuntutan kurikulum TK karena konsumen majalah anak adalah anak dan majalah tersebut difungsikan sebagai media pembelajaran di Taman Kanak-kanak (TK). Dengan pertimbangan latar belakang tersebut, penelitian ini perlu dilaksanakan dengan tujuan menjelaskan representasi penanaman perilaku (1) sosial, (2) kognitif, dan (3) seni dalam bahasa majalah TK. Penelitian ini menggunakan pendekatan kualitatif model interaktif dengan jenis penelitian analisis wacana. Penelitian analisis wacana berusaha menelaah unit-unit fungsional perilaku komunikatif yang terbentuk dari (1) sistem bahasa: wacana, kalimat, dan kosakata; (2) paralinguistik: gambar-gambar; (3) unsur kultural: perilaku sosial dan seni; dan (4) unsur penalaran: perilaku kognitif yang direpresentasikan dalam majalah anak. Data penelitian berupa representasi isi penanaman perilaku sosial, kognitif, dan seni dalam majalah anak prasekolah dan bahasa (wacana, kalimat, dan kosakata) yang merepresentasikannya, perilaku anak, dan tuntutan kurikulum TK. Data diperoleh dengan teknik dokumentasi dan observasi dan dianalisis dengan prosedur (1) pengumpulan data, (2) penyajian data, (3) reduksi data, dan (4) verifikasi data. Teori yang digunakan untuk menganalisis dan menjelaskan representasi penanaman perilaku tersebut bersifat multidisipliner, berupa (1) teori analisis wacana pandangan Cook; (2) teori semiotik; (3) teori pemerolehan bahasa dan perilaku: pemerolehan bahasa, perkembangan kognitif Piaget, sosiokultural Vygotsky, psiko-sosiolinguistik Jalongo, dan perkembangan perilaku seni; (4) teori bahasa guru; dan (5) teori pembelajaran anak usia TK. Hasil analisis data menunjukkan bahwa representasi penanaman perilaku sosial dalam majalah anak terklasifikasi atas dua kategori, yaitu (1) penanaman perilaku yang mengarahkan anak-anak untuk dapat berintaraksi dan menjalin hubungan dengan orang lain, seperti perilaku kasih sayang, sopan-santun, mengetahui baik-buruk/benar-salah, hormat, gotong-royong, tolong-menolong, disiplin, percaya diri, dan tanggung jawab serta (2) penanaman perilaku yang mengarahkan anak-anak untuk dapat mengendalikan emosinya. Representasi penanaman perilaku sosial dalam bahasa majalah anak sejajar dengan perilaku sosial anak dan tuntutan kurikulum TK. Penanaman perilaku sosial diungkapkan melalui simbol-simbol verbal berupa wacana (interaktif, naratif, dan percakapan bergambar) yang sebagian memiliki fungsi ganda, berbagai jenis kalimat (deklaratif, interogatif, imperatif, dan interjektif) yang sebagian memiliki fungsi ganda, dan kosakata bernilai sosial yang diperjelas dengan gambar-gambar. Ini menunjukkan bahwa penanaman perilaku sosial dalam majalah anak direpresentasikan melalui berbagai jenis wacana dan kalimat yang sebagian memiliki fungsi ganda dan kosakata bernilai sosial-emosional. Representasi penanaman perilaku kognitif dalam bahasa majalah anak terklasifikasi atas tiga kategori, yaitu penanaman perilaku kognitif pada tataran (1) praoperasional: menyontoh, menentukan, dan memilih; (2) operasi-konkret: menghitung, mengurutkan, menjumlahkan/mengurangi, mengelompokkan, melengkapi, menebak, menghubungkan, membedakan, mencari kejanggalan, mencari objek tersembunyi, menyusun, memecahkan masalah, membuat sesuatu, dan melakukan percobaan; serta (3) operasi-formal: mencari sebab-akibat (tingkat tinggi). Penanaman perilaku kognitif dalam majalah anak tidak sejajar dengan perilaku anak dan tuntutan kurikulum TK. Tuntutan penanaman perilaku kognitif dalam majalah anak lebih tinggi daripada perilaku kognitif anak dan tuntutan kurikulum TK. Penanaman perilaku tersebut diungkapkan melalui simbol-simbol verbal berupa wacana (interaktif dan paparan angka/hitungan) yang sebagian memiliki fungsi ganda, berbagai jenis kalimat (deklaratif, interogatif, imperatif, dan interjektif) yang sebagian memiliki fungsi ganda, dan kosakata bermuatan kognisi diperjelas dengan gambar-gambar. Ini berarti, penanaman perilaku kognitif pada tataran operasi-formal tingkat tinggi direpresentasikan dalam majalah anak melalui berbagai jenis wacana dan kalimat yang sebagian memiliki fungsi ganda dan kosakata bermuatan kognisi. Representasiisipenanaman perilaku seni dalam bahasa majalah anak berbentuk (1) bernyanyi, (2) menggambar, (3) mewarna, (4) bersajak, (5) mencipta, dan (6) menari. Representasi penanaman perilaku seni dalam bahasa majalah anak tidak sejajar dengan perilaku seni anak, namun sejajar dengan tuntutan kurikulum TK. Tuntutan dalam majalah anak dan kurikulum TK lebih bervariasi daripada perilaku seni anak. Penanaman perilaku seni direpresentasikan dalam berbagai simbol verbal, baik berupa wacana (interaktif, paparan lagu, dan sajak) yang sebagian memiliki fungsi ganda, berbagai jenis kalimat (deklaratif, interogatif, dan imperatif) yang sebagian memiliki fungsi ganda, dan kosakata bernilai seni didukung oleh gambar-gambar. Ini menunjukkan bahwa penanaman perilaku seni-kreatif direpresentasikan dalam berbagai jenis wacana dan kalimat yang sebagian memiliki fungsi ganda dan kosakata bernilai seni. Secara umum, hasil penelitian ini dapat disimpulkan bahwa penanaman perilaku sosio-kultural positif-kreatif dan berpikir operasi-formal direpresentasikan dalam majalah TK melalui berbagai tataran bahasa. Hasil penelitian ini memiliki konsekuensi perlunya penyesuaian kompleksitas bahasa dan tuntutan tingkat berpikir dalam majalah anak dengan perilaku anak.

Makna partisipasi masyarakat (studi kasus peranan partisipasi masyarakat dalam penyelenggaraan program PAUD di Desa Bongkot Kec. Peterongan Kab. Jombang) / Jati Utami

 

Tesis, Program Studi Pendidikan Luar Sekolah, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Sanapiah Faisal, (II) Prof. Dr. Supriyono, M.Pd. Kata kunci: partisipasi, masyarakat, PAUD Penelitian ini bertujuan mengetahui gambaran partisipasi masyarakat terhadap penyelenggaraan PAUD yang mencakup gambaran penyelenggaraan PAUD Rahmat Said, bentuk partisipasi masyarakat dan makna partisipasi masyarakat dalam penyelenggaraan program PAUD tersebut. Penelitian studi kasus ini dilakukan di Desa Bongkot Kecamatan Peterongan Kabupaten Jombang Jawa Timur terhadap warga masyarakat Desa Bongkot dari unsur pelaku antara lain: tenaga pengelola, tenaga pendidik, perangkat desa dan tokoh masyarakat, orang tua murid, dan dilengkapi pula dengan mitra penyelenggara atau pihak yang terlibat dalam penyelenggara yakni yayasan setempat dan SKB sebagai institusi negara yang berkepentingan dalam pelaksanaan program PAUD Rintisan. Data diambil secara secara sampling bola salju sebanyak 24 orang. Data digali dengan tehnik wawancara dan dianalisis secara diskriptif. Diketahui bahwa PAUD Rahmat Said dapat berdiri dan terselenggara berkat partisipasi warga masyarakat. Keberadaan PAUD Rahmat Said mendapat tanggapan yang positif dari masyarakat. Partisipasi masyarakat diberikan dalam bentuk inisiasi atau gagasan, tenaga, materi, dan pengelolaan. Bentuk partisipasi tersebut terpilah dalam bentuk partisipasi sebagai tenaga pengelola, sebagai tenaga pendidik, keterlibatan perangkat desa dan tokoh masyarakat dalam penyelenggaraan, dan partisipasi orang tua murid. Dari penggalian data diketahui bahwa pemaknaan partisipasi masyarakat berhubungan dengan 1) pemahaman masyarakat tentang pendidikan, 2) adanya nilai pandang untuk mengutamakan pendidikan, 3) adanya nilai-nilai agama yang dianut sebagai motivasi dalam berpartisipasi, dan 4) adanya tokoh panutan masyarakat dalam pembangunan pendidikan yang membekali sikap dasar masyarakat terhadap pendidikan, 5) partisipasi bermakna penting (a) bagi kemajuan pembangunan sebuah wilayah, (b) demi kelancaran sebuah penyelenggaraan pendidikan, (c) bagi ketahanan atau keberlanjutan sebuah program kegiatan, (d) untuk bangunan sikap sosial keagamaan, solidaritas masyarakat, kebersamaan, dan rasa memiliki terhadap hasil pembangunan di wilayahnya. Berdasarkan hasil dan temuan penelitian ini disarankan kepada (1) lembaga PAUD hendaknya juga mengembangkan program yang dapat meningkatkan pemahaman dan pengetahuan orang tua tentang pendidikan anak usia dini, (2) masyarakat hendaknya meningkatkan pemahaman tentang pendidikan anak usia dini khususnya menyangkut pola perkembangan anak melalui keikutsertaan dalam sosialisasi pendidikan anak. (3) institusi pemerintah maupun organisasi non pemerintah yang bertanggung jawab dan berkepentingan untuk pengembangan pendidikan khususnya PAUD , selain melakukan upaya sosialisasi tentang pentingnya pendidikan anak usia dini, namun juga dapat memotivasi keterlibatan unsur masyarakat dalam penyelenggaraan pendidikan dan mempertimbangkan nilai pandang lokal guna mendorong partisipasi masyarakat.

Penggunaan strategi catalisting untuk meningkatkan kemampuan menulis esai mahasiswa Jurusan Pendidikan Bahasa & Sastra Indonesia Fakultas Sastra dan Seni Universitas Negeri Yogyakarta / Setyawan Pujiono

 

Tesis, Jurusan Pendidikan Bahasa Indonesia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Suparno, (II) Dr. Nurhadi, M.Pd. Kata kunci: pembelajaran menulis, menulis esai, strategi Catalisting. Penelitian ini bertujuan untuk (1) meningkatkan kemampuan menulis esai mahasiswa melalui strategi Catalisting pada tahap mengembangkan subtansi isi, (2) meningkatkan kemampuan menulis esai mahasiswa melalui strategi Catalisting pada tahap mengorganisasi karangan, dan (3) meningkatkan kemampuan menulis esai mahasiswa melalui strategi Catalisting pada tahap mengembangkan tulisan. Penelitian ini merupakan penelitian tindakan kelas dengan prosedur penelitian berupa perencanaan, tindakan, dan refleksi. Subjek penelitian ini adalah mahasiswa kelas A JPBSI FBS UNY angkatan 2009 peserta Matakuliah Menulis Faktual yang berjumlah 23 orang. Teknik pengumpulan data yang digunakan dalam penelitian ini berupa hasil pengamatan, wawancara, dan dokumentasi. Instrumen yang digunakan dalam penelitian meliputi pedoman catatan lapangan, pedoman wawancara, pedoman rubrik penilaian, dan angket. Hasil penelitian menunjukkan bahwa terjadi peningkatan kemampuan mahasiswa pada tahap mengembangkan subtansi isi, mengorganisasi masalah, dan mengembangkan tulisan. Pada tahap mengembangkan subtansi isi siklus 1, dosen tidak menjelaskan tujuan membaca esai model, serta tidak menjelaskan cara mengembangkan masalah dan solusi. Akibatnya, mahasiswa kesulitan menemukan dan mengembangkan subtansi isi karangannya. Pada siklus 2, dosen mengarahkan mahasiswa untuk memfokuskan membaca pada bagian isi, menandai bagian-bagian yang penting, dan mengarahkan mahasiswa untuk menemukan subtansi isi karangan. Hasilnya, mahasiswa mampu mengembangkan subtansi isi karangan. Pada tahap mengorganisasi masalah siklus 1, dosen tidak menjelaskan langkah-langkah pembelajaran serta tidak memberikan contoh cara mengorganisasi masalah. Akibatnya, mahasiswa belum mampu menyusun kerangka karangan sesuai dengan yang diharapkan. Pada siklus 2, dosen sudah melakukan proses pembelajaran sesuai dengan sekenario pembelajaran yang telah disusun. Dosen memberikan contoh cara menemukan masalah dan mengorganisasi masalah dalam kerangka karangan. Hasilnya, mahasiswa mampu menemukan masalah-masalah baru dan mampu mengorganisasi masalah dalam kerangka karangan secara logis. Pada tahap mengembangkan tulisan, pada siklus 1 dosen hanya mengarahkan mahasiswa menulis esai dari judul, tesis, masalah, dan solusi. Dosen tidak memberikan contoh cara memilih kata, menyusun kalimat, paragraf, dan penggunaan ejaan serta tanda baca yang benar. Akibatnya, karangan mahasiswa urutan masalahnya menjadi tidak logis. Selain itu, terdapat hubungan antarkalimat kurang kohesif, penggunaan kalimat kompleks kurang efektif, dan banyak kesalahan ejaan serta tanda baca. Pada siklus 2, dosen mengarahkan mahasiswa untuk menulis esai berdasarkan pengembangan masalah yang telah disusun dalam kerangka karangan. Sebelum mengarang, dosen memberikan pengarahan dan contoh menyusun kalimat, paragraf, tatabahasa, dan penggunaan ejaan serta tanda baca. Selain itu, dosen juga menjelaskan cara pengembangan masalah dari paragraf awal, tubuh, dan akhir karangan. Hasilnya, mahasiswa mampu mengembangkan tulisannya dengan urutan masalah yang logis, kalimat efektif, dan tidak banyak terjadi kesalahan penggunaan ejaan dan tanda baca.

Pengaruh cooperative learning model tutorial sebaya (peer tutoring) berbantuan popular social network terhadap prestasi belajar siswa mata pelajaran produktif RPL kelas X SMK N 5 Malang / Tysna Riadena Utami

 

Kata Kunci: cooperative learning, tutorial sebaya, prestasi belajar, popular social network Model pembelajaran Tutorial Sebaya berbantuan popular social network (Facebook) adalah model pembelajaran yang meminta siswa untuk saling membantu dalam proses belajar kelompok di kelas, sehingga siswa yang yang belum paham akan terbantu oleh siswa yang sudah paham yang disebut tutor sebaya dan melalui popular social network siswa akan tetap aktif belajar di luar jam formal, siswa juga bisa langsung berinteraksi dengan teman atau gurunya, dalam mengkonsultasikan ketidakpahaman pada suatu materi, yaitu dengan membuat Facebook group. Penelitian ini bertujuan untuk mendeskripsikan keterlaksanaan cooperative learning model Tutorial Sebaya (Peer Tutoring) berbantuan popular social network serta untuk mengetahui pengaruh cooperative learning model Tutorial Sebaya (Peer Tutoring) berbantuan popular social network terhadap prestasi belajar siswa. Rancangan penelitian yang digunakan adalah quasy experimental dengan teknik purposive sampling, sampel yang digunakan adalah kelas X RPL 3 sebagai kelompok eksperimen dan kelas X RPL 4 sebagai kelompok kontrol. Instrumen yang digunakan yaitu instrumen perlakuan yaitu silabus, RPP, modul, kisi-kisi soal beserta soal dan kunci jawaban, serta instrumen pengukuran tes tulis, angket dan lembar observasi keterlaksanan aktivitas guru dan siswa. Teknik analisis data yang digunakan adalah analisis statistik kuantitatif dengan bantuan SPSS. Hasil penelitian menunjukkan bahwa keterlaksanaan pembelajaran kooperatif model Tutorial Sebaya berbantuan popular social network bisa dikatagorikan berjalan dengan sangat baik, dengan merujuk pada data observasi aktivitas guru yang mencapai 90% dan aktivitas siswa mencapai 85%. rata-rata nilai prestasi belajar siswa pada kelas eksperimen adalah 80 dan pada kelas kontrol adalah 72, dari hasil perhitungan uji-t diperoleh hasil yaitu nilai Sig(0,000)menunjukkan bahwa terdapat perbedaan rata-rata nilai prestasi belajar siswa yang diajar pembelajaran kooperatif model Tutorial Sebaya berbantuan popular social network dengan yang siswa yang diajar menggunakan metode ceramah bermakna, sedangkan hasil analisis regresi hasil perhitungan dari variabel independent yaitu keterlaksanaan model pembelajaran kooperatif model Tutorial Sebaya berbantuan popular social network dan variabel dependent yaitu prestasi belajar siswa terdapat sumbangan sebesar 12,6 %, hasil perhitungan uji regresi diperoleh hasil yaitu nilai Sig(0,036)pengaruh positif yang signifikan dari hasil keterlaksanaan cooperative learning model Tutorial Sebaya berbantuan popular social network terhadap prestasi belajar siswa Mata Pelajaran Produktif RPL Kelas X SMK N 5 Malang.

Hubungan karakteristik cara belajar dan peran guru terhadap hasil belajar TIK siswa kelas X di SMA Negeri 1 Trenggalek / Dhodit Rengga Tisna

 

Kata Kunci: Karakteristik Cara Belajar,Peran Guru dan Hasil Belajar TIK Cara belajar merupakan cara yang digunakan siswa untuk mencapai tujuan pembelajaran serta mendapatkan pesan dari sumber pesan. Cara belajar mengacu pada cara belajar yang disukai siswa. Sumber pesan adalah guru, siswa, orang lain ataupun penulis buku. Dalam hal ini guru sangat berperan dalam penyampaian pesan tersebut, yaitu menyampaikan pesan kepada penerima pesan yaitu siswa. . Guru pada umumnya menganggap bahwa semua siswa sama sehingga memperlakukan mereka sama. Pada prinsipnya hal itu bertentangan dengan hakekat manusia, khususnya siswa. Guru yang bijaksana akan menghargai siswa dan memperlakukan siswa sesuai dengan hakekat mereka masing-masing. Suatu tindakan guru yang dipandang tepat terhadap seorang siswa belum tentu tepat untuk siswa lain. Secara umum digunakan tiga media dalam menerima informasi, yaitu berdasarkan visual(penglihatan), auditori(pendengaran), dan kinestetik(sentuhan dan gerakan). Disini guru memiliki peranan penting yaitu mengetahui karakteristik siswa yang diajarnya, kemudian dapat mengembangkan cara belajar yang sesuai dengan karakteristik cara belajar siswa Penelitian ini bertujuan untuk: (1) Mengungkap hubungan Karakteristik Cara Belajar dan Hasil Belajar TIK; (2) Mengungkap hubungan Peran Guru dan Hasil Belajar TIK; (3) Mengungkap hubungan Karakteristik Cara Belajar dan Peran Guru terhadap Hasil Belajar TIK. Metode penelitian menggunakan metode kuantitatif korelasional. Metode sampling yang dipakai adalah proporsional random sampling dengan responden 65 siswa. Analisis diperoleh dengan menggunakan teknik korelasi partial, yaitu untuk mengetahui besarnya hubungan (1) Karakteristik Cara Belajar dengan Hasil Belajar TIK; (2) Peran Guru dengan Hasil Belajar TIK; (3) Karakteristik Cara Belajar dan Peran Guru terhadap Hasil Belajar TIK. Analisis data dilakukan dengan bantuan perangkat lunak SPSS for Windows release 16. Hasil penelitian adalah sebagai berikut: Analisis diskriptif korelasi antara Karakteristik Cara Belajar dengan Hasil Belajar TIK yaitu P(Visual) rata-rata nilai 73, Q(Auditorial) rata-rata nilai 69, PQ(Visual-Auditorial) rata-rata nilai 77.04, PR(Visual-Kinestetik) rata-rata nilai 83.11, PQR(Visual-Auditorial-Kinestetik) rata-rata nilai 94.5. Nilai koefisien korelasi parsial antara Peran Guru dengan Hasil Belajar TIK yaitu Ry2 sebesar 0,392. Tingkat Karakteristik Cara Belajar dalam kategori yaitu sebanyak P sebanyak 4 responden (6%), kategori Q sebanyak 1 responden (1%), kategori PQ sebanyak 11 responden (17%), kategori PR sebanyak 22 responden (34%), kategori PQR sebanyak 27 responden (42%).; Tingkat Peran Guru dalam kategori sangat tinggi sebanyak 63 responden (96,9%); Tingkat Hasil Belajar TIK dalam kategori sangat tinggi 59 responden (90,74%). Nilai koefisien korelasi parsial antara X2 dengan Y yaitu Ry2 sebesar 0,392 dengan probabilitas p hitung ≤ p standar, yaitu 0,001 < 0,05. Yang berarti harga korelasinya berada pada kategori indeks korelasi rendah sehingga dapat dikatakan tidak ada korelasi antara variabel X2 dengan Y. Kesimpulan penelitian adalah sebagai berikut: (1) Ada hubungan positif antara Karakteristik Cara Belajar dengan Hasil Belajar TIK; (2) Tidak ada hubungan positif antara Peran Guru dengan Hasil Belajar TIK; (3) Tidak ada hubungan positif antara Karakteristik Cara Belajar dan Peran Guru terhadap Hasil Belajar TIK.

Efektifitas pemanfaatan internet untuk pembelajaran TIK bagi siswa SMAN dan MAN di Kota Mojokerto / Dhaniyar

 

Kata Kunci : efektifitas, internet, pembelajaran TIK Dewasa ini berkembangnya teknologi informasi dan komunikasi sangat pesat baik di negara-negara maju maupun negara yang sedang berkembang seperti di Indonesia. Salah satu teknologi informasi dan komunikasi yang berkembang pesat diabad ini adalah internet. Kehadiran internet telah memberikan perubahan secara revolusioner terhadap cara hidup dan aktivitas manusia sehari-hari. Internet hadir sebagai media yang mengintegrasikan segala media komunikasi dan informasi konvensional yang telah ada. Melalui internet, setiap orang dapat mengakses ke dunia global untuk memperoleh berbagai informasi yang mereka butuhkan dalam segala kebutuhan sehari-harinya.Melihat penggunaan internet dalam dunia pendidikan masih jauh dari harapan, maka kita dapat meneliti sejauh mana efektifitas penggunaan internet dalam pelaksanaan pembelajaran TIK. Penelitian ini bertujuan untuk mendeskripsikan Efektifitas Penggunaan Internet Dalam Pelaksanaan Pembelajaran TIK pada SMAN dan MAN di Kota mojokerto, seberapa jauh efektifitas penggunaan internet yang dilakukan oleh siswa dalam pelaksanaan pembelajaran TIK di Kota mojokerto, serta penggunaan internet selain untuk pembelajaran. Untuk mencapai tujuan tersebut, maka penelitian ini dilaksanakan dengan menggunakan metode deskriptif. Pengambilan data menggunakan angket dengan metode random sampling. Instrumen yang digunakan yaitu: instrument efektifitas pemanfaatan internet, efektifitas penggunaan internet untuk pembelajaran. dan efektifitas penggunaan internet diluar pembelajaran.Subjek penelitian siswa pada SMAN dan MAN di Kota Mojokerto. Adapun teknik analisis yang digunakan adalah deskriptif kuantitatif. Hasil penelitian menunjukkan bahwa efektifitas pemanfaatan internet pada SMAN dan MAN di Kota Mojokerto antara lain yaitu dari segi Waktu yang diberikan dalam menggunakan internet di sekolah, Tempat yang digunakan akses internet, Sarana prasarana layanan akses internet, Hasil yang dicapai pemanfaatan, efektifitas penggunaan internet untuk pembelajaran, dan efektifitas penggunaan internet diluar pembelajaran TIK pada SMAN dan MAN di Kota Mojokerto, Untuk hasil efektifitas pemanfaatan internet di sekolah untuk pembelajaran diperoleh nilai rata – rata 52,55% yang dapat berfungsi sebagai media untuk menunjang tujuan belajar dan pembelajaran siswa karena internet merupakan media pendidikan yang efektif dan efisien sedangkan untuk hasil efektifitas pema

Pengaruh pembelajaran kooperatif tipe stad (Student team achievement divisions) berbantuan CD (Compact Disk) pembelajaran interaktif terhadap prstasi belajar siswa kelas X pada mata pelajaran KKPI di SMK Cendika Bangsa malang / Lya Tri Peni Handayani

 

Kata Kunci: Kooperatif Tipe STAD (Student Teams Achievement Division), CD (Compact Disc) Pembelajaran Interaktif, Prestasi Belajar. Proses pembelajaran KKPI di SMK Cendika Bangsa Malang perlu adanya inovasi metode pembelajaran yang mengarah pada peningkatan prestasi belajar. Hasil diskusi dengan guru mata pelajaran, proses pembelajaran KKPI di kelas X, ditemukan permasalahan rendahnya prestasi siswa dan siswa cenderung bosan dalam proses belajar mengajar, sehingga sering muncul kegaduhan dikelas. Siswa yang tuntas belajar pada kelas tersebut belum mencapai 80%, sehingga kelas belum mencapai kriteria ketuntasan minimal. Rancangan penelitian yang digunakan adalah rancangan Quasi Experimental Design, sampel yang digunakan adalah kelas X-B sebagai kelompok eksperimen yang di ajar dengan model STAD. Instrumen yang digunakan yaitu: instrumen pembelajaran berupa silabus, RPP, kisi-kisi, dan kunci jawaban soal. Instrumen pengukuran berupa angket. Teknik analisis data yang digunakan adalah analisis statistik kuantitatif dengan bantuan SPSS. Analisis statistik kuantitatif digunakan untuk menganalisis data kemampuan awal siswa dan prestasi belajar siswa kelas eksperimen, terdiri dari uji normalitas untuk mengetahui apakah kedua sampel kelas tersebut berdistribusi normal, uji homogenitas digunakan mengetahui apakah kedua sampel kelas tersebut homogen, dan uji hipotesis dengan uji regresi linear sederhana, digunakan untuk mengetahui pengaruh antara Cooperative Learning tipe Student Teams Achievement Division (STAD) berbantuan CD (Compact Disc) pembelajaran interaktif terhadap prestasi belajar siswa. Hasil penelitian menunjukkan bahwa ada pengaruh antara Cooperative Learning tipe STAD berbantuan CD (Compact Disc) pembelajaran interaktif terhadap prestasi belajar siswa. Nilai rata-rata prestasi belajar siswa kelas eksperimen sebesar 86,31 untuk kelas eksperimen. Nilai tertinggi untuk kelas eksperimen 93 sedangkan nilai terendah untuk kelas eksperimen sebesar 76. Dari data tersebut dapat dilihat bahwa siswa yang diajar dengan mengunakan metode STAD memiliki nilai rata-rata tinggi. Cooperative Learning tipe STAD berbantuan CD (Compact Disc) pembelajaran interaktif memberikan pengaruh terhadap prestasi belajar siswa. Hal ini berarti bahwa model regresi yang didapatkan hanya mampu menjelaskan pengaruh antara Cooperative Learning tipe STAD berbantuan CD (Compact Disc) pembelajaran interaktif terhadap prestasi belajar siswa sebesar 79,7% dan sisanya sebesar 20,3%. Prestasi belajar siswa dipengaruhi oleh faktor lain yang tidak dikaji dalam penelitian ini.

Hubungan antara efektifitas pembelajaran dan kebiasaan belajar dengan prestasi belajar mata pelajaran produktif siswa TKJ kelas X di SMKN Kota Malang / Ana Mufida

 

Kata Kunci: efektifitas pembelajaran, kebiasaan belajar, prestasi belajar Salah satu jurusan atau program keahlian yang saat ini diminati adalah Teknik Komputer dan Jaringan (TKJ). Keberhasilan efektifitas pembelajaran merupakan hal utama yang diharapkan dalam pelaksanaan pendidikan di sekolah. Sebagai pendidik, guru harus membimbing siswa untuk memperbaiki kebiasaan belajar agar mengalami perubahan kearah yang lebih baik. Penelitian ini ditujukan untuk mengungkap gambaran objektif tentang: (1) Hubungan antara efektifitas pembelajaran (X1) dengan prestasi belajar (Y), (2) Hubungan kebiasaan belajar (X2) dengan prestasi belajar (Y), dan (3) Hubungan antara efektifitas pembelajaran (X1) dan kebiasaan belajar (X2) secara simultan dengan prestasi belajar (Y) pada mata pelajaran produktif. Penelitian ini dilakukan di SMK Negeri kota Malang. Desain penelitian menggunakan metode expost facto korelasional. Teknik sampling yang dipakai adalah proporsional random sampling dengan responden 210 siswa. Analisis diperoleh dengan menggunakan teknik regresi linear ganda, yaitu untuk mengetahui besarnya hubungan (X1) dan (X2) dengan (Y). Analisis data dilakukan dengan bantuan perangkat lunak SPSS for Windows release 17. Hasil penelitian ini: (1) X1 dalam kategori sedang yaitu sebanyak sebanyak 176 responden (83,81%); (2) X2 dalam kategori sedang yaitu 186 responden (88,57%); (3) Y dalam kategori tinggi sebanyak 210 responden (100%). Nilai koefisien korelasi parsial antara X1 dengan Y yaitu rx1y sebesar 0,473; nilai koefisien korelasi parsial antara X2 dengan Y yaitu rx2y sebesar 0,533; besarnya nilai koefisien korelasi ganda 2 prediktor antara X1 dan X2 dengan Y yaitu R sebesar 0,718 dan nilai Fhitung sebesar 110,299. Sumbangan prediktor atau koefisien determinasi sebesar = R2 diperoleh hasil sebesar 0,516 (51,6%). Kesimpulan penelitian ini: (1) X1 berada dalam kategori sedang, (2) X2,berada dalam kategori sedang, dan Y cenderung berada dalam kategori tinggi (2) Ada hubungan positif dan signifikan antara X1 dengan Y; (3) Ada hubungan positif dan signifikan antara X2 dengan Y pada mata pelajaran produktif siswa TKJ kelas X di SMKN kota Malang (4) Ada hubungan positif dan signifikan antara X1 dan X2 secara simultan dengan Y pada mata pelajaran produktif siswa TKJ kelas X di SMKN kota Malang.

Pengembangan media CD pembelajaran program macromedia flash geografi SMP Kelas VIII / Merizka Listyaningrum

 

Kata Kunci: media CD pembelajaran, macromedia flash, geografi Seiring perkembangan ilmu dan teknologi, media pembelajaran yang digunakan semakin canggih melibatkan peran komputer. Salah satu produk media pembelajaran yang memanfaatkan multimedia berbasis komputer adalah CD Interaktif, yakni merupakan media yang menggunakan sebuah format multimedia dan dikemas dalam sebuah CD. CD Interaktif dapat membantu mempertajam pesan yang disampaikan dengan kelebihannya menarik indera dan menarik minat, karena merupakan gabungan antara pandangan, suara, dan gerakan. Penggunaan CD Interaktif ini sangat bagus untuk menerangkan proses, teori, ataupun praktek yang sulit digambarkan dengan kata-kata. Salah satu contoh materi yang sulit digambarkan dengan kata-kata karena melingkupi suatu proses alam dan teori yang tidak dapat dihadirkan secara langsung ke dalam kelas yakni Kondisi Fisik Wilayah Indonesia. Banyak siswa merasa kesulitan dalam memahaminya. Oleh karena itu, dibutuhkan suatu cara untuk mengatasi permasalahan tersebut, yakni dengan memanfaatkan media CD pembelajaran Macromedia Flash. Tujuan pengembangan media pembelajaran ini adalah untuk memudahkan dan memperjelas pesan, meningkatkan motivasi belajar siswa, dan meningkatkan pemahaman siswa. Karakteristik media pembelajaran CD Interaktif ini yakni adanya komunikasi interaktif antara pengguna dengan media, sehingga mempermudah penyampaian pesan pembelajaran. Rancangan penelitian ini menggunakan model pengembangan prosedural yang bersifat deskriptif. Model prosedural yang bersifat deskriptif ini menggariskan langkah-langkah umum yang harus diikuti untuk menghasilkan produk, yang terdiri dari kegiatan identifikasi kompetensi dasar dan indikator, analisis bahan ajar, desain media, produksi, editing, prototipe media, validasi produk, uji coba produk, dan produk akhir. Data penelitian bersifat kuantitatif yang diperoleh dari uji coba produk. Data yang dihasilkan selanjutnya dianalisis menggunakan teknik deskriptif kualitatif untuk mendapatkan skor akhir dengan merata-rata total jumlah skor jawaban responden dibagi dengan total jumlah skor ideal, dikalikan konstanta 100%. Hasil pengembangan media CD Interaktif ini diketahui memenuhi kriteria ”layak” dari siswa selaku audiens dengan tingkat kelayakan sebesar 90,80%. Dari hasil pengembangan dapat disimpulkan bahwa produk yang dihasilkan tergolong kriteria valid/layak, sehingga produk tidak direvisi dan tidak dilakukan uji coba ulang dari audiens, serta dapat digunakan sebagai media pembelajaran di sekolah. Bertitik tolak dari penelitian ini, beberapa saran yang diperkirakan dapat meningkatkan manfaat dan pengembangan produk yang akan datang diajukan adalah: (1) guru hendaknya menggunakan media ini dalam pembelajaran di kelas khususnya untuk materi Kondisi Fisik Wilayah Indonesia dengan memanfaatkan LCD untuk memperoleh tampilan yang besar dan menarik, (2) agar media dapat digunakan secara luas, maka dapat disebarluaskan melalui forum MGMP, (3) untuk pengembang produk yang akan datang disarankan membuat produk untuk bahasan lainnya seperti: atmosfer, hidrosfer, pedosfer, ataupun materi lainnya dengan animasi yang lebih baik dan menarik dengan memanfaatkan program yang lebih canggih lagi.

Pembelajaran kooperatif tipe STAD (Student teams achievement division) untuk meningkatkan interaksi dalam proses dan hasil belajar mengajar mengefrais roda gigi lurus pada siswa kelas XII SMK Pekerjaan Umum Malang / Muhamad Hariyanto

 

Tesis, Program Studi Pendidikan Kejuruan, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Amat Mukhadis, M.Pd., (II) Drs. H. Isnandar, M.T. Kata kunci: pembelajaran STAD, roda gigi lurus, interaksi pembelajaran, hasil belajar, SMK. Permasalahan pokok dalam penelitian ini adalah masih rendahnya interaksi siswa dalam proses pembelajaran mengefrais roda gigi lurus. Metode pembelajaran yang digunakan masih berorientasi pada guru dan belum mampu merangsang siswa untuk terlibat aktif dalam proses pembelajaran. Sebagian besar siswa mengalami kesulitan dalam penyelesaian perhitungan roda gigi lurus dan mengaplikasikan hasil perhitungan tersebut pada kegiatan praktik pembuatan roda gigi lurus. Pencapaian hasil belajar siswa belum menunjukkan hasil yang optimal Hal ini dibuktikan dengan perolehan nilai rata-rata untuk setiap kompetensi dasar pada tahun pelajaran 2008/2009 yakni 6,95, 6,58, dan 6,48, dimana nilai tersebut masih dibawah kriteria ketuntasan minimal (KKM) yang disyaratkan untuk mata diklat produktif yaitu 7,00 (tujuh koma nol-nol). Penelitian ini adalah penelitian tindakan kelas (Classroom Action Reaserch) dengan pokok masalah yaitu bagaimana cara meningkatkan interaksi siwa dalam proses pembelajaran agar hasil belajarnya ikut meningkat. Solusi yang dilakukan melalui penerapan pembelajaran kooperatif tipe STAD. Rancangan penelitian tindakan kelas dilaksanakan secara bersiklus. Masing-masing siklus terdiri atas tiga sampai empat kali pertemuan. Dua sampai tiga kali pertemuan untuk pelaksanaan tindakan dan satu kali pertemuan untuk pemberian tes. Tes dilaksanakan diakhir siklus secara individu. Jenis tes yang diberikan berupa tes tulis (uraian) dan tes praktik (unjuk kerja). Subjek penelitian adalah siswa kelas XII program keahlian teknik pemesinan SMK Pekerjaan Umum Malang yang berjumlah 22 siswa. Seluruh siswa dijadikan sebagai subjek penelitian sehingga dari jumlah siswa yang ada dapat dibagi menjadi lima kelompok. Tiap kelompok beranggotakan siswa dengan kemampuan yang heterogen. Penelitian dilakukan pada semester ganjil tahun pelajaran 2009/2010. Intrumen penelitian dibuat sendiri oleh peneliti, terdiri atas: lembar observasi, soal tes, dan lembar angket. Pengumpulan data dilaksanakan selama proses pembelajaran berlangsung. Sumber data diperoleh dari siswa dan guru. Untuk data interaksi dalam proses pembelajaran diperoleh dari hasil observasi, sedangkan data hasil belajar diperoleh dengan mengolah data hasil tes tulis (uraian) untuk aspek kognitif, tes praktik (unjuk kerja) untuk aspek psikomotorik, dan nilai sikap untuk aspek afektif. Selanjutnya data tersebut dianalisis secara deskriptif kuantitatif. Keberhasilan pemberian tindakan dengan melihat presentase pencapaian peningkatan interaksi dalam proses pembelajaran dan nilai hasil belajar yang diukur berdasarkan indikator keberhasilan pembelajaran yang ditentukan yaitu: untuk siklus I sebesar 80%, siklus II sebesar 85%, dan siklus III sebesar 90% dengan kriteria ketuntasan minimal yang disyaratkan yaitu 7,00 (kategori cukup). Hasil penelitian menunjukkan ada peningkatan hasil belajar mengefrais roda gigi lurus secara klasikal yang dinyatakan kompeten dengan nilai ≥ 7,00 pada tiap-tiap siklus. Siklus I sebanyak 11 siswa yang dinyatakan kompeten, siklus II sebanyak 16 siswa, dan siklus III meningkat menjadi 20 siswa atau 90,9%. Perolehan nilai rata-rata siswa juga meningkat. Siklus I nilai rata-rata siswa sebesar 7,22, siklus II sebesar 7,47, dan siklus III meningkat menjadi 7,83. Interaksi siswa dalam proses pembelajaran juga mengalami peningkatan pada semua aspek yang diamati. Untuk keseriusan siswa dalam mengikuti pembelajaran menunjukkan bahwa rata-rata siswa memiliki keseriusan dan tanggung jawab atas tugas-tugas yang diberikan oleh guru serta bersedia mendengarkan dan mencatat hal-hal penting yang disampaikan guru. Kemampuan siswa pada saat belajar kelompok juga meningkat, hal ini tampak dari interaksi antar sesama anggota kelompok yang sangat baik, pada saat mengerjakan LKS. Sedangkan untuk aspek keaktifan siswa dalam presentasi menunjukkan bahwa siswa telah mengalami peningkatan yang cukup signifikan karena sebagian besar siswa menunjukkan keberanian untuk bertanya maupun menjawab pertanyaan yang ditujukan kepadanya serta aktif dalam mengikuti kegiatan presentasi. Berdasarkan hasil penelitian dapat disimpulkan bahwa penerapan pembelajaran kooperatif tipe STAD mampu meningkatkan hasil belajar siswa kelas XII program keahlian teknik pemesinan SMK Pekerjaan Umum Malang dengan pencapaian indikator keberhasilan pembelajaran sebesar 90,9% (kategori baik sekali/optimal) dan terjadi peningkatan interaksi selama proses pembelajaran berlangsung.

Penjamin mutu pembelajaran pada rintisan Sekolah Menengah Atas bertaraf internasional (Studi multisitus di SMA Negeri 3 Malang dan SMA Negeri 5 Malang ) / Hariyanto

 

Tesis, Program Studi Manajemen Pendidikan. Program Pascasarjana Universitas Negeri Malang. Pembimbing : (I) Prof. Dr. Hendyat Soetopo, M.Pd., (II) Prof. Dr. Hj.Nurul Ulfatin, M.Pd. Kata kunci: penjaminan mutu, pembelajaran, rintisan sekolah menengah atas bertaraf internasional. Penjaminan mutu pendidikan untuk memenuhi Standar Nasional Pendidikan dan Standar Sekolah Bertaraf Internasional dilakukan oleh satuan pendidikan secara bertahap, sistematis dan terencana. Setiap tahapan yang paling penting adalah pemenuhan standar proses. Di dalam Undang Undang Sistem Pendidikan Nasional No. 20 Tahun 2003 dinyatakan bahwa pembelajaran adalah proses interaksi peserta didik dengan pendidik dan sumber belajar pada suatu lingkungan belajar. Yang menjadi permasalahan dalam penelitian ini adalah bagaimana implementasi penjaminan mutu pembelajaran pada rintisan SMA bertaraf internasional (RSMABI), karena penyelenggaraan RSMABI berfokus pada peningkatan mutu yang berkelanjutan. Fokus yang dikaji dalam penelitian ini adalah (1) penyusunan standar mutu pembelajaran, (2) pelaksanaan pemetaan kurikulum nasional dan kurikulum internasional (Cambridge), (3) pengadaan dan peningkatan sarana prasarana, (4) pelaksanaan peningkatan kualitas sumber daya manusia, dan (5) pelaksanaan pengawasan pembelajaran. Penelitian ini menggunakan pendekatan kualitatif, dengan rancangan multisitus pada latar SMAN 3 Malang dan SMAN 5 Malang sebagai rintisan SMA bertaraf internasional. Rancangan penelitian multisitus dengan metode analisis komparatif konstan dan analisa induktif untuk menemukan makna dari fenomena pada latar penelitian. Penentuan informan dilakukan dengan teknik pengambilan sampel secara purposive sampling, internal sampling, time sampling, dan teknik bola salju (snowball sampling). Teknik pengumpulan data yang digunakan adalah (1) wawancara mendalam, (2) observasi partisipan, dan (3) studi dokumentasi. Data yang terkumpul dianalisis secara berulang yang di dalamnya melibatkan kegiatan reduksi data, sajian data dan verifikasi/penarikan kesimpulan baik melalui analisis dalam situs maupun analisis lintas situs guna menyusun konsep temuan lapangan. Kredibelitas data dicek dengan triangulasi sumber dan metode, member chek, diskusi teman sejawat,dan kecukupan referensi. Sedangkan dependabilitas dan konfirmabilitas diperoleh melalui pengauditan oleh dosen pembimbing. Temuan penelitian ini adalah: pertama, penyusunan standar mutu disusun oleh tim khusus atau guru matapelajaran dan disahkan oleh kepala sekolah. Evaluasi standar mutu dilakukan secara periodik dan sebagai panduan untuk merevisi dan memperbaiki ulang standar mutu di masa selanjutnya. Kedua, perencanaan dan mekanisme pemetaan kurikulum dilakukan oleh guru matapelajaran melalui empat tahap, yaitu (1) inventarisasi core topic kurikulum nasional dan kurikulum internasional, (2) melakukan adopsi terhadap topik yang ada di kurikulum internasional tetapi tidak ada di kurikulum nasional, (3) melakukan adaptasi terhadap materi yang dibahas baik di kurikulum nasional maupun internasional, dan (4) menyusun silabus. Evaluasi pemetaan kurikulum dilaksanakan secara periodik. Kendala-kendala dalam pelaksanaan pemetaan kurikulum adalah kemampuan bahasa dan substansi materi atau konten yang dimiliki oleh tenaga pendidik oleh guru matapelajaran. Ketiga, pelaksanaan peningkatan kualitas sumberdaya manusia dilakukan oleh tim khusus atau unit penjaminan mutu melalui analisis kebutuhan. Bentuk peningkatan kualitas sumberdaya manusia adalah pelatihan-pelatihan, workshop dan juga studi lanjut pada guru dan karyawan. Evaluasi terhadap pelaksanaan peningkatan kualitas sumberdaya manusia dilakukan secara periodik. Keempat, pelaksanaan pengadaan dan peningkatan sarana dan prasarana pendukung pembelajaran dilakukan oleh tim khusus atau wakil kepala sekolah bidang sarana prasarana melalui analisis kebutuhan. Evaluasi terhadap pelaksanaan pengadaan dan peningkatan sarana dan prasarana dilakukan secara periodik. Kelima, pelaksanaan pengawasan pembelajaran dilakukan dilakukan oleh kepala sekolah dan pengawas satuan pendidikan. Tindak lanjut dari supervisi adalah memberikan masukan secara langsung kepada guru dan selanjutnya digunakan sebagai dasar program peningkatan kualitas sumberdaya manusia sesuai dengan kebutuhan. Berdasarkan hasil penelitian ini, disampaikan saran kepada SMAN 3 dan SMAN 5 Malang dan penyelenggara program RSMABI lainnya bahwa dalam penjaminan mutu pembelajaran perlu disusun standar mutu pembelajaran, pemetaan kurikulum nasional dan internasional berdasarkan potensi peserta didik, analisis kondisi internal dan lingkungan satuan pendidikan; peningkatan kualitas sumberdaya manusia, pengadaan dan peningkatan sarana prasarana berdasarkan analisis kebutuhan; dan pengawasan pembelajaran yang dilaksanakan oleh kepala sekolah dan pengawas satuan pendidikan. Semua proses penjaminan mutu tersebut dievaluasi secara periodik untuk perbaikan di tahun berikutnya. Saran untuk Dinas Pendidikan dan Direktorat Pembinaan SMA adalah berkontribusi lebih banyak terhadap peningkatan kualitas sumberdaya manusia dan sarana prasarana pembelajaran, menggali proses penjaminan mutu pembelajaran yang telah dilaksanakan oleh RSMABI di lapangan sebagai pertimbangan dalam penyempurnaan regulasi pendidikan khususnya penjaminan mutu pembelajaran pada RSMABI yang dibuat oleh Kemendiknas. Saran untuk pengembang teori manajemen pendidikan dan peneliti selanjutnya adalah temuan-temuan penelitian ini dapat memperkaya pengembangan terori manajemen pendidikan pada sekolah-sekolah bertaraf internasional atau yang memiliki karakteristik yang sama dengan latar penelitian, dan sebagai rujukan untuk penelitian selanjutnya.

Pengembangan alat bantu dari bahan bahan bekas dalam pembelajaran kebugaran jasmani siswa kelas V SD Negeri Penarukan Kepanjen Kabupaten Malang / Ilham Atho'illah

 

Kata kunci: Pengembangan, Alat Bantu, Pendidikan Jasmani Olahraga dan Kesehatan, Kebugaran Jasmani. Di SD Negeri Penarukan Kepanjen Kabupaten Malang aktivitas kebugaran jasmani diberikan pada pembelajaran Pendidikan Jasmani Olahraga dan Kesehatan aspek pengembangan, berdasarkan observasi awal berupa kuesioner analisis kebutuhan yang diberikan kepada guru pendidikan jasmani olahraga dan kesehatan, pelaksanaan pembelajaran kebugaran jasmani meliputi sit–up, push–up, back-up, belum pernah dilakukan dengan menggunakan alat bantu, untuk itu perlu dilakukan pembelajaran kebugaran jasmani menggunakan alat bantu dari bahan-bahan bekas. Tujuan pengembangan alat bantu dari bahan-bahan bekas dalam pembelajaran kebugaran jasmani siswa kelas V SD Negeri Penarukan ini adalah diharapakan guru dapat lebih mudah menyampaikan materi pembelajaran aktivitas kebugaran jasmani sehingga pembelajaran dapat berlangsung dengan baik, efektif dan menyenangkan. Penelitian ini menggunakan model penelitian pengembangan dari Borg and Gall (1983:775), peneliti tidak menggunakan keseluruhan tetapi hanya menggunakan 7 langkah adalah sebagai berikut: 1) analisis kebutuhan, 2) pengembangan rancangan produk, 3) evaluasi para ahli, 4) uji kelompok kecil, 5) revisi hasil uji kelompok kecil, 6) uji kelompok besar, 7) revisi hasil uji kelompok besar kemudian menjadi produk akhir berupa model pembelajaran kebugaran jasmani menggunakan media sederhana dari bahan bambu. Berdasarkan hasil analisa dari guru pendidikan jasmani SD Negeri Penarukan, 100% menyatakan sangat menarik. Dan klasifikasi persentase antara 76 – 100 % tergolong dalam klasifikasi baik (dapat digunakan). Hasil analisa uji kelompok besar (uji lapangan) terhadap 40 siswa SD Negeri Penarukan, 100% menyatakan sangat mudah untuk melakukan aktivitas kebugaran menggunakan alat modifikasi dari bahan-bahan bekas, dan 100% sangat menyenangkan melakukan aktivitas kebugaran menggunakan alat modifikasi dari bahan-bahan bekas ini. Hasil klasifikasi persentase yaitu antara 76 – 100 % tergolong dalam klasifikasi baik (dapat digunakan). Kesimpulan dari penelitian ini adalah: 1) dapat menarik perhatian siswa untuk mengikuti pembelajaran aktivitas kebugaran jasmani, 2) siswa dapat melakukan aktivitas kebugaran jasmani dengan mudah dan senang, 3) guru dapat memanfaatkan bahan-bahan bekas yang sudah tidak terpakai lagi untuk dijadikan alat bantu pembelajaran kebugaran jasmani.

Peningkatan pembelajaran IPA melalui model problem solving pada siswa kelas IV MI Miftahul Ulum Gondangrejo Kecamatan Gondangwetan Kabupaten Pasuruan / Abid Ardiansyah

 

Kata Kunci : Problem Solving, Pembelajaran, IPA, SD Pelaksanaan kegiatan pembelajaran IPA yang bersifat teacher centered menyebabkan aktivitas dan hasil belajar siswa rendah. Prosentase ketuntasan hasil belajar klasikal pra tindakan 42,85% dengan nilai rata-rata hasil belajar kelas 65,95. Untuk menyelesaikan rendahnya aktivitas dan hasil belajar siswa, peniliti memberikan solusi dengan menerapkan model pembelajaran Problem solving. Melalui penerapan model pembelajaran Problem solving, siswa akan aktif melakukan percobaan untuk memecahkan masalah sehingga aktivitas dan hasil belajar siswa dalam memecahkan masalah meningkat. Penelitian ini bertujuan untuk mendeskripsikan: (1) Penerapan model pembelajaran problem solving pada pembelajaran IPA materi pokok perubahan lingkungan fisik dan pencegahnya di kelas IV MI Miftahul Ulum Gondangrejo Kecamatan Gondangwetan Kabupaten Pasuruan; (2) Peningkatan aktivitas belajar siswa melalui model pembelajaran problem solving pada pembelajaran IPA, serta (3) Peningkatan hasil belajar siswa melalui model pembelajaran problem solving pada pembelajaran. Penelitian ini termasuk penilitian tindakan kelas dengan pendekatan kualitatif interaktif yang dilakukan secara bersiklus. Setiap siklus terdiri dari perencanaan, tindakan dan pengamatan, refleksi, dan perbaikan rencana. Tehknik pengumpulan data yang digunakan antara lain tehknik observasi, wawancara, dokumentasi, tes dan catatan di lapangan. Subyek penilitian ini adalah siswa kelas IV sebanyak 21 siswa yang terdiri dari 3 siswa laki-laki dan 18 siswa perempuan. Hasil penilitian ini yaitu penerapan model pembelajaran problem solving dapat merubah kegiatan pembelajaran yang bersifat teacher centered menjadi student centered dan dapat meningkatkan aktivitas dan hasil belajar siswa. Prosentase ketuntasan hail belajar klasikal siklus-1 yaitu 71% dengan nilai rata-rata 65,53. Prosentase ketuntasan hail belajar klasikal siklus-2 yaitu 100% dengan nilai rata-rata 85,92. Berdasarkan kesimpulan diatas maka agar siswa memiliki daya nalar yang tinggi dan mampu memecahkan masalah maka guru sebaiknya menerapkan model pembelajaran Problem solving, khususnya pada pembelajaran materi perubahan lingkungan dan pencegahnya.

Pelaksanaan keselamatan dan kesehatan kerja (k3) pada pembelajaran praktik perbaikan motor listrik di bengkel kerja Sekolah Menengah Kejuruan (SMK) di Bojonegoro, Lamongan dan Tuban / Bambang Sri Budiono

 

Kata kunci: Keselamatan dan Kesehatan Kerja (K3), pembelajaran praktik, per- baikan motor listrik, SMK di Bojonegoro, Lamongan, dan Tuban. Peserta didik Sekolah Menengah Kejuruan (SMK) perlu dibekali kompe-tensi melaksanakan Keselamatan dan Kesehatan Kerja (K3) saat bekerja di beng-kel. Penyelenggaraan pendidikan dan pelatihan pelaksanaan K3 untuk menjawab tuntutan “Nihil Kecelakaan Kerja” dunia industri. Bagi peserta didik Kompetensi Keahlian Teknik Instalasi Tenaga Listrik (TITL) kinerja melaksanakan K3 terin-tegrasi pada setiap topik pembelajaran praktik di bengkel kerja. Salah satu topik dimaksud adalah penguasaan kompetensi perbaikan motor listrik. Pada hakekat-nya pelaksanaan K3 bertujuan untuk mencegah kecelakaan kerja dari bahaya arus listrik, mekanik, dan perilaku individu. Tujuan penelitian ini untuk mengungkap variabel: (1) komponen yang mendukung pembelajaran praktik terkait pelaksanakan K3, (2) kemampuan guru praktik terkait pelaksanaan K3, dan (3) kinerja peserta didik terkait pelaksanaan K3. Penelitan ini termasuk jenis penelitian deskriptif jenis survey. Populasi pe-nelitian meliputi seluruh peserta didik Kompetensi Keahlian Teknik Instalasi Te-naga Listrik (TITL) di Bojonegoro, Lamongan dan Tuban. Untuk memperoleh da-ta pelaksanaan K3 pembelajaran praktik perbaikan motor listrik di bengkel kerja menggunakan metode angket. Sebelum angket didistribusikan dilakukan uji ins-trumen untuk memastikan bahwa tiap-tiap butir instrumen telah memenuhi syarat validitas dan reliabilitas. Uji validitas instrumen menggunakan analisa r Product Moment dari Pearson Correlations dan uji reliabilitas menggunakan analisa Alpha Cronbach. Analisa data menggunakan statistik deskriptif tanpa menguji hipotesis. A-nalisis bertujuan untuk memperoleh gambaran tentang variabel yang diteliti. Hasil analisis mengungkap fakta bahwa: (1) sebagian besar lembaga SMK di Bojonego-ro, Lamongan dan Tuban mendukung pembelajaran praktik terkait pelaksanaan K3 dengan katagori baik, (2) sebagian besar guru praktik di tiga daerah tersebut selama pelaksanaan K3 pada pembelajaran praktik perbaikan motor listrik berkemampuan cukup, dan (3) sebagian besar peserta didik di tiga daerah tersebut selama pelaksa-naan K3 pembelajaran praktik perbaikan motor listrik berkinerja cukup. Berdasarkan temuan penelitian ini, direkomendasikan beberapa saran, an-tara lain: (1) lembaga SMK Bojonegoro, Lamongan dan Tuban agar senantiasa mempertahankan kualitas pelaksanaan K3 terkait pembelajaran praktik di lingku-ngan bengkel kerja. Demikian pula lembaga SMK dapat secara aktif mensosialisa-sikan kebijakan dan komitmen K3 kepada peserta didik, dan melengkapi fasilitas K3 yang memadai guna menciptakan pembelajaran praktik tanpa kecelakaan, (2) guru praktik agar senantiasa meningkatkan kemampuan melaksanakan K3 pada pembelajaran praktik perbaikan motor listrik di bengkel kerja. Kemampuan guru praktik dalam peran memberi instruksi keselamatan kerja dan membimbing beker-ja sesuai dengan langkah aman, sehingga peserta didik terhindar dari cidera sela-ma belajar praktik. Guru perlu memberi motivasi dan memberi contoh bekerja a-man kepada peserta didik, sehingga dapat meningkatkan hasil belajar praktik, (3) peserta didik agar senantiasa meningkatkan penguasaan pengetahuan K3 terkait pembelajaran praktik perbaikan motor listrik di bengkel kerja. Peserta didik perlu menguasai pengetahuan K3 tentang penggunaan peralatan tangan, penggunaan a-lat ukur, dan penggunaan peralatan mesin bertenaga listrik, sehingga berkinerja a-man dan sehat selama melaksanakan praktik di bengkel kerja.

Pembelajaran menulis di kelas X jurusan teknik permesinan SMKN 6 Malang / Mu'awanah

 

Pengaruh penerapan model inquiri terhadap hasil belajar IPS Kelas V SDN Sumberejo 02 Kecamatan Gedangan Kabupaten Malang / Endah Setio Rini

 

Kata Kunci: Pengaruh, Inquiri, Hasil Belajar, IPS SD. Tes Awal penelitian menunjukan dalam pengisian soal pre-tes baik kelas eksperimen maupun kelas kontrol, siswa masih banyak mengalami kesulitan untuk menjawab soal. Hal ini terjadi karena penyampaian materi tentang jenis-jenis usaha dan kegiatan ekonomi di Indonesia menggunakan metode ceramah dan tanya jawab saja. Upaya yang dapat dilakukan untuk meningkatkan kemampuan siswa dalam materi jenis-jenis usaha dan kegiatan ekonomi di Indonesia yaitu menggunakan model pembelajaran Inquiri melalui tahapan-tahapan sebagai berikut: (1) Pemberian Permasalahan, (2) Melakukan Pengamatan, (3) Menganalisis dan menyajikan hasil karya, dan (4) Mengkomunikasikan dan menyajikan hasil karya. Rumusan Masalah dalam penelitian ini adalah, (1) Bagaimanakah pengaruh penerapan model Inquiri terhadap hasil belajar siswa kelas V dalam mata pelajaran IPS? (2) Bagaimanakah hasil belajar siswa kelas V dalam mata pelajaran IPS menggunakan model Inquiri?. Rancangan penelitian ini menggunakan rancangan penelitian Quasi Experimental Design dengan sampel 52 siswa yang terbagi kedalam dua kelas yaitu 26 siswa sebagai kelas eksperimen diberi pembelajaran menggunakan model Inquiri dan 26 siswa sebagai kelas kontrol diberi pembelajaran secara konvensional. Teknik pengambilan sampel yang digunakan dalam penelitian ini adalah Sampel Jenuh. Instrumen perlakuan meliputi, Rancangan Pelaksanaan Pembelajaran (RPP) dan Lembar Kerja Siswa (LKS). Teknik pengumpulan data dalam penelitian ini adalah data kemampuan awal siswa baik kelas eksperimen maupun kelas kontrol dan Hasil belajar siswa baik kelas eksperimen maupun kelas kontrol. Penelitian ini adalah penelitian eksperimen semu, dengan uji asumsi yang dilakukan meliputi uji normalitas, uji homogenitas dan uji hipotesis. Hasil penelitian ini menunjukan thitung = 2,986 dan ttabel = 2,0086, pada taraf signifikansi α = 0,05. Sehingga dari data yang diperoleh dapat disimpulkan karena thitung > ttabel, maka tolak Ho dan terima H1, sehingga terdapat pengaruh antara kelas eksperimen yang menggunakan model Inquiri dan kelas kontrol yang menggunakan metode ceramah dan tanya jawab terhadap hasil belajar. Hasil belajar IPS siswa kelas kontrol yang menggunakan metode ceramah dan tanya jawab lebih rendah dengan rata-rata 74,5 dan siswa kelas eksperimen yang menggunakan model Inquiri lebih tinggi dengan rata-rata 79,5, sehingga pembelajaran dengan model inquiri berpengaruh. Saran dalam penelitian ini antara lain penggunaan model pembelajaran Inquiri dapat memberikan hasil yang baik, maka diperlukan adanya kesempurnaan pelaksanaan pembelajaran dan membina hubungan baik dengan siswa, perlu dilakukan penelitian kembali di beberapa sekolah yang mengalami kondisi serupa agar hasil yang diperoleh dapat dijadikan pembanding bagi peneliti selanjutnya, bagi guru IPS di SD untuk menggunakan beberapa model pembelajaran yang bervariasi dalam proses belajar mengajar.

Hubungan pemanfaatan internet dan ketersediaan fasilitas internet di sekolah terhadap hasil belajar mata pelajaran TIK siswa kelas XI di SMA Negeri 9 Malang / Muhammad Ja'far Shodiq

 

Perkembangan dan kemajuan teknologi internet telah dimanfaatkan dunia pendidikan dan pembelajaran, termasuk dalam pembelajaran TIK. Pembelajaran TIK di sekolah yang menuntut penggunaan Internet sebagai sarana belajar dapat menjadikan salah satu cara untuk

Pengaruh pembelajaran kooperatif model group investigation (GI) berbantuan cd tutorial terhadap hasil belajar TIK siswa kelas VIII di SMP Negeri 1 Modung Bangkalan / Masagung Hariyandi

 

Kata kunci: Pembelajaran kooperatif, Group Investigation, hasil belajar Pemilihan metode pembelajaran yang tepat perlu diupayakan guru untuk memudahkan proses terbentuknya pengetahuan pada siswa. Salah satu strategi pembelajaran yang memungkinkan siswa belajar secara optimal adalah metode pembelajaran Group Investigation (GI). GI merupakan metode pembelajaran yang melibatkan siswa sejak perencanaan, baik dalam menentukan topik maupun cara untuk mempelajarinya melalui investigasi. Metode pembelajaran ini menuntut para siswa untuk memiliki kemampuan yang baik dalam berkomunikasi maupun dalam ketrampilan proses kelompok (Group Process Skills). Tujuan penelitian ini adalah untuk mengetahui perbedaan hasil belajar TIK siswa antara siswa yang diajar menggunakan metode pembelajaran Group Investigation pada kelas eksperimen dengan siswa yang diajar menggunakan metode pembelajaran Ekspositori pada kelas kontrol dan untuk mengetahui adanya pengaruh terhadap hasil belajar siswa setelah diterapkan pembelajaran Group Investigation pada kelas eksperimen. Penelitian eksperimen semu ini dilakukan di SMP Negeri 1 Modung Bangkalan pada semester genap tahun ajaran 2010/2011. Populasi penelitian adalah keseluruhan siswa kelas VIII sebanyak 128 siswa dengan sampel penelitian adalah kelas VIIIa (32 siswa) sebagai kelompok eksperimen dan kelas VIIIb (32 siswa) sebagai kelompok kontrol. Pengambilan sampel menggunakan teknik sampel kelompok (cluster sample). Instrumen perlakuan berupa Silabus, RPP, dan lembar unjuk kerja, sedangkan instrumen pengukuran hasil belajar meliputi angket, penilaian tes, rubrik observasi (afektif dan psikomotor), dan tugas. Teknik analisis data digunakan untuk mengetahui perbedaan hasil belajar siswa dengan uji-t, dan respon siswa terhadap keterlaksanaan pembelajaran kaitannya dengan sumbangan terhadap hasil belajar dengan uji regresi linier sederhana. Berdasarkan hasil analisis data, diperoleh simpulan hasil penelitian. Pertama, terdapat perbedaan pada hasil belajar antara kelas ekperimen dan kelas kontrol dibuktikan dengan nilai Signifikansi (p) = 0,000 < 0,05 pada perhitungan uji beda hasil belajar. Kedua, terdapat pengaruh signifikan penerapan metode kooperatif model Group Investigation (GI) berbantuan CD tutorial terhadap hasil belajar TIK Siswa Kelas VIII pokok bahasan membuat dokumen pengolah angka sederhana pada kelompok eksperimen, dibuktikan dengan analisis regresi linier sederhana yang menghasilkan nilai Signifikansi (p) = 0,000 < 0,05.

Wacana kekuasaan dalam naskah Babad Lombok / Lalu Habiburrahman

 

Tesis. Jurusan Pendidikan Bahasa Indonesia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Maryaeni, M.Pd., (II) Prof. Dr. Wahyudi Siswanto, M.Pd. Kata kunci: Naskah Babad Lombok, Wacana Sejarah, hermeneutika gadamerian, wacana kritis Periode lahirnya naskah babad di Jawa dan di Bali adalah sekitar abad ke-18 tetapi lebih banyak di tulis sekitar abad ke-19. Pada masa masa tersebut Lombok berada di bawah kekuasaan Bali. Kekuasaan Bali di Lombok bahkan telah terjadi sejak abad sebelumnya yakni akhir abad ke-17 dan bertahan hingga akhir abad ke-19. Salah satu tradisi babad di Lombok adalah naskah Babad Lombok. Di antara naskah Babad Lombok salah satunya sudah ditransliterasi dan diterjemahkan ke dalam Bahasa Indonesia oleh Lalu Gde Suparman. Naskah hasil transliterasi dan terjemahan ini akan menjadi objek dalam penelitian ini. Penelitian ini difokuskan untuk menjawab empat hal, yakni;(1) gambaran umum dan ringkasan isi naskah Babad Lombok;(2) kondisi politik di Lombok pada sekitar periode lahirnya naskah babad;(3)hubungan Lombok dengan pengaruh luar, dalam naskah Babad Lombok; (4) strategi, realisasi, dan fungsi wacana kekuasaan dalam naskah Babad Lombok. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan wacana historis dan hermeneutika gadamerian dengan memanfaatkan teori wacana kritis. Penelitian ini menghasilkan beberapa hal sebagai berikut: (1) Di dalam naskah Babad Lombok diceritakan sebagai berikut. (a) kisah sejak Nabi Adam hingga penghuni-penghuni awal di Lombok. (b) Kisah konflik Raja Lombok dengan Demung Brangbantun. (c) Kisah pindahnya Kerajaan Lombok ke Seleparang dan berganti nama menjadi Kerajaan Seleparang (d) Kisah polemik Arya Banjar Getas dengan Raja Seleparang. (e) Kisah Polemik Arya Banjar Getas dengan Raja Pejanggik. (f) Kisah runtuhnya Kerajaan Pejanggik dan Seleparang akibat pemberontakan Arya Banjar Getas yang dibantu oleh kekuatan Bali(Karangasem); (2) kondisi politik di Lombok pada sekitar periode lahirnya naskah babad, di dominasi oleh kekuatan Bali yang berkuasa bahkan sejak abad ke-17 dan berakhir pada abad ke-19. Munculnya dominasi kekuatan Bali ini dipengaruhi oleh beberapa faktor sebagai berikut. (a) secara politik, Lombok Barat, Lombok Tengah dan Lombok utara tidak memiliki aristokrasi dan pusat kekuasaan yang kokoh. Aristokrasi dan pusat kekuasaan yang kokoh di Lombok pada saat itu hanya terdapat di Seleparang, di pesisir tenggara Lombok Timur. Keadaan tanpa aristokrasi di Lombok Barat, Lombok Tengah dan Lombok Utara ini kemudian dimanfaatkan dengan baik oleh kekuatan Bali untuk mengusir pengaruh Sumbawa-Makassar di Seleparang. Konfrontasi Bali dan Sumbawa-Makassar di Lombok terjadi sejak awal abad ke-17. Bali berhasil memantapkan kekuasaannya secara kokoh di Lombok sekitar 1740. (b) Kemampuan Bali memainkan peran politiknya yang begitu cermerlang antara abad ke-17 hingga abad ke-18, di pengaruhi juga oleh keyakinan spiritual yang menjadikan Gelgel sebagai pusat kosmos. Kesadaran ini berkembang antara abad ke-16 hingga abad ke-17. Hal ini menyebabkan, meskipun secara internal mereka terpecah hingga menjadi 33 kerajaan-kerajaan kecil pada paruh pertama abad ke17, tetapi secara eksternal pejabat-pejabat setingkat menteri tetap mampu memainkan peran politik dalam rangka perluasan wilayahnya di Lombok bahkan ke Belambangan di Jawa. (c) Sumbawa pada abad ke-17 berada di bawah otoritas Makassar. Pada bulan Juni 1669, Kerajaan Makassar runtuh setelah diserbu kekuatan gabungan masyararakat Bone di bawah pimpinan Arung Palakka dan VOC di bawah pimpinan Cornelis Speelman. Di satu sisi, dengan sendirinya Sumbawa kemudian terlepas dari pengaruh Makassar, di sisi lain, keadaan ini telah mengakibatkan konflik internal di antara kerajaan-kerajaan di Sumbawa. Konflik di Sumbawa terus berlangsung hingga 1816;(3) Naskah Babad Lombok mengungkap bahwa Lombok pernah membangun hubungan, antara lain dengan Sunan Giri, Sumbawa dan Bali; (4) strategi, realisasi dan fungsi linguistik kekuasaan dalam naskah Babad Lombok sebagai berikut. Pertama, membangun garis generasi elit Lombok dengan Nabi Nuh, berfungsi:(a) sebagai legitimasi kekuasaan elit politik di Lombok; (b) sebagai bentuk perlawanan terhadap idiologi Majapahit. Kedua, pencitraan negatif garis generasi terakhir penguasa Seleparang dan Pejanggik, berfungsi:(a) sebagai pembenaran atas pemberontakan Banjar Getas di Seleparang, sebagai pembenaran atas penggulingan kekuasaan yang dilakukan Banjar Getas terhadap penguasa Pejanggik yang dibantu oleh Karangasem, serta sebagai pembenaran atas penggulingan kekuasaan-kekuasaan tertinggi di Lombok oleh Karangasem;(b) sebagai bentuk pemertahanan elit Lombok dari ancaman kerutuhan status sosial akibat perkembangan Islam ortodoks yang di bawa oleh Karaeng Matoaya. Ketiga, mitos Arya Banjar Getas sebagai pemegang “wahyu kekuasaan” terakhir di Lombok dari generasi Majapahit, berfungsi:(a) sebagai bentuk penerimaan elit Lombok di bawah Hegemoni Bali;(b) sebagai bentuk perjuangan kelas sosial agar setara dengan kelas sosial triwangsa. Hasil penelitian ini dapat dimanfaatkan sebagai berikut. Pada jenjang pendidikan menengah pertama dan menengah atas, bermanfaatkan sebagai alternatif pembelajaran kontekstual untuk materi muatan lokal dan sastra Indonesia. Di samping itu, hasil penelitian ini juga bisa dimanfaatkan sebagai model pembelajaran integral dan berkarakter.

Studi pelaksanaan pembelajaran berbasis lesson study bagi mahasiswa PPL program studi pendidikan teknik informatika di SMA Laboratorium Universitas Negeri Malang / Endra Kuswara

 

Kata Kunci: pembelajaran, lesson study, PPL. Guru memegang peran utama dalam meningkatkan kualitas pembelajaran dan menentukan keberhasilan siswa di sekolah. Mahasiswa PPL PTI UM sebagai calon guru, yaitu calon tenaga kependidikan, perlu dibina dan dikembangkan kemampuannya. Perlu diupayakan cara atau pendekatan yang layak untuk mengatasi masalah seputar pembelajaran. Melalui lesson study, sangat dimungkinkan meningkatkan kualitas pembelajaran dan kualitas pendidik. Oleh karena itu, pelaksanaan PPL diterapkan dengan menggunakan pendekatan lesson study. Tujuan dari penelitian ini adalah: (1) mendeskripsikan pelaksanaan kegiatan perencanaan pembelajaran (plan) oleh mahasiswa PPL PTI UM, (2) mendeskripsikan pelaksanaan kegiatan pembelajaran (do) oleh mahasiswa PPL PTI UM, (3) mendeskripsikan pelaksanaan kegiatan refleksi hasil pembelajaran (see) mahasiswa PPL, dan (4) mengungkap hambatan dari pelaksanaan pembelajaran berbasis lesson study bagi mahasiswa PPL PTI UM. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Penelitian ini dilakukan di SMA Lab. Universitas Negeri Malang. Subyek penelitian ini adalah mahasiswa PPL program Pendidikan Teknik Informatika tahun ajaran 2010-2011 semester genap. Prosedur pengumpulan data dalam penelitian ini meliputi wawancara, studi dokumentasi dan observasi. Langkah-langkah yang dilakukan pada tahap analisis data adalah reduksi data, displai data, dan penarikan kesimpulan. Hasil penelitian ini bahwa: (1) Pelaksanaan kegiatan perencanaan pembelajaran (plan) oleh mahasiswa PPL prodi Pendidikan Teknik Informatika di SMA Laboratorium Universitas Negeri Malang dilakukan dengan cara guru model sudah membuat rancangan pelaksanaan pembelajaran (RPP) terlebih dahulu, lalu didiskusikan dengan dengan guru pamong dan mahasiswa PPL PTI UM. Hal-hal yang didiskusikan dalam tahap plan tersebut, yaitu tujuan pertemuan, tujuan pembelajaran, apersepsi untuk pembuka pembelajaran, metode yang digunakan, media pembelajaran yang akan digunakan, materi yang akan disampaikan, alokasi waktu dan instrumen evaluasi pembelajaran. (2) Pelaksanaan kegiatan pembelajaran (do) oleh mahasiswa PPL prodi Pendidikan Teknik Informatika di SMA Laboratorium Universitas Negeri Malang merupakan bentuk realisasi dari hasil dalam tahap plan. Pelaksanaan do dilaksanakan dengan pedoman RPP yang telah disusun sebelumnya, dimana guru model menggunakan model konstruktivistik dan media pembelajaran berupa modul elektronik. Observer dibagi untuk mengamati kelompok yang telah ditentukan oleh guru model dengan berpedoman lembar observasi. Observer hanya bertugas mengamati aktivitas siswa, tidak ada yang membantu siswa dalam pembelajaran. (3) Pelaksanaan kegiatan refleksi hasil pembelajaran (see) mahasiswa PPL prodi Pendidikan Teknik Informatika di SMA Laboratorium Universitas Negeri Malang dilakukan setelah kegiatan pembelajaran (do) pada hari yang sama. Refleksi dihadiri oleh guru pamong, guru model dan observer dari mahasiswa PPL PTI UM yang hadir pada saat do. Refleksi dipimpin oleh moderator, yaitu guru pamong dan notulen dari mahasiswa PPL PTI UM. Komentar observer sebagian besar sudah berpusat pada aktivitas siswa. (4) Hambatan dari tahap plan, yaitu: (a) ketidaksesuaian dalam menempatkan metode, materi dan media dengan kondisi kelas yang ada dan (b) kurangnya komunikasi dan koordinasi satu tim dalam pelaksanaan plan. Hambatan dari tahap do, yaitu:(a) kurangnya percaya diri dari guru model; (b) kurangnya kemampuan mengelola kelas; (c) ketidaksesuaian antara RPP dan implementasi pembelajaran di kelas; (d) sarana dan prasarana seperti ruang lab/kelas yang terlalu memanjang dan komputer yang sering rusak dan (e) pada saat menjadi observer, ada siswa yang datang terlambat dan terlalu banyak siswa yang diamati oleh observer. Hambatan dari tahap see, yaitu: (a) tidak hadirnya salah satu observer, sehingga dapat mengurangi masukan yang didapatkan dan (b) keterbatasan waktu dalam pelaksanaan refleksi pembelajaran. Saran yang dapat peneliti berikan, yaitu: (1) dalam tahap perencanaan pembelajaran (plan), sebaiknya dilakukan satu minggu sebelum proses pembelajaran dikarenakan, jika ada kekurangan dari hasil plan, guru model dapat mempersiapkan perbaikan beberapa hari sebelumnya, sehingga dalam pembelajaran bisa berlangsung lebih baik; (2) dalam tahap pelaksanaan pembelajaran (do), guru model sebaiknya mengelompokkan siswa secara heterogen sebelum pembelajaran, dengan harapan pembelajaran dapat berjalan sesuai harapan dan siswa dapat lebih aktif dalam bekerja secara kelompok; (3) dalam tahap refleksi pembelajaran (see), sebaiknya dilakukan langsung setelah pembelajaran, agar semua observer dapat hadir dan pembelajaran sebelumnya masih mudah diingat; (4) untuk pihak sekolah, ruang laboratorium yang memanjang sebaiknya ditata lebih baik lagi, untuk memudahkan guru model dalam pembelajaran dan perlu adanya perawatan komputer secara berkala, untuk mencegah hambatan dalam pembelajaran. Selain itu, pelaksanaan lesson study perlu ditambah kuantitasnya karena dirasa dapat meningkatkan kualitas pembelajaran dan kemampuan mahasiswa PPL PTI UM dan (5) untuk institusi, sebaiknya mahasiswa PPL PTI UM diberikan materi tentang metode pembelajaran dan penerapannya serta memberikan materi tentang lesson study lebih awal sehingga pada saat praktik di lapangan sudah memiliki bekal yang cukup dalam pembelajaran.

Pengembangan sumber belajar berbasis website pada mata pelajaran pendidikan kependudukan dan lingkungan hidup / Nanda Angesthi Puspitaningtyas

 

Kata kunci: sumber belajar, Pendidikan Kependudukan dan Lingkungan Hidup, web, pembelajaran mandiri. Salah satu solusi yang bisa membantu siswa dalam belajar mandiri adalah menggunakan pembelajaran berbasis websie. Harapan atas dibuatnya sumber belaj

Pengaruh model pembelajaran koopeartif tipe TAI (Team Assisted Individualization) dengan model pembelajaran PBL (Problem Based Learning) terhadap hasil belajar TIK kelas X SMA Negeri 1 Kepanjen / Ali Mustofa

 

Kata Kunci: Team Assisted Individualization, PBL, Hasil Belajar TIK Model pembelajaran dalam proses belajar mengajar sangat berperan dalam keberhasilan belajar siswa. Pemilihan model pembelajaran yang tepat akan memperbesar peluang pencapaian keberhasilan belajar. Langkah yang dapat diupayakan oleh seorang guru adalah dengan melakukan pendekatan-pendekatan secara individu kepada siswa yang memiliki kemampuan di bawah rata-rata untuk memberikan bantuan dalam pemahaman materi agar tidak tertinggal oleh siswa lain dan memberikan motivasi agar siswa yang bersangkutan mau berusaha seperti siswa lain. Tujuan penelitian ini mendeskripsikan: (1) Perbedaan hasil belajar siswa antara yang kegiatan pembelajaranya menggunakan model pembelajaran kooperatif tipe TAI (Team Assisted Individualization) dan model pembelajaran PBL (Problem Based Learning), (2) Pengaruh penerapan model pembelajaran antara yang kegiatan pembelajaranya menggunakan model pembelajaran kooperatif tipe TAI (Team Assisted Individualization) dan model pembelajaran PBL (Problem Based Learning). Rancangan penelitian yang digunakan adalah quasi eksperiment dengan teknik purposive sampling, adapun sampel penelitian adalah siswa kelas X-2 sebagai kelas kontrol dan X-6 sebagai kelas eksperimen. Instrumen yang digunakan yaitu instrumen permbelajaran yaitu silabus, rpp, dan instrumen pengukuran menggunakan rubrik afektif, rubrik unjuk kerja, jobsheet, tes serta angket untuk mengukur variabel X dan variabel Y. Teknik analisis data yang digunakan adalah analisis statistik kuantitatif dengan bantuan SPSS dan analisis kualitatif. Hasil penelitian menunjukkan bahwa rata-rata nilai hasil belajar siswa pada kelompok eksperimen adalah 84,85 dan pada kelompok kontrol adalah 80,86 serta hasil rerata respon siswa kelas eksperimen 83,14 dan 80,60 pada kelas kontrol. Data hasil belajar dari masing-masing kelas diuji hipotesis menggunakan uji-t serta data hasil belajar dan data respon siswa diuji hipotesis menggunakan uji regresi linear sederhana. Dari uji-t diperoleh hasil yaitu thitung (5,152) > ttabel (2,000) sehingga terdapat perbedaan hasil belajar siswa kelas eksperimen dan kelas kontrol. Kesimpulan penelitian ini: (1) Terdapat perbedaan hasil belajar yang signifikan antara kelas yang kegiatan pembelajaranya menggunakan model pembelajaran kooperatif tipe TAI (Team Assisted Individualization) dan model PBL, (2) Terdapat pengaruh yang signifikan antara model pembelajaran baik pada kelas eksperimen maupun kelas kontrol terhadap hasil belajar siswa sehingga model pembelajaran kooperatif tipe TAI (Team Assisted Individualization) lebih baik daripada model pembelajaran PBL (Problem Based Learning).

Perbedaan antara metode project based learning dan pembelajaran kooperatif tipe team assisted individualization terhadap hasil belajar TIK siswa kelas X pada kompetensi dasar membuat dokumen pengolah kata dengan variasi tabel grafik gambar dan diagram di SMA BSS Brawija

 

Kata kunci: Project Based Learning, Pembelajaran Kooperatif, TAI (Team Assisted Individualization), perbedaan, hasil belajar. Teknologi Informasi dan Komunikasi merupakan salah satu mata pelajaran wajib di SMP, SMA dan SMK. Karena itulah siswa dituntut untuk menguasai dan memahami TIK. Di SMA BSS, guru dalam pembelajarannya sering menerapkan model pembelajaran kooperatif, dengan melihat ciri-ciri pembelajarannya, guru menerapkan pembelajaran kooperatif tipe TAI. Karena dalam pembelajaran guru selalu menerapkan model tersebut, oleh karena itu dalam penelitian ini diterapkan metode Project Based Learning pada materi membuat dokumen pengolah kata dengan variasi tabel gambar grafik dan diagram. Tujuan dari penelitian ini adalah mengetahui signifikan perbedaan antara metode Project Based Learning dan Pembelajaran Kooperatif tipe TAI terhadap hasil belajar TIK di SMA BSS Brawijaya Smart School. Penelitian ini merupakan penelitian eksperimen semu dengan pola pretest-posttest control group design. Subyek penelitian ini adalah siswa kelas X SMA BSS Brawijaya Smart School Tahun ajaran 2010/2011. Sampel penelitian menggunakan dua kelas dimana teknik pengambilannya melalui purposive sam-pling. Kelas X-1 sebagai kelas eksperimen dan X-5 sebagai kelas kontrol. Variabel penelitian terdiri dari, variabel bebas yaitu metode pembelajaran dan varia¬bel terikat yaitu hasil belajar. Instrumen yang digunakan dalam penelitian ini adalah instrumen perlakuan dan instrumen pengukuran hasil belajar. Hasil penelitian menunjukkan bahwa terdapat pengaruh yang signifikan antara metode Project Based Learning dan Pembelajaran Kooperatif tipe TAI terhadap hasil belajar TIK di SMA BSS Brawijaya Smart School. Berdasarkan hasil uji hipotesis diperoleh nilai Sig(p)=0,000 dimana nilai tersebut lebih kecil dari 0,05. Sehingga H0 ditolak dan dapat disimpulkan bahwa terdapat perbedaan yang signifikan antara metode Project Based Learning dan Pembelajaran Kooperatif tipe TAI terhadap hasil belajar TIK di SMA BSS Brawijaya Smart School.

Hubungan keefektifan kepemimpinan kepala sekolah, iklim sekolah dan motivasi kerja guru dengan kinerja guru pada SD Negeri yang berada di wilayah perbatasan pasca konflik kota Ambon / Wiliem Yacob Hetharion

 

Tesis, Program Studi Manajemen Pendididkan, Program Pascasarjana Unuversitas Negeri Malang,. Pembimbing (1) Prof. Dr. Willem Mantja, M.Pd, (2) Prof. Dr. Bambang Budi Wiyono, M.Pd. Kata kunci: keefektifan kepemimpinan kepala sekolah, iklim sekolah, motivasi kerja guru dan kinerja guru. Konflik etnis yang terjadi selama 4 tahun di Propinsi Maluku secara umum dan Kota Ambon menyebabkan perubahan yang signifikan pada aspek sosial kemasyarakatan, termasuk implikasinya dalam penyelenggaraan pendidikan. Pasca terjadinya konflik, sebagian besar penyelenggaraan pendidikan berlangsung secara terpisah pada kedua komunitas yang terlibat konflik. Akibat yang ditimbulkan konflik antara dua komunitas terhadap aktivitas pendidikan di Kota Ambon adalah menurunnya kinerja guru dari tingkat Sekolah Dasar hingga Sekolah Menengah. Terlebih lagi, para guru lebih memilih bertugas pada daerah atau lokasi masing-masing karena alasan keamanan.Dapat dijelaskan pula bahwa para guru di Kota Ambon cenderung menghindari sekolah yang terletak pada wilayah perbatasan kedua komunitas yang terlibat dalam konflik. Fakta ini menunjukkan bahwa adanya pengelompokkan guru berdasarkan identitas dua komunitas sehingga mengurangi fungsi sekolah sebagai kelompok belajar (learning society). Rumusanmasalah penelitianiniadalah (1) Bagaimanagambarankeefektifankepemimpinankepalasekolahpada SD Negeri yang berada di wilayah perbatasan pasca konflik Kota Ambon?. (2) Bagaimana gambaran iklim sekolah pada SD Negeri di wilayah perbatasan pasca konflik kota Ambon? (3) Bagaimanagambaranmotivasikerja guru pada SD Negeri di wilayahperbatasanpascakonflik kota Ambon? (4) Bagaimanagambarankinerja guru pada SD Negeri di wilayahperbatasanpascakonflikkota Ambon?. (5) Apakahadahubunganantarakeefektitankepemimpinankepalasekolah, iklimsekolahdanmotivasi guru dengankinerja guru pada SD Negeri di wilayahperbatasanpascakonflikkota Ambon secara simultan? Penelitian ini dilakukan dengan rancangan penelitian diskriptif korelasional. Dilaksanakanpada SD Negeridi wilayah-wilayahperbatasandaerahkonflik di Kota Ambon sejumlah 18 lembaga dengan populasi 290 orang dan jumlah sampel 148 orang. Sampel diambil dengan random proporsional. Penelitian ini menggunakan kuesioner atau angket sebagai instrumen dalam pengumpulan data penelitian. Hasil analisis data penelitian secara deskriptif menunjukkan bahwa (1) tingkat kecendrungan keefektifankepemimpinankepalasekolahpada SD Negeri di wilayahperbatasanpascakonflik Kota Ambon dipersespsikan baik atau berada pada kategori tinggi dan kategori sangat tinggi. (2) Tingkat iklim sekolah pada SD Negeri Kota Ambon berada pada kategori tinggi. (3) Tingkat motivasikerja guru pada SD Negeridi Kota Ambon berada pada kategori tinggi sebesar dan berada pada kateogi sangat tinggi.dan (4) Tingkat kinerja guru pada SD Negeridi Kota Ambon tergolong tinggi dengan frekuensi. Hasil uji hipotesis juga menunjukkan bahwa (1) Terdapat hubungan yang signifikan antara keefektifan kepemimpinan kepala sekolah dengan kinerja guru. (2) Terdapat hubungan yang signifikan antara iklim sekolah dengan kinerja guru. (3) Terdapat hubungan yang signifikan antara motivasi guru dengan kinerja kerja guru. Dan (4) Terdapat hubungan yang signifikan antara keefektifan kepemimpinan kepala sekolah, iklim sekolah, motivasi guru dengan kinerja guru. Berdasarkan analisis regresi diperoleh hasil persamaan regresi Y = 0,137X1 + 0,196X2+0,418X3+18,275.Hasil perhitungan sumbangan efektif menunjukkan bahwa varaibel keefektifan kepemimpinan kepala sekolah memberikan kontribusi sebesar 22,57%, variabel iklim sekolah memberikan kontribusi sebesar 21,83% dan variabel motivasi kerja guru memberikan kontribusi sebesar 24,30% kepada kinerja guru pada SDNegeri di wilayahperbatasan di Kota Ambon. Dengan demikian, diperoleh total sumbangan ketiga variabel adalah sebesar 68,7%, sedangkan sisanya ditentukan oleh variabel-variabel lain. Berdasarkanhasilpenelitianini,beberapa saran antara lain: (1)Sebagai guru mendapatmendapatmasukanuntukmemperbaikidiridalammelaksanakantugasdantanggungjawabsesuaidenganprofesi yang dimilikisehinggadapatmeningkatkankualitassumberdayamanusiasesuaidenganprofesionalisme yang dimiliki. (2) Kepala sekolahdalammelaksanakantugaskepemimpinannyadapatmenciptakandanmemberikanpenghargaan(reward) bagipara guru dalammelaksanakantugasnya.Iklimsekolah yang baiksehinggapara guru dapattermotivasiuntukmeningkatkankinerjanya yang dimiliki. (3) Hasilpenelitianinimemberikangambaranbahwapengelolaanpenyelenggaraanpendidikan di wilayah-wilayahperbatasankomunitas yang pernahterlibatdalamkonfliksangatbergantungpadaaspekkepemimpinankepalasekolah, iklimsekolahdanmotivasikerja guru terhadapkinerja guru sebagaifaktor internal. DengandemikiandisarankankepadadinasPendidikandanOlah Raga kota Ambon seharusnyamenentukanbahwadalammemilihkepalasekolahpadasekolah yang berada di wilayahperbatasanpascakonflikhendaknyadidasaripadapenilaianmutukepemimpinangunamenciptakankondisisekolah yang efektif agar proses pembelajarandanpeningkatankualitaspendidikandapatberjalandenganbaiksesuaidengantujuanpendidikan.(4).Penelitianinidiharapkandapatmenjadirujukanbagipenelitilainnya yang inginmengkajisecaralebihkomprehensifterkaitdenganManajemenPendidikanpadawilayah-wilayah yang termasukdalamdaerahkonflik.

Pembelajaran dengan pendekatan penemuan terbimbing untuk meningkatkan pemahaman konsep jarak dan sudut dalam ruang dimensi tiga pada peserta didik kelas X.9 SMA Negeri 1 Tumpang / Didik Sukanto

 

Tesis Program Studi Pendidikan Matematika, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr.Edy Bambang Irawan, M.Pd. dan (II) Dr. Santi Irawati, M.Si. Kata Kunci : Konsep Jarak dan Sudut, Penemuan Terbimbing. Mempelajarikonsepjarakdansudutmerupakanhal yang pentingbagisetiap orang.Dalamaktivitaskehidupansehari-harinya, dengandisadariatautidak, setiap orang selalumenggunakankonsepjarakdansudut.Dari hasil tes yang dilakukan peneliti menunjukkan bahwa (1) peserta didik mengalamikesulitandalammenyelesaikansoaltes, dan (2) peserta didikhanyabelajardenganmenghafaltanpamemahamikonsepnya. Dengan kata lain, bahwapemahamanpeserta didikterhadapkonsepjarakdansudutdalamruangdimensi tiga belumtertanamdenganbaik.Pemahaman yang dimaksud dalam penelitian inimerupakanbagiandaridomain cognitive Taxonomy Bloom yang meliputi(1) translation, yaitukemampuanmengubahsimbol/kalimattanpamengubahmakna,(2) interpretation, yaitukemampuanmenafsirkanataumenjelaskanmakna yang terdapatdalamsimbol, dan(3) extrapolation,yaitukemampuanuntukmelihatkecenderunganatausuatutemuan (perhitungan). Pelaksanaan penelitian ini menggunakan pendekatan kualitatif dengan rancangan penelitian tindakan kelaspada peserta didik kelas X.9 SMA Negeri 1 Tumpang, Kabupaten Malang. Aktivitas pembelajaran sebagai tindakan dalam penelitian ini bertujuan untuk meningkatkan pemahaman peserta didik terhadap konsep jarak dan sudut dalam ruang dimensi tiga. Proses pembelajaran untuk meningkatkan pemahaman peserta didik terhadap konsep jarak dan sudut dalam ruang dimensi tiga yang hendak dicapai oleh setiap peserta didik diakhiri dengan pelaksanaan tes akhir tindakan yang sesuai dengan domain cognitive taxonomy Bloom yang meliputi aspek (1)interpretation, (2) translation, dan (3) extrapolation. Pelaksanaan penelitian ini menghasilkan (1) pembelajaran dengan pendekatan penemuan terbimbing dapat membantu peserta didik untuk menemukan kembali dan memahami konsep jarak dan sudut dalam ruang dimensi tiga, (2) desain pembelajaran dengan pendekatan penemuan terbimbing yang berupa langkah-langkah pembelajaran yang tertuang dalam rancangan rencana pelaksanaan pembelajaran. Langkah-langkah pembelajaran dengan pendekatan penemuan terbimbing yang dimaksud dalam penelitian ini antara lain (a) merumuskan masalah, (b) menyelesaikan masalah, (c) menyusun konjektur, (d) pemeriksaan konjektur, (e) verbalisasi konjektur, (f) uji konjektur, dan (g) penarikan kesimpulan. Berdasarkan hasil penelitian ini, maka bagi guru matematika yang hendak melakukan penelitian tindakan kelas pada materi jarak dan sudut dengan pendekatan penemuan terbimbing sebagai penelitian lanjutan pada tahun berikutnya, hendaknya mempersiapkan perangkat pembelajaran, media pembelajaran, dan sarana-prasarana, serta instrumen penelitian dengan sebaik-baiknya. Selain itu, bagi peneliti lain yang hendak melakukan penelitian serupa di SMA Negeri 1 Tumpang maupun di sekolah lain, dapat menggunakan hasil penelitian ini sebagai acuan alternatif dalam pelaksanaan penelitian lanjutan untuk memperoleh desain pembelajaran serupa yang lebih baik dan lebih sempurna.

Pengaruh metode pembelajaran dan prior knowledge terhadap kemampuan komunikasi matematika dan hasil belajar / Amma Mokh Mansyur

 

Program Studi Teknologi Pembelajaran, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Nyoman Sudana Degeng, M.Pd., (II) Prof. Dr. H. Punadji Setyosari, M.Ed., M.Pd., (III) Dr. Waras Kamdi, M.Pd. Kata kunci: metode pembelajaran, prior knowledge, kemampuan komunikasi matematika, hasil belajar. Sesungguhnya banyak konsep matematika yang dapat digali dari kehidupan nyata dan konsep-konsep tersebut digunakan untuk memecahkan masalah-masalah dunia nyata. Para siswa dapat dibantu untuk membangun pengetahuan matematika berdasarkan pada pengalaman nyata mereka sehari-hari dan selanjutnya membawa pemahamannya tersebut ke tahap yang lebih tinggi. Dengan demikian, perlu dilakukan suatu penelitian implementasi metode pembelajaran yang memanfaatkan pengalaman nyata siswa. Salah satu metode pembelajaran yang dapat diimplementasikan adalah diskusi Mathematician’s Circle. Diskusi Mathematician’s Circle menyajikan cara-cara untuk merangsang siswa dalam menuliskan masalahnya sendiri dan melakukan verifikasi maknanya dengan yang lain agar menjadi pemecah masalah matematika yang efektif. Teknik tersebut mencakup pembagian masalah yang dihasilkan sendiri pada Mathematician’s Circle dan penerbitan masalah di lembar kerja. Tujuan dari penelitian ini adalah untuk mengetahui (1) perbedaan kemampuan komunikasi matematika siswa yang belajar dengan metode diskusi Biasa dan diskusi Mathematician’s Circle, (2) perbedaan hasil belajar siswa antara yang belajar dengan metode diskusi Biasa dan diskusi Mathematician’s Circle, (3) perbedaan kemampuan komunikasi matematika antara siswa yang memiliki prior knowledge tinggi dan rendah, (4) perbedaan hasil belajar antara siswa yang memiliki prior knowledge tinggi dan rendah, (5) pengaruh interaksi antara metode pembelajaran dan prior knowledge terhadap kemampuan komunikasi matematika, (6) pengaruh interaksi antara metode pembelajaran dan prior knowledge terhadap hasil belajar. Penelitian ini menggunakan metode eksperimen dan dilaksanakan pada bulan maret – Juni 2010. Populasi dalam penelitian ini adalah siswa kelas X SMKN 1 Sambeng – Lamongan. Data diambil dari tes untuk kemampuan komunikasi matematika dan hasil belajar, sedangkan dukumen untuk prior knowledge. Rancangan penelitian yang digunakan adalah rancangan dua faktor dalam versi faktorial 2x2 pretes – postes nonequivalent control group design. Analisis data menggunakan teknik diskriptif dan analisis statistik MANOVA. Berdasarkan hasil analisis data, ditemukan hasil-hasil penelitian sebagai berikut: (1) ada perbedaan signifikan kemampuan komunikasi matematika antara siswa yang belajar dengan metode diskusi Biasa dan diskusi Mathematician’s Circle (F = 9,770; p = 0,003), (2) ada perbedaan signifikan hasil belajar antara siswa yang belajar dengan metode diskusi Biasa dan siswa yang belajar dengan metode diskusi Mathematician’s Circle (F = 12,505; p = 0,001), (3) ada perbedaan signifikan kemampuan komunikasi matematika antara siswa yang memiliki prior knowledge tinggi dan rendah (F = 434,227; p = 0,000), (4) ada perbedaan signifikan hasil belajar antara siswa yang memiliki prior knowledge tinggi dan rendah (F = 457,369; p = 0,000), (F = 457,369; p = 0,000), (5) tidak ada pengaruh interaksi antara metode pembelajaran dan prior knowledge terhadap kemampuan komunikasi matematika (F = 0,174; p = 0,678), (6) tidak ada pengaruh interaksi antara metode pembelajaran dan prior knowledge terhadap hasil belajar (F = 1,021; p = 0,316). Temuan-temuan dalam penelitian ini, mengindikasikan bahwa diskusi Mathematician’s Circle berpengaruh lebih efektif daripada pendekatan diskusi biasa terhadap kemampuan komunikasi matematika dan hasil belajar di SMKN 1 Sambeng - Lamongan. Diskusi Mathematician’s Circle lebih akomodatif terhadap prior knowledge dalam pencapaian kemampuan komunikasi matematika dan hasil belajar.

Penerapan strategi bauran promosi pada toko buku diskon Toga Mas Malang / Mochammad Budi Nugroho

 

Kata Kunci : Bauran Promosi, Toko Buku Diskon Togamas Malang Promosi merupakan salah satu faktor penentu keberhasilan suatu program pemasaran yang bertujuan menyebarkan informasi, mempengaruhi, dan mengingatkan pasar sasaran atas perusahaan dan produknya agar bersedia menerima, membeli , dan loyal pada produk yang ditawarkan perusahaan yang bersangkutan. Meskipun secara umum promosi memliki fungsi yang sama, akan tetapi promosi memiliki komponen-komponen khusus yang disebut bauran promosi, komponen dari bauran promosi itu sendiri meliputi periklanan (advertising), penjualan personal (personal selling), promosi penjualan (sales promotion), hubungan masyarakat (public relation), pemasaran langsung (direct marketing). Melalui komponen tersebut dapat dipadukan menjadi bauran promosi yang bertujuan untuk menginformasikan perusahaan dan produk dari perusahaan tersebut. Penulisan laporan ini bertujuan untuk mengetahui penerapan Strategi Promotional Mix pada Toko Buku Diskon Togamas Malang, bauran promosi yang paling efektif dan kurang efektif pada Toko Buku Diskon Togamas Malang, dan untuk mendeskripsikan beberapa alternatife yang bisa dipilih dalam menyelesaikan masalah promosi yang ada pada Toko Buku Diskon Togamas Malang. Strategi Bauran Promosi yang digunakan pada Toko Buku Diskon Togamas Malang adalah periklanan (advertising), penjualan personal (personal selling), promosi penjualan (sales promotion), hubungan masyarakat (public relation), pemasaran langsung (direct marketing). Iklan adalah bentuk komunikasi tidak langsung, yang didasari pada informasi tentang keunggulan atau keuntungan suatu produk, yang disusun sedemikian rupa sehingga menimbulkan rasa menyenangkan yang akan mengubah pikiran seseorang untuk melakukan pembelian. Sedangkan yang dimaksudperiklanan adalah seluruh proses yang meliputi penyiapan, perencanaan, pelaksanaan, dan pengawasan iklan. Personal Selling adalah komunikasi langsung (tatap muka) antara penjual dan calon pelanggan untuk memperkenalkan suatu produk kepada calon pelanggan dan membentuk pemahaman pelanggan terhadap produk sehingga mereka kemudian akan mencoba dan membelinya. Promosi penjualan adalah bentuk persuasi langsung melalui penggunaan berbagai insentif yang dapat diatur untuk merangsang pembelian produk dengan segera dan/atau meningkatkan jumlah barang yang dibeli pelanggan Direct marketing adalah system pemasaran yang bersifat interaktif secara langsung, yang memanfaatkan satu atau beberapa media iklan untuk menimbulkan respon yang terukur dan atau transaski di sembarang lokasi. Public Relation merupakan upaya komunikasi menyeluruh dari suatu perusahaan untuk mempengaruhi presepsi, opini, keyakinan, dan sikap berbagai kelompok terhadap perusahaan tersebut Toko Buku Diskon Togamas Malang juga memiliki bauran promosi yang paling efektif dan kurang efektif, bauran promosi yang paling efektif adalah Sales promotion dan yang kurang efektif adalah Personal Selling. Tetapi Toko Buku Diskon Togamas juga secara tidak langsung mempunyai promosi dari mulut ke mulut oleh konsumen kepada konsumen yang menjadikan hal itu sebagai promosi yang paling efektif di Togamas Malang. Toko Buku Diskon Togamas Malang juga mempunyai kendala dalam promosi dan kurangnya tenaga promosi namun hal ini bisa diatasi dengan cara meningkatkan promosi yang efektif dalam Togamas seperti promosi dari mulut kemulut, sales promotion, public relation pada Togamas Malang dan untuk kurangnya tenaga promosi agar lebih efektif dan efisien dengan perekrutan Pegawai Marketing yang baru.

Pengaruh model pembelajaran kooperatif stad dengan diagram vee terhadap hasil belajar siswa pada materi hidrolisis gram kelas XI IPA SMAN 1 Krueng Barona Jaya Aceh Besar / Dewi Suryantina

 

Kata Kunci: model pembelajaran kooperatif STAD (Student Teams Achievement Divisions), diagram Vee, hasil belajar, konstruktivisme. Hidrolisis garam merupakan salah satu materi kimia yang diberikan pada siswa Sekolah Menengah Atas (SMA). Materi hidrolisis garam banyak melibatkan konsep, prinsip, teori, kerja ilmiah serta perhitungan secara matematis, sehingga siswa mengalami kesulitan dalam menghubungkan teori dengan kerja ilmiah yang dilakukan di laboratorium. Penerapan pembelajaran kooperatif STAD dengan diagram Vee diduga akan mempermudah siswa dalam mempelajari materi hidrolisis garam karena pada bagian kiri bentuk V, siswa dilibatkan untuk mengisi sendiri konsep, teori dan juga prosedur kerja serta alat dan bahan yang akan digunakan pada saat melakukan praktikum sesuai dengan pertanyaan fokusnya. Di samping itu, pembelajaran kooperatif STAD yang dirangkaikan dengan pembelajaran praktikum menggunakan diagram Vee ini diduga lebih efektif. Penelitian ini bertujuan untuk: 1) mengetahui perbedaan hasil belajar siswa yang dibelajarkan dengan model pembelajaran kooperatif STAD menggunakan diagram Vee dan siswa yang dibelajarkan dengan model pembelajaran kooperatif STAD pada materi hidrolisis garam, 2) mengetahui persepsi siswa terhadap penerapan model pembelajaran kooperatif STAD dengan diagram Vee dan persepsi siswa terhadap model pembelajaran kooperatif STAD tanpa diagram Vee pada materi hidrolisis garam. Penelitian ini menggunakan rancangan deskriptif dan eksperimen semu. Sampel dalam penelitian ini adalah siswa kelas XI IPA SMA Negeri 1 Krueng Barona Jaya Kabupaten Aceh Besar tahun ajaran 2010/2011 sebanyak dua kelas. Kelas eksperimen dibelajarkan dengan model pembelajaran kooperatif STAD dengan diagram Vee dan kelas kontrol dibelajarkan dengan model pembelajaran kooperatif STAD tanpa diagram Vee dan kedua model pembelajaran ini merupakan variabel bebas, sedangkan variabel terikatnya adalah hasil belajar siswa. Data hasil penelitian merupakan data hasil belajar dan persepsi siswa terhadap model pembelajaran yang diberikan pada masing-masing kelas. Pengumpulan data dilakukan dengan menggunakan a) lembar observasi meliputi keaktifan individu dan kelompok yang digunakan untuk mengetahui aspek afektif, dan aspek psikomotor dapat diketahui melalui observasi kinerja siswa di laboratorium, b) pos tes untuk melihat aspek kognitif siswa setelah dilakukan pembelajaran materi hidrolisis garam yang terdiri dari 20 soal dengan validitas isi 88%, dan c) angket yang digunakan untuk mengetahui persepsi siswa terhadap model pembelajaran. Data yang diperoleh dianalisis secara deskriptif untuk menentukan persepsi siswa dan statistik untuk menentukan reliabilitas 0,888 dan hasil belajar siswa dianalisis dengan uji t menggunakan SPSS 16 for Windows. Hasil penelitian menunjukkan bahwa 1) ada perbedaan hasil belajar siswa antara yang dibelajarkan dengan model pembelajaran kooperatif STAD dengan diagram Vee lebih tinggi dibandingkan siswa yang dibelajarkan dengan model pembelajaran kooperatif STAD tanpa diagram Vee pada materi hidrolisis garam dengan rata-rata hasil belajar siswa 84,33 kelas eksperimen dan 76,45 kelas kontrol, 2) persepsi siswa terhadap model pembelajaran kooperatif STAD dengan diagram Vee lebih tinggi yaitu 70,10% dibandingkan terhadap model pembelajaran kooperatif STAD yaitu 64,22% pada materi hidrolisis garam. Oleh karena itu model pembelajaran kooperatif STAD dengan diagram Vee pada materi hidrolisis garam ini dapat membantu siswa dalam melakukan kegiatan praktikum di laboratorium karena sebelumnya mereka sudah mengetahui dan merancang sendiri prosedur kerja yang akan dilakukan di laboratorium dalam bentuk diagram Vee, serta membantu dalam memahami konsep/teori dengan cara berdiskusi bersama kelompok kooperatif STAD.

Pengaruh modal role playing terhadap motivasi dan hasil belajar siswa pada mata pelajaran IPS kelas V di SDN Sumberejo 01 Gedangan Malang / Heri Purwwanti

 

Kata kunci: pengaruh, pembelajaran, model role playing, motivasi, IPS SD Berdasarkan hasil observasi di SDN Sumberejo Gedangan 01 Malang, pada hari Sabtu tanggal 20 Agustus 2011 guru kelas V melaksanakan pembelajaran dengan metode ceramah dan metode penugasan. Guru mulai awal masuk kelas sampai akhir pembelajaran hanya aktif menjelaskan di depan kelas, siswa pasif dalam pembelajaran. KKM yang telah ditentukan untuk matapelajaran IPS yaitu ≥ 70. Berdasarkan ulangan harian pada mata pelajaran Ilmu Pengetahuan Sosial materi pokok “Keragaman Budaya dan Suku Bangsa di Indonesia” diperoleh data dari 26 jumlah siswa kelas V yang ikut ulangan harian, terdapat 14 siswa tuntas belajar dan 12 siswa belum tuntas belajar sehingga harus mengikuti pelajaran remidi. Jenis penelitian ini adalah Quasy Experimental Design. Rancangan penelitian yang digunakan adalah desain pre-test and post-test group. Populasi dalam penelitian ini adalah seluruh siswa kelas V SDN Sumberejo 01 Gedangan Malang tahun pelajaran 2011/2012 yang berjumlah 52 orang. Sampel dalam penelitian ini berjumlah 52 orang yang terbagi menjadi 2 kelas yaitu 26 siswa kelas VB sebagai kelompok eksperimen dan 26 siswa kelas VA sebagai kelompok kontrol. Tujuan penelitian yaitu untuk mengetahui adanya pengaruh model role playing terhadap motivasi dan hasil belajar Ilmu Pengetahuan Sosial siswa kelas V SDN Sumberejo 01 Gedangan Malang. Hasil penelitian menunjukkan bahwa siswa memiliki motivasi yang tinggi dan respon positif terhadap pembelajaran Ilmu Pengetahuan Sosial dengan model role playing. Dari 10 item pernyataan yang telah diberikan mayoritas siswa menjawab dengan jawaban sangat setuju dan setuju. Berdasarkan hasil uji hipotesis dengan menggunakan uji t maka dapat disimpulkan bahwa model role playing berpengaruh terhadap hasil belajar siswa. Hal ini dapat dilihat dari nilai thitung dan nilai signifikansi untuk post test. Nilai thitung dan nilai signifikansi untuk posttest berturut-turut sebesar -8,383 dan 0,000 sedangkan ttabel sebesar 2,0086. Perbandingan menunjukkan bahwa nilai posttest memiliki thitung > ttabel. Selain itu didapatkan pula nilai signifikan < α = 0,05, sehingga dapat disimpulkan tolak Ho atau terima Ha yang berarti bahwa terdapat perbedaan yang signifikan antara kelas yang diberi treatmen maupun kelas kontrol terhadap nilai posttest. Berdasarkan hasil penelitian, dapat disimpulkan bahwa model role playing berpengaruh terhadap motivasi dan hasil belajar siswa pada matapelajaran IPS kelas V di SDN Sumberejo 01 Gedangan Malang. Oleh karena itu, disarankan kepada guru agar menerapkan model role playing dalam pembelajaran IPS khususnya materi pokok “Keanekaragaman Suku Bangsa dan Budaya di Indonesia”.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 |