Analisis daya saing daerah wilayah pengembangan lingkar kota Malang / Chris Wijayanti Puspita

 

ABSTRAK Puspita, Chris Wijayanti. 2016. Analisis Daya Saing Daerah Wilayah Pengembangan Lingkar Kota Malang. Tesis, Program Studi Ilmu Ekonomi, Program Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Dr. Farida Rahmawati, SE, ME, (II) Dr. Hadi Sumarsono, ST, M.Si. Kata Kunci: Daya Saing Daerah, Multi Sektor Analisis, Sektor Unggulan, Kriteria Daya Saing. Adanya Masyarakat Ekonomi Asean (MEA) sebagai bentuk integrasi ekonomi ASEAN merupakan harapan sekaligus ancaman bagi Indonesia. Harapan tersebut adalah melalui MEA Indonesia mampu mencapai kesetabilan perekonomian negara dan kesejahteraan masyarakat yang lebih baik. Sedangkan ancaman yang timbul adalah apabila negara tidak dapat bersaing, maka perekonomian negara tersebut semakin melemah. Pada era otonomi daerah saat ini, keberhasilan negara dalam menghadapi MEA tentu tidak dapat dilepaskan dari fakta bahwa daerah yang dalam hal ini adalah kabupaten/kota merupakan tokoh utama dalam peranan pencapaian tersebut. Kabupaten/ kota yang memiliki daya saing ekonomi kuat tentu akan menjadi ujung tombak negara dalam menghadapi persaingan MEA. Semakin banyak daerah yang berdaya saing kuat, tentu negara akan semakin kuat dan mampu bersaing dengan negara lainnya. Sebaliknya, semakin banyak daerah yang berdaya saing lemah maka negara akan bersusah payah dan butuh usaha yang lebih untuk menghadapi persaingan MEA. Dengan kata lain negara yang berdaya saing kuat terbentuk dari daerah Kabupaten/Kota yang berdaya saing kuat pula. Pembangunan ekonomi daerah pada dasarnya bersifat multisektoral dengan melibatkan banyak pelaku pembangunan sehingga diperlukan kerja sama dan koordinasi di antara semua pihak yang berkepentingan. Selain itu, untuk mengevaluasi kinerja pembangunan ekonomi daerah dibutuhkan identifikasi terhadap kriteria evaluasi dan pengukuran daya saing yang tepat. Wilayah Pengembangan Lingkar Kota Malang sebagai unit ekonomi harus memiliki daya saing kuat untuk mendukung Pusat Kegiatan Nasional dan untuk Meningkatkan kesejahteraan masyarakatnya. Tujuan dari penelitian adalah (1) menentukan kriteria untuk mengukur daya saing daerah, (2) menemukan sektor unggulan di Wilayah Pengembangan Lingkar Kota Malang Data yang digunakan adalah data primer yang diperoleh dari pengisian kuisioner oleh responden. Responden terdiri dari perwakilan BAPPEDA, bagian perekonomian Kabupaten Malang, Disperindag, Dinas Koperasi dan UMKM, perwakilan dari sembilan Kecamatan yang ada dalam Wilayah Pengembangan Lingkar Kota Malang, dan perwakilan masing-masing sektor (pertanian, Industri, jasa) di masing-masing kecamatan. Hasil penelitian ini adalah (1) terdapat sebelas kriteria yang dijabarkan kedalam 34 pertanyaan, untuk mengukur daya saing daerah. (2) Sektor industri merupakan sektor unggulan di Wilayah Pengembangan Lingkar Kota Malang

Studi fenomenologis tentang stres sekolah pada siswa SMA Negeri 1 Puri Mojokerto / Btari Indra Savitri

 

Kata Kunci : stres sekolah, siswa SMA Sekolah merupakan rumah kedua bagi anak setelah keluarga dan sekolah. Sekolah tersebut mempunyai arti yang sangat penting bagi kehidupan dan perkembangan para siswa. Sekolah dipandang dapat memenuhi beberapa kebutuhan siswa dan menentukan kualitas kehidupan mereka di masa depan. Namun, pada saat yang sama sekolah ternyata juga dapat menjadi sumber masalah, yang pada gilirannya memicu terjadinya stres di kalangan siswa. Penelitian ini bertujuan untuk memperoleh deskripsi yang jelas dan rinci mengenai: (a) makna stres sekolah bagi siswa; (b) ciri-ciri siswa yang mengalami stres sekolah; (c) gambaran umum penyebab timbulnya stres sekolah pada diri siswa; (d) dampak stres sekolah bagi diri siswa; dan (e) cara siswa menghadapi stres sekolah. Selain itu, penelitian ini bertujuan untuk memperoleh pemahaman arti suatu peristiwa dan keterkaitannya dengan siswa yang mengalami stres sekolah. Penelitian ini dilakukan dengan pendekatan kualitatif. Jenis penelitian yang digunakan adalah fenomenologi karena penelitian yang dilakukan berusaha memahami arti peristiwa mengenai stres sekolah dan kaitan-kaitannya terhadap siswa yang berada di dalam situasi-situasi stres sekolah di SMA Negeri 1 Puri Mojokerto. Lokasi penelitian ini terletak di Jalan Jayanegara nomer 2 kabupaten Mojokerto. Peneliti berperan sebagai instrumen kunci, dengan subyek penelitian ini adalah siswa kelas XI SMA Negeri 1 Puri Mojokerto. Prosedur pengumpulan data yang digunakan adalah wawancara, observasi dan studi dokumentasi. Mengacu pada pendekatan kualitatif yang digunakan dalam penelitian, dipilihlah teknik sampling, yaitu snowball sampling. Analisis data terdiri dari tiga tahap, yaitu mereduksi data, penyajian data, dan penarikan kesimpulan. Pengecekan keabsahan data dilakukan dengan menggunakan lima cara, yaitu: (a) perpanjangan pengamatan; (b) meningkatkan ketekunan; (c) triangulasi yang digunakan adalah triangulasi teknik; (d) menggunakan bahan referensi; serta (e) kepastian (confirmability). Tahap-tahap penelitian terdiri dari tiga tahap, yaitu: tahap persiapan, tahap pelaksanaan, dan tahap akhir. Hasil penelitian menunjukkan bahwa para siswa memaknai stres sekolah sebagai suatu keadaan atau kondisi dimana mereka mengalami tekanan di sekolah yang disebabkan karena tugas yang tidak sesuai dengan kapasitasnya, bermasalah dengan teman, dan bosan terhadap pelajaran. Ciri-ciri yang siswa alami ketika merasa stres adalah tidak dapat berkonsentrasi dalam belajar, resah atau tidak tenang, sering marah-marah, merasa pusing ketika berpikir, murung atau diam dan suka melamun. Penyebab umum timbulnya stres sekolah yang dialami para siswa antara lain: cara guru dalam mengajar, tugas-tugas yang tidak sesuai dengan kapasitasnya, sering diberikan ulangan, ejekan teman karena nilai ulangan yang rendah serta pelajaran yang dianggap membosankan dan susah. Dampak yang siswa alami ketika mengalami stres sekolah adalah tidak dapat berkonsentrasi dalam belajar, nilai pelajaran jadi menurun atau rendah, serta malas untuk bersekolah. Ada berbagai macam cara yang dilakukan para siswa dalam mengatasi stres sekolah yang mereka alami, seperti ber-sms-an, facebook atau twitter, bercanda dengan teman, menghibur diri dengan jalan-jalan keliling sekolah, mendengarkan musik dan bahkan pergi ke kantin atau koperasi siswa (kopsis) yang ada di sekolah. Berdasarkan temuan-temuan penelitian, disarankan beberapa hal untuk konselor di sekolah, sekolah SMA Negeri 1 Puri, jurusan BK, dan peneliti. Konselor di sekolah disarankan untuk dapat mengetahui dan memahami gejala-gejala yang timbul pada diri siswa yang mengalami stres ketika berada di kelas serta dapat memberikan layanan BK yang sesuai. Untuk sekolah SMA Negeri 1 Puri disarankan perlu diberikannya pelayanan bimbingan dan konseling bagi para siswa yang mengalami stres sekolah serta perlu diberikan pelatihan bagi para guru dalam pemberian metode pembelajaran. Untuk jurusan Bimbingan dan Konseling (BK) disarankan untuk dapat menginformasikan hasil penelitian ini kepada mahasiswa agar mahasiswa mampu untuk lebih peka terhadap siswa yang mengalami stres sekolah dan dapat memberikan pelayanan-pelayanan BK sesuai dengan stres yang siswa alami. Untuk peneliti selanjutnya agar lebih fokus meneliti aspek-aspek lain yang berkaitan dengan stres sekolah, terutama tindakan konselor dalam pencegahan dan pengatasan siswa yang mengalami stres sekolah agar dapat memperkecil terjadinya stres di sekolah.

Perception of senior high school English teachers and students about personal competence / Aurora Paramahita Kusumawardhani

 

ABSTRAK Kusumawardhani, Aurora Paramahita. 2016. Perception of English Teachers and Students on Personal Competence. Tesis, Pendidikan Bahasa Inggris, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Utami Widiati, M.A., Ph.D (II) Fachrurrazy, M.A., Ph.D Kata kunci: persepsi, guru Bahasa Inggris, kompetensi kepribadian Sangatlah penting bagi para guru untuk mulai menyadari bahwa memiliki kompetensi kepribadian yang unggul sangat berperan pada kualitas belajar dan prestasi belajar peserta didik. Penelitian ini bertujuan untuk mendeskripsikan persepsi guru Bahasa Inggris terhadap kompetensi kepribadian mereka, persepsi peserta didik terhadap kompetensi kepribadian guru Bahasa Inggris, dan kesesuaian antara persepsi guru Bahasa Inggris dan peserta tersebut. Penelitian ini menggunakan rancangan penelitian survei dengan partisipan sampel 35 orang guru Bahasa Inggris and 246 peserta didik kelas XII dan XI dari SMA negeri di Malang. Instrumen penelitian ini adalah kuesioner dan panduan wawancara untuk guru Bahasa Inggris dan peserta didik. Instrumen tersebut telah diuji coba pada guru bahasa Inggris dan peserta didik kelas XII SMKN 12 Malang dan telah divalidasi oleh ahli dan secara statistik. Prosedur analisis data adalah: (a) memeriksa dan menyortir kuesioner, (b) mentabulasi data, (c) menyajikan jawaban dari masing-masing item berdasarkan jumlah dari jenis pilihan, (d) menginterpretasikan data kuantitatif, (e) mentranskrip hasil wawancara, dan (f) menginterpretasikan dan menggabungkan data kuantitatif dan kualitatif. Hasil analisis data menunjukkan (1) persepsi guru Bahasa Inggris sangat bagus (89,68%). Nilai-nilai yang paling menonjol adalah fleksible; peduli, memiliki empati, dan menolong; bertanggung jawab; hangat; bersikap baik; mendorong dan memotivasi; berpikiran terbuka; bekerja sama; tepat waktu; komunikatif dan interaktif; percaya diri dan bangga; menghormati; adil; aktif; dan memahami kemampuan individu peserta didik; (2) Persepsi peserta didik sangat bagus (77,30%). Nilai-nilai yang paling menonjol adalah percaya diri dan bangga, hangat, bersikap baik, menghormati, adil, memahami kemampuan individu peserta didik, ceria, rendah hati, dan memberi penjelasan yang jelas; (3) Sebagian besar dari nilai-nilai yang menonjol dari persepsi peserta didik termasuk dalam nilai-nilai yang menonjol dalam persepsi guru Bahasa Inggris. Nilai-nilai yang sama yang muncul dari persepsi guru Bahasa Inggris dan peserta didik adalah memiliki pengetahuan yang luas dan memahami kemampuan individu peserta didik. Persepsi guru Bahasa Inggris terhadap kompetensi kepribadiannya meliputi nilai-nilai yang berhubungan dengan kemampuan kognitif dan afektif. Namun, persepsi peserta didik terhadap kompetensi kepribadian lebih berkaitan dengan nilai-nilai afektif.

Comparing the women in madame bovary and the awakening / Miftahur Roifah

 

Kata Kunci: abad 19, karakter perempuan, potret perempuan, peranan perempuan Kondisi sosial wanita selalu berubah dari waktu ke waktu. Hal ini juga diikuti oleh berubahnya tugas dan peranan mereka di masyarakat. Sastra adalah salah satu sumber dimana tugas dan peranan wanita dari waktu ke waktu bisa dipelajari. Dengan kata lain, sastra berkontribusi pada pengetahuan wanita tentang kondisi dan perana wanita melalui representasi dari karakter perempuannya. Studi ini membandingkan dua novel yaitu Madame Bovary oleh Gustave Flaubert dan The Awakening oleh kate Chopin. Tujuan dari studi perbandingan ini adalah untuk mengetahui lebih jauh potret kehidupan wanita pada abad 19 melaui penggambaran karakter perempuan dari dua novel tersebut. Studi ini menganalisa bagaimana penulisnya menggambarkan karakter perempuan utamanya yaitu Emma Bovary dan Edna Pontellier. Studi ini melihat bahwa gender penulis mempengaruhi penggambaran karakter perempuannya. Selanjutnya studi ini juga mengidentifikasi bagaimana pengaruh jaman Victoria kontemporer terhadap penggambaran karakter perempuan. Bagaimanapun juga, kedua novel tersebut tidak boleh di klaim sebagai penggambaran wanita secara umum pada kedua wilayah di atas. Tetapi kedua novel tersebut bisa dijadikan rujukan tentang bagaimana menjadi seorang wanita pada abad 19 di Perancis dan Amerika.

Rancang bangun knalpot dilengkapi catalytic converter bahan dasar tembaga untuk konsentrasi polutan CO dan HC engine 4 langkah satu silinder / Agung Tri Saputro, Ahmad Yazid Quswaini

 

Penerapan model pembelajaran think pair share (TPS) pada materi ekosistem dan pencemaran lingkungan untuk meningkatkan aktivitas kooperatif dan hasil belajar siswa kelas X-C SMAN 1 Ngantang / Nury Aji Saktianny

 

Kata kunci: Think Pair Share, Aktivitas Kooperatif, Hasil belajar Observasi awal dan wawancara dengan pihak SMAN 1 Ngantang, Malang yang dilakukan pada tanggal 5 Mei 2010 menunjukkan bahwa pembelajaran yang sering dilakukan adalah ceramah. Saat pembelajaran berlangsung, siswa masih kurang aktif menjawab dan belum berani mengungkapkan pendapat tentang materi. Rerata hasil belajar siswa yaitu 62,81 sedangkan kriteria ketuntasan belajar sebesar 53,12%. Hal ini menunjukkan bahwa hasil belajar siswa masih rendah dan belum mencapai Kriteria Ketuntasan Minimal (85%). Dengan adanya permasalahan tersebut, maka dilakukan penelitian tindakan kelas (PTK) dengan melakukan penerapan model pembelajaran Think Pair Share. Penelitian ini bertujuan untuk meningkatkan aktivitas kooperatif dan hasil belajar siswa. Penelitian Tindakan Kelas (PTK) ini terdiri dari dua siklus. Kedua siklus dilakukan selama dua kali pertemuan. Siklus I dilakukan pada tanggal 12 Mei dan 19 Mei 2010, sedangkan siklus II dilakukan pada tanggal 26 Mei dan 2 Juni 2010. Setiap pertemuan dalam pembelajaran terdiri dari empat tahap yaitu tahap perencanaan, pelaksanaan, observasi dan refleksi. Materi yang digunakan dalam penelitian ini adalah Ekosistem dan Pencemaran Lingkungan. Model pembelajaran TPS terdiri dari tiga langkah yaitu langkah thinking (berpikir), pairing (berpasangan), dan sharing (berbagi). Model TPS memberikan waktu kepada para siswa untuk berpikir dan merespons serta saling bantu satu sama lain. Hasil penelitian menunjukkan bahwa aktivitas kooperatif siswa mengalami peningkatan. Aktivitas kooperatif yang dilakukan siswa pada siklus I, tingkatan cukup (C) mendominasi sebesar 54,98%, tingkatan baik (B) mencapai 31,86% dan tingkatan kurang (K) sebesar 13,12%. Pada siklus II tingkatan baik sudah mendominasi aktivitas kooperatif yaitu sebesar 70% Tingkat cukup dan kurang sudah mengalami penurunan yaitu masing-masing mencapai 26,25% dan 3,75%. Hasil belajar siswa juga mengalami peningkatan dari sebelum tindakan ke siklus I dan siklus II. Rerata hasil belajar siswa sebelum tindakan yaitu 62,81, rerata hasil belajar pada siklus I yaitu 71,31, dan pada siklus II yaitu 83,59. Sebelum tindakan persentase ketuntasan 53,12%, pada siklus I persentase ketuntasan 68,75%, sedangkan pada siklus II persentase ketuntasan 87,50%. Dari hasil penelitian, dapat disimpulkan bahwa penerapan metode pembelajaran TPS dapat meningkatkan aktivitas kooperatif dan hasil belajar Siswa kelas X-C SMAN 1 Ngantang. Berdasarkan hasil penelitian ini, dapat disarankan agar diterapkan model pembelajaran TPS sebagai pembelajaran alternatif untuk meningkatkan aktivitas kooperatif dan hasil belajar siswa.

Pengembangan bahan ajar fisika berbasis SAVI (Somatic, Auditory, Visual, Intellectual) pada pokok bahasan optika geometri untuk SMA kelas X semester II / Eki Luthfintri

 

Kata kunci: bahan ajar fisika, SAVI, optika geometri Dalam suatu proses pembelajaran diperlukan bahan ajar untuk membantu jalannya proses pembelajaran tersebut. Bahan ajar yang digunakan haruslah memenuhi kriteria bahan ajar yang baik sehingga siswa mudah memahami materi. Berdasarkan hasil survei yang dilakukan pada guru dan siswa ditemukan bahwa siswa kurang aktif dalam pembelajaran. Hal ini ditunjukkan dengan belum adanya inisiatif siswa untuk membaca maupun mengerjakan soal latihan yang ada pada bahan ajar fisika. Salah satu cara yang ditempuh yaitu dengan mengembangkan bahan ajar fisika berbasis SAVI (Somatic, Auditory, Visual, Intellectual) yang diharapkan mampu meningkatkan kemampuan siswa untuk aktif bergerak, berbicara, mengamati, menemukan konsep, dan memecahkan masalah dalam pembelajaran fisika. Tujuan dari penelitian ini adalah untuk mengembangkan, mengetahui karakteristik, serta mengetahui kelayakan bahan ajar fisika berbasis SAVI (Somatic, Auditory, Visual, Intellectual) pada pokok bahasan optika geometri untuk SMA Kelas X semester 2. Penelitian ini merupakan penelitian pengembangan yang menggunakan lima langkah awal metode Borg dan Gall, yaitu penelitian dan pengumpulan data, perencanaan, pengembangan draf produk, uji coba, dan revisi hasil uji coba. Kelayakan diukur dengan menggunakan uji validitas oleh tim ahli materi (dua dosen fisika dan satu guru fisika SMA Negeri 4 Malang), serta pengguna bahan ajar (sepuluh siswa SMA Negeri 4 Malang). Hasil penelitian menunjukkan bahwa bahan ajar fisika berbasis SAVI pada pokok bahasan optika geometri memperoleh nilai rata-rata 3,44 dari penilaian tim ahli yang berarti layak. Dari siswa, diperoleh nilai rata-rata 3.40 yang berarti layak. Hal ini berarti bahan ajar yang disusun sudah layak untuk digunakan. Berdasarkan hasil penelitian ini disarankan untuk melakukan penelitian pengembangan lebih lanjut terhadap bahan ajar fisika tersebut dengan melakukan uji coba lebih luas, sehingga diperoleh bahan ajar fisika berbasis SAVI pada pokok bahasan optika geometri yang teruji validitasnya secara empiris.

Citra wanita Indonesia dalam sinetron produksi PT Multivision plus / oleh Mislinatul Sakdiyah

 

Identifikasi kesulitan siswa kelas XI Kompetensi Keahlian Kimia Industri di SMK Gula Rajawali Madiun pada materi termokimia / Fara Nisa

 

ABSTRAK Nisa, Fara. 2016. Identifikasi Kesulitan Siswa Kelas XI Kompetensi Keahlian Kimia Industri di SMK Gula Rajawali Madiunpada Materi Termokimia.Skripsi,Program Studi Pendidikan Kimia, FMIPA, Universitas Negeri Malang. Pembimbing: (1) Dr. Siti Marfu’ah, M.S.,(2) Drs. Parlan, M.Si. Kata kunci:kesulitan belajar, termokimia, konseptual, algoritmik. Ilmu kimia merupakan ilmu yang diperoleh dan dikembangkan berdasarkan eksperimen yang mencari jawaban atas pertanyaan apa, mengapa, dan bagaimana gejala-gejala alam; khususnya yang berkaitan dengan komposisi, struktur, sifat, transformasi, dinamika dan energetika zat. Energi yang terlibat dalam proses fisika dan kimia dipelajari dalam termokimia. Termokimia merupakan salah satu konsep penting dalam kimia yang berkaitan dengan pengukuran dan perubahan kalor yang menyertai reaksi kimia, perubahan fase, dan pembentukan larutan. Siswa harus memiliki pemahaman konseptual dan pemahaman algoritmik yang utuh untuk menguasai materi termokimia. Penelitian ini bertujuan untuk mengetahui letak kesulitan siswa kelas XI Kimia Industri SMK Gula Rajawali Madiun pada materi termokimia. Desain penelitian ini adalah penelitian deskriptif dengan pendekatan kualitatif. Subjek penelitian adalah siswa kelas XI Kimia Indistri SMK Gula Rajawali Madiun yang terdiri dari 30 siswa. Subjek adalah siswa yang diduga mengalami kesulitan dan memiliki rata-rata nilai UH termokimia rendah. Penjaringan data menggunakan instrumen tes diagnostik dan wawancara. Tes diagnostik berupa soal pilihan ganda beralasan. Hasil penelitian menunjukkan bahwa: (1) kesulitan-kesulitan yang dialami siswa adalah pada konsep (a) reaksi eksoterm dan endoterm adalah menentukan reaksi eksoterm dan endoterm, arah aliran kalor serta prediksi harga ΔH; (b) perubahan entalpi adalah menjelaskan perubahan entalpi pembentukan dan menjelaskan perubahan entalpi pembentukan; (c) data entalpi pembentukan standar adalah menjelaskan persamaan termokimia perubahan entalpi pembentukan standar. (2) Perhitungan algoritmik yang sulit bagi siswa adalah pada perhitungan (a) data perubahan entalpi pembentukan standar adalah menentukan rumus perubahan entalpi berdasarkan ΔH°f; (b) data energi ikatan adalah menentukan rumus perubahan entalpi berdasarkan data energi ikatan dan menuliskan rantai ikatan suatu senyawa; (c) kalorimeter sederhana adalah mengkonversi joule menjadi kilojoule, kilogram menjadi gram, dan °C menjadi Kelvin; menentukan rumus perubahan entalpi berdasarkan kalorimeter sederhana; dan menerapkan operasi matematis; (d) hukum Hess adalah menentukan rumus perubahan entalpi berdasarkan hukum Hess dan menentukan tahap-tahap operasi persamaan reaksi dan ΔH°r nya.

Pengaruh penggunaan media pembelajaran audiovisual bahasa Inggris terhadap prestasi belajar bahasa Inggris siswa TK Islam Bani Hasyim Singosari Malang / Dianita Permata Sari

 

Kata Kunci: media pembelajaran audiovisual, prestasi belajar bahasa Inggris, Taman kanak-kanak. Media pembelajaran merupakan faktor penunjang penting dalam proses bela- jar mengajar. Seiring dengan perkembangan teknologi yang pesat, banyak ber-munculan media pembelajaran diantaranya media pembelajaran audiovisual. Me-lalui media pembelajaran audiovisual, siswa dapat memahami materi pembelajar-an dengan lebih mudah, menarik dan dapat membuat siswa merasakan kejadian nyata melalui simulasi, sehingga siswa mampu mendapatkan bekal dasar pengeta-huan, keterampilan dan sikap yang sesuai dengan harapan. Berdasarkan hasil pe-nelitian tersebut, penelitian ini bertujuan (1) untuk mendeskripsikan prestasi bel-ajar bahasa Inggris siswa yang belajar menggunakan media audiovisual, (2) un-tuk mendeskripsikan prestasi belajar bahasa Inggis siswa yang belajar tanpa menggunakan media audiovisual, (3) untuk mengungkap pengaruh penggunaan media audiovisual bahasa Inggris terhadap prestasi belajar bahasa Inggris. Desain yang digunakan adalah static group design yang disebut juga non-equivalent post-test only design. Populasinya adalah siswa Taman kanak-kanak Islam Bani Hasyim Singosari Malang. Sampel yang diambil berjumlah 43 siswa yaitu 22 siswa dari kelas B2 sebagai kelas kontrol dan 21 siswa dari kelas B1 se-bagai kelas eksperimen. Variabel yang digunakan adalah media pembelajaran au-diovisual dan prestasi belajar bahasa Inggris siswa. Eksperimen dilakukan di ru-ang laboratorium audiovisual untuk kelompok eksperimen, sedangkan untuk ke-lompok kontrol dilakukan di dalam kelas. Jenis data yang digunakan adalah data primer yaitu data mengenai prestasi belajar bahasa Inggris yang diperoleh melalui tes prestasi belajar dan data sekunder yang berupa data siswa. Instrumen yang di- gunakan adalah tes prestasi belajar bahasa Inggris berupa kumpulan pertanyaan yang diajukan pada siswa secara lisan dan siswa memberikan jawaban secara li-san. Analisis hasil penelitian menggunakan uji beda independent sample t-test. Hasil penelitian ini menunjukkan ada pengaruh penggunaan media audiovisu-al terhadap prestasi belajar bahasa Inggris, terbukti dengan adanya perbedaan skor prestasi belajar bahasa Inggris yang signifikan antara kelompok kontrol dengan kelompok eksperimen, t = 2,062, Sig. 0,046<0,05. Berdasarkan hasil penelitian di atas, maka dapat disimpulkan bahwa media pembelajaran audiovisual berpengaruh terhadap prestasi belajar bahasa Inggris yang dimiliki siswa Taman kanak-kanak, sehingga media pembelajaran audiovi-sual ini dapat dijadikan pertimbangan untuk guru Taman kanak-kanak Islam Bani Hasyim Singosari Malang sebagai salah satu alternatif metode pembelajaran yang dapat memberikan hasil lebih efektif dan efisien terhadap prestasi belajar siswa. Penelitian selanjutnya disarankan untuk memberikan perlakuan pre test terlebih dahulu.

Pengaruh service quality terhadap loyalitas pelanggan (studi pada Bank Muamalat Indonesia Cabang Malang) / Rani Fahmi

 

Kata kunci: Service quality, Loyalitas pelanggan Pertumbuhan ekonomi suatu negara dapat ditandai dengan pertumbuhan industri perbankan yang ada dalam negara tersebut. Perkembangan bank-bank syariah di Indonesia mengalami kendala karena Bank Syariah hadir di tengah-tengah perkembangan dan praktik-praktik perbankan konvensional yang sudah mengakar dalam kehidupan masyarakat secara luas. Oleh karena itu, bank Syariah harus memberikan pelayanan prima (service excellent) dengan cara meningkatkan service quality. Hal ini dilakukan agar pelanggan menjadi loyal dengan produk yang ditawarkan. Rumusan masalah dalam penelitian ini adalah: (1) bagaimana keadaan service quality (reliability, responsiveness, assurance, empathy, tangibles, dan compliance) dan loyalitas pelanggan pada Bank Muamalat Indonesia Cabang Malang?, (2) apakah service quality (reliability, responsiveness, assurance, empathy, tangibles, dan compliance) berpengaruh secara parsial terhadap loyalitas pelanggan pada Bank Muamalat Indonesia Cabang Malang?, (3) apakah service quality (reliability, responsiveness, assurance, empathy, tangibles, dan compliance) berpengaruh secara simultan terhadap loyalitas pelanggan pada Bank Muamalat Indonesia Cabang Malang?, (4) variabel service quality (reliability, responsiveness, assurance, empathy, tangibles, dan compliance) manakah yang dominan mempengaruhi loyalitas pelanggan pada Bank Muamalat Indonesia Cabang Malang?. Populasi dalam penelitian ini adalah pelanggan nasabah Tabungan Muamalat yang tercatat sebanyak 159.729 sampai bulan Desember 2010, penentuan sampel menggunakan rumus Slovin, sehingga diperoleh sampel sebanyak 100 orang. Tekhnik sampling dalam penelitian ini menggunakan (accidental sampling) untuk menyebarkan kuesioner kepada responden. Kuesioner dalam penelitian ini termasuk dalam kuesioner tertutup yang menggunakan skala Likert dengan 5 pilihan jawaban. Penelitian ini menggunakan uji validitas dan uji reliabilitas. Analisis data yang menggunakan regresi linear berganda dengan uji asumsi klasik. Hasil penelitian ini adalah: (1) bahwa keadaan service quality terhadap loyalitas pelanggan Bank Muamalat Indonesia Cabang Malang cukup tinggi, (2) dengan nilai thitung sebesar 2,911 dan sig t 0,005, maka ada pengaruh positif yang signifikan service quality variabel reliability secara parsial terhadap loyalitas pelanggan Bank Muamalat Indonesia Cabang Malang diterima; dengan nilai thitung sebesar 2,395 dan sig t 0,019, maka ada pengaruh positif yang signifikan service quality variabel responsiveness secara parsial terhadap loyalitas pelanggan Bank Muamalat Indonesia Cabang Malang diterima; dengan nilai thitung sebesar 3,830 dan sig t 0,000, maka ada pengaruh positif yang signifikan service quality variabel assurance secara parsial terhadap loyalitas pelanggan Bank Muamalat Indonesia Malang diterima; dengan nilai thitung sebesar 2,242 dan sig t 0,027, maka ada pengaruh positif yang signifikan service quality variabel empathy secara parsial terhadap loyalitas pelanggan Bank Muamalat Indonesia Cabang Malang diterima; dengan nilai thitung sebesar 3,244 dan sig t 0,002, maka ada pengaruh positif yang signifikan service quality variabel tangibles secara parsial terhadap loyalitas pelanggan Bank Muamalat Indonesia Cabang Malang diterima; dengan nilai thitung sebesar 4,766 dan sig t 0,000, maka ada pengaruh positif yang signifikan service quality variabel compliance secara parsial terhadap loyalitas pelanggan Bank Muamalat Indonesia Malang diterima, (3) dengan nilai Fhitung = 34,574 > Ftabel = 2,19 dengan taraf signifikansi 0,000, dengan melihat taraf signifikansi yang lebih kecil dari 0,05, maka ada pengaruh positif yang signifikan antara reliability, responsiveness, assurance, empathy, tangibles dan compliance secara simultan terhadap loyalitas pelanggan Bank Muamalat Indonesia Cabang Malang diterima, (4) variabel yang dominan mempengaruhi loyalitas pelanggan pada Bank Muamalat Indonesia Cabang Malang adalah compliance yang menunjukkan nilai SE sebesar 23,7%. Berdasarkan penelitian ini dapat disimpulkan bahwa: (1) keadaan service quality (reliability, responsiveness, assurance, empathy, tangibles dan compliance) Bank Muamalat Indonesia Cabang Malang cukup tinggi, (2) ada pengaruh positif yang signifikan antara service quality yang terdiri dari reliability, responsiveness, assurance, empathy, tangibles dan compliance secara parsial terhadap loyalitas pelanggan di Bank Muamalat Indonesia Cabang Malang, (3) ada pengaruh positif yang signifikan antara service quality yang terdiri dari reliability, responsiveness, assurance, empathy, tangibles dan compliance secara simultan terhadap loyalitas pelanggan di Bank Muamalat Indonesia Cabang Malang, (4) variabel service quality yang dominan berpengaruh terhadap loyalitas pelanggan di Bank Muamalat Indonesia Cabang Malang adalah variabel compliance (kesesuaian dengan prinsip Syariah). Saran dalam penelitian ini adalah: (1) pihak Bank Muamalat Indonesia Cabang Malang lebih meningkatkan responsiveness kepada pelanggan, dari segi assurance karyawan harus bersikap profesional dalam memberikan pelayanan kepada pelanggan, segi tangibles Bank Muamalat Indonesia Cabang Malang bisa lebih meningkatkan kenyamanan bagi pelanggan, diharapkan kepercayaan pelanggan terhadap compliance selalu dipertahankan dan menjadi perhatian khusus dengan meningkatkan kualitas dari compliance; (2) Peneliti selanjutnya, perlu pengujian lebih mendalam mengenai service quality pada perbankan syariah, terutama untuk menemukan peranan dimensi syariah dalam menciptakan loyalitas pelanggan.

Pengaruh cara belajar dan tingkat stres terhadap hasil belajar siswa pada mata pelajaran ekonomi di SMA Negeri 1 Malang / Andi Setiawan

 

Kata kunci: Cara Belajar, Tingkat Stres, Hasil Belajar Ekonomi. Cara belajar merupakan strategi yang dilakukan siswa untuk memperoleh hasil belajar yang lebih baik. Cara belajar dibagi menjadi cara belajar di rumah dan cara belajar di sekolah. Tingkat stres merupakan tekanan pada aspek emosi, fisik, intelektual dan interpersonal siswa sebagai akibat dari adanya stressor yang diperoleh individu. Masalah dalam penelitian ini adalah: (1) Bagaimana pengaruh antara cara belajar terhadap hasil belajar siswa pada mata pelajaran ekonomi di SMA Negeri 1 Malang? (2) Bagaimana pengaruh antara tingkat stres terhadap hasil belajar siswa pada mata pelajaran ekonomi di SMA Negeri 1 Malang? (3) Bagaimana pengaruh antara cara belajar dan tingkat stres terhadap hasil belajar siswa pada mata pelajaran ekonomi di SMA Negeri 1 Malang?. Rancangan penelitian yang digunakan adalah rancangan deskriptif korelasional. Populasi pada penelitian ini adalah seluruh siswa kelas X SMAN 1 Malang. Teknik pengambilan sampel dengan “Proportional Random Sampling” Instrumen yang digunakan adalah angket dan dokumentasi. Analisis deskriptif korelasionalnya menggunakan analisis regresi linier berganda untuk mengetahui pengaruh variabel cara belajar (X1) dan tingkat stres (X2) terhadap hasil belajar (Y). Hasil penelitian menunjukkan terdapat pengaruh positif antara cara belajar terhadap hasil belajar dengan tingkat signifikansi t (0,000) lebih kecil dari α (0,05) dan sumbangan efektif 6,62%, terdapat pengaruh negatif antara tingkat stres terhadap hasil belajar dengan tigkat signifikansi t (0,000) lebih kecil dari α (0,05) dan sumbangan efektif 57,22%. Secara simultan terdapat pengaruh cara belajar dan tingkat stres terhadap hasil belajar dengan Fhitung = 145.934 dan taraf signifikansi sebesar 0,000, angka Adjusted R Square = 0,634. Berdasarkan hasil penelitian ini, saran (1) bagi siswa dapat mengatur waktu dan cara belajarnya lebih efektif dan aktif dalam mengikuti pelajaran dan berusaha mengatasi stres yang dialami dalam belajar seperti memanfaatkan waktu luang sebaik-baiknya, belajar atau mempersiapkan pelajaran sebelum dimulai dan rajin berolah raga, (2) bagi sekolah perlu memberikan bimbingan kepada siswa dalam hal cara belajar dan mengolah stres agar siswa lebih baik dalam mengatasi masalah yang dapat menimbulkan stres dalam belajar, (3) bagi peneliti lain diharapkan untuk lebih dalam dan spesifik dalam meneliti masalah tingkat stres siswa dengan metode yang lebih baik.

Penerapan maksim tutur dan prinsip sopan santun dalam komunikasi terapeuktik di RSUD dr. R. Soedarsono Pasuruan / oleh Imron Rosidi

 

Penerapan model pembelajaran kooperatif tipe Student Team Achievement Division (STAD) untuk meningkatkan kedisiplinan dan hasil belajar siswa pada matapelajaran basis data kelas X RPL SMK Islam Batu / Roshina Hila Dini

 

Dini, Roshina Hila. 2015. Penerapan Model Pembelajaran Student Team Achievement Division (STAD) Untuk Meningkatkan Kedisiplinan dan Hasil Belajar Pada Matapelajaran Basis Data Kelas X RPL SMK Islam Batu. Skripsi. Jurusan Teknik Elektro, Fakultas Teknik, Universitas Negeri Malang. Pembimbing (I) Drs. Dwi Prihanto, S.S.T, M.Pd. (II) Triyanna Widiyaningtyas, S.T., M.T. Kata Kunci : Student Team Achievement Division (STAD), Kedisiplinan, dan Hasil Belajar Berdasarkan hasil Kajian Praktik Lapangan (KPL) di SMK Islam Batu diketahui bahwa, siswa kelas X RPL cenderung kurang disiplin sehingga kemampuan kognitifnya rendah. Tingkat kedisiplinannya dilihat dari ketepatan waktu masuk kelas, kehadiran di kelas, kedisiplinan mengikuti kegiatan pembelajaran di kelas, kedisiplinan berseragam dan ketepatan waktu mengumpulkan tugas. Untuk itu perlu adanya inovasi dalam sistem pembelajaran yang diterapkan. Model pembelajaran yang akan digunakan adalah Student Team Achievement Division (STAD) untuk meningkatkan kedisiplinan dan hasil belajar siswa dengan cara memberikan stimulus kepada siswa dengan memberikan reward kepada kelompok siswa yang disiplin. Sehingga antar anggota kelompok dapat saling memotivasi untuk disiplin. Penelitian ini merupakan penelitian tindakan kelas (classroom action research), Model penelitian ini terdiri dari beberapa langkah, yaitu : (1) perencanaan, (2) pelaksanaan tindakan, (3) pengamatan (observasi) dan (4) refleksi yang selanjutnya diikuti oleh siklus spiral berikutnya. Pengumpulan data dilakukan dengan teknik wawancara, tes tertulis dan observasi. Subyek penelitian ini adalah seluruh siswa kelas X jurusan RPL tahun ajaran 2015/2016. Dalam penelitian ini data yang diperoleh berupa data kedisiplinan dan hasil belajar siswa. Hasil penelitian menunjukkan bahwa penerapan model kooperatif tipe STAD dapat meningkatkan kedisiplinan dan hasil belajar siswa. Persentase keseluruhan kedisiplinan siklus I sejumlah 80,8 % pada siklus II mengalami peningkatan menjadi 92,6 %. Untuk hasil belajar ranah afektif dari siklus I 80,8 menjadi 92,6 pada siklus II. Untuk ranah kognitif dari siklus I yaitu 72,4 % menjadi 88,8 % pada siklus II. Sedangkan ranah psikomotorik siklus I yaitu 75,3 % menjadi 90,2 % pada siklus II. Berdasarkan paparan hasil penelitian dapat disimpulkan bahwa penerapan model pembelajaran kooperatif tipe Student Team Achievement Division (STAD) dapat meningkatkan kedisiplinan dan hasil belajar siswa pada matapelajaran Basis Data kelas X SMK Islam Batu.

Faktor-faktor yang mempengaruhi pendapatan pedagang kaki lima di kawasan Objek Wana Wisata Padusan Kecamatan Pacet Kabupaten Mojokerto / Nila Wardani

 

ABSTRAK Wardani, Nila. 2016. Faktor-Faktor Yang Mempengaruhi Pendapatan Pedagang Kaki Lima di kawasan Wana Wisata Padusan Kecamatan Pacet Kabupaten Mojokerto. Skripsi, Jurusan Pendidikan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. Singgih Susilo, M.S, M.Si, (II) Drs. Marhadi Susilo K, M.Si. Kata Kunci: Pedagang, pendapatan, jam kerja, lama kerja, modal, tenaga kerja Pedagang kaki lima Minimnya kesempatan kerja di sektor formal mengakibatkan banyak angkatan kerja yang beralih pada pekerjaan di sektor informal. Terutama pada objek wisata yang banyak menyerap tenaga kerja khususnya sebagai pedagang kaki lima yang cukup membantu perputaran ekonomi warga. Pacet merupakan salah satu kecamatan yang berada di kabupaten Mojokerto yang terkenal dengan wana wisata Padusan yang memiliki banyak pengaruh terhadap masyarakat sekitar. Daya tarik wana wisata Padusan membuat warga sekitar tertarik menjadi pedagang kaki lima. Penelitian ini bertujuan untuk mengetahui pendapatan yang diperoleh pedagang kaki lima di kawasan wana wisata Padusan serta faktor-faktor yang diduga dapat mempengaruhi pendapatan yang diperoleh. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif dengan menggunakan pendekatan survey. Pengambilan sampel menggunakan teknik proportional random sampling yaitu dari populasi sebesar 187 pedagang kaki lima diambil sampel sebesar 65. Untuk kategori pedagang buah dan sayur sebesar 6 sampel, pedagang makanan dan minuman 43 sampel dan pedagang oleh-oleh 16 sampel. Teknik pengambilan data menggunakan observasi, wawancara dan dokumentasi. Analisis data yang digunakan dalam penelitian ini adalah analisis tabulasi tunggal, tabulasi silang dan regresi linier berganda. Berdasarkan hasil analisis data yang telah dilakukan menunjukkan: 1) pendapatan pedagang kaki lima wana wisata Padusan rata-rata per hari adalah Rp.1.450.000,-. Berdasarkan uji statistik diketahui bahwa variabel yang memiliki hubungan dengan tingkat pendapatan pedagang adalah jam kerja dan modal; 3) Faktor dominan yang mempengaruhi pendapatan pedagang kaki lima adalah modal.  

Pengembangan model latihan pertahanan passing bawah bolavoli dalam menerima service pada klub putri Buah Segar Kabupaten Banyuwangi / Wanda Puspita Anggraini

 

ABSTRAK Anggraini, Wanda Puspita. 2016. Pengembangan Model LatihanPertahananPassingBawahBolavolidalamMenerimaServicePadaKlubPutriBuah Segar KabupatenBanyuwangi. Skripsi, JurusanKepelatihanOlahraga, FakultasIlmuKeolahragaan, UniversitasNegeri Malang. Pembimbing: (1) Drs. SetyoBudiwanto, M.Kes, (2) Dra. Sulistyorini, M.Pd. Kata kunci: bolavoli, penelitiandanpengembangan, taktikpertahanan. Taktikbertahandalampermainanbolavoliberfungsi agar pertahanan yang baik, rapidankuat, diharapkantimakandapatmenyerangkembalitimpenyerang. Salah satuupayapertahanandalammelakukanpermainanbolavoliadalahdenganmelakukanpassingbawahpadasaatmenerimaservice. Bertahandenganmenerimaserviceadalahlangkahawalsebuahpertahananuntukmelakukanserangankembalikepadatimlawan. Berdasarkanhasilobservasidanwawancara yang dilakukanolehpenelitipadaklubputriBuah Segar KabupatenBanyuwangi, taktikpertahanansudahdiberikan, tetapibelumada model-model latihankhususuntukmeningkatkanpertahananpassingbawahdalammenerimaservice. Hasildariwawancaradanobservasi yang telahdilakukan, makapenelitiinginmengembangkan model latihanpertahananpassingbawahdalammenerimaservice. Tujuandaripengembanganiniadalahuntukmengembangkan model latihanpertahananpassingbawahdalammenerimaservicepadaklubputriBuah Segar KabupatenBanyuwangi. Model pengembangandalampenelitiandanpengembanganinimenggunakanteoriResearch and Developmentdari Borg dan Gall yang dimodifikasidandisesuaikandengankeadaan di lapangan. Dari 10 langkahpengembangan yang dikemukakanoleh Borg dan Gall, penelitihanyamenggunakan 7 langkahdikarenakanketerbatasanwaktu, tenagadanbiaya. Metodepenelitiandanpengembanganinimenggunakan model konseptual yang telahmelaluibeberapatahap, yaitu (1) evaluasiprodukdari 1 ahlibolavoli, 1 ahlikepelatihanbolavoli, 1 ahli media, (2) ujicobakelompokkecilsebanyak 6 atlet yang dipilihsecara random danujicobakelompokbesarsebanyak 19 atlet. Hasildaripenelitianpengembangandari model-model latihanpertahananpassingbawahsebagaiberikut: dariahlibolavolimendapatkanpersentase 75%denganvalidasibaik, ahlikepelatihanbolavolimendapatkanpersentase 81% denganvaliditassangatbaik, ahli media memperolehpersentase 80% denganvaliditassangatbaik, dariujicobakelompokkecilmemperolehpersentase 88% denganvalidasisangatbaikdanujicobakelompokbesarmemperolehpersentase 89% denganvalidasisangatbaik. Kesimpulandaripenelitiandanpengembanganproduk model latihanpertahananpassingbawahdalammenerimaserviceiniadalahterdapat lima belas model latihandenganvaliditassangatbaik yang dikemasdalambentukbukupanduan. Produkbukupanduaninilebihpraktisdigunakanolehpelatihdanatlet, karenabisadibawakemanasaja.

Kontribusi implimentasi competency by based training, kondisi sarana-prasarana dan motivasi belajar terhadap kompetensi peserta diklat UPT PK Singosari / Akbar Joko Ainul Yaqin

 

ABSTRAK Yaqin, Akbar J.A. 2016. Kontribusi Competency Based Training, Kondisi Sarana-Prasarana dan Motivasi Belajar terhadap Kompetensi Peserta Diklat UPT PK Singosari. Tesis. Jurusan Pendidikan Kejuruan, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. H. A. Sonhadji K.H., M.A., Ph.D, (II) Dr. Tuwoso, MP. Kata kunci:CBT, sarana-prasarana, motivasi, kompetensi, pendidikan danpelatihan. Saat ini dunia pendidikan sebagai penghasil tenaga terampil, masih belum diserap sepenuhnya oleh dunia industri. Hal ini disebabkan kurangnya keterkaitan maupun kesesuaian kompetensi yang dimiliki dengan kebutuhan dunia industri.Pemberdayaan Balai Latihan Kerja (BLK)atau sekarang lebih dikenal dengan Unit Pelatihan Teknis Pelatihan Kerja (UPT-PK) merupakan salah satu solusi untuk meningkatkan kualitas tenaga kerja di Indonesia.Dalam meningkatkan kualitas tenaga kerja di Indonesia melalui pelaksanaan pemberdayaan UPT-PK, masih terdapat kekurangan dan permasalahan yang terjadi. Permasalahan yang dihadapi saat ini pada umumnya terkait dengan pelaksanaankegiatan pembelajaran dan pelatihan yang kurang maksimal, yakni keterbatasan sarana prasarana, serta lingkungan belajar yang tidak serupa dengan dunia kerja. Kondisi ini bisa menyebabkan ketidaksiapan lulusan dalam memasuki dunia kerja.Tujuan yang ingindicapai dalam penelitian ini adalah untuk mengetahui kontribusi Implementasi CBT dan kondisi sarana prasarana secara signifikan terhadap motivasi belajar, dan untuk mengetahui kontribusi implementasi CBT, sarana prasarana, dan motivasi belajar secara signifikan terhadap kompetensi peserta diklat. Metode penelitian yang digunakan dalam penelitian ini adalah metode pendekatan kuantitatif denganpath analysis model dekomposisi. Teknik pengumpulan data menggunakan lembar observasi, angket, dan tes. Populasi dalam penelitian ini sebanyak 72 peserta diklat dan sampel penelitian diambil secara keseluruhan. Teknik analisis data yang digunakan yaitu analisis korelasi dan analisis regresi dengan taraf signifikasi 0,05. Hasil analisis menunjukkan bahwaimplementasi CBT dan kondisi sarana prasarana berkontribusi secara simultan terhadap motivasi belajar sebesar 42,9%.Kontribusi implementasi CBT terhadap motivasi belajar secara langsung sebesar 17,47%dan secara tidak langsung sebesar 7,7%. Kontribusi kondisi sarana prasarana terhadap motivasi belajar secara langsungsebesar 10,56% dan secara tidak langsung sebesar 7,7%.Selain itu, hasil analisis juga menunjukkan bahwa implementasi CBT, kondisi sarana prasarana, dan motivasi belajar berkontribusi secara simultan terhadap kompetensi peserta diklat sebesar 59,1%, implementasi CBT berkontribusi secara langsung terhadap kompetensi peserta diklat sebesar 6,7% dan berkontribusi secara tidak langsung melalui motivasi belajar sebesar 9,4%. Kondisi sarana prasarana berkontribusi secara langsung terhadap kompetensi peserta diklat sebesar 17,3% dan berkontribusi secara tidak langsung melalui motivasi belajar sebesar 7,2%. Motivasi belajar berkontribusi secara langsung terhadap kompetensi peserta diklat sebesar 5,11%. Saran dari hasil penelitian yakni agar di UPT PK Singosari dapat meningkatkan pelaksanaan CBT secara lebik baik lagi sehingga dapat mengingkatkan motivasi dan kompetensi peserta diklat di UPT PK Singosariserta lebih mempertimbangkan tentang kelengkapan sarana dan prasarana yang menunjang proses pelatihan.

Perilaku seks pranikah remaja (studi fenomenologi) / Shinda Putri Eka Mamandani

 

ABSTRAK Mamandani, Shinda Putri Eka. 2016. Perilaku Seks Pranikah Remaja. Skripsi. Jurusan Bimbingan dan Konseling, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Blasius Boli Lasan, M.Pd. (II) Dra. Ella Faridati Zen, M.Pd. Kata Kunci: Perilaku Seks Pranikah, Remaja Masa remaja adalah masa peralihan seorang individu dari masa anak-anak menuju dewasa. Tugas perkembangan pada masa remaja salah satunya adalah memilih pasangan hidup dan memulai hidup berkeluarga. Remaja akan menjalin relasi dengan lawan jenis dengan cara berpacaran untuk mencapai tugas perkembangannya. Usia remaja dianggap akan cenderung menunjukan tingkah laku seksual yang tidak bertanggungjawab seiring matangnya organ reproduksi yang mereka alami. Matangnya organ reproduksi yang terjadi pada remaja mendorong mereka untuk melakukan perilaku seks pranikah.Peneliti bertujuan untuk mengetahui deskripsi perilaku seks pranikah remaja, pemaknaan remaja terhadap perilaku seks pranikah dan alasan remaja melakukan perilaku seks pranikah. Peneliti menggunakan pendekatan kualitatif dengan jenis penelitian fenomenologi. Lokasi penelitian di Kelurahan Kedawung, Kecamatan Nglegok, Kabupaten Blitar. Subjek penelitian, subjek primer yaitu Melati, Kembang, Lily. Subjek sekunder yaitu, kakak kandung Melati, teman Kembang, tetangga Lily dan ibu Kembang. Teknik pengambilan sampel menggunakan teknik bola salju (snowball sampling).Analisis data lapangan menggunakan analisis model Miles and Huberman. Hasil temuan dapat disimpulkan bahwa: (1) Perilaku seks pranikah yang dilakukan remaja meliputi, melakukan ciuman bersama pasangannya, pelukan, petting, menyentuh organ intim pasangan, bersenggama sampai dengan penetrasi. (2) Perilaku seks pranikah dimakanai remaja sebagai perwujudtan rasa cinta pasangan terhadapnya. Remaja merasa pasangannya semakin mencintainya setelah mereka melakukan perilaku seks pranikah bersama. (3) Alasan remaja melakukan perilaku seks pranikah karena lemahnya kontrol orang tua yang diberikan kepada anak-anaknya.(4) Lemahnya kontrol masyarakat terhadap perilaku remaja yang melakukan perilaku seks pranikah, membuat mereka tidak merasa sungkanuntuk melakukan perilaku seks pranikah di rumah. Berdasarkan simpulan penelitian, maka dapat diajukan saran khususnya pada konselor agar meminimalisir perilaku seks pranikah dengan mengenalkan kegiatan lain kepada siswa seperti mengikuti kegiatan ekstra kulikuler yang ada di sekolah. Dengan mengikuti kegiatan ekstrakulikuler diharapkan siswa yang orang tuanya tidak berada di rumah, mereka akhirnya miliki kegiatan yang positif tidak berada di rumah setelah pulang sekolah.

Redesain pembelajaran ekonomi di SMK Negeri 1 Batu / Yosita Vemi Rismawati

 

ABSTRAK Rismawati, Yosita, Vemi. 2016. Rdesain Pembelajaran Ekonomi di SMK Negeri 1 Batu. Tesis. Jurusan Pendidikan Ekonomi, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. H. Sugeng Hadi Utomo. M.Ec., (2) Dr. Mit witjaksono, MS.Ed. Keywords: ekonomi, pendidikan, SMK, pembelajaran, adaptif Materi ekonomi sebagai salah satu bagian dari mata pelajaran IPS yang dilaksanakan di SMKN 1 Batu untuk Jurusan Jasa Boga selama ini dilaksanakan layaknya pelajaran ekonomi di SMA. Hal ini tidak sesuai dengan tujuan mata pelajaran adaptif sebagai pelajaran yang mendukung mata pelajaran produktif. Selain itu pelaksanaan pembelajaran materi ini selama 1 semester dan harus menuntaskan 10 Kompetensi Dasar dirasa cukup memberatkan mengingat setengah waktu dari semester ini dilaksanakan untuk kegiatan prakerin. Tujuan dari pengembangan ini adalah mendesain ulang pembelajaran pada materi ekonomi dalam mata pelajaran IPS yang selama ini tidak terlaksana dengan baik dalam rangka memudahkan guru untuk memberikan pembelajaran materi ekonomi secara tuntas dan memberikan kebermaknaan bagi siswa dalam setiap ektivitas pembelajaran. Penelitian pengembangan ini dilaksanakan dengan menggunakan pendekatan Design Based Research (DBR). Produk dari penelitian dan pengembangan berupa Desain pembelajaran untuk materi ekonomi yang meliputi: panduan pembelajaran untuk guru dan lembar kerja siswa. dalam panduan guru tercakup RPP, bahan ajar, tugas siswa serta instrumen penilaian. Hasil penelitian menunjukkan bahwa bahwa (1) Hasil uji validasi prototype dilakukan oleh praktisi dan siswa. Hasilnya diperoleh nilai diatas 85 dan berada pada kriteria nilai sangat baik dan tidak revisi. Halini membuktikan bahwa prototype hasil pengembangan ini layak digunakan dan diterapkan, (2) Hasil uji coba produk juga menunjukkan bahwa prototype desain pembelajaran materi ekonomi untuk SMK Jurusan Jasa Boga efektif dan dapat diterapkan oleh guru dan siswa dan (3) pemanfaatan desain pembelajaran ekonomi untuk SMK Jasa Boga sebagai panduan pembelajaran mampu meningkatkan hasil belajar siswa, baik pada nilai pengetahuan, sikap maupun keterampilan.

Hubungan antara motivasi berprestasi dan adversity quotient dengan prestasi akademik siswa SMAN 1 Malang / Heridha Yuninda

 

Kata Kunci: motivasi berprestasi, adversity quotient, prestasi akademik, siswa Adversity Quotient adalah suatu cara yang digunakan untuk mengetahui seberapa jauh seseorang mampu menghadapi kesulitan dan bagaimana kemampuan seseorang dalam mengatasinya. Motivasi berprestasi adalah usaha seseorang dalam menguasai tugasnya, mencapai kesuksesan, mengatasi rintangan, menjadi lebih baik dari orang lain, dan sesuatu yang dilakukan untuk mendapatkan penghargaan atas pekerjaannya. Prestasi akademik adalah hasil dari proses belajar secara formal di sekolah, berupa penguasaan pengetahuan atau keterampilan yang dikembangkan oleh mata pelajaran, lazimnya ditunjukkan dengan nilai tes atau angka nilai yang diberikan oleh guru dalam rapor. Penelitian ini bertujuan untuk mengetahui hubungan antara motivasi berprestasi dengan prestasi akademik, mengetahui hubungan antara Adversity Quotient dengan prestasi akademik siswa, mengetahui hubungan antara Adversity Quotient dengan motivasi berprestasi, dan mengetahui hubungan antara motivasi berprestasi dan Adversity Quotient dengan prestasi akademik pada siswa SMAN 1 Malang. Penelitian ini adalah penelitian deskriptif dan korelasional. Pengambilan sampel ditentukan dengan teknik stratified proportional random sampling. Ada tiga alat pengumpul data dalam penelitian ini yaitu skala motivasi berprestasi, skala Adversity Quotient, dan dokumentasi laporan hasil rapor siswa. Subyek penelitian adalah siswa SMAN 1 Malang berjumlah 321 anak. Sampel penelitian adalah siswa SMAN 1 Malang kelas XI berjumlah 79 anak. Berdasarkan hasil analisis deskriptif, dapat diketahui bahwa sebagian besar siswa kelas XI SMAN 1 Malang yaitu sebesar 49,3% memiliki motivasi berprestasi yang rendah, sebagian besar siswa kelas XI SMAN 1 Malang yaitu sebesar 36,7% memiliki Adversity Quotient rendah, dan sebagian besar siswa kelas XI SMAN 1 Malang yaitu sebanyak 46,8% siswa memiliki prestasi akademik yang sedang. Hasil analisis korelasi product moment menghasilkan koefisien korelasi antara motivasi berprestasi dengan prestasi akademik sebesar rx1y = 0, 352 dengan nilai p<0.05. Ini berarti dapat disimpulkan bahwa ada hubungan antara motivasi berprestasi dengan prestasi akademik. Hasil analisis korelasi product moment menghasilkan koefisien korelasi antara Adversity Quotient dengan prestasi akademik sebesar rx2y= 0.424 dengan nilai p< 0.05. Ini berarti ada hubungan antara Adversity Quotient dengan prestasi akademik. Hasil analisis korelasi product moment menghasilkan koefisien korelasi antara motivasi berprestasi dengan Adversity Quotient sebesar rx1x2= 0,780 dengan p< 0,05, artinya ada hubungan antara motivasi berprestasi dengan Adversity Quotient. Hasil analisis korelasi ganda menghasilkan koefisien korelasi antara motivasi berprestasi dan Adversity Quotient dengan prestasi akademik yaitu Rsquare= 0.181 dengan sig= 0,001 artinya R2 = 0,181, signifikan pada 0,001 sehingga Ha

Penerapan model pembelajaran kooperatif tipe STAD untuk meningkatkan aktivitas dan hasil belajar siswa pada tema 7 cita-citaku di kelas IV SDN Gadungan 04 Kecamatan Puncu Kabupaten Kediri / Kristin Dwi Oktavia

 

ABSTRAK Oktavia, Kristin Dwi. 2016 Penerapan Model Pembelajaran Kooperatif Tipe STAD untuk meningkatkan Aktivitas dan Hasil Belajar Siswa pada Tema 7 Cita-citaku di Kelas IV SDN Gadungan 04 Kecamatan Puncu Kabupaten Kediri. Skripsi. Program Studi S1 PGSD. Jurusan KSDP. Fakultas Ilmu Pendidikan. Universitas Negeri Malang. Pembimbing: (I) Drs. Toha Mashudi, S.Pd., M.Pd (2) Dra. Sri Sugiharti, M.Pd Kata kunci: model kooperatif tipe STAD, aktivitas, hasil belajar, tema cita-citaku. Berdasarkan hasil observasi di kelas IV SDN Gadungan 04 Kecamatan Puncu Kabupaten Kediri di temukan bahwa(1) Pembelajaran didominasi oleh guru, (2) Aktivitas siswa selama kegiatan pembelajaran masih kurang, dan (3) Hasil belajar siswa masih kurang terdapat beberapa siswa nilainya dibawah Standar Ketuntasan Minimal. Tujuan dari penelitian ini untuk meningkatkan aktivitas dan hasil belajar melalui penerapan model pembelajaran kooperatif tipe STAD. Penelitian ini menggunakan pendekatan deskriptif kualitatif jenis penelitian ini menggunakan penelitian tindakan kelas yang dilaksanakan dalam 2 siklus, tiap siklus terdiri dari 2 pertemuan. Penelitian ini dilakukan di SDN Gadungan 04 Kecamatan Puncu Kabupaten Kediri pada semester genap pada tahun ajaran 2015/2016 dengan subjek penelitian berjumlah 24 siswa dengan 13 siswa laki-laki dan 11 siswa perempuan. Pembelajaran dengan menerapkan model kooperatif tipe STAD terlaksana dengan baik. Hal ini terbukti dengan (1) Pembelajaran dengan menerapkan model pembelajaran kooperatif tipe STAD terlaksana dengan baik, (2) Aktivitas siswa selama kegiatan pembelajaran pada siklus I sebesar 63% meningkat menjadi 78,23% pada siklus II, (3) Hasil belajar siswa juga mengalami peningkatan, nilai rata-rata siswa pada pra tindakan 57,67 dengan persentase ketuntasan klasikal 20,84%, pada siklus I meningkat nilai rata-rata siswa menjadi 66,97 dengan persentase ketuntasan klasikal 47,9%, dan pada siklus II juga meningkat 78,85 dengan persentase ketuntasan klasikal 83,33%. Berdasarkan data tersebut dapat disimpulkan bahwa penerapan model pembelajaran kooperatif tipe STAD pada tema 7 Cita-citaku dapat meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Gadungan 04 Kecamatan Puncu Kabupaten Kediri. Peningkatan tersebut dapat dilihat pada aktivitas guru dalam pembelajaran dengan menerapkan model pembelajaran kooperatif tipe STAD, aktivitas siswa selama kegiatan pembelajaran, dan hasil belajar siswa. Disarankan dalam menerapkan model pembelajaran kooperatif tipe STAD, memperhatikan langkah-langkah pada STAD seperti penyampaian motivasi dan tujuan pembelajaran, pembagian kelompok, presentasi guru, kegiatan belajar dalam kelompok, pemberian kuis, dan penghargaan prestasi tim.

Keefektifan metode pengajaran berprograma untuk tingkat kemampuan awal siswa yang berbeda terhadap prestasi belajar biologi siswa kelas I SMUN I Talun Blitar / oleh Dwi Bekti Anggrainy

 

Caram engaktifkans iswa,d apatd itempuhd enganm enerapkabne rbagar utctorlrorr crrgu.siuurl,u lrs utuc lin nturnnynnd alahm ctodcp cngqiorabnc rprograma. Metodien idisajikadna larnb entukb ingkai-bingkaatia uu nir-unikt ecilyangb erisi konsep-konsyeapn gs alingb erkaitans, ehinggam emudahkagnu rud ans iswad alam kegiatanb elajarm engajarS. elainm etodep engajaranya ngh arusd iperhatikang uru, tingkatk emampuaanw als iswaj uga harusd iperhatikank, arenati ngkatk emampuan awala dalahla tarb elakangp engetahuadna lamb idangp engaiaranya nga kan dipelajarinyKaa. renaa danyap erbedaatnin gkatk emampuaanw alp adas iswai nilah muncupl ermasalahapna dap emilihanm etodep engajarano.l eh karenai tu penelitian inj dilakukanu ntukm engetahuki eefektifanm etodep engajarabne rprogramau ntuk tingkakt emampuaanw aly angb erbedate rhadapp restasbi elajarb iologis iswa. Penelitianin i bertujuanu ntuk mengetahuai pakahm etodep engajaran hcrprogrurcrla'c klil'rrrrlusiks wur lcrrl',akler urarnpuanw alv angberbeddaa laur meningkatkapnre stasbi etajabr iologis iswad anu ntukm engetahupie rsepssii swa tentangp enggunaamn etodep engaiaranb erprogramtae rsebutH. ipotesisd alarn penelitianin i adalaha dap engaruhk emampuana walb iologi siswad engan menggunakmane todep engajarabne rprogramtae rhadap restasbi elajarb iologis iswa kelasI SMUN egeriI TalunB litarp adap okokb ahasaVn irusd anM onera. Populaspie nelitiainn i adalahs iswak elasI SMI.JN egerIi TalunB litary ang tersebadra lam7 kelas.D ari ketujuhk elast ersebudt ipilih duak elass ebagasi ampel penelitianS. ecaraa cakt erpilih kelas1 7d enganju mtah4 0 siswas ebagaki elompok kontroyl angd iajart anpam etodep engajaranb erprogramad,a nk elasl a dengan jumlah4 0 siswas ebagaki elompoke ksperimenya ngd iajar-dengamn enggunakan mctodep eng ajaranb erprog rama. Seteladhi lakukana nalisisd atad iperolehh asit( l) Prestasbi elajarb iologi sisway angd iajard enganm enggunakamn etodep engajaranb erprogramale bihb aik daripadasi sway angd iajart anpam cnggunakamn etodep engajarabne rprogramap ada pokokb ahasaVni rusd anM onera(,2 ) Ada interaksai ntaram etodep engajaran berprogramdae nganti ngkatk emampuana waly angb erbeday, aitu sisway ang berkernanrprt.rrwana lr cndahlc bihb aikh asilnvad aris isway angberkemampuaawn al s€dsngb ile diajar denganm etode pengajarany &ng sarna,( 3) Siswa lebih menyukai mctodpce ngsjarabne rprogramdaa lamh alp enguasakaonn sept,in gkatk emudahan, keefektifadna, ne fis iensi. Darih asilp enelitiante rsebuat dab eberapsaa rany angp erlud itindaklanjuti, antarela in;( l ) Metodep ongajaranin i telaht erbuktib erpengarubha ik terhadap prestasbie lajarb iologi siswa,s ehinggad iharapkang urud apatm enggunakamn etode pengajarabne rprogramsae bagasi alahs atua ltematifm etodep engajaradni kelas,( 2) Bagip emerhatmi etodologip engajarand, iharapkanr lqpatm enyusunL KB (Lembar KegiataBn erprogramay)a ngd apatd ipakais ebagatia mbahanm ediab elajar,( 3) Bagi penelitbi erikutnyap,e rlud itelitil agi tentangm etodep engajarabne rprograrnyaa ng efsktifu ntukt ingkatk emampuaanw als iswas edangd ant inggi,s ehinggdaa pat memperolephre stosbi elajary ango ptimals esuadi enganti ngkatk emampuaanw al siswate rsebut

Dampak program nasional pemberdayaan masyarakat mandiri perdesaan (PNPM-MP) dalam meningkatkan kesejahteraan masyarakat di Kecamatan Wonosari Kabupaten Malang / Dewi Ningnurati

 

Kata Kunci: Dampak, PNPM-MP, kesejahteraan masyarakat Kemiskinan adalah permasalahan utama dalam agenda pembangunan di Indonesia sampai dengan tahun 2010. Masalah kemiskinan menjadi prioritas utama kebijakan pemerintah karena merupakan amanat konstitusi dalam rangka mencapai tujuan nasional sebagaimana yang tercantum dalam pembukaan Undang-Undang Dasar 1945. Salah satu cara dalam pengentasan kemiskinan adalah dengan menggunakan pendekatan pemberdayaan, sehingga pemerintah mengeluarkan beberapa program pemberdayaan masyarakat antara lain: PPK, P2K, P4K, PEMP dan KUBE. Program-program pemberdayaan masyarakat dalam pengentasan kemiskinan pelaksanaannya kurang efektif sehingga pemerintah mengeluarkan program baru yaitu Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan (PNPM-MP). Kecamatan Wonosari merupakan salah satu dari 33 kecamatan di Kabupaten Malang yang melaksanakan PNPMMP. Berdasarkan permasalahan tersebut maka perlu dilakukan penelitian untuk mengkaji dampak PNPM-MP dalam meningkatkan kesejahteraan masyarakat dan sebagaimana yang ada pada tujuan program, sehingga peneliti melakukan penelitian yang berjudul “Dampak Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan (PNPM-MP) dalam Meningkatkan Kesejahteraan Masyarakat di Kecamatan Wonosari Kabupaten Malang”. Tujuan penelitian ini adalah untuk mengetahui: (1) Bagaimana dampak Program Nasional Pemberdayaan Masyarakat Mandiri Perdesaan (PNPM-MP) dalam pengembangan prasarana sosial dasar dan ekonomi bagi rumah tangga miskin di Kecamatan Wonosari Kabupaten Malang; (2) Bagaimana dampak PNPM-MP dalam perluasan lapangan pekerjaan bagi rumah tangga miskin di Kecamatan Wonosari Kabupaten Malang; (3) Bagaimana dampak PNPM-MP dalam pengembangan partisipasi keswadayaan dan kesejahteraan masyarakat di Kecamatan Wonosari Kabupaten Malang. Jenis penelitian yang digunakan adalah penelitian kualitatif-studi kasus. Sumber data diperoleh dari hasil wawancara, observasi dan dokumentasi. Subyek penelitian ini adalah Pengelola PNPM-MP di Kecamatan Wonosari dan di desa serta masyarakat penerima manfaat dari PNPM-MP di Kecamatan Wonosari Kabupaten Malang. Pengumpulan data menggunakan teknik wawancara, observasi, dan dokumentasi. Analisis data yang digunakan adalah analisis data model interaktif (reduksi, penyajian dan verifikasi data). Hasil penelitian ini menunjukkan bahwa: (1) dampak PNPM-MP dalam pengembangan prasarana sosial dasar pendidikan pada pembangunan gedung TK bagi rumah tangga miskin di Kecamatan Wonosari yaitu adanya ketersediaan prasarana sosial dasar pada pendidikan, meningkatkan kualitas prasarana gedung i

Penerapan bauran pemasaran pada PT. Jawa Pos Radar Malang / Kartika Maia Sari

 

Kata kunci: Bauran Pemasaran, Jawa Pos Radar Malang Persaingan yang ketat dialami oleh media massa, dengan munculnya berbagai surat kabar, tabloid ataupun majalah baru, baik lokal maupun nasional. Untuk itu diperlukan suatu strategi yang tepat dari perusahaan dengan selalu menginovasi produk, terutama Koran Jawa Pos itu sendiri sesuai dengan slogannya “ Selalu Ada Yang Baru “ sehingga dapat lebih memuaskan pelanggan. Salah satunya adalah menerapkan bauran pemasaran yang tepat Tujuan penulisan ini adalah untuk mengetahui penerapan bauran pemasaran pada Jawa Pos Radar Malang dan juga untuk mengetahui apa faktor penghambat dan pendukung Jawa Pos Radar Malang dalam melakukan Penerapan Bauran Pemasarannya. Hasil praktek yang didapat adalah Jawa Pos Radar Malang melakukan penerapan bauran pemasarannya, yang terdiri dari : Produk dengan penerapan Startegi Diversifikasi Produk, Penerapan Strategi Positioning Produk dan Strategi Overlap Produk, Distribusi dengan cara Saluran Distribusi tidak langsung (indirect Channel of distribution) dan Menerapkan strategi Cakupan distribusi, Harga disesuaikan dengan kondisi atau kemampuan masyarakat, ekonomi lingkungan, dan biaya-biaya transportasi, gaji karyawan, dan bahan baku. Harga jual Jawa Pos Radar Malang secara eceran sebesar Rp. 3.500,00 dan secara berlangganan adalah Rp. 75.000,00 per bulannya dan Promosi dengan mengadakan berbagai acara contohnya acara DBL ( Deteksi Basketball Language ) di kota Malang tepatnya di sekolah Dempo pada tahun 2007, mengadakan even Batu Agritech, mengadakan even Sampoerna / Ijo Royo-Royo dan Rembuk Kampung, mengadakan even Klik bersama Kapolresta, Telkomsel dan U-Mail. Adapun faktor pendukung dalam penerapan bauran pemasaran adalah Perusahaan Jawa Pos Radar Malang memiliki sumber daya manusia yang berpotensial, Perusahaan Jawa Pos Radar Malang memuat tidak hanya berita-berita lokal maupun nasional, tetapi mulai, Nasional dan juga daerah dari segala bidang dan faktor penghambatnya adalah Sulitnya mencari sumber daya manusia yang berpotensial dan pesaing pasar yang semakin ketat adalah masalah yang harus dihadapi oleh setiap perusahaan.

Performa guru fisika dalam proses belajar mengajar kelas I di SLTPN se-kota Malang / oleh Wheni Setyowati

 

Salah satu faktor yang mempengaruhi daya serap siswa terhadap materi pelajaran adalah penampilan guru pada proses belajar mengajar. Untuk mengetahui kualitas performa guru dalam proses belajar mengajar yaitu melalui observasi pada saat guru melakukan tugasnya di depan kelas.

Kemampuan berpikir kritis siswa kelas X melalui model pembelajaran guidedf inquiry dengan link map pada materi Fluida Statis / Risa Agustin

 

ABSTRAK Agustin, Risa. 2016. Kemampuan Berpikir Kritis Siswa Kelas X Melalui Model Pembelajaran Guided Inquiry dengan Link Mappada Materi Fluida Statis. Tesis. Program Studi Pendidikan Fisika, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Arif Hidayat, M.Si, (II) Dr. Wartono, M.Pd Kata kunci: model pembelajaran guided inquiry, link map, kemampuan berpikir kritis Berpikir kritis merupakan kekuatan berpikir yang haru dibangun pada siswa sehingga menjadi suatu kepribadian dari siswa untuk memecahkan segala persoalan di dalam kehidupannya. Kemampuan berpikir kritis sangat penting bagi siswa karena dengan kemampuan ini siswa mampu bersikap rasional dan memilih alternatif pilihan yang terbaik bagi dirinya. Siswa yang memiliki kemampuan berpikir kritis akan selalu bertanya pada diri sendiri dalam setiap menghadapi segala persoalannya untuk menentukan yang terbaik bagi dirinya. Tujuan penelitian adalah untuk mengetahui kemampuan berpikir kritis siswa pada materi fluida statis dalam pembelajaran guided inquiry denganlink map, dan pengaruh penerapan pembelajaranguided inquiry denganlink map terhadap kemampuan berpikir kritis siswa pada materi fluida statis. Penelitian ini menggunakan rancangan mixed method model embedded experimental. Subjek penelitian ini adalah kelas X MIA 1 MAN Sumenep yang terdiri dari 39 orang siswa pada semester genap tahun ajaran 2015/2016. Instrumen penelitian terdiri atas silabus, RPP, LKS, soal tes kemampuan berpikir kritis dan kuis. Data dianalisis secara kuantitatif, yaitu dengan menggunakan uji-t berpasangan, N-gain dan effect size. Data dianalisis pula secara kualitatif, yaitu melalui tahap reduksi data, pengodean, penyajian data dan penarikan kesimpulan. Hasil penelitian menunjukkan bahwa: siswa mengalami perkembangan kemampuan berpikir kritis dan indikator berpikir kritis yang tinggi yaitu mendefinisikan istilah secara kualitatif, mengobservasi dan mempertimbangkan hasil observasi, membuat nilai-nilai pertimbangan, memfokuskan pertanyaan dan menginduksi serta mempertimbangkan hasil induksi secara logis; kemampuan berpikir kritis siswa meningkat di setiap pertemuan dengan n-gain 0,7 dalam kategori tinggimampu membuat siswa menjadi lebih percaya diri untuk berargumen dan bertanya ketika mengikuti pembelajaran dan guided inquiry dengan link map memberikan pengaruh atau efek yang cukup terhadap kemampuan berpikir kritis siswa dengan nilai d effect size 0,93.

Evaluasi potensi mata air Song Bajul untuk suplai air bersih penduduk di Desa Pucanglaban dan Desa Sumberdadap Kecamatan Pucanglaban Kabupaten Tulungagung tahun 2010-2050 / Mar'atus Sholekhah

 

Kata Kunci: kebutuhan air, kuantitas air, proyeksi penduduk Kekeringan merupakan keadaan dimana sebagian besar penduduk merasakan kurangnya air untuk memenuhi kebutuhan hidupnya. Masalah ini dialami oleh penduduk Kabupaten Tulungagung bagian selatan, yaitu Kecamatan Pucanglaban. Penduduk Desa Pucanglaban memanfaatkan mata air Umbul Bendo dan Desa Sumberdadap memanfaatkan mata air Sumber Kucur, yang masing-masing memiliki debit 0,5 liter/detik, sehingga terdapat batasan waktu untuk mendapatkan pasokan air bersih. Di Desa Panggungkalak terdapat sumber mata air yang memiliki debit yang besar, yang diharapkan mampu mengatasi permasalahan kekurangan air bersih. Mata air tersebut dinamakan mata air Song Bajul yang merupakan mata air karst. Penelitian ini bertujuan untuk menganalisis potensi (kuantitas) mata air Song Bajul, menganalisis kebutuhan air, dan mengevaluasi potensi mata air Song Bajul untuk memenuhi kebutuhan air bersih tahun 2010-2050 di Desa Pucanglaban dan Desa Sumberdadap. Penelitian ini merupakan penelitian deskriptif kuantitatif. Metode yang digunakan yaitu metode survei. Obyek dalam penelitian ini meliputi mata air Song Bajul dan penduduk Desa Pucanglaban dan Sumberdadap. Sampel responden ditentukan dengan Stratified Proportional Random Sampling dan jumlah responden ditentukan dengan Stratified Sampling. Jumlah responden di Desa Pucanglaban 156 KK dan Desa Sumberdadap 133 KK. Hasil penelitian ini yaitu: (1) kuantitas mata air Song Bajul adalah 201,67 liter/detik atau 17.424.616,32 liter/hari, (2) saat ini total kebutuhan air bersih penduduk Desa Pucanglaban dan Desa Sumberdadap yaitu 1.030.381,24 liter/hari, (3) Perkiraan total kebutuhan air bersih penduduk Desa Pucanglaban dan Desa Sumberdadap tahun 2050 yaitu 2.536.746,61 liter/hari. Dari hasil penelitian ini dapat disimpulkan bahwa (1) Debit mata air Song Bajul memiliki debit yang relatif stabil sepanjang tahun karena merupakan mata air karst, (2) terjadi perbedaan pola konsumsi antara jenis pekerjaan, (3) besar kebutuhan air bersih penduduk Desa Pucanglaban dan Sumberdadap tahun 2050 dapat tercukupi dengan debit mata air Song Bajul baik pada musim kemarau dan dan musim penghujan. Saran yang dapat diberikan: (1) untuk penelitian selanjutnya hendaknya dilakukan juga evaluasi kualitas mata air, (2) faktor kebocoran harus diperhatikan dalam proses distribusi air sehingga kuantitas air yang diperoleh lebih akurat, (3) hendaknya dilakukan prediksi penggunaan lahan untuk beberapa tahun yang akan datang.

Pemerolehan kalimat bahasa Indonesia tulis sebagai bahasa pertama siswa kelas III SD
oleh Iswatun Hasanah

 

ABSTRAK I{asanahI,s watun 2D0l/2002.P emerolehanK alimu BahasaI ndonesia Tulis sebagai Balwsa Pertama Siswa Kelas III SD. Slripsi, Jurusan Pendidikan Bahasa dan Sastra Indonesia, Fakultas Sastrq Universitas Negeri Malang. Pembimbing(l:) Drs.O scarRusmadjMi, . Pd,( 2)Dra.T itikllarsiati, M. Pd. Kata kunci: Pemerolehabna hasas, iswak elasI II SD, kalimatb ahasaIn donesiatu lis. Pemerolehakna limatb ahasaIn donesias ebagabi ahasap ertamap adaa nak dapatd ikatakanm erupakans uatug ejalat ingkat penguasaanp ola kalimat bahasa Indonesipaa dat ingkatu siat ertentu.P olak alimaty angt elahd ikuasaai nakm emiliki karalleristik tert€ntuy ang membedakannyad enganp ola kalimat yangd ikuasaia nak remaja dan orang dewasa Pola kaidah yang dikrlasai anak SD pada tingkatan tertentu dapatd idugas ebagapi ola kaidahy ang bersifat sementara. Penelitian"P emerolehakna limatb ahasaIn donesiatu lis sebagabi ahasa pertamas iswak elasI II SD" secarau mumb ertujuanu ntukm emperolehd eskripsi objektiftentanpge merolehakna limatb ahasaIn donesiay angt erdapadt alamk arangan sisunake lasI II SD, yang dikhususkanp adaa speks intaksisp adat atarank alimat. Penelitian ini didasarkan pada asumsi bahura (l) dalam Bahasa Indonesia terdapatjenis-jenkisa Umat(, 2) BahasaIn donesias udahd iajarkanp adas iswak elas III SD, (3) siswak elas III SD yang berbahasap ertamab ahasaI ndonesias udah memperolejhe nis-jenisk alimatb ahasaIn donesias ecaraa lami,d an( 4) keterampilan menulis sudah diajarkan pada siswa kelas III SD. Metode yang digunakan dalam penelitian ini adalah metode deslriptif Data yangd igunakans dalah karangany ang dihasilkano leh siswak elasI II SD Negeri Jetis III Lamongan. Hasilp enelitianin i menunjukkanb ahwaje nis-jenisk alimatb ahasaIn donesia telah diperoleh siswa kelas III SD. Jenis kalimat tersebut antara lain (1) kalimat berdasarkarne sponsiy ang diharapkan,( 2) kalimat berdasarkans ifal hubungana ktoraksi, d an (3) kalimat berdasarkans truhumya. Kalimat bahasaI ndonesiab erdasarkan responsyia ngd iharapkany angd iperolehs iswak elast II SD adalah( l) kalimatb erita, (2) kalimat pertanyaand, an (3) kalimat perintah.K alimat berita yang diperoleh adalahk alimat berita tunggald an majemuk.K alimat pertanyaany ang diperoleh adalahk alimat pertanyaand enganm cnambehkank ata-katat any4 menggunakan intonasi tanya" menambahlnnkza opa (-kth) dan bufun (-kah)- Kalimat perintah yangd iperoleha dalahk alimatp erintahy angs ebenarnydaa na jakan. Adapunk alimat bahaErI ndonesiab erdasarkans ifat hubungana ktor-aksiy ang diperolehs iswak elasI II SD antaral ain (l) kalimata ktif, dan( 2) kalimatp asif. Kalimata ktif yang diperoleha dalahk alimat yang predikatnyab erafiksm ely'-,b erafiks I II ber-, dankalimat y angp redikatnyati dak berimbuhan(v erbaa us).K alimatp asify ang diperoleha dalahk alimaty angp redikatnyab erprefiksd i-. Sementarait u kalimat bahasaln donesiab erdasarkans truktumyay ang diperoleh siswa kelas Iu sD adalah (l) kalimat netnal, (2) kalimat inversi, dan 13)k alimatp ermutasiK. alimat netraly angd iperoleha dalahk alimaty angb erpola s-P, s-P-O,S -P-K,d an S-P-O-K.K alimat inversiy angd iperoleha dalahk alimaty ang berpolaP -S,K -P-S,P -O-S,d anP -S-O.K alimat permutasyi angd iperoleha dalah kalimat yang berpola K-S-P, K-S-P-O, S-K-P-O, K-S-P-K dan K-S-P-O-K. Pemerolehank alimat-katimatt ersebutd i atas rnerupakanb ukti baltwas iswa kelasI II SD telahm enguasaki aidahp embentukakna limatb ahasaIn donesiad engan baik.A rtinya,k alimat-kalimayt angd ikunsais iswak elasI II SD tersebutte lahc ukup digunakan untuk kebutuhan komunikasi sehari-hari dengan mitra tuturnya sesuai dengan karakter bahasa anak yang diperoleh. Kemampuan kalimat bahasa Indonesia tenebut didasarkanp adap ola dan aturank ebahasaayna ng telah dikuasaia naks esuai denganti ngkatp engalamaann akd enganli ngkungank ebahasaannya. Berdasarkanp enelitiani ni, ada beberapas arany ang dapatd isampaikan kepadab erbagaip ihak sebagati indak lanjut hasil penelitiani ni. Saran-saranya ng 6lig13tr5ndkaann, taraL ains epertib erikut. Pertam4 penyusunk urikulum dan buku t€ks disarankans upaya mempertimbangkank elengkapand en urutan peinerolebank alimat bahasaIn donesia tulis siswak elasI II SD berdasarkanre sponsiy ang diharapkan,b erdasarkans ifat hubungana klor-aksi,d an berdasarkans trukturnya,s ehinggas esuaid engank eadaan siswa danjenjang materi yang disusun dapat s€suai dengan perkembangan pemerolehanb hasa siswa. Kedua, guru bidang studi BahasaI ndonesiad isarankanh endaknya mendasarkapna daje nis-jenisk alimatd anp ola-polak alimaty angd iperolehs iswa subjekp enelitianin i dalamm embuabt ahan,m enyajikand alamk elasd an penilaiannyas ecarain tegratil baik untukp okokb ahasank hususte ntangk alimat maupuna spekb ahasay ang lain Dengand emikiaru penyajianp engajaranB ahasa tndonesiad i SD dapat( I ) sesuaid enganp enguasaansi swat erhadapm ateny ang diperolehd, an( 2) sesuadi enganjenjangk esulitand alamp emerolehabna hasa' Ketiga,p enelitid anp engkajim asalahp emerolehabna hasaIn donesia disarankans upayam engadakanp enelitianl ebih lanjut dari penelitiani ni, karena pemerolehanb ahasam asihp erlu diteliti untuk membuktikans ecaraa kural Penelitian lanjutant ersebrCd isannkan agarl ebih memperluasin ferrralt ingkat kelasa tauu sia dari siwa Di sampingi tu" penelitianl anjutand iharapkanm enggunakanm etodey ang berbedad enganp enelitianin i.

Penerapan metode mind mapping untuk meningkatkan keterampilan menulis narasi siswa kelas V SDN Purwantoro 02 Malang / Bayu Dwi Septiawan

 

Kata kunci: Metode Mind Mapp, Keterampilan Menulis Narasi. Berdasarkan hasil observasi yang peneliti lakukan di kelas V SDN Purwantoro 02 Malang didapatkan fakta bahwa, pembelajaran yang dilakukan guru terhadap kemampuan siswa dalam menulis karangan menunjukkan siswa mengalami kesulitan dalam penggunaan diksi, ejaan dan tanda baca, serta membangun kepaduan kata dengan kalimat sesuai dengan isi cerita. Nilai yang diperoleh pun secara klasikal rata-ratanya hanya mencapai 45,05. Sedangkan SKM yang ditentukan adalah 75 untuk ketuntasan kelas. Untuk itu agar dapat meningkatkan keterampilan menulis narasi siswa perlu diadakan perbaikan pembelajaran dengan menerapkan metode Mind Mapp. Penelitian ini bertujuan untuk: (1) mendiskripsikan penerapan metode Mind Mapping untuk meningkatkan keterampilan menulis narasi siswa. (2) mendiskripsikan peningkatan keterampilan menulis narasi siswa dengan penggunaan metode Mind Mapping. Penelitian ini menggunakan jenis PTK yang dilaksanakan dalam 2 siklus, tiap siklus 2 pertemuan. Subjek penelitian adalah siswa kelas V SDN Purwantoro 02 Malang. Dalam penelitian ini peneliti menjadi pengajar dan guru kelas sebagai observer. Jenis data yang hendak dikumpulkan adalah data proses pembelajaran dan hasil keterampilan menulis narasi siswa. Sumber datanya adalah siswa kelas V dan juga guru Bahasa Indonesia di kelas tersebut. Teknik pengumpulan data yang digunakan adalah observasi, dokumentasi dan tes dengan instrument berupa lembar observasi, kamera dan soal test. Hasil penelitian menunjukkan bahwa penggunaan metode Mind Mapp untuk pembelajaran Bahasa Indonesia siswa kelas V SDN Purwantoro 02 Malang dengan standar kompetensi “Mengungkapkan pikiran, perasaan, informasi, dan pengalaman secara tertulis dalam bentuk karangan, surat undangan, dan dialog tertulis” dapat dilaksanakan dengan efektif. Keterampilan menulis narasi siswa meningkat dari 45,05 pada kegiatan pratindakan menjadi 55,16 pada siklus I dan menjadi 75,37 pada siklus II. Pada penilaian menulis narasi terdapat beberapa indikator yang dirasa perlu diperhatikan. Hal ini ditunjukkan dengan adanya keberhasilan indikator yang rendah dibandingkan dengan indikator yang lain. Indikator tersebut adalah pemilihan kata, serta penggunaan Ejaan dan tanda baca. Untuk indikator pemilihan kata dapat diselesaikan dengan menambahkan sumber bacaan kepada siswa pada waktu mengerjakan Lembar Kegiatan Siswa. Sedangkan indikator penggunaan ejaan dan tanda baca dapat diselesaikan dengan cara pembiasaan dan latihan yang berkelanjutan. Dari hasil penelitian ini, guru seharusnya melakukan persiapan yang matang sebelum kegiatan belajar mengajar seperti lebih menyiapkan media ataupun bahan pembelajaran yang diperlukan untuk menunjang ketercapaian indikator, sedangkan untuk pihak sekolah diharapkan kerjasamanya dalam menumbuhkan minat siswa untuk menulis dengan menyediakan fasilitas berupa buku bacaan anak dan tempat yang nyaman untuk membaca sehingga kosa kata siswa bertambah dengan harapan dapat menumbuhkan minat menulis siswa.

Evaluasi kesesuaian lahan untuk pengembangan kawasan permukiman di Kabupaten Mojokerto / Puja TDT Mastika

 

Kata kunci: evaluasi kesesuaian lahan, permukiman Kawasan permukiman merupakan kawasan di luar kawasan lindung yang digunakan sebagai lingkungan tempat tinggal atau hunian masyarakat berada di wilayah perkotaan dan perdesaan. Kabupaten Mojokerto memiliki luas wilayah 969.360 km2. Pertambahan penduduk sebesar 64.050 jiwa/tahun yang didominasi oleh penduduk pendatang tersebut menyebabkan kebutuhan akan permukiman juga meningkat. Apabila diproyeksikan hingga tahun 2015 dengan laju pertumbuhan penduduk rata-rata sebesar 2,00%, jumlah penduduk Kabupaten Mojokerto adalah 1.207.579 jiwa dengan kebutuhan rumah mencapai 301.769 unit. Sehingga dapat diasumsikan pada tahun 2015 diperlukan lahan seluas 6.035 ha sebagai lahan yang siap dibangun sebanyak 301.769 unit rumah. Untuk itu perlu dilakukan adanya evaluasi lahan untuk mengetahui tingkat kesesuaian lahan yang dapat dikembangkan sebagai kawasan permukiman. Penelitian ini bertujuan mengevaluasi kesesuaian lahan untuk pengembangan kawasan permukiman dan menganalisis sebaran kesesuaian lahan untuk pengembangan kawasan permukiman di Kabupaten Mojokerto berdasarkan kelas kesesuaian lahan untuk pemukiman. Metode yang digunakan dalam penelitian ini adalah metode survey dengan pendekatan deskriptif. Data yang digunakan dalam penelitian ini meliputi data primer dan data sekunder. Pengolahan data spasial menggunakan software ArcView 3.3. yaitu dengan cara menumpangsusunkan tiga peta yaitu peta jenis tanah, peta kemiringan lereng dan peta penggunaan lahan. Populasi yang diperoleh dari overlay peta sebanyak 33 unit lahan, sampel penelitian yang diambil sebanyak 7 unit lahan. Teknik pengambilan sampel menggunakan teknik purpossive sampling. Penentuan kelas kesesuaian lahan untuk permukiman ditetapkan berdasarkan jumlah hasil pengharkatan (scoring) terhadap parameter-parameter kesesuaian lahan pada satuan lahan. Hasil penelitian menunjukkan bahwa kelas sesuai untuk pengembangan kawasan permukiman 1.217,844 ha atau 5,19% dari luas seluruh unit lahan, terletak di Kecamatan Gedeg, Puri, Sooko dan Trowulan. Kelas kesesuaiaan lahan cukup sesuai untuk pengembangan kawasan permukiman dengan luas 7860,89 ha atau 58,38% dari luas seluruh unit lahan penelitian, terletak di Kecamatan Kemlagi, Jetis dan Dawarblandong. Selain itu terdapat 4708,76 ha lahan didalam rencana pola ruang Kabupaten Mojokerto yang tidak layak dikembangkan sebagai kawasan permukiman (Kecamatan Ngoro, Pacet dan Trawas) atau 20,06% dari luas keseluruhan unit lahan. Kelas kesesuaian lahan sesuai (K1An dan K1Al), sesuai untuk dikembangkan menjadi kawasan permukiman perkotaan. Kelas kesesuaian lahan cukup sesuai (T1Al, K2Gr, T1Gr, T2Gr, T3Gr) sesuai untuk dikembangkan menjadi kawasan permukiman perkotaan.

Pengembangan media pembelajaran berbasis auto play untuk mata kuliah teknik penerjemahan di Jurusan Sastra Arab Fakultas Sastra Universitas Negeri Malang / Syayidah Ginanjar Rahayu

 

Kata Kunci: Hak Asasi Manusia, Pembelajaran Pendidikan Kewarganegaraan (PKn) Hak Asasi Manusia merupakan hak dasar yang dimiliki manusia yang tidak dapt di kurangi dengan suatu apapun. Dalam proses pembelajaran Hak Asasi Manusia merupakan salah satu komponen yang dapat mendukung terwujudnya pembelajaran yang lebih menghargai hak-hak manusia dan mewujudkan pembelajaran aktif (active learning), pembelajaran efektif (effective learning), dan pembelajaran yang menyenangkan (joyfull learning). Pelaksanaan Hak Asasi Manusia di SMP Negeri 1 Wajak diaktualisasikan dalam bentuk proses pemebelajaran yang aktif, efektif dan menyenangkan, hal ini dapat terlihat dalam keterlibatan siswa dalam pelaksanaan kegiatan belajar mengajar. Penelitian ini bertujuan untuk (1) mendiskripsikan implementasi hak asasi manusia dalam proses pembelajaran Pendidikan Kewarganegaraan (PKn) di Kelas VII SMP Negeri 1 Wajak Kabupaten Malang, (2) kendala-kendala yang dihadapi oleh guru dalam melaksanakan hak asasi manusia dalam proses pembelajaran Pendidikan Kewarganegaraan (PKn), (3) upaya-upaya yang dilakukan oleh guru guna mengatasi kendala-kendala implementasi hak asasi manusia dalam proses pembelajaran Pendidikan Kewarganegaraan (PKn). Berdasarkan tujuan tersebut, pendekatan yang digunakan dalam penelitian ini adalah pendekatan deskriptif kualitatif. Sedangkan sumber data dibedakan menjadi dua, yaitu sumber data manusia dan sumber data non manusia (dokumen). Penentuan informan penelitian ditentukan dengan menggunakan teknik purposive sampling. Pengumpulan data dilakukan menggunakan tiga metode, yaitu observasi, wawancara, dan dokumentasi. Analisis data dilakukan meliputi tiga unsur, yaitu reduksi data, penyajian data, dan kesimpulan atau verifikasi data. Untuk menjamin keabsahan data dilakukan dengan menggunakan empat teknik, yaitu perpanjangan kehadiran peneliti, ketekunan pengamatan, triangulasi (sumber, metode, teknik), dan pemeriksaan sejawat. Temuan penelitian menujukkan bahwa (1) implementasi HAM dalam proses pembelajaran PKn di SMP Negeri 1 Wajak meliputi (a) Implementasi HAM dalam perencanaan pembelajaran yang meliputi: Perumusan kompetensi pembelajaran, dimana guru mengembangkan kompetensi dasar yang terdapat dalam standar isi kedalam beberapa indikator pembelajaran, dalam mengembangkan indikator guru tetap memperhatikan potensi dan kemampuan dari peserta didiknya; Perencanaan materi, dalam proses pembelajaran guru selalu menumbuhkan sikap demokratis melalui keterbukaan untuk bertanya atau berpendapat jika dalam pembelajaran ditemukan perbedaan antara materi dengan buku; Perencanaan metode, guru melakukan pemilihan metode yang akan digunakan sehingga pembelajaran lebih efektif, aktif dan sesuai dengan tujuan Perencanaan media, penggunaan media disesuaikan dengan materi yang diajarkan, serta penggunaan media terbatas pada media OHP dan Perencanaan evaluasi pembelajaran, meliputi kegiatan perencanaan waktu, materi yang diujikan serta intrumen dan bentuk tes yang akan digunakan (b) implementasi HAM dalam pelaksanaan pembelajaran, diwujudkan dengan pemberian hak pada siswa dalam bentuk hak untuk bertanya, menyampaikan pendapat, serta mengemukakan gagasan. (c) implementasi HAM dalam evaluasi pembelajaran, dalam merencanakan waktu evaluasi guru berpedoman pada kalender akademik agar tidak berbenturan dengan kegiatan sekolah, serta dalam menentukan soal evaluasi guru tetap memperhatikan batasan-batasan kompetensi dasar yang ditentukan. (2) faktor pendorong implementasi hak asasi manusia dalam proses pembelajaran di SMP Negeri 1 Wajak adalah sebagai berikut: Ingin mengubah paradigma pembelajaran yang konvensional menjadi pembelajaran yang modern, pembelajaran aktif, dan pembelajaran yang menyenangkan. Mewujudkan pembelajaran yang mengedepankan persamaan hak dan kebebasan dalam mengembangkan pengetahuan dan kreativitas. Sedangkan faktor penghambat adalah: Masih kurangnya pengetahuan guru dan siswa tentang penggunaan haknya dalam proses pembelajaran; Siswa masih belum bisa sepenuhnya mengharagai hak-hak masing-masing individu; Adanya sebagian siswa yang memaksakan kehendak dalam berpendapat; Kurangnya komunikasi yang baik antara guru dan siswa. (3) Upaya yang dilakukan untuk mengatasi hambatan implementasi HAM dalam proses pembelajaran PKn adalah: Guru selalu mengadakan komunikasi, sharing dan interaksi dengan siswa; Guru selalu memotivasi diri untuk meningkatkan profesionalismenya unutk meningkatkan kualitas dalam mengajar; Guru selalu menghadirkan model pembelajaran yang efektif dan menyenangkan. Beberapa saran sebagai tindak lanjut pelaksanaan hak asasi manusia dalam proses pembelajaran yaitu: (1) Guru perlu lebih meningkatkan kualitas dan kemampuannya sebagai seorang tenaga pengajar yang profesional, (2) Bagi pihak sekolah, perlu adanya bimbingan dan pelatuhan tentang hak asasi manusia bagi guru yang betujuan untuk meningkatkan kesadaran guru dalam peningkatan dan penghargaan hak asasi manusia dalam pembelajaran, (3) Bagi Diknas, perlu adanya pertimbangan tentang penerapan hak asasi manusia dalam pelaksanaan pembelajaran di sekolah serta perlu pelatihan atau sosialisasi tentang hak asasi manusia dalam mengembangkan pendidikan yang mengedepankan nilai-nilai hak asasi manusia.

Pengaruh pembentukan soal dalam strategi daur belajar 6 fase terhadap pemahaman konseptual dan pemahaman algoritmik siswa kelas XI MIA SMA Negeri 7 Malang pada materi kesetimbangan kimia / Julian Hadi Ferry

 

ABSTRAK Ferry, Julian Hadi. 2015. Pengaruh Pembentukan Soal dalam Strategi Daur Belajar 6 Fase terhadap Pemahaman Konseptual dan Pemahaman Algoritmik Siswa Kelas Xi Mia Sma Negeri 7 Malang Pada Materi Kesetimbangan Kimia. Tesis, Program Studi Pendidikan Kimia, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dra. Srini M. Iskandar, M.Sc., Ph.D., (II) Dr. Siti Marfu’ah M.S. Kata kunci: pemahaman konseptual, pemahaman algoritmik, daur belajar 6 fase-”pembentukan soal”, kesetimbangan kimia. Kesetimbangan kimia merupakan konsep dasar bagi siswa untuk dapat memahami topik kimia yang lainnya, seperti asam basa dan kelarutan. Kesetimbangan kimia memiliki aspek konsep yang abstrak, konkret, dan algoritmik. Berdasarkan karakteristik tersebut menjadikan kesetimbangan kimia sebagai salah satu materi yang sulit dipahami siswa. Penelitian ini dilakukan dengan tujuan untuk mengetahui perbedaan pemahaman konseptual dan algoritmik siswa kelas XI SMA Negeri 7 Malang yang dibelajarkan dengan strategi Daur Belajar 6 Fase-”Pembentukan Soal” dan strategi Daur Belajar 6 Fase pada materi kesetimbangan kimia. Rancangan penelitian yang digunakan adalah quasy experimental dengan desain posttest only nonequivalent control group design. Populasi penelitian adalah siswa kelas XIA MIA SMA Negeri 7 Malang Tahun Ajaran 2014/2015. Sampel penelitian adalah siswa kelas XI MIA 3 sebagai kelas eksperimen dan siswa kelas XI MIA 4 sebagai kelas kontrol. Kelas ekperimen dibelajarkan dengan strategi daur belajar 6 fase-”pembentukan soal” dan kelas kontrol dibelajarkan dengan strategi daur belajar 6 fase. Data penelitian diambil dari tes pilihan jamak dengan 13 soal pemahaman konseptual dan 7 soal algoritmik. Data penelitian berupa skor dan dianalisis menggunakan uji statistik komparatif t-test. Hasil penelitian menunjukkan bahwa (1) terdapat perbedaan pemahaman konseptual dan pemahaman algoritmik yang signifikan antara siswa yang dibelajarkan dengan strategi daur belajar 6 fase-”pembentukan soal” dan strategi daur belajar 6 fase pada materi kesetimbangan kimia dan; (2) rata-rata nilai pemahaman konseptual dan pemahaman algoritmik siswa kelas eksperimen (73,291 dan 75,397) lebih tinggi daripada siswa kelas kontrol (63,348 dan 64,706) pada materi kesetimbangan kimia. Berdasarkan hasil tersebut dapat disimpulkan bahwa strategi daur belajar 6 fase-”pembentukan soal” memberikan hasil yang lebih baik daripada strategi daur belajar 6 fase pada materi kesetimbangan kimia.

Peningkatan kemampuan menulis kreatif naskah drama dengan menggunakan media video klip musik pop untuk siswa kelas VIII-G SMP Negeri 2 Malang / Yossy Firmansyah

 

Kata kunci: Kemampuan menulis, pembelajaran menulis, media video klip Dalam kegiatan belajar mengajar, menulis mempunyai peranan penting karena menulis merupakan dasar untuk menguasai kemampuan berbahasa lainnya. Oleh karena itu, penggunaan media yang tepat dalam pembelajaran merupakan hal yang harus dipertimbangkan oleh pengajar agar tujuan pembelajaran kemampuan menulis dapat tercapai. Akan tetapi, kenyataan di lapangan menunjukkan pembelajaran menulis masih perlu ditingkatkan. Berdasarkan hasil studi pendahuluan di SMP Negeri 2 Malang, kemampuan menulis siswa masih rendah dan belum mencapai nilai standar yang ditetapkan sekolah tersebut terutama pada kemampuan menulis naskah drama. Berdasarkan alasan-alasan tersebut, penelitian ini bertujuan meningkatkan kemampuan menulis naskah drama pada siswa kelas VIII G SMP Negeri 2 Malang menggunakan media video klip. Penggunaan media video klip diharapkan dapat menambah minat dan semangat siswa dalam belajar siswa tentang menulis naskah drama sehingga pembelajaran menulis dapat dilaksanakan sebagaimana mestinya. Manfaat penelitian ini adalah membantu siswa dalam mengatasi kesulitan pembelajaran khususnya menulis naskah drama, memotivasi siswa untuk belajar, dan melatih siswa melakukan kegiatan menulis secara efektif. Penelitian ini menggunakan desain penelitian tindakan kelas yang terdiri atas dua siklus. Tiap siklus terdiri atas tahap perencanaan, tindakan, observasi, dan refleksi. Pengambilan data dilakukan dengan tes dan nontes. Alat pengambilan data yang digunakan berupa tes, observasi, dan wawancara. Analisis data yang dilakukan secara kuantitatif dan kualitatif. Berdasarkan analisis data penelitian kemampuan menulis naskah drama siswa pada kemampuan awal, siklus I, dan siklus II menunjukkan peningkatan pada tahap pramenulis, tahap menulis dan tahap pascamenulis. Penggunaan media video klip pada tahap pramenulis dikategorikan sangat baik sebesar 82,7% siswa dapat meningkatkan kemampuan siswa dalam membuat kerangkan naskah drama. Penggunaan media video klip pada tahap menulis dikategorikan sangat baik sebesar 95,6% siswa dapat meningkatkan kemampuan siswa dalam membuat naskah drama dengan mengembangkan kerangka naskah drama menjadi naskah drama yang utuh dan padu. Penggunaan media video klip pada tahap pascamenulis dikategorikan sangat baik sebesar 100% siswa dapat memberikan komentar terhadap naskah drama milik temannya. Peningkatan kemampuan menulis naskah drama pada tiap siklus diikuti dengan perubahan perilaku positif siswa.. Dari hasil penelitian ini, saran yang disampaikan peneliti adalah penggunaan media video klip dapat menumbuhkan minat dan ketertaikan siswa dalam pembelajaran menulis naskah drama sehingga perlu dipertimbangkan penggunaannya dalam pembelajaran.

Pengembangan inventori keterampilan sosial bagi siswa sekolah menengah / oleh Victoria Yonathan P.

 

Pengembangan buku teks muatan sejarah lokal "Sunan Bejagung (Kisah dan Peranannya)" sebagai penunjang materi pokok pada KD 3.7 di kelas X MIA 2 kurikulum 2013 MAN Tuban / Khusnul Khotimah

 

ABSTRAK Khotimah, Khusnul. 2016. Pengembangan Buku Teks Muatan Sejarah Lokal “Sunan Bejagung (Kisah dan Peranannya)” Sebagai Penunjang Materi Pokok pada KD 3.7 di Kelas X MIA 2 Kurikulum 2013 MAN Tuban. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang, Pembimbing: (1) Deny Yudo Wahyudi, S.Pd., M.Hum, (2) Najib Jauhari, S.Pd., M. Hum Kata Kunci: Sunan Bejagung, Tuban, Sunan Bonang Sejarah merupakan salah satu mata pelajaran pada ilmu pengetahuan sosial yang mempelajari peristiwa masa lampau. Salah satu mata pelajaran yang mempelajari masa lampau inilah yang terkadang menyebabkan peserta kesulitan dalam mempelajari sejarah. Pembelajaran sejarah atau mata pelajaran sejarah pada kurikulum 2013 terbagi menjadi dua, yakni sejarah dan sejarah Indonesia. Peserta didik akan lebih memahami materi sejarah jika pada pembelajaran sejarah dikaitkan dengan kehidupan sehari-hari dan memanfaatkan sejarah yang ada di sekitar atau pada lingkungan peserta didik. Hal tersebut dapat dilakukan pada pembelajaran sejarah dengan memberikan atau menyisipkan materi sejarah dengan sejarah lokal (daerah). Pada pembelajaran sejarah jarang sekali sejarah lokal itu diberikan kepada peserta didik. Tuban merupakan salah satu kota yang mempunyai banyak sekali peristiwa-peristiwa sejarah. Letak geografisnya yang berada pada jalur pantai utara Jawa menyebabkan Tuban menjadi kota yang bersejarah pada masa Hindu dan masa Islam (Madya). Berdasarkan hal tersebut banyak sekali peristiwa-peristiwa sejarah lokal Tuban yang dapat dijadikan sebagai bahan ajar, sumber belajar, maupun media pembelajaran untuk menunjang mata pelajaran sejarah, namun pada kenyataannya masih banyak peristiwa-peristiwa sejarah di Tuban yang belum terkaji. Peneliti dalam penelitian ini menggunakan metode penelitian dan pengembangan (Research and Development/R n D) dengan menggunakan konsep penelitian dan pengembangan Sugiyono. Penelitian ini ditujukan untuk menghasilkan sumber belajar yang berupa buku teks dengan materi sejarah lokal Tuban yang berjudul “Keberadaan Sunan Bejagung (Kisah dan Peranannya). Pada penelitian dan pengembangan ini melalui 9 tahapan penelitian, yakni potensi dan masalah, pengumpulan data, desain produk, validasi desain, revisi produk, uji coba produk, revisi produk, uji coba pemakaian, dan revisi produk. Peneliti pada penelitian dan pengembangan ini menggunakan angket peserta didik untuk mengukur keefektivitasan produk dan menggunakan pretest dan posttest untuk mengetahui pemahaman peserta didik mengenai materi. Penelitian dan pengembangan ini dilakukan di kelas X MIA 2 MAN Tuban dengan 10 peserta didik pada uji coba produk (kelas kecil) dan 38 peserta didik untuk uji coba pemakaian (kelompok besar). Berdasarkan hasil penelitian dan pengembangan yang dilakukan oleh peneliti, maka dihasilkan angket peserta didik untuk menguji keefektivitasan produk pada kelas kecil dengan persentase sebesar 85,5 %. Pada kelompok besar dihasilkan persentase untuk keefektivitasan produk sebesar 82, 38% dan hasil rata-rata pretest dan posttest sebesar 36, 578 menjadi 91,052. Berdasarkan hasil penelitian dan pengembangan tersebut, maka produk yang dikembangkan sangat valid dan layak untuk digunakan pada pembelajaran untuk menunjang materi sejarah. Bagi peneliti lain diharapkan dapat melakukan penelitian lainnya yang terkait dengan sumber belajar maupun media belajar yang bermuatan sejarah lokal, agar dapat memperbaiki penelitian yang sudah ada dan memperjelas sumber belajar ini ataupun melakukan penelitian baru dengan pembahasan yang lain yang berkaitan dengan sejarah lokal.

Implementing the learning together strategy to improve the reading comprehension ability of the tenth graders of M.A. Raudlatut Thalabah Kediri / Sholihun

 

Unpublished Thesis, English Language Teaching, Graduate Program of State University of Malang. Advisors: (1) Dr. Johannes A. Prayogo, M. Ed, M.Pd (II) Dr. Suharmanto, M.Pd. Key words: implementing, reading comprehension, Learning Together strategy. Reading is an important part of language skills which must be taught in classes of Senior High Schools. In reading activities, the students are expected to be able to comprehend reading passages. In teaching reading at the tenth graders of MA Raudlatut Thalabah, the English teachers faced problems related to this skill. First, the interaction between students was low. Second, the reading activities were dominated by small minority of high achievers. Third, students' motivation was low. Meanwhile, based on the finding of the preliminary study, it was indicated that the teaching of reading at MA Raudlatut Thalabah is not satisfactory. Therefore, this research was designed to improve the students’ reading comprehension through the use of Learning Together Strategy. The objective of the study was to describe how Learning Together Strategy improved the reading comprehension ability of the tenth graders of MA Raudlatut Thalabah Kediri. Meanwhile, this study was focused on descriptive text as the text type which must be taught to the tenth graders of Madrasah Aliyah. The design of the study was Collaborative Classroom Action Research. In this design, the researcher and the collaborative teacher worked together in preparing a suitable procedure of Learning Together Strategy, designing the lesson plan, determining of the criteria of success, implementing the action, observing and doing reflections. The subjects of this research were 46 tenth graders of MA Raudlatut Thalabah, Kediri, East Java in the academic year 2008/2009. This research was conducted in 2 cycles, each of which consisted of two meetings. The data of the research were obtained from (1) observation sheet, which was used to obtain information about teacher’s and the students’ activities and performance during the implementation of Learning Together Strategy, (2) field notes, which were used to note the data, and (3) test, which was used to identify whether the students made progress or improved the reading comprehension ability or not. The result of the research showed that the implementation of Learning Together Strategy in the teaching and learning of reading comprehension can successfully improve the students’ comprehension skill. There were 4 steps in implementing the Learning Together Strategy, namely (1) Assigning the students to group by dividing students into group. Each group has a mixed of high, medium, and low achievers and both male and female students in each group. Then, giving the roles for the group members such as leader, reader, writer, checker, encourager, and helper, (2) Activating the students’ background knowledge. The teacher showed the pictures and asking the students to mention words that might be used in the text, (3) Encouraging the students to comprehend the text. The teacher asked the students to read the text silently, gave the model on how to read the text, asked the students to discus the content of the text, and encouraged the students to help each other. (4) Reviewing the reading activity. The teacher checked the students’ answers and making conclusion of the topic and gave reward for the best group. Based on the result of the research, it was indicated that this strategy has strength; particularly it can improve the reading comprehension of the students and in increasing the students’ involvement in teaching and learning of reading activities. The research findings indicated that the students were active during the reading activities and the students’ reading comprehension ability improves after the implementation of the action. The improvement was shown by the increase of the percentage of the students’ achievement in reading comprehension ability. Cycle 1 showed that the number of students who got the score of greater or equal to 65. There were 25 students out of 46 students or 54.35% gained the score of greater or equal to 65. Meanwhile, Cycle 2, the students who gained the score of greater or equal to 65 were 37 out of 46 students or 80.43%. It fulfilled the criterion of success in term of the score improvement. Whereas, the finding indicated that Learning Together Strategy was successful to empower students’ participation and motivation to be actively involved in the instructional process. The students were active in the class in terms of sharing ideas, reading, answering the questions, making groups, using Learning Together Strategy. Based on the findings of the study, it is suggested that the English teachers, the school and for the future researchers apply or implement Learning Together Strategy in teaching reading classes since the strategy can improve the students’ reading comprehension ability. For English teachers are recommended also to employ Learning Together Strategy in order to be able to teach reading comprehension effectively. English teachers should organize the groups by considering the students’ achievement levels. Meanwhile, they should implement the strategy as alternatives strategies in English instruction to make the students are interested and motivated in attending the teaching learning activities. For the school, this strategy is suggested to provide special lesson time for students to practice the reading comprehension, which can be done for their intra curricular activities or extra curricular activities. For the future researchers, this strategy was as like small group setting, so that they should well known the principal of Learning Together Strategy.

Pengembangan paket pelatihan keterampilan keterbukaan diri siswa SMU
oleh Himyatul Amanah

 

ABSTRAK AmanahH,i myatul2. 002.l' en gen thangaPn ak et l)c I u ti l tun KeI e r um pr I u t t KeterhukuaDni ri SiswaS Mtl SkripsiJ, urusanB imbinganK onselingd an PsikologFi IPU niversitaNs egeriM alang.P embimbing(: 1 ) Dra.N ur HidayahM, Pd,( lI) Drs.L utfi FauzanM, .Pd, Katak unci:K eterbukaadni ri, hubungaann tarpribadi. Manusiaa dalahm akhlukin dividud ans osialS. ebagami akhlukin dividud an sosiaml anusibae rhubungadne ngano rangl ain.H ubungany angd imaksudy aitu hubungapnr ibadih, ubungabne lajarh, ubungasno siald, anh ubunganp ekerjaan Sebagcaoi ntohs istemc arab elajars iswaa ktif (CBSA)y angd iterapkadni sekolahsekolahm enuntust iswau ntukb isaa ktif. Keaklifan perlud iimbangtd engan kemampuakne ilmuannysae rtak eterampilakno munikasyia ngb aik.K omunikasi yangd imaksuda dalahk eterbukaadni ri. Sisway angt erbukaa kana ktif bertanya, menjawabd,a nb erhubungaann tarpribadi. Tujuan penelitianin i untukm enghasilkadnr af PaketP elatihanK eterampilan KeterbukaaDni ri (PPKKD),s edangkadnr af PPKKD bertujuanu ntukm emberikan pengalamabna gis iswas upayas iswam emahammi aknak eterbukaadnir i, mengetahui bagaimancaa ra bersikapte rbuka,b erucapte rbuka,m engetahumi anfaatk eterbukaan diri,d ans elanjutnyasi swad apatb erhubungaann tarpribadi. Modelp engembangyaann gd igunakana dalahm odelp roseduraMl. odel prosedurmale nuruDt ick danC arey( 1985)m engemukakating at ahapp enilaianya itu (1)penilaiapne roranga(n2 ) penilaiank elompokk ecit( 3) penilaianla panganP.a da pengembangianni penelitid apatm elaksanakapna dat ahapp ertamad engant iga langkahy aitu( I ) penyusunand rafPPKKD (2) uji ahli (3) revisid rafpaketl engkap. Penilapi aket 4 oranga hli. Ahli tersebuta dalah2o rangd osenB imbingan, seorang guruB ahasaIn donesiad, ans eorangd osenT eknologiP endidikan(T EP) Datay ang diperoleha dalahd atak ualitatif dank uantitatif.S edangkatne knik pengumpuladna ta melaluwi awancarad ana ngket.W awancarad ilaksanakank etikak onsultasdi engan keduao rangd osenp ernbimbings ertak etikab erkonsultasdi enganp araa hli dengan caram encatatA. ngkety angd iberikant erdiri atasd raf PPKKD danf ormatu ji ahli. Paraa hli memberikanp enilaians esuaki ompetensyi angd irniliki yaitu ahli bimbingan menilaki ualitasis i draf PPKKD,a hli bahasam enilaik ualitasb ahasad raf PPKKD. dana hli pembelajaramn enilaik ualitasr ancangand raf PPKKD. Draf PPKKD ini merupakana daptasdi ari modelJ ohnson(1 990)y angb erisi9 pelatihanya itum embinah ubunganp, engenalana ma,p emberiann ama,b erbagi nasal alu,h ubungapne rsahabatakne,s adaradni ri, daerahy angb elumd ikenali, wawancarafa, ntasi.D ataP PKKD ini dianalisisd engana nalisisd eskriptif yaitu melaluip erhitunganp ersentasdea ri penilaianp araa hli. l l Hasila nalisisp ersentasdea ri ke 4 ah 3 (sesuaai)d alah2: orangahlib imbingan.de dinilayi aituu raianp enjelasaunm um,u ralar dibenkasne suadi enganu murs iswaS MU, ; raktu Yangd isediakante rhadaP relatihanu' raianr asionalp aketp elatihan' han.u raianb alikanlF eedbac'f tu ratan rand iri. Seorangahblia hasa7 l % rded alamk alimat,h ubungank alimat iran utama unluk setiap paragrap' sifat )an seoranga hli pembelajaran8 3 %o bahasad,a nr ancangadnr afPPKKD. Sedangkaknu alifikasik etetapanm enunjukkan bahwak ategorsi esuabi eradaa ntan7 0 ,1Vo'9 0o/o resimputand raf ppKKD ini dapatd idugam emiliki kesesuaiaunn tuk dilatihkanp adas iswaS MU dalamm eningkatkanke terampilank eterbukaand iri Draf PPKKDju gam erupakanm ediaa lternatifu ntukm eningkatkank eterampilan hubungaann tarpribadsi iswaS MU. keterbatasan draf PPKKD ini yaitu baru pada uji teoretik dan draf PPKKD efektitapabilad ilatihkano leh pakard alarnb idang komunikasai taup elatihy ang berpengalamdaenm ikianju ga ke subjekp engembangD.i harapkana day ang melanjutkapne nelitianin i padau ji lapanpn.

Pengembangan buku permainan lape di Kabupaten Dompu Pulau Sumbawa Nusa Tenggara Barat / M. Syamsurizal

 

Kata kunci: Pengembangan, Permainan, Buku Permainan Lape. Hingga saat ini, buku dianggap sebagai salah satu media tulisan yang dapat digunakan untuk mempromosikan dan mengenalkan semua jenis kebudayaan yang ada di Indonesia. Pertimbangannya pemilihan buku sebagai media untuk mempromosikan budaya tersebut dikarenakan buku memiliki banyak keuntungan: sederhana, mudah diakses dan mudah untuk diletetakkan dimana saja. Salah satu kebudayaan yang dapat direpresentatifkan dalam bentuk sebuah buku adalah permainan “Lape”. Permainan “Lape” itu sendiri berasal dari Nusa Tenggara Barat (NTB), terutama di kabupaten Dompu dan Bima. Permainan “Lape” hampir mirip dengan bulutangkis. Perbedaan diantara kedua permainan/olahraga ini hanya terdapat pada jenis alat pemukul dan bola (kok) yang digunakan. Alat pemukul yang digunakan dalam permainan “Lape” terbuat dari kayu yang bentuknya menyerupai dayung sampan dan bola (kok) terbuat dari karet dan bulu unggas yang berwarna putih. Tujuan yang ingin dicapai adalah mempopulerkan permainan lape yang belum diketahui oleh masyarakat luas dalam bentuk buku. Dalam penelitian ini model pengembangan dari sepuluh langkah penelitian pengembangan dari Borg and Gall (1983:775), peneliti tidak menggunakan keseluruhan tetapi hanya menggunakan 7 langkah. Adapun 7 langkah yang dipilih oleh peneliti untuk pengembangan buku permainan lape di kabupaten Dompu adalah sebagai berikut: 1) riset dan pengumpulan informasi dalam melakukan penelitian awal atau analisis kebutuhan (need assesment) dengan angket yang ditujukan kepada 15 masyarakat Dompu, serta wawancara kepada tokoh-tokoh masyarakat, 2) pengembangan rancangan produk, 3) evaluasi para ahli dengan menggunakan 1 ahli permainan, 1 ahli media pembelajaran, yang menghasilkan berupa produk awal, 4) revisi rancangan produk berdasarkan evaluasi para ahli (hasil rancangan produk berupa produk awal) dan uji coba lapangan pada kelompok kecil, 5) revisi hasil dari uji coba lapangan pada kelompok kecil, 6) uji coba lapangan pada kelompok besar, 7) revisi dari hasil uji coba lapangan pada kelompok besar kemudian menjadi produk akhir berupa buku permainan lape di Kabupaten Dompu Pulau Sumbawa Nusa tenggara barat. Lokasi penelitian adalah di Kelurahan Simpasai, Kelurahan Kandai II, Kelurahan Monta Baru dan Desa Wawonduru di Kecamatan Woja Kabupaten Dompu. Subjek uji coba dalam pengembangan buku permainan lape di kabupaten Dompu ini terdiri dari (1) tinjauan ahli, terdiri dari seorang ahli permainan dan seorang ahli media, (2) mayarakat Kecamatan Woja dari empat Kelurahan/desa di Kabupaten Dompu sebagai kelompok uji coba dengan jumlah 12 masyarakat untuk uji coba kelompok kecil dan 30 masyarakat untuk uji kelompok lapangan. Teknik pengumpulan data menggunakan instrument untuk para ahli serta pedoman pertanyaan untuk masyarakat. Analisis data yang digunakan adalah analisis deskriptif dengan menggunakan persentase. Hasil pengembangan buku permainan lape di Kabupaten Dompu ini memenuhi kriteria sangat baik untuk ahli media (83,52%), memenuhi kriteria sangat baik untuk masyarakat pada uji coba kelompok kecil adalah (80,78%) dan uji coba lapangan adalah (82,55%). Ini berarti pengembangan buku permainan lape di kabupaten Dompu dapat digunakan di masyarakat Dompu khususnya di Kecamatan Woja. Berdasarkan penelitian ini, disarankan agar dilakukan uji coba secara berulang-ulang pada subjek yang lebih besar.

Developing multimedia based listening material for 1st grade student of SMK / Rahmati Putri Yaniafari

 

Kata Kunci: CD interaktif, Multimedia, Courseware, Listening, Materi belajar mandiri. Listening comprehension umumnya dianggap memiliki peran kunci dalam pembelajaran/akuisisi bahasa. Listening comprehension memberi para pelajar informasi yang digunakan dalam membangun pengetahuan yang diperlukan dalam penggunaan bahasa. Ketika pengetahuan dibentuk, siswa dapat mulai berbicara. Periode dimana pelajar hanya mendengarkan saja merupakan waktu untuk pengamatan dan pembelajaran yang menyediakan dasar untuk keterampilan bahasa yang lain (Nation dan Newton, 2009). Materi listening berbasis multimedia seperti listening courseware diyakini sebagai media yang baik untuk membantu siswa belajar listening. Sebagai lembaga pendidikan yang bertanggung jawab dalam mendidik sumber daya manusia dengan kompetensi akademik dan kompetensi profesi khusus, Sekolah Menengah Kejuruan (SMK) sebaiknya mendidik siswa untuk memiliki kompetensi dalam bahasa Inggris terkait dengan kompetensi karir masa depan mereka termasuk keterampilan listening. Karena itu, tujuan dari penelitian ini adalah untuk mengembangkan materi listening berbasis multimedia untuk siswa kelas 1 SMK Jurusan Akomodasi Perhotelan yang berguna untuk digunakan dalam belajar mandiri. Penelitian dan pengembangan (R & D) ini mengadopsi kerangka model pengembangan Koper (1995). Prosedur pengembangan ini dimulai dengan prapenelitian yang bertujuan membuat desain umum dari program yang nantinya akan menjadi perencanan pembelajaran. Fase berikutnya adalah fase definisi. Pada fase ini, rencana proyek per aplikasi media diciptakan dimana perencanaan dibuat secara lebih rinci daripada di fase sebelumnya. Tahap ketiga adalah scripting. Kunci dari fase scripting adalah menemukan berbagai skrip yang dibutuhkan dalam mewujudkan hasil desain yang diinginkan. Tahap penutup adalah realisasi teknis. Untuk membuat produk akhir, fase ini harus diselesaikan, yang terdiri dari editing komponen audio visual, desain teknis, validasi, dan uji coba produk. Kemudian, proses dilanjutkan ke evaluasi produk yang terdiri dari validasi ahli materi, validasi ahli media, validasi guru, dan uji coba produk. Berdasarkan evaluasi produk, media ini kemudian direvisi untuk mendapatkan hasil terbaik. Produk akhir dari penelitian ini adalah sebuah paket CD untuk belajar listening. Aplikasi tersebut berisi tujuh materi listening yang tersebar di lima unit. Setiap unit terdiri dari sesi pre-listening yang berisi konteks materi listening dan glosarium, sesi while-listening yang berisi materi utama dalam bentuk video atau audio dan latihan untuk mengecek pemahaman peserta didik, sedangkan sesi terakhir post-listening berisi penelaahan materi. Desain keseluruhan media dibuat menyerupai simulasi game untuk meningkatkan minat siswa. Dalam uji coba produk, para siswa tampak antusias dalam belajar listening menggunakan materi berbasis multimedia. Mereka menganggap bahwa materi dan teks yang digunakan pada media sudah cukup jelas. Mereka juga menegaskan bahwa penyajian media sangat menarik. Penggunaan materi listening berbasis multimedia ini diharapkan dapat memenuhi kebutuhan materi listening siswa SMK kelas 1 Jurusan Akomodasi Perhotelan. Media ini diharapkan dapat meningkatkan minat dan motivasi siswa dalam belajar bahasa Inggris dan meningkatkan keterampilan listening mereka.

Pergeseran kepemimpinan lahan pertanian apel dan pengaruhnya terhadap kehidupan ekonomi masyarakat desa Bumiaji Kota Batu (1997-2003) / oleh Sa'diyah Nuraini

 

Peran orang tua dalam mengembangkan kecerdasan interpersonal anak usia dini di pos PAUD Pelangi Kelurahan Polowijen Kecamatan Blimbing Malang / Farah Hanifatul Mukaromah

 

Kata Kunci: peran orang tua, kecerdasan interpersonal, anak usia dini Kecerdasan Interpersonal merupakan ke¬mampuan untuk memahami dan bekerja sama dengan orang lain. Ke¬cerdasan ini terutama menuntut kemampuan untuk menyerap dan tanggap terhadap suasana hati, perangai, niat, dan hasrat orang lain. Seseorang yang mempunyai kecerdasan antarpribadi bisa mempunyai rasa belas kasihan dan tanggung jawab sosial yang besar. Pengembangan kecerdasan interpersonal penting bagi anak dikarenakan akan menjadi dasar saat anak bergaul dengan teman serta lingkungan. Masa awal-awal usia anak merupakan masa yang penting dalam tahap pertumbuhan dan perkembangan seorang manusia. Karena pada masa ini dimulainya pertumbuhan dasar yang akan mempengaruhi dan menentukan perkembangan anak selanjutnya. Peran orang tua dalam perkembangan kecerdasan interpersonal anak sangat dibutuhkan, karena orang tua adalah anggota keluarga yang paling dekat dibandingkan anggota keluarga yang lain. Sehingga orang tua dapat mendampingi dan mengembangkan kecerdasan interpersonal anak semaksimal mungkin. Perhatian orang tua yang baik terhadap perkembangan kecerdasan interpersonal anak usia dini dapat menjadikan anak tumbuh dengan optimal. Berkaitan dengan itu, maka diperlukan pembahasan mengenai peran orang tua dalam mengembangkan kecerdasan interpersonal anak usia dini. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal, yang mencakup perkembangan kecerdasan interpesonal anak usia dini di Pos PAUD Pelangi, peran orang tua dalam mengembangkan kecerdasan interpersonal anak usia dini di Pos PAUD Pelangi, dan hambatan-hambatan yang dihadapi orang tua dalam mengembangkan kecerdasan interpersonal anak usia dini di Pos PAUD Pelangi. Penelitian ini menggunakan metode deskriptif kuantitatif. Deskriptif karena penelitian ini bertujuan mendeskripsikan atau menggambarkan tentang peran orang tua dalam pengembangan kecerdasan bahasa anak usia dini dalam bentuk uraian atau narasi dan kuantitatif karena bertujuan memperoleh dukungan data berupa data kuantitatif dari lapangan. Populasi yang diambil adalah seluruh orang tua peserta didik Pos PAUD Pelangi yang berjumlah 25 orang, maka teknik pengambilan sampelnya adalah dengan menggunkan total sampling, yaitu seluruh orang tua peserta didik di Pos PAUD Pelangi. Teknik analisis data yang digunakan dalam penelitian ini adalah deskriptif dengan menggunakan persentase. Hasil penelitian ini menunjukkan bahwa (1) kecerdasan interpersonal anak usia dini di Pos PAUD Pelangi adalah kurang baik, hal ini ditunjukkan dengan nilai tertinggi ada pada jawaban sering dengan persentase 38,6% dan masuk dalam klasifikasi kurang baik. (2) peran orang tua dalam mengembangkan kecerdasan interpersonal anak pada umumnya cukup baik, hal ini ditunjukkan dengan nilai tertinggi ada pada jawaban sering dengan persentase 53,6% dan masuk dalam klasifikasi cukup baik. (3) hambatan-hambatan orang tua dalam mengembangkan kecerdasan interpersonal anak usia dini yang ditemukan dalam penelitian ini adalah emosi anak, emosi orang tua, lingkungan keluarga, dan lingkungan sekolah yang sebagian besar responden menjawab iya, sedangkan teman sebaya tidak menjadi penghambat dalam perkembangan kecerdasan interpersonal anak usia dini dibuktikan dengan 92% responden menjawab tidak. Saran dari peneliti adalah (1) bagi lembaga Pos PAUD Pelangi, disarankan dapat menjadi media perantara dalam memberi informasi tentang perkembangan anak didik, terutama kecerdasan interpersonal anak didik kepada orang tua, serta lembaga memberikan informasi terkait dengan pendidikan anak usia dini kepada orang tua, (2) bagi orang tua, sebagai pendidik utama dan pertama bagi anak dalam mengembangkan seluruh potensi, terutama kecerdasan interpersonal anak, para orang orang tua disarankan memperhatikan dan berperan aktif dalam setiap perkembangan anak. Orang tua disarankan senantiasa menambah ilmu atau wawasan tentang perkembangan anak usia dini, (3) bagi peneliti lanjutan, disarankan ada penelitian lanjutan yang membahas tentang peran orang tua dalam pengembangan kecerdasan interpersonal anak usia dini lebih mendalam lagi, karena peneliti merasa belum sempurna dalam penulisan skripsi ini dan banyak kekurangannya, sehingga memerlukan peneliti lanjutan untuk menyampurnakan penelitian ini.

Pengembangan trainer PLC portable Paket Keahlian teknik Otomasi Industri di SMKN 1 Singosari / Nahwan Hadi Nopsi Zikri

 

ABSTRAK Hadi Nopsi Zikri, Nahwan. 2015. Pengembangan Trainer PLC Portable Program Keahlian Teknik Otomasi Industri di SMKN 1 Singosari. Skripsi, Jurusan Teknik Elektro. Program Studi Pendidikan Teknik Elektro. Universitas Negeri Malang. Pembimbing: (1) Drs. Slamet Wibawanto, M.T. (2) Drs. Puger Honggowiyono, M.T. Kata Kunci: Pengembangan, Trainer, PLC, Portable. PLC merupakan salah satu sub bahasan yang terdapat pada silabus paket keahlian Teknik Otomasi Industri di SMKN 1 Singosari. Berdasarkan hasil wawancara, pak Syamsul selaku guru di SMK menyatakan bahwa sekolah masih kekurangan media pembelajaran PLC. Sekolah juga masih memerlukan pengembangan terhadap media pembelajaran, selain itu trainer yang digunakan di sekolah memiliki fisik yang besar, tentunya akan sangat sulit untuk dipindahkan serta membutuhkan tempat penyimpanan yang cukup luas dan otomatis akan mudah terkena debu dan cepat kotor sehingga alat akan cepat rusak. Tujuan dari pengembangan trainer ini adalah mengembangkan dan menghasilkan sebuah trainer PLC Portable yang layak untuk digunakan sebagai media pembelajaran, menguji tingkat kelayakan trainer apakah sudah layak atau belum melalui uji coba pembelajaran pada kelompok kecil dan kelompok besar, dan media pembelajaran yang dikembangkan nantinya dapat membantu siswa dalam pembelajaran pada saat praktikum tentang PLC. Prosedur penelitian dan pengembangan yang digunakan adalah model pengembangan ADDIE, adapun prosedurnya yaitu: (1) Kegiatan analisis dibagi menjadi dua yaitu analisis kinerja dan analisis kebutuhan; (2) Desain, pada tahapan desain hal yang dilakukan adalah merumuskan tujuan pembelajaran dan menyusun desain produk; (3) Development atau pengembangan produk dibuat berdasarkan desain yang telah dibuat sebelumnya; (4) Implementation, produk yang sudah dibuat diimplementasikan di dalam kelas; (5) Evaluasi, tujuan dari tahap evaluasi adalah menilai kualitas produk instruksional dan proses, baik sebelum dan sesudah implementasi untuk menentukan tingkat kelayakan produk. Hasil Validasi yang telah dilakukan oleh ahli dan responden antara lain: (1) dari Ahli media sebanyak 98,61%; (2) dari ahli materi sebanyak 90%; (3)dari Ujicoba Kelompok Kecil sebanyak 90,12% dan; (4) dari Ujicoba Kelompok Besar sebanyak 90,02%. Berdasarkan Hasil Validasi dan Ujicoba yang telah dilakukan, dapat disimpulkan bahwa Trainer PLC Portabel Program Keahlian Teknik Otomasi Industri di SMKN 1 Singosari dinyatakan layak digunakan sebagai media pembelajaran.

Pengaruh penggunaan modul pembelajaran kimia berbasis learning cucle 5-E pada materi koloid terhadap hasil belajar siswa kelas XI semester 2 MAN Malang II Kota Batu / Laksmi Dwi Agustina

 

Kata Kunci: modul, Learning Cycle 5-E, hasil belajar, koloid Keberhasilan dalam suatu proses pembelajaran dapat dilihat dari meningkatnya kemampuan belajar siswa secara mandiri, sehingga siswa dapat menguasai materi yang dipelajari dan mendapatkan hasil belajar yang maksimal sesuai dengan apa yang dikuasai. Model pembelajaran Learning Cycle 5-E merupakan salah satu alternatif model pembelajaran konstruktivistik yang banyak melibatkan siswa dalam proses pembelajaran yaitu dengan menuntun siswa untuk memperoleh pengetahuannya sendiri dengan melewati beberapa fase dalam setiap pembelajaran yaitu fase engagement, exploration, explanation, elaboration, dan evaluation. Untuk mendukung keterlaksanaan model pembelajaran supaya lebih efektif dan efisien maka diperlukan adanya suatu sumber belajar yang relevan, salah satunya yaitu berupa modul pembelajaran yang berbasis Learning Cycle 5-E. Tujuan penelitian adalah untuk mengetahui perbedaan hasil belajar siswa yang belajar dengan menggunakan model pembelajaran Learning Cycle 5-E dengan berbantuan modul dan siswa yang belajar dengan model pembelajaran Learning Cycle 5-E tanpa berbantuan modul dalam materi koloid. Penelitian yang dilakukan merupakan penelitian eksperimen dengan menggunakan rancangan eksperimental semu (quasy experimental design) dengan model desain posttest only control group design. Sampel penelitian adalah siswa kelas XI IPA 2 dan kelas XI IPA 3 MAN Malang II Kota Batu tahun pelajaran 2011/2012 yang dipilih secara acak untuk menentukan kelas eksperimen dan kelas kontrol. Penelitian menggunakan dua macam instrumen yaitu instrumen perlakuan dan instrumen pengukuran. Instrumen perlakuan meliputi rencana pelaksanaan pembelajaran (RPP) dan modul pembelajaran berbasis Learning Cycle 5-E. Instrumen pengukuran berupa tes untuk mengukur hasil belajar siswa dan lembar observasi untuk mengetahui keterlaksanaan pembelajaran. Analisis data hasil belajar siswa dilakukan dengan uji hipotesis dengan menggunakan bantuan SPSS 16.0 for Windows. Uji hipotesis menggunakan perhitungan Independent Sample T-Test dengan nilai probabilitas sebesar 0,05. Berdasarkan hasil analisis dapat disimpulkan bahwa terdapat perbedaan hasil belajar antara siswa yang belajar dengan model pembelajaran Learning Cycle 5-E dengan berbantuan modul dan siswa yang belajar dengan model pembelajaran Learning Cycle 5-E tanpa berbantuan modul. Nilai rata-rata hasil ulangan harian untuk siswa yang belajar dengan model pembelajaran Learning Cycle 5-E dengan berbantuan modul adalah 80,15 dan siswa yang belajar dengan model pembelajaran Learning Cycle 5-E tanpa berbantuan modul adalah 75,23. Hasil penelitian didukung oleh hasil uji hipotesis dimana diperoleh nilai probabilitas yaitu 0,013 < 0,05 dan nilai thitung > ttabel yaitu 2,588 > 2,008.

Pengaruh strategi pembelajaran kontekstual tipe kolaboratif vs ekspositori dan motivasi berprestasi terhadap hasil belajar deiksis wacana / Alex Djawa

 

PENGARUH STRATEGI PEMBELAJARAN KONTEKSTUAL TIPE KOLABORATIF VS PEMBELAJARAN EKSPOSITORI DAN MOTIVASI BERPRESTASI TERHADAP HASIL BELAJAR DEIKSIS WACANA Alex Djawa, I Wayan Sudana Degeng1, Utami Widiati2, Anselm J. E. Toenlioe3 Teknologi Pembelajaran, Sekolah Pascasarjana, Universitas Negeri Malang E-Mail:adjawa61@gmail.com. Abstrak: Penelitian ini menggunakan dua strategi pembelajaran, yaitu strategi pembelajaran kontekstual tipe kolaboratif vs pembelajaran ekspositori. Dalam aplikasi untuk pebelajar ternyata strategi pembelajaran kontekstual tipe kolaboratif lebih unggul dibandingkan dengan ekspositori. Penelitian ini bertujuan untuk mengetahui (1) perbedaan hasil belajar antara kelompok pebelajar yang diberi perlakuan dengan menggunakan strategi pembelajaran kontekstual tipe kolaboratif dan menggunakan strategi pebelajaran ekspositori. (2) perbedaan hasil belajar antara kelompok pebelajar dengan motivasi berprestasi tinggi dan kelompok pebelajar dengan motivasi berprestasi rendah. (3) Interaksi antara strategi pembelajaran dan motivasi berprestasi terhadap hasil belajar deiksis wacana. Instrumen yang digunakan adalah instrumen tes dan angket. Dari analisis menggunakan Anova ditemukan F hitungan 8367 dengan nilai yang signifikan probabilitas 0,004. Signifikansi nilai probabilitas di bawah tingkat signifikansi 0,05. Oleh karena itu, dapat disimpulkan bahwa Ho ditolak. Artinya, ada perbedaan yang signifikan antara pembelajaran kontekstual tipe kolaboratif vs pembelajaran espositori terhadap hasil belajar deiksis wacana Kata Kunci: pembelajaran kontekstual, kolaboratif, ekspositori, motivasi berprestasi, hasil belajar

Pengaruh informasi laba, total arus kas, dan opini audit going concern terhadap harga saham pada perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia periode 2007-2009 / Nani Hakim Mariana

 

Kata Kunci : Informasi Laba, Total Arus Kas, Opini Audit Going concern dan Harga Saham Perusahaan selalu menginginkan agar harga saham selalu meningkat. Hal ini dapat terjadi jika perusahaan menyampaikan informasi mengenai kondisi perusahaan kepada investor luar. Informasi yang disampaikan oleh perusahaan bisa berupa laporan keuangan yang telah diaudit oleh auditor yang didalamnya terdapat informasi tentang laba perusahaan, arus kas perusahaan serta laporan auditor independen yang memuat opini auditor. Penelitian ini dilakukan untuk menguji pengaruh informasi laba, total arus kas, opini audit going concern secara parsial dan simultan terhadap harga saham. Populasi dari penelitian ini adalah perusahaan manufaktur yang listing di BEI tahun 2007-2009. Pengambilan sampel dilakukan dengan menggunakan teknik purposive sampling, yaitu perusahaan manufaktur yang terdaftar di BEI selama periode 2007-2009, menerbitkan laporan keuangan auditan selama periode pengamatan, dan memiliki catatan harga saham yang lengkap. Data yang digunakan adalah data sekunder, berupa laporan keuangan. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi linier berganda. Hasil analisis menunjukkan bahwa secara parsial variabel informasi laba, total arus kas dan opini audit going concern berpengaruh secara signifikan terhadap harga saham. Untuk pengujian secara simultan variabel informasi laba, total arus kas, opini audit going concern berpengaruh signifikan terhadap harga saham. Hal ini menunjukkan bahwa ketiga variabel ini dianggap sebagai sinyal yang dapat digunakan dan merupakan faktor-faktor yang dapat dijadikan pertimbangan bagi investor dalam menetapkan keputusan investasi sehingga dapat meningkatkan harga saham. Dianjurkan untuk penelitian selanjutnya, menggunakan faktor lain yang bisa mempengaruhi harga saham, menggunakan sampel yang berbeda menggunakan metode lain, serta memperpanjang tahun penelitian.

Analisis pengaruh kualitas layanan terhadap tingkat kepuasan konsumen : studi kasus pada konsumen PT. Pos Indonesia (Persero) Tulungagung / oleh Livianti Agustina

 

Hubungan minat baca dengan motivasi memilih program studi Pendidikan Bahasa, Sastra Indonesia, dan Daerah mahasiswa tingkat I Universitas Negeri Malang angkatan 2011 / Budi Setyarini

 

Kata kunci: minat baca, motivasi memilih Program Studi. Membaca merupakan hal yang tidak dapat diabaikan begitu saja karena dengan membaca akan diperoleh pengetahuan, pengertian, daya pikir, dan memperoleh sikap hidup yang baik untuk menjadi warga negara yang berguna bagi masyarakat. Sedangkan motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah merupakan salah satu faktor yang menentukan keberhasilan mahasiswa dalam menguasai mata kuliah yang ditempuhnya. Motivasi sangat berperan dalam rangka pencapaian tujuan. Suatu perbuatan akan berhasil bila didasarkan motivasi pada diri seseorang tersebut. Seseorang dapat dipaksa untuk melakukan suatu perbuatan tetapi ia tidak mungkin dipaksa untuk menghayati perbuatan itu sebagaimana mestinya. Begitu pula dalam memilih Prodi tanpa adanya minat baca dan motivasi dari diri mahasiswa untuk mempelajari Prodi yang akan ditempuhnya, maka dia akan sulit untuk mempelajari matakuliah yang ditempuhnya di program studi (Prodi) yang telah dipilih. Penelitian ini bertujuan untuk mengetahui bagaimana hubungan antara minat baca dengan motivasi memilih Program Studi Pendidikan Bahasa, Sastra Indonesia, dan Daerah. Penelitian ini dilakukan pada mahasiswa tingkat I Program Studi Pendidikan Bahasa, Sastra Indonesia, dan Daerah dengan sampel berjumlah 32 mahasiswa yang diperoleh dengan metode proporsional random sampling. Metode analisis yang digunakan adalah deskriptif korelasional dengan bantuan software program SPSS 17.00 for Windows. Hasil penelitian menunjukkan bahwa: (1) korelasi antara faktor personal minat baca dengan faktor internal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011 menghasilkan nilai r = 0,756; p = 0,000 < 0,05, berarti ada hubungan signifikan antara faktor personal minat baca dengan faktor internal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011, (2) korelasi antara faktor institusional minat baca dengan faktor internal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011 menghasilkan nilai r = 0,697; p = 0,000 < 0,05, berarti ada hubungan signifikan antara faktor institusional minat baca dengan faktor internal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011, (3) korelasi antara faktor personal minat baca dengan faktor eksternal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011 menghasilkan nilai r = 0,763 dengan p = 0,000 < 0,05, berarti ada hubungan signifikan antara faktor personal minat baca dengan faktor eksternal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011, (4) korelasi antara faktor institusional minat baca dengan faktor eksternal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011 menghasilkan nilai r = 0,672 dengan p = 0,000 < 0,05, berarti ada hubungan signifikan antara faktor institusional minat baca dengan faktor eksternal motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011, dan (5) korelasi antara faktor-faktor minat baca dengan faktor-faktor motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011 menghasilkan nilai Rhitung 0,839 > Rtabel 0,449 ; p = 0,000 dan nilai R2 = 0,704, berarti ada hubungan signifikan dan sumbangan 70,4% dari minat baca dengan motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah tingkat I angkatan 2011. Dari hasil penelitian, dapat disarankan bagi calon mahasiswa agar (1) memperhatikan minat baca sesuai dengan faktor-faktor minat baca untuk menentukan Program Studi di Jurusan Sastra Indonesia karena sesuai dengan minat efektivitas studi bisa dicapai dengan baik dan proses studi bisa lebih lancar, (2) bisa menyiasati perkembangan proses studinya, dan (3) mengembangkan potensi diri terhadap berbagai matakuliah khususnya untuk matakuliah mayor dan minor secara lebih optimal. Diharapkan kepada Program Studi Pendidikan Bahasa, Sastra Indonesia, dan Daerah ketika menjaring mahasiswa baru memperhatikan minat baca calon mahasiswa dengan cara interview. Bagi guru disarankan untuk mengondisikan minat baca siswa melalui berbagai kegiatan pembelajaran membaca. Minat baca dapat tumbuh dan berkembang sehingga dapat bermanfaat bagi studi lanjut. Peneliti selanjutnya diharapkan lebih banyak menggali atau meneliti tentang faktor-faktor lain yang mempengaruhi motivasi memilih Prodi Pendidikan Bahasa, Sastra Indonesia, dan Daerah. Tujuannya agar diperoleh hasil penelitian yang lebih lengkap.

Perbedaan pembelajaran kooperatif model Group Investigation (GI) dan model jigsaw terhadap peningkatan prestasi belajar fisika siswa kelas VIII SMP Negeri 2 Arjasa / Suharno Wahyudi

 

Kata kunci: Pembelajaran kooperatif, model GI (Model Group Investigation), prestasi belajar. Proses pembelajaran yang diterapkan oleh guru dikelas sangat berpengaruh terhadap keberhasilan siswa dalam belajar. Rendahnya prestasi belajar siswa merupakan indikasi pembelajaran yang belum optimal. Hal ini dipengaruhi oleh banyak faktor diantaranya penggunaan metode pembelajaran yang kurang tepat. Oleh karena itu perlu adanya metode yang dapat meningkatkan prestasi belajar siswa yaitu salah satunya dengan menggunakan metode kooperatif model GI (Group Investigation) dan model Jigsaw. Penelitian ini bertujuan untuk mengetahui perbedaan pembelajaran kooperatif model GI (Group Investigation) dan model pembelajaran Jigsaw terhadap prestasi belajar fisika siswa kelas VIII SMP Negeri 2 Arjasa, Situbondo yang terdiri dari kelas VIII-A sebagai kelas eksperimen dan kelas VIII-B sebagai kelas pembanding. Jenis penelitian ini adalah penelitian eksperimen. Instrumen pengumpulan data yang digunakan berupa tes prestasi fisika siswa yang diberikan saat pra-tes dan pasca-tes. Teknik analisis yang digunakan adalah uji-t untuk data prestasi belajar dengan bantuan komputer program SPSS 16.0 for Windows. Hasil penelitian menunjukkan bahwa nilai rata-rata Post-tes prestasi belajar fisika kelas eksperimen tidak lebih tinggi dibandingkan kelas pembanding. Hasil rata-rata nilai akhir kelas eksperimen sebesar 72.17. Sedangkan rata-rata nilai akhir kelas pembanding sebesar 69.95. Hal ini dapat dilihat dari hasil analisis uji-t menggunakan Independent Sample T-Test, thitung = 0.549 dengan df sebesar 44 dan taraf signifikansi 5% lebih kecil dari ttabel (t44;.05 = 1.680). Sehingga dapat disimpulkan bahwa pembelajaran kooperatif model GI (Group Investigation) tidak berpengaruh lebih besar daripada model pembelajaran model Jigsaw khusus pada pokok bahasan pesawat sederhana terhadap prestasi belajar fisika siswa.

Hubungan antara career self efficacy dan pengambilan keputusan karier siswa kelas XI SMA Negeri di Kabupaten Probolinggo / Qori Rizka Rizkiana

 

Kata kunci : career self efficacy, pengambilan keputusan karier Siswa SMA sebagai remaja hanya perlu diberi bimbingan karier agar dapat menguasai keterampilan keputusan karier secara tepat. Remaja belajar dan berlatih membuat rencana, memilih alternatif keputusan, bertindak sesuai dengan hasil keputusannya sendiri serta bertanggung jawab atas apa yang telah dilakukannya. Siswa yang memiliki keterampilan pengambilan keputusan, tidak akan bingung menghadapi karier masa depannya. Rumusan masalah dalam penelitian ini adalah: (1) Bagaimana tingkat career self efficacy siswa kelas XI SMA Negeri di Kabupaten Probolinggo? (2) Bagaimana pengambilan keputusan karier siswa kelas XI SMA Negeri di Kabupaten Probolinggo? (3) Apakah ada hubungan antara career self efficacy dengan pengambilan keputusan karier pada siswa kelas XI SMA Negeri di Kabupaten Probolinggo?. Penelitian ini menggunakan rancangan penelitian deskriptif korelasional. Populasi dalam penelitian ini adalah siswa kelas XI SMA Negeri di Kabupaten Probolinggo tahun pelajaran 2010/2011. Pengambilan sampel menggunakan teknik multistage random sampling. Tahap pertama dari 17 SMA Negeri yang ada di Kabupaten Probolinggo ditentukan 4 sekolah dan diambil secara random dengan teknik undian. Tahap berikutnya dari setiap sekolah yang terpilih sebagai kelompok sampel, selanjutnya ditentukan jumlah subyek yang dijadikan anggota sampel, dan juga diambil secara random dengan teknik undian. Peneliti mengambil 13% dari jumlah populasi yang ada, sehingga sampel ditentukan sebanyak 225 siswa. Instrumen yang digunakan dalam penelitian ini berupa inventori career self efficacy dan inventori pengambilan keputusan karier. Hasil penelitian menunjukkan bahwa, (1) sangat banyak siswa (90,2%) yang memiliki tingkat career self efficacy dalam kategori sedang, sangat sedikit siswa (9,8%) yang memiliki career self efficacy dalam kategori tinggi, dan tidak ada siswa yang memiliki career self efficacy rendah, sehingga dapat dikatakan bahwa sebagian besar siswa kelas XI SMA Negeri di Kabupaten Probolinggo memiliki tingkat career self efficacy dalam kategori sedang; (2) cukup sedikit siswa (46,2%) yang memiliki tingkat pengambilan keputusan dalam kategori tinggi, cukup sedikit pula siswa (53,8%) yang memiliki tingkat pengambilan keputusan karier dalam kategori sedang dan tidak ada siswa yang memiliki tingkat pengambilan keputusan karier yang rendah, sehingga dapat dikatakan bahwa sebagian besar siswa kelas XI SMA Negeri di Kabupaten Probolinggo memiliki tingkat pengambilan keputusan karier dalam kategori sedang; (3) ada hubungan antara career self efficacy dengan pengambilan keputusan karier sebesar rxy=0,346 dan probability error diperoleh sebesar 0,000 sehingga penambahan tingkat career self efficacy diikuti dengan penambahan tingkat pengambilan keputusan kareir atau penurunan tingkat career self efficacy akan diikuti dengan penurunan tingkat pengambilan keputusan karier. Dengan demikian, hipotesis dalam penelitian ini yang menyatakan bahwa terdapat hubungan antara career self efficacy dengan pengambilan keputusan karier diterima. Berdasarkan hasil penelitian bahwa career self efficacy dapat memberikan kontribusi positif dalam pengambilan keputusan karier, diharapkan siswa dapat meningkatkan career self efficacy-nya. Peningkatan career self efficacy dapat dilakukan dengan cara memberikan bimbingan karier secara intensif kepada siswa. Konselor perlu melakukan penajaman program di bidang karier agar siswa semakin memahami diri terutama yang berhubungan dengan masalah-masalah karier siswa di masa depan. Dalam menyusun materi bimbingan karier, konselor diharapkn melakukan analisis kebutuhan agar konselor lebih memahami siswa yang terkait dengan faktor-faktor yang mempengaruhi terhadap pengambilan keputusan kariernya. Selain itu, konselor perlu mengadakan konseling khusus untuk penjurusan siswa, sehingga penjurusan tidak hanya berdasarkan kriteria nilai.

Analisis rasio keuangan daerah pada APBD periode anggran 2008-2010 sebagai penilaian kinerja pada Dinas Prendapatan, Pengelolaan Keuangan dan Aset (DPPKA) Kabupaten Malang / Arevin Putri Miyanta

 

Kata Kunci: Anggaran Pendapatan dan Belanja (APBD), Analisis Rasio Keuangan Daerah, Penilaian Kinerja pada DPPKA Usaha pemerintah daerah dalam menggali sumber dana yang berasal dari potensi daerah yang dimiliki serta kemampuan mengelola dan memanfaatkan sumber dana yang ada tercermin dalam Anggaran Pendapatan dan Belanja Daerah (APBD). Salah satu untuk menganalisis kinerja keuangan daerah adalah dengan melakukan analisis rasio keuangan terhadap Anggaran Pendapatan dan Pembelanjaan (APBD) yang telah ditetapkan dan dilaksanakan. Untuk mencapai kinerja pemerintah Kabupaten Malang diperlukan analisis rasio pada APBD yang diantaranya: rasio kemandirian keuangan daerah, rasio efektifitas PAD, rasio efisiensi belanja pemerintah. Analisis ini digunakan untuk mengetahui tolak ukur dalam menilai kemandirian keuangan daerah dalam membiayai penyelenggaran otonomi daerah, mengukur efektivitas dan efisiensi dalam merealisasikan pendapatan daerah. Hasil penulisan ini adalah : tingkat kemandirian daerah Kabupaten Malang masih tergolong rendah dan tingkat ketergantungan daerah terhadap sumber dana ekstern masih dikatakan tinggi. Rasio efektivitas PAD pemerintah Kabupaten Malang secara umum dikatakan efektif dalam merealisasikan Pendapatan Asli Daerah (PAD). Rasio efisiensi belanja kabupaten Malang telah efisien dalam mengalokasikan belanja daerah, karena kurang dari 100% dan juga tidak melebihi dari target yang ditetapkan. Berdasarkan hasil penelitian yang telah dilakukan terhadap perhitungan dalam bab sebelumnya akan didukung dengan hasil akhir yang telah dicapai dapat disimpulkan bahwa kinerja keuangan pada Pemerintah Kabupaten Malang tahun 2008-2010 termasuk dalam kategori baik dalam pengelolaan anggaran pendapatan dan belanja, hal ini dilihat dari analisis rasio keuangan yang bersumber pada APBD tahun 2008-2010 sedangkan saran yang diberikan, (1) Pemerintah Daerah harus mampu mengoptimalkan penerimaan dari potensi pendapatannya yang telah ada, terutama Pendapatan Asli Daerah (PAD) (2) Efisiensi belanja dapat dicapai dengan cara menanamkan semangat kepada setiap pegawai pemerintah daerah untuk melakukan penghematan atas setiap belanja.

Pendidikan karakter orang dewasa di Pondok Pesantren Salafiyah Biba'a Fadlrah Turen Malang / Kisyanto

 

ABSTRAK Kisyanto, 2016. Pendidikan Karakter Orang Dewasa di Pondok Pesantren Salafiyah Biba’a Fdlrah Malang. Disertasi, Program Studi Teknologi Pembelajaran, Pasca Sarjana Universitas Negeri Malang. Pembimbing (I) Prof. Dr. H. Punaji Setyosari, M.Pd, M.Ed., (II) Dr. H. Sulton, M.Pd, (III) Dr. Dedi Kuswandi, M.Pd. Kata Kunci: Pendidikan Karakter, Kecerdasan Komprehensip, Pondok Pesantren Salafiyah Penelitian ini dilatar belakangi bahwa dari banyak kajian yang sudah dilakukan, pondok pesantren sebagai lembaga pendidikan non formal telah terbukti efektif dalam menerapkan pendidikan ahlak atau karakter, pendidikan nilai, baik nilai yang bersumber dari agama maupun dari nilai luhur budaya bangsa. Tujuan penelitian ini untuk mengungkap dan menyingkap hal-hal yang bersifat subtantif, dan selanjutnya menganalisis, dan membuat paradigma keilmuan yang berkaitan dengan pelaksanaan pendidikan karakter orang dewasa di Ponpes Salafiyah Biba’a Fadlrah Turen Malang. Penelitian ini fokus pada aktivitas santri, pengurus, dan tokoh-tokoh yang terlibat dalam pelaksanaan pendidikan karakter orang dewasa yang dilaksanakan selama 14 bulan, mulai dari maret 2015 sampai dengan Mei 2016. Penelitian ini menggunakan pendekatan kualitataif studi kasus. Pengolahan data hasil penelitian menggunakan bantuan softwere NVivo 11. Temuan penelitian ini adalah: 1) Karakter inti yang ditumbuhkembangkan adalah iman dan cinta kepada Tuhan YME, yang terwujud dalam sikap dan perilaku bertaqwa pada Tuhan YME, cinta dan kasih sayang terhadap sesama mahluk ciptaan-Nya, dan sadar sifat kehambaan diri, dengan berbagai atribut karakter mulia yang melekat padanya. 2) Strategi internalisasi, pembiasaan, penguatan, dan pengembangan atribut karakter mulia dilakukan melalui berbagai macam aktivitas santri dalam format “Belajar Hidup Beragama”, pensucian hati, ngalab berkah, pengembangan kecerdasan komprehensip, dawuh-dawuh pengasuh, sarana, media, dan strategi pembelajaran, lingkungan belajar, keteladanan pengasuh, dan penegakan aturan. 3) Strategi pembelajaran untuk mengembangkan kecerdasan komprehensip dengan memberikan kebebasan belajar santri dan menggunakan strategi pembelajaran inovatif. 4) Peran pengasuh (kyai) menjadi sentral keseluruhan warga ponpes, pengasuh sebagai penanggung jawab utama, leadher dan manager, pelaksana program, penyelia, konselor, orang tua, pendidik atau guru, pemberdaya, murobby ruh , suri tauladan, serta sumber belajar bagi santri. 5) faktor-faktor yang mendukung keberhasilan meliputi: peran dan pengaruh pengasuh, visi, misi, dan tujuan ponpes, aktivitas kelembagaan, dasar dan prinsip pendidikan dan pembelajaran, falsafah dan jiwa pesantren, strategi, media, dan materi pembelajaran, lingkungan belajar, sarana dan prasana penunjang serta potensi pesantren, penegakan aturan, dukungan santri, masyarakat dan pemerintah. 6) Manfaat yang diperoleh santri, masyarakat, dan pemerintah meliputi: perubahan nasib santri, bertambahnya berbagai ilmu pengetahuan dan keterampilan kecakapan hidup, terselesaikannya segala permasalahannya, adanya bangunan fenomenal untuk pendidikan dan pembelajaran karakter serta berbagai macam disiplin ilmu, serta tumbuh dan berkembangnya ekonomi di lingkungan masyarakat.

Pola penggunaan dan hubungan antara intensitas penggunaan internet sebagai sumber belajar dan prestasi belajar mahassiswa Teknik Sipil Universitas Negeri Malang / Atung Tri Hudaya

 

Kata kunci : Pendidikan tinggi, intensitas, internet. Sebagai sebuah sumber informasi yang hampir tidak terbatas, internet memenuhi kapasitas untuk dijadikan sebagai salah satu sumber belajar,terutama bagi Mahasiswa Teknik Sipil, potensi media internet sebagai sumber belajar sangat besar untuk memberikan akses informasi, pengetahuan dan pemahaman serta membantu dan menunjang proses perkuliahan, mulai dari regristrasi akademik, membantu menyelesaikan tugas kuliah, sampai pada pemahaman materi yang diberikan oleh dosen. Dilatar belakangi masalah tersebut, penulis berkeinginan menggali informasi untuk mengetahui lebih jauh tentang sejauh mana mahasiswa Teknik Sipil telah memanfaatkan internet sebagai sumber belajar Rumusan masalah penelitian ini adalah: (1) Mengetahui pola penggunaan internet sebagai sumber belajar mahasiswa Jurusan Teknik Sipil Universitas Negeri Malang; (2) Mengetahui hubungan intensitas menggunakan internet sebagai sumber belajar dengan prestasi belajar mahasiswa Teknik Sipil Universitas Negeri Malang. Memperhatikan dari rumusan masalah tersebut desain penelitian ini ada dua macam,untuk mengetahui pola penggunaan internet digunakan analisis deskriptif, sedangkan untuk mengetahui hubungan digunakan analisis korelasi. Subjek penelitian ini adalah mahasiswa teknik sipil UM, sedangkan untuk pengambilan sampel didapat 30% dari jumlah populasi yaitu diperoleh 91 mahasiswa. Hasil dari penelitian menyebutkan bahwa: (1)pola mahasiswa menggunakan internet sebagai sumber belajar terdapat beberapa hal diantaranya ,lokasi mengakses di rumah (47,25%), sering mengakses internet (59,34%), >4 jam sekali mengakses internet (36,26%), search engine sering diakses (61,53%) (2) Dari hasil analisa korelasi product moment pearson yang telah dilakukan, nilai signifikansi p(0,172) untuk hubungan antara variabel intensitas menggunakan internet sebagai sumber belajar (X) dan prestasi belajar (Y) > α (0.05) sehingga dapat disimpulkan bahwa tidak ada hubungan antara intensitas menggunakan internet sebagai sumber belajar (X) dan prestasi belajar (Y).

Pengaruh strategi bauran pemasaran (marketing mix) terhadap perilaku konsumen dalam membeli jenang di PT. Kusuma Satria Dinasasri Wisata Jaya Batu Malang
oleh Sribimayanti Wiratna

 

Persainganya ng gencara ntarap erusahaayna ng memproduksbi arangs ejenis akan mendorongp erusahaanu ntuk lebih berpacum eningkatkanh asil produksinya baik kuantitasm aupun kualitasnya.s etiap perusahaanu uit yung berskalab esar maupun kecil, tidak pernah lepas dan pelaksanaan strateg bauran p€masaran (marketingm ix) daLamp erencanrurpne masarannyas.e mentarai tu tujuan kegratan pemasaraand alahju ga untuk mempengaruhpie mbeli,o leh karenai tu hal ini sangat pentingb agi manajerp emasaranu ntuk memahammi engapad an bagaimanati ngkah laku konsumens ehinggap erusahaand epat mengembangkapnr oauk, menentukan hargam, empromosikadna nm endistribusikapnr oduknyas ecu.uG bih buik. Penelitianin i ingin mengetahuai pakahs hategib auranp emasara(nm arketing nrix) mampu mempengaruhi perilaku konsumen, dalam membeli Jenang Aper. Denganm enggunakanp endekatand eskriptif korelasional,p enelitian ini berusaha untuk menjelaskanp engaruhs trategib auran pemasaran(m arketingn u) terhadap perrlaku konsumen dalam membeli Jenang Apel di pr Kusuma satria Dinasasii WisataJ ayaB atuM alang. Populasi dalam penelitian ini adalah seluruh konsumen Jenang Apel sedangkasna mpelnyaa dalahp engunjungy ang memberij enanga pel di pr Kusuma SatriaD inasasrwi isata Jaya Baru Malang, samperd iambil i""i.u acak( rantlom sampltngD) ari pengunjungy ang ada peneliti rnengambil5 0 (konsumen)s ebagar sampelP. enentuajnu mlah sampelt ersebutk arenak eterbatasanp eneliti dalam hal tenag4b iayad anw aku. Penelitianin i mempunyadi ua variabely aitu variabelb ebas( X) dan variabel terikat (Y). vanabel bebas (X) penelitian ini adalah strategl promosi-(Xl), strategi hg1 (X2), strategi promosi (x3) dan strategi saluran distrilusi (X+). sedangkan variabelterika(Yt ) dalamp enelitianin i adalahp erilakuk onsumen. Hasil penelitian menyimpulkan bahwa : (l) ada pengaruh antara strategr p^toq*_t erhadapp erilakuk onsumend alam membelij enang apel di pr Kusuma SatriaD inasasrwi isata JayaB atu Malang, (2) adap engaruha ntaras trategih arga terhadapp erilakuk onsumend alam membeli jenang apel di pr Kusuma satria Dinasasrwi isata Jaya Batu Malang, (3) aoa pengaruha ntara strategi promosi terhadapp erilakuk onsumend alam memberi jenang apel di pr Kusima satria Dinasasri Wisata Jaya Batu Malang, (4) ada pengaruh antara strategi saluran distribusi terhadap perilaku konsumen dalam membeli jenang apel di PT Kusuma SatriaD inasasrWi isataJ ayaB atu Malang,( 5) ada pengaruha ntaras trategip roduk, strategi harga, strategi promosi dan strategi saluran distribusi secara bersama terhadape rilakuk onsumend alamm embelij enanga pelP T KusumaS atriaD inasasri WisataJ ayaB atu Malang,( 6) Strategiy ang paling dominanp engaruhnytae rhadap perilaku konsumen dalam membeli jenang apel di PT Kusuma Satria Dinasasri WisataJ ayaB atuM alanga dalahs trategis alurand istribusi. Saran yang bisa dikemukakan berkaitan dengan temuan yang diperoleh selamam elaksanakapne nelitiani ni adalah: (l) Dalamr angkam eningkatkank ualitas produk jenang apel, maka penhal "rasa" hendaknya memperoteh perhatian yang utamaH. al ini tidak berartib ahwaf aktor lain sepertik emasanm, erk danw amat idak diperhatikanH. al tersebutd isampaikand enganm engingatb ahwau nggulanb ersaing dari produk yang berbentuk makanan adalah soal "rasa". Disarankan pula agar komposisai pel lebih banyakd aripadat epung,( 2) Salurand istribusiy ang digunakan hendaknytae tapd ipertahankanjik, a mungkind itingkatkan.

Pengembangan perangkat pembelajaran pencemaran lingkungan berbasis penelitian fitoremediasi untuk mengembangkan keterampilan ilmiah, sikap peduli lingkungan dan motivasi mahasiswa pada matakuliah dasar-dasar ilmu lingkungan / Dyah Afiat Mardikaningtyas

 

ABSTRAK Mardikaningtyas, Dyah Afiat. 2016. Pengembangan Perangkat Pembelajaran Pencemaran Lingkungan Berbasis Penelitian Fitoremediasi untuk Menunjang Keterampilan Ilmiah, Sikap Peduli Lingkungan dan Motivasi Mahasiswa pada Matakuliah Dasar-dasar Ilmu Lingkungan. Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Ibrohim, M.Si., (II) Dr. Endang Suarsini, M.Ked. Kata Kunci: Perangkat pembelajaran, pencemaran lingkungan, keterampilan ilmiah, motivasi, sikap peduli lingkungan Pendidikan lingkungan, menjadi salah satu pendidikan yang sangat penting untuk dilaksanakan mulai dari jenjang sekolah dasar hingga perguruan tinggi. Sebagai pengaplikasian pendidikan sains yang berorientasi pada wujud peduli lingkungan, maka mahasiswa diajarkan untuk mengalami proses belajar untuk memperoleh pengetahuan sekaligus dapat memiliki sikap peduli lingkungan dalam dirinya. Sesuai dengan deskripsi matakuliah yang terdapat dalam Katalog Jurusan Biologi FMIPA UM, matakuliah Dasar-dasar Ilmu Lingkungan mengkaji tentang lingkungan beserta permasalahannya, salah satunya adalah masalah pencemaran lingkungan. Berdasarkan analisis kebutuhan mahasiswa, maka dikembangkan pembelajaran untuk materi pencemaran lingkungan berbasis penelitian fitoremediasi. Tujuan dari penelitian pengembangan ini adalah menghasilkan perangkat pembelajaran yang berkualifikasi valid, praktis serta efektif sehingga dapat diaplikasikan dan menunjang keterampilan ilmiah, motivasi serta sikap peduli lingkungan mahasiswa agar mereka ikut berkontribusi menjaga lingkungan alam sekitar dan berupaya memperbaiki kerusakan yang terjadi. Penelitian ini merupakan jenis penelitian pengembangan dan menggunakan model pengembangan Borg dan Gall. Hasil dari penelitian ini berupa produk perangkat pembelajaran pencemaran lingkungan berbasis penelitian fitoremediasi yang diharapkan berkualifikasi valid, praktis dan efektif. Data validitas perangkat pembelajaran meliputi validitas isi dan empiris, diperoleh dari proses uji validasi menggunakan lembar validasi yang dinilai oleh validator. Tingkat validitas perangkat pembelajaran pada bagian Rencana Perkuliahan Semester (RPS) adalah 93,06%, bagian Satuan Acara Perkuliahan (SAP) adalah 92,97%, validitas bagian handout dari aspek kelayakan isi materi mencapai 96,71%, validitas perangkat dari aspek sajian atau tampilan mencapai tingkat validitas 80,77%, secara umum perangkat dikategorikan valid dan layak untuk diimplementasikan. Kepraktisan perangkat diperoleh dari hasil pengisian angket keterbacaan yang telah diisi oleh mahasiswa. Hasil uji kepraktisan menunjukkan nilai 100% pada aspek kelengkapan isi dan 87,47% dalam aspek keterbacaan dan kepraktisan. Perangkat pembelajaran dapat dikatakan praktis apabila mudah digunakan dan diaplikasikan bagi mereka yang menggunakan. Keefektifan perangkat dapat dilihat dari hasil yang diinginkan melalui penggunaan produk pengembangan pembelajaran. Hasil keefektifan perangkat pembelajaran menunjukkan hasil yang efektif tinggi, dibuktikan dengan skor keterampilan ilmiah mahasiswa tergolong sangat baik, sikap peduli lingkungan tinggi dan motivasi belajar mahasiswa tinggi. Kesimpulan dari hasil penelitian ini adalah perangkat pembelajaran yang dikembangkan, telah memenuhi kriteria valid, praktis dan efektif, sehingga perangkat pembelajaran untuk materi pencemaran lingkungan berbasis penelitian fitoremediasi dapat diimplementasikan kepada mahasiswa yang menempuh matakuliah Dasar-dasar Ilmu Lingkungan.

Tingkat partisipasi orangtua terhadap pembelajaran anak ditinjau dari status sosial ekonomi di Sekolah Dasar Negeri Ketapang I Probolinggo / Putri Permata Sari

 

ABSTRAK Sari, Putri Permata. 2010.Tingkat Partisipasi Orangtua Terhadap Pembelajaran Kata kunci: partisipasi orangtua, status sosial, ekonomi dan pembelajaran anak. Keberhasilan pembangunan di bidang pendidikan tidak hanya tergantung pada kemampuan guru dalam mengajar, tetapi juga tergantung dari ada tidaknya kesadaran masyarakat yang ada di sekolah. Disamping itu keberhasilan belajar siswa juga ditentukan orangtua dan masyarakat. Setiap orangtua ikut memberikan partisipasi dalam kegiatan belajar putra-putrinya dengan cara yang berbeda-beda. Adanya perbedaan tersebut disebabkan karena latar belakang keluarga yang berbeda pula. Keadaan status sosial ekonomi orangtua penting terhadap perkembangan pendidikan anak-anaknya, karena dengan perekonomian yang cukup di dalam keluarga tersebut, maka anak mendapat kesempatan yang lebih luas untuk mendapatkan fasilitas sebagai bagian dari partisipasi orang tua dalam pembelajaran anak. Oleh karena itu keadaan status sosial ekonomi orangtua akan dijadikan pertimbangan dalam menentukan tingkat partisipasi orangtua dalam pembelajaran anak. Berdasarkan latar belakang maka rumusan masalah dalam penelitian ini adalah: (1) Bagaimana partisipasi orangtua terhadap pembelajaran anak ditinjau dari status sosial ekonomi di SDN Ketapang I Probolinggo ? (2) Bagaimana tingkat status sosial ekonomi orangtua siswa di SDN Ketapang I Probolinggo ? (3) Apakah terdapat hubungan antara tingkat partisipasi orangtua ditinjau dari pendidikan terhadap pembelajaran anak di SDN Ketapang I Probolinggo ? (4) Apakah terdapat hubungan antara tingkat partisipasi orangtua ditinjau dari penghasilan terhadap pembelajaran anak di SDN Ketapang I Probolinggo ? (5) Apakah terdapat hubungan antara tingkat partisipasi orangtua ditinjau dari pekerjaan dan penghasilan terhadap pembelajaran anak di SDN Ketapang I Probolinggo? Tujuan penelitian ini yaitu untuk mengetahui (1) partisipasi orangtua terhadap pembelajaran anak ditinjau dari status sosial ekonomi di SDN Ketapang I Probolinggo. (2) tingkat status sosial ekonomi orangtua siswa di SDN Ketapang I Probolinggo. (3) hubungan antara tingkat partisipasi orangtua ditinjau dari pendidikan terhadap pembelajaran anak di SDN Ketapang I Probolinggo. (4) hubungan antara tingkat partisipasi orangtua ditinjau dari penghasilan terhadap pembelajaran anak di SDN Ketapang I Probolinggo. (5) hubungan antara tingkat partisipasi orangtua ditinjau dari pekerjaan dan penghasilan terhadap pembelajaran anak di SDN Ketapang I Probolinggo. i Teknik analisis yang digunakan dalam penulisan ini terdiri atas (1) analisis deskripitif, (2) analisis korelasi Tau Kendall’s dan (3) analisis koefisien kontingensi. Berdasarkan hasil penelitian dan pembahasan yang telah dilakukan, maka dapat disimpulkan suatu kesimpulan sebagai berikut: (1) Partisipasi orangtua terhadap pembelajaran anak ditinjau dari status sosial ekonomi di SDN Ketapang I Probolinggo masuk dalam kategori sangat tinggi. (2) Tingkat status sosial ekonomi orangtua siswa di SDN Ketapang I Probolinggo, orangtua siswa yang memiliki penghasilan sebesar Rp. 500.000,- sampai dengan 750.000, berada pada persentase tertinggi bekerja sebagai wirausaha/wiraswasta dan memiliki tingkat pendidikan SMU. (3) Terdapat hubungan antara tingkat partisipasi orangtua ditinjau dari pendidikan terhadap pembelajaran anak di SDN Ketapang I Probolinggo. (4) Terdapat hubungan antara tingkat partisipasi orangtua ditinjau dari penghasilan terhadap pembelajaran anak di SDN Ketapang I Probolinggo. (5) Terdapat hubungan antara tingkat partisipasi orangtua ditinjau dari pekerjaan dan penghasilan terhadap pembelajaran anak di SDN Ketapang I Probolinggo. Berdasarkan kesimpulan, maka disampaikan saran kepada: (1) kepala sekolah yaitu hendaknya dalam usaha meningkatkan partisipasi orangtua diharapkan berupaya untuk memberikan dukungan sepenuhnya kepada orangtua siswa. Usaha nyata yang dapat dilakukan yaitu dengan memberikan bea siswa kepada siswa yang benar-benar membutuhkan sehingga proses pembelajaran dapat berjalan sesuai dengan ketentuan yang diharapkan; (2) Bagi orangtua yaitu hendaknya orangtua selalu berupaya untuk berpartisipasi sesuai dengan penghasilan yang diperoleh, pekerjaan, dan tingkat pendidikan yang dimiliki sehingga dapat meningkatkan kualitas pembelajaran anak; (3) Bagi Jurusan Administrasi Pendidikan, hasil penelitian ini diharapkan dapat dijadikan bahan referensi tambahan untuk jurusan dalam pengembangan perkuliahan manajemen hubungan masyarakat; (4) Bagi peneliti selanjutnya yang berminat untuk melanjutkan penulisan ini diharapkan untuk menyempurnakannya yaitu dengan menggunakan variabel lain yang terkait dengan pembelajaran siswa sehingga penelitian ini dapat lebih berkembang dan memperluas wawasan.

Penerapan strategi diversifikasi produk sebagai upaya meningkatkan cakupan pasar pada perusahaan "MUlya" Tulungagung / Astri Damayanti

 

Kata kunci: strategi, diversifikasi produk Perubahan selera konsumen ditunjang oleh perkembangan percepatan teknologi dan informasi, mengakibatkan perusahaan berlomba dalam lingkungan usaha yang kompetitif untuk menambah ragam dan jumlah produknya. Upaya ini yang dilakukan oleh perusahaan ‘’MULYA’’ Tulungagung, juga memproduksi barang yang sesuai dengan kebutuhan dan keinginan konsumen yang sebagian besar adalah kontaraktor rumah dan juga individu yang ingin membangun rumah. Hal inilah yang membuat penulis mengambil judul ‘’Penerapan Strategi Diversifikasi Produk Sebagai Upaya Meningkatkan Cakupan Pasar pada Perusahaan ‘’MULYA’’ Tulungagung’’ di dalam pemenuhan tugas akhir. Berdasarkan hasil praktikum yang telah dilakyukan ada dua implementasi diverasifikasi yang dilaksanakan oleh perusahaan’’MULYA’’ Tulungagung, yakni strategi diversifikasi horizontal strategi untuk menciptakan produk baru. Hal tersebut terbukti dengan variasi jenis produk genteng, paving, batako, beton yang dihasilkan oleh perusahaan. Strategi diversifikasi konsentris; suatu strategi untuk mencari produk baru yang dihasilkan dengan teknologi baru pula, merupakan pengembangan kedepan perusahaan, sebagai contoh memproduksi keramik, tetapi hal ini belum dilaksanakan karena berbagai kendala yang ada. Strategi ini bertujuan untuk memepertahankan dan memperluas pasar. Ini semua tidak terlepas dari berbagai faktor yang mendorong perusahaan ‘’MULYA’’ Tulungagung dalam menerapkan strategi ini yang tidak lain adalah adanya sikap konsumen yang semakin selektif, persaingan pasar yang semakin ketat dan semakin tingginyapermintaan pasar terhadap suatu produk sehingga menuntut perusahaan untuk melakukan penyesuaian akan produk yang dihasilkan terhadap permintaan pasar. Dari uraian diatas dapat dikatakan bahwa suatu perusahaan yang memiliki keinginan untuk mengembangkan pasarnya dapat menerapkan strategi dengan jalan mendiversifikasi produk yang dihasilkannya. Pada intinya strategi ini bertujuan untuk menghilangkan kejenuhan konsumen pada suatu produk yang imbasnya konsumen diharapkan tidak berpindah ke produk lain yang pilihan produknya lebih bervariasi. Dengan adanya strategi diversifikasi produk maka perusahaan ‘’MULYA’’ Tulungagung dapat memproduksi produk yang lebih beragam. Untuk kedepannya diharapkan perusahaan ‘’MULYA’’ Tulungagung dapat mengoptimalkan kinerja perusahaan dengan ditunjang sarana dan prasarana yang memadai .

Metafora dalam peristiwa perkawinan adat daerah Gorontalo / by Kartin H. Lihawa

 

Identifikasi motif pada aksesoris Tari Gandrung Banyuwangi / Dhatu Aprila Ardhani

 

ABSTRAK Ardhani, Dhatu Aprila.2015. Identifikasi Motif Pada Aksesoris Tari Gandrung Banyuwangi. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Ida Siti Herawati, M.Pd (II)Dra. TjitjikSriwardhani, M.Pd Kata Kunci: motif, aksesoris, Tari Gandrung, Banyuwangi Tari Gandrung merupakan salah satu tari dari Banyuwangi. Penari Gandrung dilengkapi dengan aksesoris Omprog, Rumbai, Kembang goyang, Kelat bahu, Ilat-ilat, Sembong, Gelang, Oncer, Pending, Kipas, Sampur yang sangat indah, menarik, dan anggun. Sehingga tari tersebut membuat peneliti yang berasal dari pendidikan seni tertarik meneliti untuk mengetahui lebih jauh dari aksesoris Tari Gandrung Banyuwangi. Tujuan penelitian ini untuk mendeskripsikanmotif yang ada pada aksesoris Tari Gandrung Banyuwangi meliputi bentuk, tekstur, dan warna. Akseosris Tari Gandrung terdiri dari Omprog, Rumbai, Kembang goyang, Kelat bahu, Ilat-ilat, Sembong, Gelang, Oncer, Kipas, Sampur. Penelitianinimenggunakanpendekatankualitatifdiskriptif. Subjekdalampenelitianiniadalahaksesoris Tari Gandrung Banyuwangi. Data padapenelitianinidiperolehmelaluipengamatan, wawancara dan dokumentasi. Analisis data yang digunakandengan cara reduksi data, dan kategorisasi. Untuk menjaga keabsahan data, dilakukan kegiatan trianggulasi teori. Lokasi di Sanggar Tari Jl. Banterang Baru No. 37 Kampung Melayu,Kabupaten Banyuwangi milik Bapak Subari Sofian dan sekaligus sebagai informan dalam penelitian. Hasil penelitian meliputi: pertama, bentuk dari aksesoris Tari Gandrung Banyuwangi yaitu bentuk non geometris dan geometri. Bentuk non geometris yang ada pada bagian Omprog yaitu ornamen Gajah Oling dan Kepala Manusia yang dipahat pada kulit, sedangkan pada Ilat-ilat, Sembong, Oncer, ornamen Gajah Oling berasal dari susunan manik-manik. Bentuk geometris ada pada ornamen Manik Melingkar, Tripel oval, doble segitiga, sate lingkaran, persegi zig-zag, cucuk rebung, dan tebu seceret. Kedua, tekstur pada aksesoris yaitu tekstur kasar ornamen Gajah Oling yang berasal dari manik-manik terdiri dari bagian Ilat-ilat, Sembong, Oncer, Kelat Bahu dan tekstur kasar pada ornamen Gajah Oling dan ular berkepala manusia di omprog hasil dari kulit yang dipahat. Sedangkan tekstur halus dan licin dibagian-bagian pita atau kain bludru pada Kelat Bahu, Ilat-ilat, Sembong, Oncer, Pending, Kipas dan Sampur. Ketiga, warna utama yang banyak ditemukan pada aksesoris Tari Gandrung yaitu warna merah, warna kuning, warna hitam, dan warna putih.Warna merah selalu ada disetiap aksesoris Tari Gandrung bagian Kelat Bahu, Ilat-ilat, Sembong, Oncer, Pending, Kipas dan Sampur, kepala manusia. Warna kuning ditemukan pada bagian Omprog, Rumbai, Kelat Bahu, Ilat-ilat, Sembong, Oncer, Pending, Sampur, kepala manusia, dan gelang. Warna hitam ditemukan pada bagian kepala manusia. Warna putih dada pada pilis dan kepala manusia. Warna pendukung yang ditemukan pada aksesoris Tari Gandrung Banyuwangi yaitu warna hijau dan cokelat. Warna hijau ditemukan pada manik-manik bagian tiple segitiga, Ilat-ilat, Sembong, Oncer, dan Pending. Sedangkan warna cokelat ada pada bagian Kaca/ doble segitiga. Dari hasil penelitian ini, disarankan akan memberikan wawasan kepada siswa-siswi sekolah terhadap aksesoris Tari Gandrung Banyuwangi, sehingga tidak hanya menyenangi budayanya akan tetapi bisa mengembangkan aksesoris tersebut dengan kreatifitas mereka tanpa meninggalkan kepakeman baik dari setiap bentuk, tekstur maupun warna yang ada.

Fenomena kawin kontrak di kalangan masyarakat desa Kalisat Kecamatan Rembang Kabupaten Pasuruan / Nurika Rachma Anggraeni

 

Kata Kunci : Fenomena Kawin Kontrak, Masyarakat Desa Kalisat Perkawinan sebagai aktifitas individu merupakan fitrah bagi setiap manusia di muka bumi ini. Perkawinan dilihat dari aspek sosial mempunyai suatu kepentingan untuk memelihara kelangsungan hidup manusia baik itu dari segi pemeliharaan keturunan, menjaga keselamatan masyarakat dari dekadensi moral, dan menjaga ketentraman jiwa. Di Indonesia perkawinan merupakan ikatan yang bersifat sakral dan suci. Karena merupakan ikatan yang bersifat sakral dan suci maka Negara Republik Indonesia membentuk suatu peraturan tertulis yang mengatur tentang masalah-masalah perkawinan seperti yang dicantumkan dalam Undang-Undang No.1 Tahun 1974 Tentang Perkawinan, dimana di dalamnya terkandung makna bahwa suatu perkawinan adalah ikatan lahir batin antara seorang pria dengan seorang wanita sebagai suami isteri dengan tujuan membentuk keluarga yang bahagia dan kekal berdasarkan Ketuhanan Yang Maha Esa. Ditinjau dari sudut pandang agama Islam, perkawinan merupakan salah satu bentuk ibadah yang dilakukan oleh manusia dengan tujuan untuk mendapatkan ridha Allah SWT. Terdapat pengaruh agama yang cukup kuat terkait dengan pelaksanaan perkawinan. Dewasa ini pelaksanaan perkawinan semakin bervariasi bentuknya, di masyarakat sendiri sudah sejak lama dikenal perkawinan siri, perkawinan bawa lari, sampai dengan kawin kontrak(mut’ah). Perkawinan sebagai bagian hidup yang sakral sudah semestinya harus memperhatikan norma dan kaidah hidup yang ada dan berkembang dalam masyarakat, namun kenyataannya tidak semua orang berprinsip demikian dengan berbagai alasan pembelaan yang masuk akal dan dapat diterima oleh masyarakat, perkawinan seringkali tidak dihargai kesakralannya. Begitu pula yang terjadi dalam pelaksanaan pernikahan siri dan kawin kontrak. Kawin kontrak merupakan perkawinan atau akad yang terjadi antara seorang laki-laki dan perempuan untuk jangka waktu tertentu, setelah jangka waktu yang telah disepakati habis maka perkawinan dianggap telah berakhir dengan sendirinya. Pelaksanaan kawin kontrak(mut’ah) dapat ditemukan di Desa Kalisat, Kecamatan Rembang, Kabupaten Pasuruan. Kawin kontrak di Desa Kalisat sudah ada dan terjadi sejak tahun 1990, sifat dari perkawinan tersebut hanya bertahan untuk sementara waktu saja sesuai dengan kesepakatan kedua belah pihak yaitu pihak laki-laki dan pihak perempuan dari pelaku kawin kontrak. Kajian ini bertujuan untuk mendeskripsikan (1)faktor yang melatar belakangi seorang wanita di Desa Kalisat melakukan kawin kontrak, (2)awal mula terjadinya kawin kontrak di Desa Kalisat, (3)pelaksanaan kawin kontrak di Desa Kalisat, dan(4)persepsi masyarakat sekitar terhadap fenomena kawin kontrak yang terjadi di Desa Kalisat Kecamatan Rembang. Metode yang digunakan adalah kualitatif, digunakan metode kualitatif karena sifat dari data yang dikumpulkan sesuai dengan keadaan lapangan, wajar dan sebagaimana adanya tanpa diatur sebelumnya. Dengan pendekatan kualitatif ini peneliti menggambarkan tentang fenomena kawin kontrak yang terjadi di Desa Kalisat, Kecamatan Rembang, Kabupaten Pasuruan. Tujauan penelitian ini adalah untuk mengetahui (1)faktor yang melatarbelakangi seorang wanita di Desa Kalisat melakukan kawin kontrak antara lain latar belakang ekonomi, latar belakang agama, latar belakang pendidikan, latar belakang sosial, (2)kawin kontrak sudah ada dan terjadi di Desa Kalisat sejak tahun 1990. Berita mengenai adanya kawin kontrak di Desa Kalisat juga turut disebarkan oleh media cetak dan elektonik, sehingga sampai saat ini masyarakat luas mengetahui bahwa kawin kontrak benar terjadi di Desa Kalisat, (3)pelaksanaan kawin kontrak di Desa Kalisat didahului dengan adanya pengajuan beberapa persyaratan yang diajukan oleh pihak laki-laki dan pihak perempuan persyaratan tersebut nantinya akan menjadi kesepakatan diantara kedua belah pihak pelaku kawin kontrak,(4)muncul berbagai persepsi dikalangan masyarakat terkait fenomena kawin kontrak di Desa Kalisat. Berdasarkan hasil temuan diatas, disampaikan pula beberapa saran yakni (1)pihak LSM setempat, dan Tokoh agama hendaknya melakukan penyuluhan tentang masalah kawin kontrak, (2)pihak Pemerintah Daerah segera mengeluarkan aturan resmi terkait dengan fenomena kawin kontrak yang ada di Desa Kalisat, Kecamatan Rembang, Kabupaten Pasuruan, (3)kaum wanita hendaknya dapat melangsungkan pernikahan yang sesuai dengan Undang-Undang No.1 Tahun 1974 Tentang Perkawinan, (4)pemuka agama seperti Kyai sebaiknya dapat mengkaji lebih lanjut tentang kawin kontrak dan hubungannya dengan ajaran yang ada dalam Agama Islam.

Pengaruh iklim kerja sekolah dan motivasi kerja guru terhadap kinerja guru di SMK Muhammadiyah 05 Kepanjen / Tri Puji Rahayu

 

Kata Kunci: Iklim Kerja Sekolah, Motivasi Kerja Guru, Kinerja Guru Keberhasilan pendidikan merupakan cerminan kenerja guru di sekolah. Guru dituntut memiliki kinerja yang mampu memberikan dan merealisasikan harapan dan keinginan semua pihak terutama masyarakat umum untuk membina dan mendidik siswanya. Dalam prosesnya, kinerja dipengaruhi banyak faktor diantaranya iklim kerja sekolah dan motivasi guru. Penelitian dilakukan di SMK Muhammadiyah 05 Kepanjen dengan pertimbangan sebagai sekolah swasta, SMK Muhammadiyah 05 telah memiliki “nama” dan citra yang bagus di masyarakat Kepanjen, selain itu mayoritas pengajarnya yang berlatar belakang sebagai guru negeri dan hanya mengajar di SMK Muhammadiyah 05 menjadi hal yang menarik untuk diteliti. Penelitian ini bertujuan untuk mengetahui 1) pengaruh iklim kerja di lingkungan sekolah terhadap kinerja guru, 2) pengaruh motivasi guru terhadap kinerja guru, 3) pengaruh iklim kerja terhadap motivasi guru, dan 4) pengaruh iklim kerja melalui motivasi terhadap kinerja guru. Penelitian ini termasuk penelitian eksplanasi yang digunakan untuk mengukur hubungan antar variabel yang dihipotesiskan. Populasi penelitian ini adalah seluruh guru pengajar SMK Muhammadiyah 05 Kepanjen yang berjumlah 44 orang. Instrumen penelitian menggunakan angket. Uji validitas menggunakan pearson correlation product moment, uji realibilitas menggunakan alpha cronbach, dan analisis data menggunakan path analisis. Hasil penelitian menunjukkan bahwa: 1) iklim kerja sekolah berpengaruh positif terhadap kinerja guru, 2) motivasi kerja guru berpengaruh positif terhadap kinerja guru dan 3) iklim kerja berpengaruh positif terhadap iklim kerja sekolah, 4) iklim kerja berpengaruh positif terhadap kinerja guru melalui motivasi kerja guru. Berdasarkan hasil penelitian ini, disarankan (1) Sekolah harus tetap memelihara kondisi iklim kerja dan motivasi kerja guru (2) Bagi peneliti selanjutnya, disarankan untuk mengembangkan permasalahan-permasalahan dan menggunakan instrument lain agar dapat mengungkapkan lebih banyak permasalahan serta dapat memberikan temuan yang lebih berarti.

Perencanaan turbocooler pada motor dua tak satu silinder untuk kendaraan roda dua / oleh Tulus Suyono

 

Kekerasan Kerapan Sapi Madura sebagai sumber inspirasi penciptaan karya seni / Moh. Rofiudin

 

ABSTRAK Rofiudin, Moh. 2015.Kekerasan Kerapan Sapi Madura Sebagai Sumber Inspirasi Penciptaan Karya Seni Lukis, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I) Dra. Lilik Indrawati, M.Pd, (II) Drs. Didiek Rahmanadji, M.Pd. Kata Kunci:kekerasan kerapan sapimadura, penciptaan,seni lukis. Kerapan sapi yang dulunya untuk menghibur masyarakat ketika sedang selesai panen, kini kerapan sapi di pulau Madura berevolusi menjadi ajang kekerasan terhadap binatang khususnya sapi, karena pemilik sapi adu gengsi, dan tidak luput juga sebagai sarana untuk melakukan perjudian. Dalam bentuk kekerasan maupun perjudian itu secara agama dilarang. Terkait dengan hal tersebut, penulis mengambil ide atau gagasan berkarya dari kekerasan kerapan sapi yang mengalami perubahan, dimana penulis timbul rasa empati kapada sapi tersebut. Proses dalam penciptaan karya seni lukis ini bermula dari perancangan konsep yang didalamnya terdapat ide atau gagasan, tema, dan objek yang akan diciptakan, yaitu objek representasional. Proses dilanjutkandengan menentukan karakteristik karya,serta menentukan teknik serta alat dan bahan yang akan digunakan. Langkah selanjutnya adalah proses visualisasi, yaitu membuat sketsa diatas kertas lalu memindahkannya di atas kanvas. Tahapan utama selanjutnya adalah pewarnaan dengan menggunakan berbagai macam teknikyaitu teknik blur, sapuan kuas kering, dan dussel. Tahapan akhir adalahmemberikan detail penegasan gelap-terang,detail objek,dan ditutupproses melapisi karya dengan pelapis cat transparan. Penulis dalam setiap karya menampilkan dua objek sapi yang sedang merasakan kesakitan, dan simbol paku mewakili benda yang dibuat untuk ajang kekerasan. Dalam setiap lukisan mempunyai rasa yang berbeda karena dipengaruhi oleh keadaan jiwa si penulis atau tempatketika sedang mencoba mengeluarkan sebuah rasa marah serta empati terhadap sapi. Warna yang dominan setiap karya yang muncul selalu gelap serta goresan ekspresif yang di hasilkan oleh pisau palet.Berdasarkan hasil penciptaan ini diharapkan dapat memberikan pengalaman baru kepada pencipta maupun orang lain dalam mempelajari karya seni lukis;dimulai daripembelajaran deskripsi perancangan konsep, proses visualisasi karya, dan deskripsi karya berdasarkan sudut pandang pribadi penulis.Serta dapat memberikan pandangan dan pengalaman penulis bahwa hewan juga dapat merasakan rasa sakit ketika mengalami faktor kekerasan,diharapkan dapat memberikan pesan moral bahwa jangan menyiksa binatang peliharaan tetapi sayangilah binatang peliharaan dengan kasih sayang. Serta dapat menjabarkan secara nyata apa yang disebut sebagai proses kreatif dalam pendidikan seni.

Pembelajaran berbasis teori Dienes berbantuan kartu prima untuk meningkatkan pemahaman konsep siswa kelas V SD pada materi FPB dan KPK / Mahfud Jauhari

 

ABSTRAK Jauhari,Mahfud. 2016. Pembelajaran Berbasis Teori Dienes Berbantuan Kartu Prima untuk Meningkatkan Pemahaman Konsep Siswa Kelas V SD pada Materi FPB dan KPK. Tesis. Program Studi Pendidikan Dasar, Pasca Sarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M.Pd, (II) Prof. Drs.Gatot Muhsetyo, M.Sc Kata kunci : Peembelajaran, teori Dienes, kartu prima, pemahaman, FPB dan KPK. Observasi awal penelitian menemukan fakta bahwa siswa kelas V SDN Sukun2 Malang mengalami kendala dalam memahami konsep FPB dan KPK. Siswa hanyamengingat prosedur pengerjaan soal tanpa memahami konsep sesungguhnya sehinggasiswa salah dalam memilih prosedur untuk menyelesaikan masalah FPB dan KPK. Penelitianinibertujuan untuk mendeskripsikan pembelajaran berbasis teori Dienes yangdapatmeningkatkan pemahaman konsep siswa kelas V SDN Sukun 2 Malang pada materi FPB dan KPK. Jenis penelitian ini merupakan penelitian tindakan kelas. Penelitian ini terdiri dua siklus. Siklus I terdiri dari tiga tindakan dan siklus II terdiri dari dua tindakan. Wawancaradilakukan setelah tes akhir siklus I untuk mengukur pemahaman konsep siswa terhadap materi FPB dan KPK. Subjek wawancaraadalah empat siswa yang terdiri dari satu siswa berkemampuan tinggi, dua siswa berkemampuansedang, dan satu siswa berkemampuan rendah. Pemilihan subjek wawancara berdasarkan skor tes awal dan saran guru kelas V. Data yang dikumpulkan berupa hasil tes tulis siswa, hasil observasi, dan catatan lapangan. Teknik analisis data dilakukan secara deskriptif kualitatifmelalui tiga tahapan, yaitu reduksi data, penyajian data, dan verifikasi data. Implementasipembelajaran berbasis teori Dienes meliputi meliputi permainan bebas, penelaahan sifat bersama, representasi, penyimbolan, dan pemformalan. Hasil penelitian menunjukkan bahwa (1) persentase siswa yang tidak melakukan kesalahan kalkulasi pada siklus I sebesar 69% dan siklus II sebesar81%, (2) persentase siswa tidak melakukan kesalahan prosedur siklus I 54% dan siklusII sebesar 61%, (3) persentase tidak melakukan kesalahan konsep siklus I sebesar 63%dan siklus II sebesar 75%. Sehingga dapat disimpulkan bahwa pembelajaran berbasisteori Dienes berbantuan kartu prima dapat meningkatkan pemahaman konsep siswa kelas V SDN Sukun 2 Malang terhadap materi FPB dan KPK. Saran yang dapat dikemukakan untuk pembelajaran berbasis teori Dienes berbantuan kartu prima pada materi FPB dan KPK yang berikutnya antara lainsebaiknya disiapkan kartu prima yang berukuran lebih besar khusus untuk presentasi hasil kerja siswa di depan kelas. Kartu prima dibuat dengan warna yang berbeda khususnya kartu yang memuat bilangan sama, hal ini untuk menghidari kerancuan terhadap konsep himpunan pada saat siswa menempelkan kartu prima pada diagram Venn. Sebaiknyaguru mengalokasikanwaktu lebih banyak pada tahap penyimbolan dan pemformalan sehingga siswa dapat memahami prosedur penentuan FPB dan KPK berbantuankartu prima.

Pengolahan buah nangka sebagai bahan dasar pembuatan nata / Helpi Sanak Izati

 

Makna motivasi belajar geografi siswa SMA Negeri 1 Sukosari Bondowoso dengan pendekatan fenomenologi / Eko Anang Hadi Santoso

 

ABSTRAK Santoso, Eko Anang Hadi 2016. Makna Motivasi Belajar Geografi Siswa SMA Negeri 1 Sukosari Bondowoso dengan Pendekatan Fenomenologi. Tesis. Progam Studi Pendidikan Geografi, Progam Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Ach. Fatchan, M.Pd, M.P (II) Dr. I Nyoman Ruja, S.U Kata Kunci: Motivasi belajar, Geografi, Pendekatan fenomenologi Motivasi merupakan aspek penting dalam belajar, terutama dalam menetukan kesuksesan proses belajar. Saat ini belum banyak penelitian tentang motivasi yang menggunakan metode kualitatif dengan pendekatan fenomenologi. Tujuan penelitian ini adalah untuk mendeskripsikan, mengetahui makna dan mengetahui faktor yang berpengaruh terhadap motivasi belajar geografi siswa SMA Negeri 1 Sukosari Bondowoso Penelitian ini menggunakan metode penelitian kualitatif dengan pendekatan fenomenologi. Subjek penelitian adalah siswa SMA Negeri 1 Sukosari Bondowoso . Peneliti adalah instrument utama penelitian. Pengumpulan data menggunakan teknik wawancara, observasi dan dokumentasi. Analisis data menggunakan pisau analisis fenomenologis Alferd Schutz dengan cara memahami tindakan rasional siswa berdasarkan motif sebab (because of motives) dan motif tujuan (in order to motives). Dalam penelitian ini, triangulasi data, melakukan member check dan melakukan ketekunan pengamatan diterapkan untuk mengecek keabsahan data. Hasil penelitian ini adalah (1) pertama, berdasarkan hasil penelitian ditemukan beberapa siswa yang termotivasi dalam pembelajaran geografi dan ditemukan juga siswa yang tidak termotivasi dalam pembelajaran geografi. (2) kedua, bagi siswa yang termotivasi belajar geografi maknanya adalah memiliki hasrat belajar dari dalam diri sendiri merupakan faktor utama penyebab seorang siswa termotivasi untuk belajar. Bagi siswa yang tidak termotivasi belajar maknanya adalah memiliki keluarga yang tidak harmonis dan tidak mendapatkan dorongan belajar dari orang tua merupakan faktor utama siswa tidak termotivasi. (3) ketiga, faktor yang berpengaruh terhadap motivasi belajar geografi siswa SMA Negeri 1 Sukosari Kabupaten Bondowoso terdiri dari faktor intrinsik dan faktor ekstrinsik. Faktor intrinsik meliputi; hasrat belajar, minat belajar, keinginan berprestasi, keinginan melanjutkan ke perguruan tinggi dengan mendapatkan beasiswa dan keinginan tercapai cita-citanya. Sementara faktor ekstrinsik meliputi; keharmonisan dan dukungan keluarga, dorongan dari guru, dorongan dari teman, lingkungan sekitar, metode mengajar guru serta fasilitas dan media pembelajaran. Setelah mengetahui hasil penelitian, maka disarankan agar wali siswa lebih memberikan perhatian, dorongan dan dukungan belajar kepada putra-putrinya. Guru geografi diharapkan mampu meningkatkan kualitas pembelajarannya melalui penerapan metode pembelajaran yang variatif, menarik, komunikatif dan kooperatif

Pengaruh metode berbasis masalah vs metode investigasi kelompok dan motivasi berprestasi terhadap hasil belajar mahasiswa Jurusan PPkN FKIP Undana / Petrus Ly

 

ABSTRAK Ly, Petrus. 2016Pengaruh Metode Berbasis Masalah Vs Metode Investigasi Kelompok Dan Motivasi Berprestasi Terhadap Hasil Belajar Mahasiswa Jurusan PPKn FKIP Undana. Disertasi. Program Studi Teknologi Pembelajaran. Pascasarjana. Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. I Nyoman Sudana Degeng, M. Pd., (II) Prof. Dr. H. Punadji Setyosari,M.Pd.,M.Ed.,(III) Dr. Sulton, M.Pd. Key Words:Pembelajaran berbasis masalah, investigasi kelompok, motivasi berprestasi, hasil belajar. Persoalan dalam perkuliahan di Jurusan PPKn adalah dosen tidak menggunakan pembelajaran aktif dan inovatif, dominan mengajar menggunakan metode ceramah.Akibatnya suasana pembelajaran tidak bergairah karena selain tidak ada upaya inovatif dalam pendekatan,model pembelajaran, strategi dan metode mengajar juga tidak memperhatikan upaya memotivasi mahasiswa untuk belajar.Masalah penelitian ini adalah sebagai berikut;(1)Apakah terdapat perbedaan signifikan hasil belajar kognitif pada mahasiswa yang diajarkan dengan menggunakanmetode pembelajaran berbasis masalah dan metode investigasi kelompok?. (2).Apakah terdapat perbedaan signifikan antara hasil belajar kognitif mahasiswa yang memiliki motivasi berprestasi tinggi dan yang memiliki motivasi berprestasi rendah?.(3) Apakah terdapat interaksi antara penggunaan metode pembelajaran dan motivasi berprestasi terhadap hasil belajar kognitif.Tujuan penelitian adalah: 1) menguji perbedaan hasil belajar kognitif antara mahasiswa yang diajar dengan menggunakan metode pembelajaran berbasis masalah dan mahasiswa yang diajarkan dengan metode Investigasi kelompok,(2) menguji perbedaan hasil belajar kognitif antara mahasiswa dengan motivasi berprestasi tinggi dan mahasiswa dengan motivasi berprestasi rendah, dan (3) menguji ada tidaknya interaksi antara metde pembelajaran dan motivasi berprestasi pada hasil belajar kognitif. Penelitian ini menggunakan desain eksperimen semu (quasi experimental design) dengan rancangan versi faktorial 2x2 pretest-post test nonequivalent control group design. Subyek penelitian adalah mahasiswa Jurusan PPKn FKIP Undana Kupangyakni mahasiswa semester VI tahun akademik 2015/2016 sejumlah dua kelas. Jumlah mahasiswa yang aktif mengikuti penelitian sampai akhir adalah 50 orang sedangkan lainnya gugur pada pertemuan ke tiga dan keempat sebanyak 14 orang. Hasil penelitin menunjukkan;(1)Terdapat perbedaan hasil belajar kognitif mahasiswa yang diajar dengan menggunakan metode pembelajaran berbasis masalah dan menggunakan metode Investigasi kelompok. Mahasiswa kelas metode pembelajaran berbasis masalah memiliki rerata hasil belajar yang tinggi dibandingkan dengan metode Investigasi Kelompok. (2)Terdapat perbedaan hasil belajar kognitif anatara mahasiswa dengan motivasi berprestasi tinggi dan mahasiswa dengan motivasi berprestasi rendah. (3) Ada interaksi antara metode pembelajaran dan motivasi berprestasi terhadap hasil belajar kognitif. Berdasarkan hasil temuan penelitian, dosen disarankan untuk menerapkan metode pembelajaran berbasis masalah dan metode Investigasi kelompok pada proses pembelajaran, terutama mata pada Jurusan PPKn FKIP Undana, karena selain dapat sangat berpengaruh signifikan terhadap peningkatan hasil belajar, meningkatkan motivasi berprestasi dan meningkatnya kemampuan mahasiswa dalam menemukan dan memecahkan masalah serta dapat menumbuh kembangkan kemampuan berpikir tingkat tinggi mahasiswa.

Persepsi siswa terhadap profil kompetensi guru dalam pembelajaran IPS kelas IV SDN Kebonsari 4 Kota Malang / Evi Dianita

 

Kata Kunci: Persepsi Siswa, Kompetensi Guru, Pembelajaran IPS SD IPS merupakan bidang studi gabungan dari 4 disiplin ilmu, yaitu sejarah, geografi, sosiologi dan ekonomi. Untuk itu perlu adanya kemampuan dalam menyampaikan materi IPS yang didalamnya memuat 4 disiplin ilmu IPS. Dari arah kompetensi pedagogik seorang guru IPS diharapkan mampu merangkai 4 disiplin ilmu IPS menjadi satu materi yang utuh. Dari pandangan kompetensi kepribadian seorang guru IPS harus mengarah pada sosok yang berkepribadian baik dalam menerapkan materi-materi 4 disiplin ilmu IPS. Dari arah kompetensi sosial seorang guru IPS harus mampu bersosialisasi dengan baik. Dari segi kompetensi profesional seorang guru IPS harus mampu mengembangkan materi 4 disiplin ilmu IPS sesuai dengan perkembangan ilmu pengetahuan. Penulisan skripsi ini bertujuan untuk (1) Mendeskripsikan persepsi siswa tentang profil kompetensi pedagogik guru dalam pembelajaran IPS kelas IV SDN Kebonsari 4 Malang (2) Mendeskripsikan persepsi siswa tentang profil kompetensi kepribadian guru dalam pembelajaran IPS kelas IV SDN Kebonsari 4 Malang (3) Mendeskripsikan persepsi siswa tentang profil kompetensi sosial guru dalam pembelajaran IPS kelas IV SDN Kebonsari 4 Malang (4) Mendeskripsikan persepsi siswa tentang profil kompetensi profesional guru dalam pembelajaran IPS kelas IV SDN Kebonsari 4 Malang Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Sumber data dalam penelitian ini adalah siswa kelas IV SDN Kebonsari IV Malang dan Guru IPS kelas IV SDN Kebonsari 4 Malang. Teknik pengumpulan data berupa angket, dan wawancara. Teknik analisis data yang digunakan yaitu teknik deskriptif kualitatif. Keterbatasan penelitian ini, hanya meneliti 1 guru. Berdasarkan hasil analisis data menunjukkan bahwa guru IPS kelas IV memiliki kompetensi pedagogik 64% yang tergolong cukup baik, kompetensi kepribadian 87% tergolong baik, kompetensi sosial 85% tergolong baik dan kompetensi profesional 78% tergolong baik. Untuk kompetensi pedagogik pada indikator mengembangkan kurikulum, guru masih belum mengembangkan kurikulum. Dari hasil wawancara dengan guru, diketahui bahwa guru memahami teknik pembuatan RPP, namun guru belum membuat RPP sendiri. Dari hasil penelitian dapat disimpulkan bahwa berdasarkan persepsi yang diberikan siswa kelas IV, guru IPS kelas IV SDN Kebonsari IV Kota Malang secara umum sudah memiliki dan menerapkan kompetensi pedagogik, kompetensi kepribadian, kompetensi sosial dan kompetensi profesional. Meskipun masih ada indikator yang belum terpenuhi pada kompetensi pedagogik. Dari hasil kesimpulan dapat disarankan bahwa seorang guru wajib mengembangkan sendiri perangkat pembelajaran yang dimiliki. Hal ini bertujuan untuk mengembangkan teknik pembelajaran dan pengetahuan guru, terutama pada bidang ilmu pengetahuan sosial. Karena materi IPS terus berkembang mengikuti perkembangan masyarakat secara global.

Penerapan model pembelajaran Problem Based Learning (PBL) untuk meningkatkan kemampuan berpikir analitis siswa kelas XI IPS 4 MAN Kota Batu semester genap tahun ajaran 2015/2016 / Ma’rifatul Ulya

 

ABSTRAK Ulya, Ma’rifatul. 2016. Penerapan Model Pembelajaran Problem Based Learning untukMeningkatkanKemampuanBerpikirAnalitisSiswaKelas XI IPS-4 MAN Kota Batu Semester GenapTahunAjaran 2015/2016. Skripsi, JurusanGeografi, FakultasIlmuSosial. UniversitasNegeri Malang.Pembimbing; (I) Drs. Mustofa, M.Pd. (II) Drs. MarhadiS.K, M.Si. Kata Kunci: Problem Based Learning, Kemampuan,BerpikirAnalitis Berdasarkanpengamatan yang dilakukanolehpenelitipada semester genap 2015/2016 di kelas XI IPS 4 MAN Kota Batu, diketahuikemampuanberpikiranalitissiswamasihrendah.Hal inidisebabkanpembelajaran yang dilakukanoleh guru kurangmampuuntukmengasahkemampuanberpikiranalitissiswa. Model pembelajaran yang disarankanuntukmengatasirendahnyakemampuanberpikiranalitisadalah modelpembelajaranproblem based learning. Penerapanproblem based learningbertujuanuntukmeningkatkankemampuanberpikiranalitissiswa. Penelitianinitermasukdalampenelitiantindakankelas (PTK) dengansubjekpenelitiansiswakelas XI IPS 4 MAN Kota Batu yang berjumlah 29.Penelitiandilaksanakandenganduasiklus, setiapsiklusterdiridariempatlangkah.Data yang dianalisisadalahkemampuanberpikiranalitissiswa. Data dikumpulkandenganmenggunakantesdanobservasi. BerdasarkanhasilpenelitiandiketahuibahwaadapeningkatanhasilkemampuanberpikiranalitissiswamatapelajaranGeografikelas XI IPS 4 MAN Kota Batu. Rata-rata nilaikemampuanberpikiranalitissiswasiklus I adalah 71,51. Padasiklus II mengalamipeningkatanmenjadi 84,82. Berdasarkanhasilpenelitiandiperolehkesimpulanbahwapembelajaran model Problem Based Learningdapatmeningkatkankemampuanberpikiranalitissiswakelas XI IPS MAN Kota Batu semester genaptahunajaran 2015/2016. Berdasarkanpenelitian yang dilakukanterdapatduakendaladalampelaksanaan problem based learning. Kendalapertamaadalahpengorganisasiankelompok.Kendalakeduaadalahpenyajianhasilkarya.Dengandemikianperluadanyaantisipasidanpersiapandari guru untukmemaksimalkan proses pembelajarandengan model problem based learning.

Penerapan metode eksperimen melalui permainan balon udara untuk meningkatkan kemampuan kognitif anak kelompok B di TK Dharma Wanita Persatuan IX Beji / Siti Masruro

 

Kata kunci : permainan balon udara kemampuan kognitif, TK Kemampuan kognitif anak di Taman Kanak-Kanak yang integral dari struktur kegiatan pembelajaran. Untuk itu perlu adanya pembelajaran yang bisa meningkatkan kemampuan kognitif anak salah satunya dengan menggunakan permainan balon udara untuk meningkatkan kemampuan kognitif anak kelompok B TK Dharma Wanita Persatuan IX Beji. Penelitian ini bertujuan untuk (1) Untuk mendeskripsikan penerapan metode eksperimen melalui Permainan balonudara untuk meningkatkan kemampuan kognitif pada anak kelompok B di TK Dharma Wanita Persatuan IX Beji. (2) Untuk mendeskripsikan peningkatan kemampuan kognitif anak kelompok B di TK DharmaWanita Persatuan IX Beji dengan penerapan metode eksperimen melalui Permainan balon udara. Penelitian ini menggunakan desain penelitian tindakan kelas (PTK) yang terdiri dari dua siklus, masing-masing siklus terdiri dari tahap perencanaan, pelaksanakan tindakan, observasi dan refleksi. Subyek penelitian yang digunakan sejumlah 20 anak dan melibatkan satu guru kolaborator. Teknik pengumpulan data yang dilakukan melalui teknik observasi berupa lembar observasi kegiatan anak dan dokumentasi.Teknik analisis data yang digunakan untuk menguji hipotesis tindakan yaitu dengan menggunakan nilai rata-rata dari siklus I ke siklus II. Hasil penelitian sebagai berikut : sesuai dengan langkah-langkah permainan balon udara yaitu guru menyiapkan peralatan percobaan permainan balon udara, guru menjelaskan tentang percobaan yang akan dilaksanakan, anak-anak melakukan percobaan, membilang jumlah balon dan mengurutkan ukuran balon, maka kemampuan kognitif pada pratindakan diperoleh rata-rata 10% meningkat pada siklus I yang dilakukan pada tanggal 30 April 2012 yaitu diperoleh rata-rata 40%. Pada siklus II dilakukan pada tanggal 31 Mei 2012 diperoleh rata-rata 85% terjadi kenaikan skor sebesar 45%. Berdasarkan hasil penelitian dapat disimpulkan bahwa permainan balon udara dapat digunakan dengan baik untuk meningkatkan kemampuan kognitif bagi guru TK dalam pembelajaran kemampuan kognitif disarankan agar guru memberikan pembelajaran yang menyenangkan, materi yang menarik, dan memberikan kesempatan kepada anak-anak untuk mengeksplorasi potensi dan kecerdasan yang dimiliki anak.

Penerapan model pembelajaran inquiry dalam meningkatkan kemampuan berpikir tingkat tinggi siswa kelas XI IPS SMA Negeri 7 Malang / Presdhian Puspita Wardhana

 

ABSTRAK Wardhana, Presdhian Puspita. 2016. Penerapan Model Pembelajaran Inquiry dalam Meningkatkan Kemampuan Berpikir Tingkat Tinggi Siswa Kelas XI IPS SMA Negeri 7 Malang. Skripsi. Jurusan Pendidikan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. Hadi Soekamto, S.H., M.Pd., M.Si, (II) Ir. Juarti, M.P Kata Kunci: Model Pembelajaran Inquiry, Kemampuan Berpikir Tingkat Tinggi. Berdasarkan observasi yang telah dilakukan, strategi pembelajaran yang diterapkan di kelas XI IPS 4 masih belum menekankan 5M (mengamati, menanya, mengeksperimen, mengasosiasi, dan mengomunikasikan) secara optimal. Hal ini menyebabkan siswa kurang melatih kemampuan berpikirnya dan keterlibatan siswa dalam pembelajaran di kelas cenderung kurang maksimal, sehingga kemampuan berpikir siswa masih rendah. Fakta lapangan menunjukkan hanya 4-5 dari 28 siswa (17%) mampu menjawab pertanyaan dengan tingkat kemampuan kognitif yang mencakup C4 dan C5. Solusi untuk memecahkan permasalahan tersebut adalah penerapan model pembelajaran Inquiry. Model pembelajaran Inquiry mengajak siswa lebih aktif dan membangun kemampuan berpikir dikarenakan penggunaan model pembelajaran Inquiry melatih siswa untuk mengembangkan berpikir secara sistematis, logis dan kritis yang mencakup saintifik. Tujuan penelitian ini untuk meningkatkan kemampuan berpikir tingkat tinggi siswa pada mata pelajaran geografi kelas XI IPS SMAN 7 Malang. Jenis penelitian ini merupakan penelitian tindakan kelas (PTK) atau Classroom Action Research (CAR) yang mengimplementasikan model pembelajaran Inquiry. Data penelitian diperoleh dari tes kemampuan berpikir tingkat tinggi siswa dan data observasi aktivitas siswa pada saat diskusi kelompok dalam penerapan model pembelajaran Inquiry. Teknik analisis data dimulai dari pengolahan data kemudian diketahui perbandingan nilai nilai kemampuan berpikir tingkat tinggi siswa pada pra tindakan, siklus I, dan siklus II. Hasil penelitian menunjukkan nilai rata-rata hasil tes kemampuan berpikir tingkat tinggi siswa meningkat. Hal ini dibuktikan dengan nilai rata-rata sebelum pra tindakan yang hanya 77,11 meningkat setelah diberikan tindakan pada siklus I menjadi 81 dengan persentase 5,04% dan siklus II memperoleh hasil yang lebih baik menjadi 86,39 dengan persentase sebesar 6,65%. Dengan demikian dapat disimpulkan bahwa model pembelajaran Inquiry dapat meningkatkan kemampuan berpikir tingkat tinggi siswa pada mata pelajaran geografi kelas XI IPS SMAN 7 Malang. Penelitian ini disarankan pada guru untuk memberikan arahan kepada siswa agar lebih aktif pada saat diskusi kelompok dan menyesuaikan pemahaman siswa pada materi yang digunakan dan bagi peneliti selanjutnya, sebaiknya mampu melakukan penelitian dengan variabel dan materi yang berbeda.

Pembentukan karakter TGP (Tentara Genie Pelajar) pada kegiatan ekstrakurikuler Pramuka di SMP Negeri 2 Sumberpucung Kabupaten Malang / Frinsania Sajidah

 

ABSTRAK Sajidah, Frinsania. 2016. PembentukanKarakterTGP(Tentara Genie Pelajar) PadaKegiatanEkstrakulikulerPramuka di SMP Negeri 2 Sumberpucung, Kabupaten Malang. Skirpsi, Program StudiPendidikanPancasiladanKewarganegaraan, JurusanHukumdanKewarganegaraan, FakultasIlmuSosial, UniversitasNegeri Malang. Pembimbing: (1) Drs. Margono, M.Pd.,M.Si., (2) Dra. ArbaiyahPrantiasih, M.Si Kata Kunci: PendidikanKarakter, EkstrakulikulerPramuka, NilaiKrakter SekolahMenengahPertama (SMP) merupakanlembagapendidikan formal padajenjangpendidikanmenengah yang bertujuanuntukmengembangkanpotensidalamdirisebagaidisiplinilmu.Sebagaisuatupendidikan formal yang menyelenggarakanpengajaranuntukpesertadidiknya, makasegalasesuatuharusdisusundandiaturmenurutpoladansistematikatertentu agar kegiatanpembelajarandapatberlangsungterarahpadapembentukandanpengembangankarakterpesertadidik. Penelitianinidilaksanakandengantujuanuntuk (1) mengetahuiapasaja program pembentukankarakter TGP padaekstrakulikulerPramuka di SMP Negeri 2 Sumberpucung, (2) mengetahuibagaimanapelaksanaan program pembentukankarakter TGP padakegiatanPramuka di SMP Negeri 2 Sumberpucung, (3) mengetahuiapasajanilai-nilaikarakter TGP yang diterapkanpadakegiatanPramuka di SMP Negeri 2 Sumberpucung, (4) mengetahuifaktorapasaja yang menghambatmenerapkankarakter TGP padapesertadidik di SMP Negeri 2 Sumberpucung, (5) memberitahukanuntukmengetahuisolusiuntukmengatasifaktorpenghambatpenerapankarakter TGP padakegiatanPramuka di SMP Negeri 2 Sumberpucung. Penelitianinimenggunakanjenispenelitiankualitatifdeskriptif. Padapenelitiandeskriptifini, penelitibeusahauntukmenjelaskanbagaimanapenerapankarakter TGP padakegiatanPramuka di SMP Negeri 2 SumberpucungKabupaten Malang.Melaluijenispenelitianini data yang telahterkumpulmerupakanhasildariwawancaratentangbagaimanamenerapkankarakter TGP padasiswa-siswi SMP Negeri 2 Sumberpucung yang disusunsecarasistematis, akuratdan factual.Hal tersebutuntukmemberikanpenjelasansecaraterperincidansesuaidenngankeadaan yang terjadi di SMP Negeri 2 SumberpucungKabupaten Malang tanpaadarekayasa. Hasiltemuanpenelitianinimenunjukkanbahwa (1) program penerapan TGP di SMP Negeri 2 Sumberpucungdilaksanakanmelaluiserangkaiankegiatan, (2) Pelaksanaan program pembentukankarakter TGP padaekstrakulikulerdibagimenjadi 2 yaitukegiatanrutindankegiatantahunan, (3) nilai-nilaikarakter yang diterapkanpadakegiatanekstrakurikulerPramukaantara lain didapatdarikegiatanbaris-berbaris, ishoma, penyampaianmateri, penempuhansyaratkecakapanumum (SKU) danperkemahan, (4) terdapatbeberapakendaladalammenerapkankarakter TGP padakegiatanekstrakulikulerPramukaantara lain kendaladarisiswa, kendaladaripembinadankendalaanggarandana, (5) solusiuntukmneyelesaikanbeberapakendala yang adapadasaatmenerapkankarakter TGP padakegiatanekstrakulikulerPramuka di SMP Negeri 2 Sumberpucung. Berdasarkan data tersebutdapatdiambilkesimpulanbahwa program pembentukankarakterpadakegiatanPramuka di SMP Negeri 2 Sumberpucung yang paling seringdilaksanakanadalahkegiatanrutin.Dalammenerapkankarakter TGP padakegiatanPramukasangatlahdibutuhkankerjasamaantarapembinaPramuka, kakakpembinaPramuka, PanitiaGugusDepandanDewanGalangSMP Negeri 2 Sumberpucunguntuklebihseiriusdalammenerapkankarakter TGP padapesertadidik.

Pengaruh model Pembelajaran Berbasis Masalah (PBM) terhadap prestasi belajar fisika dasar II ditinjau dari kerja ilmiah dan sikap ilmiah mahasiswa Program Pendidikan Fisika-FMIPA Universitas Negeri Malang / Eddy Supramono

 

Kata Kunci: PBM, prestasi, kerja ilmiah, sikap ilmiah Kuliah teori Fisika Dasar cenderung berupa in¬formasi, dosen cenderung menuntaskan materi yang ada pada silabi. Pembelajaran yang demikian menye-babkan adanya pemahaman yang keliru pada mahasiswa tentang peme¬cahan ma-salah dalam fisika yang hanya mengutamakan produk tidak menekankan proses ilmiah, akibatnya mahasiswa meng¬alami kesulitan belajar dalam menguasai konsep fisika. Indikator kesulitan mahasiswa ditunjukkan dengan perolehan nilai pada akhir semester yang terbilang masih cukup rendah, maka perlu pembenahan pembelajaran Fisika Dasar khususnya Fisika Dasar II. Penelitian ini bertujuan menguji perbedaan prestasi belajar mahasiswa pada penerapan model PBM ditinjau dari kerja ilmiah dan sikap Ilmiah. Penelitian ini menggunakan jenis penelitian Quasy Experi¬mentation (semi eksperimen) dengan desain faktorial yang meng¬gunakan dua faktor dan masing-masing faktor menggunakan dua katagori. Populasi penelitian yang digunakan adalah seluruh mahasiswa se¬mes¬ter 2, angkatan 2011-2012 sebanyak 6 kelas. Sampel penelitian yang di¬am¬bil sebanyak 2 kelas dengan masing-masing kelas terdiri 36 mahasiswa secara purposive sampling. Selanjutnya, dari 2 kelas diambil 1 kelas sebagai kelas eksperimen (PBL), 1 kelas sebagai kelas kontrol (konvensional) dengan teknik undian. Intrumen tes prestasi berupa soal pilihan ganda sebanyak 25 butir soal yang telah melewati uji validitas dengan menggunakan responden sebanyak 87 mahasiswa angkatan 2010 dan 2011. Selanjutnya, Reliabilitas instrumen dicari dengan menggunakan KR 20, didapatkan 0,71 yang termasuk kriteria tinggi. Uji hipotesis dilakukan dengan statistik Anava Dua Jalur. Instrumen tes kerja ilmiah dan skala sikap ilmiah yang digunakan sebagai variabel moderator telah divalidasi oleh dua orang pakar. Hasil penelitian menunjukkan, bahwa ada perbedaan prestasi kerja ilmiah tinggi kelas eksperimen dengan kontrol tetapi tidak signifikan ditunjukkan dari harga : Fh > Ft (18,62>4,06), dan Qh lebih kecil Qt (1,05<4,20). Ada perbedaan prestasi belajar mahasiswa kerja ilmiah rendah yang signifikan antara kelas eksperimen dengan konvensional dibuktikan dengan adanya : Fh > Ft (11,56>4,06), dan harga Tukey 7,58 yang lebih besar dari Qt (7,58>4,20). Dengan cara yang sama didapatkan, bahwa tidak terdapat perbedaan prestasi belajar mahasiswa sikap ilmiah tinggi antara kelas eksperimen dengan konvensional dan juga tidak terdapat perbedaan prestasi belajar mahasiswa sikap ilmiah rendah antara kelas eksperimen dengan konvensional pada materi Optika-Geometrik dengan adanya hasil: Qh Qt (7,71>4.20). Interaksi terjadi antara model pembelajaran dengan prestasi belajar mahasiswa ditinjau dari kerja ilmiah, Fh > Ft (10,68>4,06) dan sikap ilmiah, Fh > Ft (5,771>4,06), atau terjadi interaksi antara faktor kolom dan baris.

Tindakan kekerasan suporter sepakbola (studi kasus Suporter Arema di Kota Malang) / Muhammad Hamzah Ratno Putra

 

ABSTRAK Putra, Muhammad Hamzah Ratno. 2016. Tindakan Kekerasan Suporter Sepakbola (Studi Kasus Kekerasan Suporter di Kota Malang). Skripsi, Jurusan Pendidikan Pancasila dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) Drs. Suparlan Al Hakim, M. Si. (2) Drs. Petir Pudjantoro, M. Si. Kata Kunci: Kekerasan Suporter, Fanatisme, Upaya represif dan upaya preventif Indonesia merupakan Negara besar yang memiliki keanekaragaman budaya di setiap daerahnya, tidak terkecuali pula denga olahraga sepakbola. Jawa timur menjadi provinsi penyumbang terbanyak klub yang berlaga di kompetisi sepakbola dalam negeri. Kota Malang termasuk salah satu kota besar di wilayah Jatim yang mempunyai klub bernama Arema. Aremania adalah suporter fanatik milik Arema yang senantiasa mendukung Arema saat bertanding. Namun kehadiran suporter disertai dengan fanatisme yang tinggi tidak selamanya berakhir baik. Fanatisme yang tinggi akhirnya akan menimbulkan persaingan antar suporter yang dapat menimbulkan aksi kekerasan antar suporter. Kekerasan ini tidak hanya menyebabkan korban jiwa tetapi juga menimbulkan kekacauan di masyarakat. Maka dari itu diperlukan solusi untuk menyelesaikan kekerasan suporter agar kejadian tersebut tidak terulang lagi. Rumusan masalah dalam penelitian ini adalah (1) Apakah kasus kekerasan suporter yang terjadi di Kota Malang? (2) Apakah faktor penyebab terjadinya kekerasan yang dilakukan oleh suporter sepakbola di Kota Malang? (3) Bagaimana langkah-langkah yang dilakukan untuk menyelesaikan permasalahan kekerasan suporter di wilayah Kota Malang? Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian studi kasus. Kehadiran peneliti bertindak sebagai pengumpul data. Lokasi penelitian terletak di Polres Malang, PSSI Kota Malang dan PT. Arema Indonesia. Sumber data yang digunakan adalah sumber data primer dan data sekunder. Prosedur pengumpulan data dalam penelitian ini adalah observasi, wawancara dan dokumentasi. Analisis data menggunakan model analisis Miles dan Huberman. Untuk menjaga keabsahan temuan digunakan triangulasi (metode, sumber dan waktu), dan kecukupan referensial. Berdasarkan analisis data tersebut, diperoleh dua kesimpulan hasil penelitian sebagai berikut. Pertama, faktor terjadinya aksi kekerasan suporter adalah faktor fanatisme, faktor panpel dalam mengakomodasi keamanan, faktor keputusan wasit, faktor perilaku pemain saat bertanding, faktor kondisi sosial dan ekonomi dan faktor fasilitas stadion. Kedua, langkah yang dilakukan untuk menyelesaikan permasalah tersebut ada dua yaitu upaya represif dan upaya preventif. Upaya represif yang dilakukan secara garis besar adalah menerapkan sanksi hukuman sesuai dengan pedoman masing-masing sesuai dengan golongan pelanggaran yang dilakukan oleh suporter, Upaya preventif yang dilakukan secara garis besar adalah melakukan sosialisasi untuk meminimalisir aksi kekerasan di dalam maupun di luar stadion. Disarankan penelitian selanjutnya untuk mengkaji tentang kondisi sosial dan ekonomi suporter di Kota Malang terkait tentang kekerasan suporter di Kota Malang.

Faktor-faktor penyebab terjadinya perkawinan usia muda di Desa Pamoroh Kecamatan Kadur Kabupaten Pamekasan / Fadolul Ghafur

 

ABSTRAK Ghafur, Fadolul. 2016. Faktor-faktor Penyebab Terjadinya Perkawinan Usia Muda di Desa Pamoroh Kecamatan Kadur Kabupaten Pamekasan. Skripsi. Jurusan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Dr. Singgih Susilo, M.S., M.Si (II) Drs. M. Yusuf Idris. Kata Kunci: Pernikahan Muda, Kondisi Ekonomi, Sosial dan Budaya Perkawinan memiliki aturan dan hukum yang berlaku salah satunya mengenai batasan usia pernikahan yaitu 18 tahun sebagaimana dijelaskan dalam undang-undang No.1 tahun 1974 tentang perkawinan, UU RI No.23 tahun 2003 tentang perlindungan anak juga berdasarkan usia pendidikan. Batasan usia perkawinan oleh BKKBN (1998) perkawinan ideal adalah perkawinan yang dilakukan oleh seorang laki-laki dengan usia minimal 25 tahun dan usia minimal wanita 20 tahun. Perkawinan usia muda pada tahun 2011 sampai 2015 terhitung jumlah pasangan yang melangsungkan akad nikah pada usia 10-19 tahun yakni 18, 26, 32, 35 dan 36. Berdasarkan hal tersebut, penelitian ini dimaksudkan untuk mengetahui pengaruh faktor ekonomi, pendidikan, beban tanggungan, budaya serta faktor yang paling berpengaruh terhadap pernikahan usia muda di Desa Pamoroh. Penelitian ini merupakan penelitian dengan metode kuantitatif melalui pendekatan expose facto. Jenis penelitian yang digunakan yaitu korelasional untuk mengetahui pengaruh variabel bebas terhadap variabel terikat dengan mengunakan metode survey dalam pengumpulan data. Jumlah sampel dalam penelitian yaitu 83 responden di Desa Pamoroh yang ditentukan secara proposional randem sampling. Analisis data yang digunakan yaitu tabulasi tunggal, tabulasi silang serta uji statistik regresi linear berganda. Hasil penelitian analisis tabulasi dan hasil uji regresi linear berganda menunjukkan bahwa secara serentak semua variabel dependen berpengaruh terhadap pernikahan dini. Pada hasil uji statistik secara parsial variable pendidikan dan beban tanggungan memiliki pengaruh dan variabel ekonomi serta budaya yang hanya memiliki pengaruh kecil terhadap variabel terikat. Faktor yang paling dominan memberikan pengaruh terhadap pernikahan muda adalah lama pendidikan dan sumbangan paling kecil adalah variabel budaya. Saran yang diajukan berdasarkan permasalah yang berkaitan dengan pernikahan muda di Desa Pamoroh yaitu 1) pemerintah Kabupaten Pamekasan perlu memperhatiakan pendidikan terutama mengenai aksesibilitas, fasilitas dan biaya pendidikan, 2) diperlukan adanya penyuluhan menyenai dampak dari pernikahan muda terutama pada perempuan, 3) perlu adanya penyuluhan pada masyarakat mengenai program KB untuk menghindari jumlah tanggungan keluarga yang tinggi.

Faktor-faktor yang mempengaruhi keikutsertaan masyarakat dalam praktek KB (studi kasus di Desa Wonokerto Kecamatan Sukorejo Kabupaten Pasuruan) / Ahmad Saikhu

 

ABSTRAK Saikhu, Ahmad. 2016. Faktor-Faktor yang Mempengaruhi Keikutsertaan Masyarakat dalam Praktek KB di Desa Wonokerto Kecamatan Sukorejo Kabupaten Pasuruan. Skripsi. Jurusan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Budijanto, M.S., M.Si (II) Drs. Marhadi Slamet Kistiyanto, M.Si. Kata Kunci: Keluarga Berencana (KB), Keikutsertaan KB, Variabel sosial, ekonomi dan Budaya Semakin tinggi pertumbuhan penduduk akan semakin besar juga usaha yang diperlukan untuk mencapai tingkat pemerataan kesejahteraan rakyat. Upaya mengatasi kependudukan tersebut dilakukan oleh banyak pihak, bahkan instansi atau departemen, lembaga, dan masyarakat. Upaya pemerintah untuk menahan ledakan penduduk ini, yaitu dengan program yang dikenal dengan istilah Keluarga Berencana (KB). KB merupakan program yang digalakkan pemerintah untuk menekan laju pertumbuhan penduduk Indonesia. Hal ini disebabkan jumlah penduduk Indonesia menduduki posisi nomor empat terbanyak di dunia. Berdasarkan hal tersebut, penelitian ini bertujuan untuk mengetahui sebaran dan memaparkan tingkat keikutsertaan PUS dalam pelaksanaan program KB serta faktor-faktor apa saja yang berkontribusi terhadap keikutsertaan PUS dalam pelaksanaan program KB di Dusun Timur Jurang Desa Wonokerto Kecamatan Sukorejo Kabupaten Pasuruan. Penelitian ini merupakan penelitian kuantitatif. Jenis penelitian yang digunakan yaitu tabulasi tunggal dan tabulasi silang untuk mengetahui hubungan variabel bebas terhadap variabel terikat dengan menggunakan metode survey dalam pengumpulan data. Jumlah sampel dalam penelitian yaitu 91 responden di Dusun Timur Jurang Desa Wonokerto yang ditentukan dengan cara Simple Random Sampling. Analisis data yang digunakan yaitu tabulasi tunggal, tabulasi silang. Saran yang diajukan berdasakan permasalahan yang berkaitan dengan keikutsertaan KB di Dusun Timur Jurang yaitu (1) masyarakat harus bertindak lebih aktif dalam artian yaitu mencari informasi sendiri mengenai program KB dengan mendatangi pelayanan kesehatan atau PPKBD, (2) pemerintah agar lebih meningkatkan lagi penyuluhan tentang program Keluarga Berencana kepada masyarakat, (3) pemerintah agar lebih memperhatikan lagi tentang terselenggaranya program Keluarga Berencana khususnya di daerah pedesaan.

Hubungan pemberian kompensasi finansial dengan kinerja karyawan PR. Delapan Wijaya Malang / Herman Panjaitan

 

Key words: Financial Compensation, Employee Performance Human resource is one of production factors that a company uses and is one of elements to determine the success of an organization. This makes human resource a company asset which efficiency and performance have to be enhanced. Therefore, the , company should be capable of creating such conditions that allow the employee to develop and improve their abilities and skills in an optimal. One of the efforts to achieve such conditions is by giving satisfactory compensation. Level of employee performance has a highly close relationship with the compensation giving system that is implemented by the company or the organization where they work. The objectives of this study were (1) to find out the implementation of financial compensation giving to the employees at PR. Delapan Wijaya Malang, (2) to find out the condition of employee performance at PR. Delapan Wijaya Malang, (3) to analyze the effects of financial compensation giving on the employee performance at PR. Delapan Wijaya Malang. This study was an explanatory research with correlational/causal associative since it attempted to find out not only the relationships among variables, but also the effects on the dependent variable. The variables studied in the research were financial compensation as the independent variable (X) and employee performance as the dependent variable (Y). The population of the study was the entire regular employees at PR. Delapan Wijaya Malang numbering 37 people. All of them were involved to be the samples, so this study could also be named population study. The research instrument was questionnaire. The findings led to the inferences that: (1) the implementation of financial compensation giving to the employees at PR. Delapan Wijaya Malang had been satisfactorily and in accordance with their necessities according to the employees. In general, they agreed with all policies that the company had set; (2) in general, the employees at PR. Delapan Wijaya Malang agreed that they worked accordingly to the rules, procedures, systems, and regulations implemented by the company; (3) financial compensation giving had a correlation with the employee

Penerapan prionsip andragogy dalam pelatihan kejuruan di Unit Pelaksana Teknis Pelatihan Kerja Singosari, Jawa Timur / Ika Nurul Marthaningtyas

 

Kata Kunci: penerapan prinsip andragogi, program pelatihan kejuruan Proses pembelajaran pelatihan berbeda dengan proses pembelajaran di sekolah. Kegiatan pelatihan merupakan proses pembelajaran bagi orang dewasa yang menggunakan pendekatan andragogi. Maka, model pendekatan andragogi dianjurkan dalam proses pembelajaran pelatihan. Tujuan penelitian ini untuk mendeskripsikan penerapan prinsip andragogi pada pelatihan kejuruan tata niaga mengenai penampilan instruktur, organisasi dan seleksi materi belajar, metode pembelajaran, dan pengelolaan lingkungan belajar. Penelitian ini menggunakan rancangan deskriptif kuantitatif, yang bertujuan mendeskripsikan penerapan prinsip andragogi dalam program pelatihan kejuruan di Unit Pelaksana Teknis Pelatihan Kerja Singosari. Populasi penelitian yakni instruktur dan peserta pelatihan berjumlah 48 orang dari kejuruan tata niaga. Teknik pengumpulan data menggunakan angket, observasi, wawancara serta studi dokumentasi, dan teknik analisis datanya menggunakan persentase. Hasil penelitian menunjukkan bahwa prinsip andragogi dalam pelatihan kejuruan tata niaga mengenai penampilan pelatih, metode pembelajaran dan pengelolaan lingkungan sudah diterapkan. Hal ini dilihat dari cara instruktur dalam berkomunikasi tidak memonopoli pembicaraan, bersemangat dan membantu pengembangan sikap positif peserta. Metode yang digunakan instruktur adalah ceramah, diskusi, simulasi dan curah pendapat yang dapat mengembangkan serta meningkatkan keterampilan peserta. Pengelolaan lingkungannya yakni, adanya saling menghargai dan mengenal antar peserta, peserta dengan instruktur. Pada pelatihan administrasi kantor dan bahasa inggris penerapan prinsip andragogi mengenai pengelolaan fisik kurang diterapkan. Demikian pula penyeleksian dan pengorganisasian materi belajar prinsip andragogi kurang diterapkan. Hal ini karena tema materi pelatihan sudah ditetapkan oleh balai, sehingga peserta tidak dapat menentukan materi yang diinginkan. Disarankan bagi instruktur, hendaknya lebih mampu membangun suasana kondusif dan terbuka agar dapat terjalin kerjasama yang baik antara peserta dan instruktur. Bagi UPT, dapat melihat ulang penataan ruangan kelas sehingga dapat memberikan suasana pembelajaran lebih menyenangkan, agar ruang gerak antara peserta dan peserta lainnya, serta antara peserta dan instruktur lebih nyaman. Bagi Jurusan PLS diharapkan penelitian ini dapat menambah khasanah pengetahuan tentang prinsip belajar orang dewasa dalam pembelajaran di Balai Pelatihan. Bagi peneliti lanjutan dapat mengembangkan hasil penelitian mengenai prinsip andragogi di kejuruan lain dan di lembaga pelatihan yang berbeda.

Pengembangan Lembar Kerja Siswa materi Permutasi dan Kombinasi dengan pensekatan inkuiri / Nurlaila Tri Wulandari

 

ABSTRAK Wulandari, Nurlaila 2016. Pengembangan Lembar Kerja Siswa materi Permutasi dan Kombinasi dengan Pendekatan Inkuiri. Skripsi, Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing : Dr. Erry Hidayanto, M.Si Kata kunci: lembar kerja siswa, permutasi dan kombinasi, pendekatan inkuiri Matematika merupakan mata pelajaran yang perlu diberikan kepada semua peserta didik mulai dari sekolah dasar sampai perguruan tinggi untuk membekali mereka kemampuan berpikir logis, analitis, sistematis, kritis dan kreatif. Berdasarkan penelitian sebelumnya, pada materi permutasi dan kombinasi peserta didik kesulitan dalam membedakannya. Peserta didik bingung dalam menerapkan dalam soal. Hal itu dikarenakan peserta didik hanya menggunakan metode menghafal tanpa memahami perbedaan dari permutasi dan kombinasi itu sendiri. Bahan ajar yang dikembangkan berupa Lembar Kerja Siswa untuk materi permutasi dan kombinasi dengan pendekatan inkuiri. Lembar Kerja Siswa dengan pendekatan inkuiri adalah Lembar Kerja Siswa yang berisi kegiatan penemuan konsep maupun latihan permasalahan permutasi dan kombinasi yang membantu siswa untuk aktif berpikir melalui pertanyaan-pertanyaan arahan yang sifatnya membimbing. Lembar Kerja Siswa ini memberikan kesempatan pada siswa untuk mempelajari pokok bahasan permutasi dan kombinasi secara mandiri dalam pengawasan dan bimbingan guru. Penelitian pengembangan ini menggunakan model pengembangan Thiagarajan. Model Thiagarajan dalam Hobri (2010:12-16) ini terdiri dari 4 tahap pengembangan yaitu Define, Design, Develop, dan Disseminate atau diadaptasikan menjadi model 4-D, yaitu pendefinisian, perancangan, pengembangan, dan penyebaran. Penelitian ini menggunakan model pengembangan Thiagarajan 4-D yang telah di adaptasi menjadi tiga tahap, yaitu Define, Design, dan Develop dengan pertimbangan terbatasnya waktu, biaya serta produk yang dikembangkan hanya dapat digunakan untuk beberapa kalangan yang sesuai dengan kriteria pengembangan. Dalam penleitian ini dilakukan tiga uji coba terhadap kualitas produk pengembangan yang terdiri dari uji kevalidan, uji kepraktisan, dan uji keefektifan. Uji kevalidan dilakukan oleh dua orang validator yang terdiri dari satu orang dosen matematika dan satu orang praktisi. Uji kepraktisan dilakukan dengan mengambil skor dari hasil pengerjaan Lembar Kerja Siswa yang telah dikerjakan oleh peserta didik. Uji keefektifan dilakukan dengan mengambil skor dari tes hasil belajar. Berdasarkan hasil analisis diperoleh 3 kesimpulan. Pertama, untuk uji kevalidan terdapat tiga instrumen yang divalidasi oleh validator. Instrumen yang pertama adalah Lembar Kerja Siswa yang memperoleh skor rata-rata hasil validasi sebesar 3,32 sehingga Lembar Kerja Siswa termasuk pada kriteria valid namun dengan revisi. Instrumen yang kedua adalah RPP yang memperoleh skor rata-rata hasil validasi sebesar 3,67 sehingga RPP termasuk pada kriteria valid namun tetap dengan revisi. Instrumen yang terakhir adalah tes hasil belajar yang memperoleh skor rata-rata hasil validasai sebesar 3,36 sehingga tes hasil belajar termasuk pada kriteria valid. Kedua, Lembar Kerja Siswa ini dapat dikatakan praktis karena sebanyak 100% peserta didik memperoleh nilai di atas kriteria yang telah ditentukan sebelumnya. Ketiga, Lembar Kerja Siswa ini dapat dikatakan efektif karena sebanyak 100% peserta didik telah tuntas dalam menyelesaikan tes hasil belajar. Berdasarkan hasil analisis tersebut dapat dikatakan bahwa Lembar Kerja Siswa yang dikembangan merupakan media yang valid, efektif, dan praktis sehingga dapat digunakan sebagai penunjang pembelajaran pada materi permutasi dan kombinasi.

Manajemen peran serta masyarakat dalam meningkatkan mutu pendidikan (Studi multi situs pada SDN Bunga Lestari, SDN Bunga Kenanga, dan SDN Bunga Melati Kevamatan Trunojoyo Kabupaten Joko Tole) / Ratnawan Lukito

 

kata kunci : manajemen peran serta masyarakat, peningkatan mutu pendidikan, sekolah dasar negeri. Pendidikan memberikan konstribusi yang sangat besar terhadap kemajuan suatu bangsa, dan merupakan wahana dalam menerjemahkan pesan-pesan konstitusi serta sarana dalam pembangunan watak bangsa (nation character building). Masyarakat yang cerdas akan memberi nuansa kehidupan yang cerdas pula, dan secara progresif akan membentuk kemandirian. Masyarakat yang demikian merupakan investasi besar untuk berjuang keluar dari krisis dan menghadapi dunia global. Oleh karena itu setiap institusi pendidikan dalam rangka peningkatan mutu pendidikannya diperlukan partisipasi masyarakat. Berdasarkan dari konteks penelitian, maka fokus penelitian ini adalah : (a) bentuk peran serta masyarakat dalam meningkatkan mutu pendidikan, (b) teknik pelaksanaan peran serta masyarakat dalam meningkatkan mutu pendidikan, dan (c) mekanisme kerja peran serta masyarakat dalan meningkatkan mutu pendidikan pada SDN Bunga Lestari Kecamatan Trunojoyo Kabupaten Joko Tole, SDN Bunga Kenanga Kecamatan Trunojoyo Kabupaten Joko Tole, dan SDN Bunga Melati Kecamatan Trunojoyo Kabupaten Joko Tole. Sedangkan tujuan penelitian ini adalah mendiskripsikan bentuk-bentuk peran serta masyarakat, teknik-teknik peran serta masyarakat, serta mekanisme kerja peran serta masyarakat dalam meningkatkan mutu pendidikan di SDN Bunga lestari, SDN Bunga Kenanga dan SDN Bunga Melati Kecamatan Trunojoyo Kabupaten Joko Tole. Dalam penelitian ini penulis menggunakan metode yang bertujuan untuk mempelajari satu atau beberapa gejala, dengan jalan menganalisanya dan dengan mengadakan pemeriksaan yang mendalam terhadap fakta, untuk kemudian mengusahakan suatu pemecahan atas masalah-masalah yang ditimbulkan oleh fakta tersebut. Peristiwa demikian diperlukan pengamatan yang mendalam terhadap situasi yang wajar yang dikenal dengan pendekatan kualitatif. Berdasarkan rancangan studi multi situs ada beberapa rangkaian tahapannya berlangsung secara serempak dan analisisnya senantiasa berbalik ketahapan pengumpulan data. Penyusunan langkah-langkah untuk mengembangkan teori dilakukan dengan cara: a) mengumpulkan data yang diinginkan, b) mencari isu kunci peristiwa yang selalu berulang atau didalam data yang merupakan kategori kasus, c) mengklasifikasi data yang memberikan banyak kegiatan/kejadian, d) mengidentifikasi kategori-kategori yang sedang diselidiki, e) mengolah data. Dari hasil penelitian ditemukan bahwa manajemen peran serta masyarakat dalam peningkatan mutu pendidikan pada SDN Bunga Lestari, SDN Bunga kenanga dan SDN Bunga Melati Kecamatan Trunojoyo Kabupaten Joko Tole, dapat peneliti kemukakan sebagai berikut: a) umumnya bentuk peran serta masyarakat (PSM) sudah tidak terbatas pada pengumpulan dana dan dukungan fisik untuk pembangunan sarana sekolah saja, tetapi juga dalam bentuk motivasi, sumbangsih pemikiran dan keterlibatan dalam kepengurusan komite sekolah, b) sedangkan teknik yang digunakan masyarakat dalam memberikan dukungan dilakukan secara langsung,melalui forum pengajian atau silaturrahmi, melalui forum rapat. c) mekanisme yang dilakukan oleh masyarakat dalam berperan serta guna peningkatan mutu pendidikan adalah secara individu, melalui tokoh masyakat, dan melalui organisasi komite sekolah. Dari hasil penelitian ini dapat disimpulkan bahwa : a) bentuk peran masyarakat dalam meningkatkan mutu pendidikan tidak terbatas pada pengumpulan dana dan dukungan fisik, sekolah sudah memberikan kesempatan kepada masyarakat untuk berpartisipasi dalam upaya peningkatan mutu pendidikan, adanya program sekolah yang melibatkan peran serta masyarakat dalam peningkataan mutu pendidikan, adanya bentuk konkrit peran serta masyarakatya dalam peningkatan mutu pendidikan, b) meningkatkan kemampuan dan kesadaran tentang teknik peran serta masyarakat merupakan bukti nyata keterlibatan masyarakat, adanya atensi sekolah yang melibatkan peran serta masyarakat, c) mekanisme yang telah dilakukan masyarakat dalam memerankan dukungan untuk meningkatkan mutu pendidikan sangat membantu tercapainya pendidikan yang bermutu. Saran yang dikemukakan dalam penelitian ini adalah: a) bagi Dinas Pendidikan Kabupaten Joko Tole sebagai sumbangsih pemikiran agar dijadikan rujukan, b) bagi komite sekolah sebagai bahan rujukan dan bahan pertimbangan dalam menjalankan organisasi, c) bagi sekolah sebagai informasi dan sumbangsih pemikiran dan contoh ideal, d) bagi pengelola atau manager pendidikan sebagai refleksi, e) bagi pengembang ilmu manajemen pendidikan dan ilmu sosial sebagai referensi pemikiran serta pijakan, f) bagi peneliti lain akan menambah gambaran tentang peran serta masyarakat dalam pendidikan.

Pengaruh penggunaan graphic organizer dalam pembelajaran pemecahan masalah terhadap kemampuan pemecahan masalah matematika pada mahasiswa yang memiliki tipe growth mindset berbeda / Abdur Rahman As'ari

 

Mesin panas mekanika kuantum sistem fermion tunggal relativistik tak bermassa dalam kotak 1 dimensi / Deny Pra Setyo

 

ABSTRAK Setyo, Deny P. 2016. Mesin Panas Mekanika Kuantum Sistem Fermion Tunggal Relativistik Tak Bermassa dalam Kotak 1 Dimensi, Universitas Negeri Malang. Pembimbing: (I) Dr. Eny Latifah, M.Si, (II) Nugroho Adi Pramono, S.Si, M.Sc Kata Kunci: Mesin Otto Kuantum, Mesin Diesel Kuantum, Sistem Fermion Tunggal TakBermassa, Persamaan Dirac, Model AnalogiTerrmodifikasi Mesin panas mekanik merupakan piranti yang digunakan untuk mengkonversi energi panas menjadi usaha mekanik. Energi panasnya diperoleh dari reservoir panas dan sisanya keluar melalui reservoir dingin. Secara kuantum, mesin panas mekanik menggunakan materi-materi kuantumdan memenuhi perilaku mikroskopis. Penelitian mengenai mesin panas kuantum penting untuk dilakukan seiring perkembangkan teknologi yang menuju miniaturisasi lebih. Pada penelitian ini telah dieksplorasi mesin panas kuantum sistem fermion tunggal relativistik tak bermassa pada kotak 1D yang menjalani siklus seperti Otto dan Diesel khususnya pada mesin Otto dan mesin Diesel untuk sistem kuantum. Eksplorasi mesin Otto dan mesin Diesel kuantum diawali dengan menyelesaikan persamaan Dirac1D dengan syarat batas potensial tak hingga. Pada penelitian ini dipilih model analogi termodifikasi dengan implementasi hukum pertama termodinamika untuk mendeskripsikan proses-proses termodinamis pada sistem kuantum. Hasil yang diperoleh untuk mesin Otto Kuantum partikel Relativistik menunjukkan formulasi efisiensi yang serupa dengan formulasi efisiensi mesin Otto klasik dan mesin Otto kuantum non-Relativistik . Hasil yang serupa juga terjadi pada mesin Diesel kuantum. Perbedaan formulasi efisiensi mesin Otto dan Diesel kuantum Relativistik dibandingkan dengan formulasi mesin Otto dan Diesel kuantum non-Relativistik adalah faktor konstanta Laplace yang merupakan rasio antara panas jenis pada tekanan tetap dan volume tetap.

Perubahan sosial desa Jatiarjo (studi kasus kehadiran Taman Safari Indonesia II Prigen bagi masyarakat dan makna pendidikannya) / Indah Puspita Sari

 

Kata Kunci: Desa Jatiarjo, Taman Safari Indonesia II Prigen, Perubahan Sosial, Makna Pendidikan. Pariwisata juga merupakan suatu sektor yang tidak jauh berbeda dengan sektor ekonomi yang lain yaitu dalam proses perkembangannya juga mempunyai dampak atau pengaruh di bidang sosial dan ekonomi. Pengaruh yang ditimbulkan tersebut dapat berupa pengaruh positif maupun negatif terhadap kehidupan masyarakat setempat. Untuk mencegah perubahaan yang negatif maka diperlukan suatu perencanaan yang mencakup aspek sosial dan ekonomi, sehingga sedapat mungkin masyarakat setempat ikut terlibat di dalam perencanaan dan pengembangan pariwisata. Hal ini perlu dilakukan untuk mendukung keberhasilan pengembangan daerah wisata yang bersangkutan. Proses pembangunan dan pengembangan suatu wilayah dapat ditunjang oleh potensi wisata yang dimilikinya. Salah satu adalah objek wisata Taman Safari Indonesia II Prigen yang berada di Desa Jatiarjo. Dengan adanya Taman Safari Indonesia II Prigen telah membawa perubahan pada masyarakat Desa Jatiarjo. Dengan datangnya peluang usaha di lingkungan mereka menyebabkan terjadinya perubahan sosial di bidang: (1) Ekonomi (2) Pendidikan dan (3) Perilaku sosial yang terjadi pada masyarakat Desa Jatiarjo. Rumusan masalah dalam penelitian ini adalah: (1) Bagaimana kondisi masyarakat Desa Jatiarjo sebelum adanya pembangunan objek wisata Taman Safari Indonesia II Prigen? (2) Bagaimana dampak sosial pada masyarakat Desa Jatiarjo setelah pembangunan objek wisata Taman Safari Indonesia II Prigen? (3) Bagaimana hubungan dengan kehadiran Taman Safari Indonesia II Prigen bagi pendidikan di Desa Jatiarjo? Penelitian ini menggunakan pendekatan penelitian kualitatif. Jenis penelitian ini bersifat studi kasus. Teknik pengumpulan data yang digunakan adalah wawancara, observasi, dan studi dokumentasi. Analisis data yang digunakan adalah reduksi data, sajian data, dan penarikan kesimpulan. Kemudian pengecekan keabsahan data yang digunakan adalah perpanjangan keikutsertaan, ketekunan pengamatan, triangulasi, dan Expert Opinion. Hasil penelitian sebagai berikut: (1) Masyarakat Desa Jatiarjo mayoritas bermata pencaharian sebagai petani. Kondisi masyarakat Desa Jatiarjo yang masih sederhana menjadikan sebuah pendidikan formal tidak begitu menarik di kalangan masyarakat tersebut. Masyarakat lebih mementingkan bekerja dari pada harus sekolah yang tidak bisa menghasilkan uang. Desa Jatiarjo merupakan kawasan daerah tertinggal. Sebelum hadirnya Taman Safari Indonesia II Desa Jatiarjo masih memiliki sumber daya manusia yang rendah, kondisi masyarakatnya pun masih sederhana. (2) Pembangunan Taman Safari Indonesia II Prigen memiliki dampak tersendiri bagi lingkungan sekitar lokasi. Bukan hanya pada kondisi alam sekitar, tetapi juga meliputi seluruh rangkaian kehidupan sosial masyarakatnya. Dampak yang ditimbulkan akibat adanya pembangunan Taman Safari Indonesia II Prigen salah satunya adalah menyempitnya lahan pertanian hal ini dikarenakan sebagaian lahan pertanian warga digunakan untuk pembangunan Taman Safari Indonesia II Prigen. (3) Setelah adanya Taman Safari Indonesia II Prigen ini baik langsung maupun tidak langsung berpengaruh besar terhadap proses pendidikan dalam peningkatan sumber daya manusia di Desa Jatiarjo.II Prigen seharusnya diimbangi oleh Pemerintah Daerah Pasuruan (Dinas Kepariwisataan) dengan pembenahan sarana dan prasarana ke arah Berdasarkan kesimpulan maka disarankan: (1) Perkembangan Taman Safari Indonesia yang lebih baik serta adanya pengaturan atau penataan terhadap para pedagang yang ada di area Taman Safari Indonesia II Prigen agar lebih rapi dan teratur sehingga dapat menarik wisatawan. (2) Kebijakan yang diambil dan diputuskan oleh pengelola Taman Safari Indonesia II Prigen seharusnya dapat disosialisasikan terlebih dahulu dan dapat diterima oleh masyarakat Desa Jatiarjo. Hal ini dimaksudkan agar terjalin hubungan yang baik untuk bersama-sama memajukan Taman Safari Indonesia II Prigen. (3) Bagi peneliti selanjutnya yang tertarik dengan tema ini tentunya lebih mengembangkan pada konflik yang terjadi antara masyarakat Desa Jatiarjo dengan Taman Safari Indonesia II Prigen.

The quality of textbook "Interlanguage: English for Senior High School Students XI" / Chyntia Heru Woro Prastiwi

 

Kata Kunci: Bahasa Inggris, Buku Teks, Evaluasi, SMU Penelitian ini brtujuan untuk mereview bagaimana buku teks “Interlanguage: English for Senior High School Students XI” memenuhi kriteria sebuah buku teks komunikatif yang baik. Tujuan ini dipecah menjadi 8 kategori: relevansi terhadap Standar Isi 2006, konten bahasa dan skill, aspek komunikatif, authentisitas, kualitas materi praktis, urutan-pengulangan-distribusi materi, teknikalitas, dan kesesuaiannya terhadap ketertarikan dan kebutuhan siswa. Desain penelitian ini menggunakan deskriptif evaluatif atau analisis isi. Lembar analisa dan kuisioner siswa merupakan instrumen utama yang digunakan. Lembar analisa mengacu pada kriteria pedoman yang diambil dari kriteria BSNP (Badan Standar Nasional Pendidikan) yang dilengkapi dengan kriteria yang bersumber dari Ur (1999), Cunningsworth (1995), Nunan (2003), Reiss (2005), dan Harmer (2007). Lembar analisa digunakan untuk menilai kualitas buku. Lembar analisa ini diisi oleh 3 evaluator, yaitu peneliti sebagai evaluator utama dan 2 guru dari Madrasah Aliyah swasta yang berfungsi sebagai evaluator sejawat. Kuisioner digunakan untuk mengetahui pendapat siswa terhadap buku teks. Pemenuhan kriteria diambil dari Sukriawati (2008), dan Fathurrahman (2004), yang digolongkan menjadi sangat baik (85%-100%), baik (65%-84%), cukup (55%-64%), buruk (40%-54%) dan sangat buruk (0%-39%). Hasil evaluasi menunjukkan bahwa relefansi terhadap Standar Isi 2006 adalah baik, isi bahasa dan skill sangat baik, aspek komunikatif baik, authentisitas sangat kurang, kualitas materi praktis sangat baik, urutan-pengulangan-distribusi materi-di cukup, teknikalitas cukup, dan kesesuaian terhadap siswa dikategorikan baik karena mengakomodasi ketertarikan dan kebutuhan siswa. Buku Interlanguage bukan buku yang baik dan tidak direkomendasikan kepada pengguna yang hanya menggunakan satu buku, karena buku ini mengabaikan kriteria utama yang sangat penting yaitu relefansi terhadap kurikulum dan buku ini tidak memenuhi semua kriteria yang dievalusi. Ada beberapa saran yang diajukan. Pertama, kepada guru yang mengacu hanya pada satu buku, mereka sebaiknya mengabaikan buku ini. Sedangkan kepada guru yang masih ingin tetap menggunakan buku ini sebagai alternatif, mereka sebaiknya melakukan perubahan dengan cara menambah, menulis kembali, menyusun ulang, atau mengurangi materi dan tugas. Kedua, kepada penulis buku hendaknya melengkapi materi yang kurang, menyediakan CD/kaset listening, kegiatan yang menarik, dialog dan teks yang otentik, dan menambah aktifitas yang kreatif. Selanjutnya kepada BSNP dan pemerintah, hendaknya menyusun kriteria penilaian yang lebih rinci serta lebih transparan dalam menyajikan hasil penilaiannya.Terakhir kepada peneliti yang fokus pada evaluasi buku, mereka dapat menggunakan hasil penelitian ini sebagai salah satu rujukan.

The efectiveness of using semantic mapping strategy in teaching reading comprehension of narrative text for eighth graders of SMP 1 Trenggalek / Rani Rahagia

 

ABSTRAK Rahagia, Rani. 2016. Efektivitas Penggunaan Strategi Pemetaan Semantik dalam Pemahaman Membaca dari Teks Narasi (Sebuah kasus untuk siswa Kelas VIII SMP Negeri 1 Trenggalek di Tahun Ajaran 2015/2016). Skripsi. Jurusan Sastra Inggris, Fakultas Sastra, Universitas Negeri Malang. Pembimbing Pertama: Dr. Mirjam Anugerahwati, M.A. Pembimbing Kedua: Dr. Arwijati Murdibjono, M.Pd. Kata Kunci:strategi pemetaan semantik, membaca, teks narasi, penelitian eksperimental Penelitian ini bertujuan untuk mengetahui efektivitas penggunaan strategi pemetaan semantik dalam pengajaran pemahaman membaca teks narasi dan perbedaan signifikan pada pemahaman membaca teks narasi dalamsatukelas sebagai kelas eksperimen. Desain penelitian ini adalah penelitian pre-eksperimental. Populasi penelitian ini adalah siswa kelas VIII SMPN 1 Trenggalek pada tahun ajaran 2015/2016. Jumlah keseluruhan siswa adalah 60 siswa. Data diperoleh dengan memberikan tes membaca di kelas VIII A sebagai kelompok eksperimen dan kelas VIII B sebagai kelas percobaan. Penelitian ini dimulai dengan memberikan pre-test, treatment, dan post-test untuk kelompok eksperimen. Dalam penelitian ini, ada tiga kegiatan utama, pre-test, treatment, dan post-test. Kegiatan tersebut dilakukan dalam empat pertemuan karena waktu yang terbatas yang diberikan oleh guru dan materi yang sudah pernah dijelaskan sebelumnya oleh guru, maka penulis memberi pre-test, meninjau secara singkat materi, menjelaskan strategi dan memberi post-test. Pre-test diadakan pada pertemuan pertama. Treatment dilakukan dalam pertemuan kedua dan ketiga. Yang terakhir adalah Post-test yang diadakan untuk mengukur memahami siswa membaca narasi teks setelah mendapatkan treatment. Data dari tes dianalisa dengan menggunakan hitungan statistik untuk mengetahui perbedaan pemahaman siswa dalam membaca narasi teks untuk kelas eksperimen. Dalam pre-test, skor rata-rata kelas eksperimen adalah 51,26 dan rata-rata skor post-test dari kelas eksperimen adalah 76. 06. Jadi, persentase peningkatan siswa dari kelompok ini adalah 32,60%. Dapat disimpulkan bahwa ada peningkatan yang signifikan antara skor pre-test dan post-test dicapai oleh siswa dari kelas eksperimen. Secara umum, hampir semua siswa membuat peningkatan dalam prestasi membaca mereka dari teks narasi setelah treatment. Hal ini dibuktikan bahwa prestasi siswa untuk post-test lebih tinggi dari pre-test. Berdasarkan penelitian yang dilakukan, terbukti bahwa penggunaan strategi pemetaan semantik efektif sebagai strategi untuk meningkatkan membaca teks narasi kepada siswa kelas delapan dari SMPN 1 Trenggalek.

Pengembangan bahan ajar pada materi titrasi pengendapan dengan model pembelajaran learning cycle 5E untuk kjelas XI Program Keahlian Kimia Industri di SMK Putra Indonesia Malang / Janiar Anugraini Riyadi

 

Kata Kunci: Bahan Ajar, Model Learning Cycle 5E, Titrasi Pengendapan SMK memiliki kewajiban untuk membekali siswa dengan ilmu dan teknologi serta ketrampilan kerja yang sesuai dengan bidangnya . Berdasarkan wawancara yang dilakukan terhadap salah satu guru kimia analisis di SMK Putra Indonesia Malang program keahlian kimia industri, dalam pelaksanaan proses belajar mengajar yang berlangsung mengalami kendala. Kendala tersebut yaitu rendahnya tingkat pemahaman siswa terhadap materi titrasi pengendapan, yaitu 50% siswa yang belum mencapai nilai SKM. Sehingga, guru menyatakan perlu adanya pengembangan bahan ajar dan variasi model pembelajaran. Hal ini diperkuat dengan kajian teoritis dan faktual yakni model pembelajaran Learning Cycle 5E oleh guru dirasa tepat digunakan dalam pengorganisasian materi titrasi pengendapan dalam pengembangan bahan ajar kimia. Bahan ajar yang dikembangkan meliputi modul, silabus dan RPP sebagai pelengkap. Tujuan dari pengembangan bahan ajar kimia pada materi titrasi pengendapan adalah mengembangkan dan mengetahui kelayakan bahan ajar kimia pada materi titrasi pengendapan dengan model pembelajaran Learning Cycle 5E untuk kelas XI program keahlian kimia industri di SMK Putra Indonesia Malang. Peneliti mengadopsi metodologi penelitian dan pengembangan yang dikemukakan oleh Thiagarajan yakni model 4-D (four-D) yang meliputi tahap define, design , develop dan desiminate . Dalam hal ini peneliti menggunakan tahapan penelitian dan pengembangan hingga pada tahap ketiga. Hasil pengembangan produk dilakukan uji coba produk untuk mengetahui kelayakan dan setelah direvisi dilakukan crosscheck oleh guru untuk mengetahui kesesuaian produk. Uji coba produk yang akan dilakukan meliputi validasi produk oleh 1 orang dosen kimia, 2 orang guru dan uji terbatas oleh 10 orang siswa melalui instrumen penelitian yang berupa lembar validasi, dan soal uji kompetensi. Hasil analisis data produk hasil pengembangan bahan ajar titrasi pengendapan menyatakan, modul yang dikembangkan dinyatakan valid oleh validator dosen dan guru dengan tingkat validitas total masing-masing 3 dan 3,05 sehingga modul dapat digunakan. Silabus yang dikembangkan dinyatakan valid oleh validator dosen dan guru dengan tingkat validitas total masing-masing 3 dan 3,07. RPP yang dikembangkan dinyatakan valid oleh validator dosen dan guru dengan tingkat validitas total masing-masing 3 dan 3,06. Modul, silabus dan RPP sesuai dengan hasil validitas yang telah diperoleh dapat digunakan.

Pengaruh pemberian kompensasi terhadap produktivitas kerja karyawan pada Pabrik Gula Ngadirejo di Kediri / oleh Dedi Susanto

 

Pengembangan media pembelajaran IPA berbantuan komputer pokok bahasan ikatan kimia untuk siswa kelas IX SMP / Sri Handayati

 

Pengaruh latihan terhadap produktivitas pegawai pada Sekolah Tinggi Agama Islam Negeri (STAIN) Kediri / oleh Septa Ahmad Bremanti

 

Hubungan pengalaman mengajar dan mengikuti diklat dengan sikap guru terhadap kompetensi mengajar praktikum komputer di SMK Kabupaten Nganjuk / Bendot Sunardi

 

Kata kunci: pengalaman, mengajar, diklat, sikap, guru, kompetensi, komputer. Sekolah Menengah Kejuruan (SMK) merupakan satuan pendidikan yang bertujuan untuk menghasilkan tamatan siap kerja, cerdas, kompetitif, dan mampu mengembangkan keunggulan lokal serta bersaing di pasar global. Akan tetapi kenyataan pelaksanaan pendidikan di SMK, masih banyak dijumpai guru yang kurang memberikan praktik langsung berupa pengalaman nyata sesuai tuntutan dunia kerja, dan penguasaan materi, serta metode mengajarnya sudah ketinggalan zaman. Oleh sebab itu penulis ingin mengungkap bagaimana pengalaman mengajar, pengalaman mengikuti diklat, dan sikap guru terhadap kompetensi mengajar, serta hubungan pengalaman mengajar dan mengikuti diklat dengan sikap guru terhadap kompetensi mengajar praktikum komputer di SMK Kabupaten Nganjuk. Tujuan utama penelitian ini untuk mengetahui hubungan pengalaman mengajar dan mengikuti diklat dengan sikap guru terhadap kompetensi mengajar praktikum komputer di SMK Kabupaten Nganjuk. Populasi penelitian ini adalah guru mata pelajaran KKPI di SMK Kabupaten Nganjuk yang berjumlah 68 orang. Semua anggota populasi dijadikan sebagai sampel penelitian dan sampel diambil dengan teknik sampling jenuh atau sensus. Rancangan penelitian menggunakan pendekatan penelitian korelasional. Data dianalisis menggunakan analisis deskriptif dan regresi ganda. Kesimpulan dari hasil analisis deskriptif menunjukkan bahwa sikap guru terhadap kompetensi mengajar praktikum komputer memiliki kecenderungan 89,09 persen berada pada kategori tinggi; pengalaman mengajar berada pada kategori sedang sebesar 70,91 persen; dan pengalaman mengikuti diklat memiliki kecenderungan 63,64 persen berada pada kategori sedang. Secara analisis regresi ganda menunjukkan bahwa: (1) terdapat hubungan linier antara pengalaman mengajar dengan sikap guru terhadap kompetensi mengajar secara positif dan signifikan. Korelasi parsial sebesar rx1y = 0,400, nilai probabilitas p = 0,001, dan sumbangan efektif 14,16 persen; (2) terdapat hubungan linier antara pengalaman mengikuti diklat dengan sikap guru terhadap kompetensi mengajar secara positif dan signifikan. Korelasi parsial sebesar rx2y = 0,261, nilai probabilitas p = 0,027, dan sumbangan efektif 4 persen; dan (3) terdapat hubungan antara pengalaman mengajar dan pengalaman mengikuti diklat secara bersama dengan sikap guru terhadap kompetensi mengajar secara positif dan signifikan. Korelasi ganda sebesar (Rx1x2y = 0,426), nilai probabilitas p = 0,006, dan sumbangan efektif 18,1 persen. Hasil regresi ganda diartikan pengalaman mengajar memberikan pengaruh terbesar terhadap peningkatan kompetensi guru. Berdasarkan kesimpulan hasil penelitian diatas dapat diajukan saran-saran: (1) sangat diperlukan upaya peningkatan kompetensi guru dengan meningkatkan kualitas diklat dan pengalaman mengajarnya; (2) pengalaman mengajar dapat ditingkatkan kualitasnya, apabila jenis mata pelajaran dengan dasar yang dimiliki guru sebelumnya telah disesuaikan; (3) pengalaman mengikuti diklat lebih berarti, jika jenis kompetensi yang dipilih relevan dengan bidang studi, dan sepenuhnya dapat diterapkan untuk kepentingan pembelajaran.

Peran serta 'Llaboratorium Bank Mini Pioner' untuk mendukung pengelolaan keuangan sekolah (Studi kasus di Sekolah Menengah Kejuruan Negeri 2 Kediri) / Dwi Ambar Ludviana

 

Kata Kunci: pengelolaan keuangan, Laboratorium Bank Mini Pionir, sumber keuangan sekolah Keuangan sekolah merupakan komponen yang menentukan terlaksananya proses belajar- mengajar bersama komponen yang lain. Dalam tataran pengelolaan keuangan diperlukan cara untuk mengatur lalu lintas uang yang diterima dan dibelanjakan mulai dari kegiatan perencanaan, pengorganisasian, pelaksanaan, pengawasan sampai dengan pertanggung jawaban. Dari kenyataan yang ada saat ini manajemen keuangan sekolah tidak lepas dari adanya masalah. Masalah yang muncul biasanya berhubungan dengan pengelolaan dana sekolah, sebab jika sekolah tidak dapat mengelola keuangan dengan baik akan mempengaruhi layanan pendidikan yang lain. Layanan tersebut meliputi kurikulum dan pembelajaran, kesiswaan, sumber daya manusia, sarana dan prasarana, hubungan lembaga pendidikan dan masyarakat. Berdasarkan uraian tersebut, fokus penelitian terkait peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan sekolah adalah pada SMK Negeri 2 Kediri, mencakup (1) perencanaan peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan; (2) pelaksanaan peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan; (3) pengawasan, pelaporan dan pertanggungjawaban peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan; dan (4) faktor-faktor yang mempengaruhi peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan. Penelitian ini menggunakan pendekatan kualitatif, dirancang dengan menggunakan rancangan studi kasus, karena pada penelitian ini menggunakan suatu kasus untuk menggambarkan suatu isu atau perhatian yang strategis. Strategisnya penelitian ini terletak pada peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan sekolah pada SMK Negeri 2 Kediri. Peneliti berperan sebagai instrumen kunci, dengan subjek penelitian adalah pembina Laboratorium Bank Mini Pionir, staf yang membantu di Laboratorium Bank Mini Pionir, kepala sekolah yang diwakili oleh wakil kepala sekolah bagian sarana dan prasaran, bendahara sekolah dan peserta didik. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian pada saat wawancara dan dokumen yang berkaitan dengan peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan sekolah di SMK Negeri 2 Kediri. Analisis data dilakukan dengan mereduksi data, menyusun dalam satuan-satuan, dan pemeriksaan keabsahan data. Pengecekan keabsahan data melalui pemeriksaan triangulasi sumber, metode, dan pengecekan keanggotaan. Kesimpulan penelitian ini yaitu (1) Perencanaan peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan di SMK Negeri 2 Kediri, yaitu (a) Sumber dana yang dimiliki SMK Negeri 2 Kediri adalah berasal dari pemerintah daerah dan komite sekolah, (b) Sekolah memiliki Rancangan Kegiatan dan Belanja Sekolah yang dibuat satu tahun sekali dan setiap empat tahun sekali; (2) Pelaksanaan peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan di SMK Negeri 2 Kediri, yaitu (a) Sumber dana yang dimiliki SMK Negeri 2 Kediri adalah berasal dari Pemerintah Daerah dalam hal ini adalah Pemerintah Daerah Kota Kediri dan komite sekolah atau dana masyarakat, (b) SMK Negeri 2 Kediri memiliki dua pengelola keuangan sekolah, yaitu Laboratorium Bank Mini Pionir dan bendahara sekolah, (c) Selain sebagai sentra pengelolaan keuangan yang bersumber dari komite, Laboratorium Bank Mini Pionir juga sebagai wadah bagi peserta didik untuk belajar praktek perbankan; (3) Pengawasan, pelaporan dan pertanggungjawaban peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan di SMK Negeri 2 Kediri, yaitu (a) Jenis pengawasan keuangan yang ada di SMK N 2 Kediri adalah pengawasan intern dan ekstern, (b) Laporan pertanggung jawaban keuangan dibuat setiap satu bulan sekali dan akan direkap untuk laporan tahunan; (4) Faktor-faktor yang mempengaruhi peran serta Laboratorium Bank Mini Pionir untuk mendukung pengelolaan keuangan di SMK Negeri 2 Kediri, yaitu (a) faktor pendukung pengelolaan keuangan sekolah adalah manfaat Laboratorium Bank Mini Pionir bagi Peserta didik adalah tempat untuk praktek perbankan dan Kepala sekolah cepat tanggap dalam penanganan masalah; (b) faktor penghambat dalam pengelolaan keuangan sekolah adalah mekanisme pelaporan dan perundang-undangan keuangan yang selalu berubah pada setiap waktu atau setiap tahun, sehingga guru memerlukan diklat keuangan dan kurang telitinya peserta didik, sehingga mengalami sedikit kesulitan pada saat membuat laporan keuangan. Saran ditujukan untuk (1) Ketua Jurusan Administrasi Pendidikan, hendaknya hasil penelitian ini dapat menjadi referensi bagi penelitian dalam ruang lingkup yang memiliki keterkaitan dengan manajemen keuangan; (2) Kepala sekolah, lebih meningkatkan peran serta dari Laboratorium Bank Mini Pionir untuk lebih mendukung keberhasilan pengelolaan keuangan di sekolah; (3) Pembina Laboratorium Bank Mini Pionir, meningkatkan peran serta dari pengurus Laboratorium Bank Mini Pionir untuk lebih mendukung keberhasilan pengelolaan keuangan di sekolah; (4) Penelitian Lanjutan, agar melakukan penelitian pengembangan untuk mengetahui sistem pengelolaan keuangan sekolah dan dapat melakukan penelitian perbandingan tentang pengelolaan keuangan yang melibatkan Laboratorium Bank Mini Pionir di sekolah lain, sehingga terungkap kebenaran dan kejelasan peran serta Laboratorium dalam pengelolaan keuangan sekolah.

Hubungan antara penghasilan orang tua dengan hasil belajar siswa SDN Madyopuro 5 Kecamatan Kedungkandang Kota Malang / Marselius Yerkohok

 

ABSTRAK Yerkohok, Marselius. 2016. HubunganantaraPenghasilan Orang TuadenganHasilBelajarSiswa SDN Madyopuro 5 KecamatanKedungkandang Kota Malang.SkripsiProgram StudiS1 Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan SekolahDasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. HartiKartini, M.Pd, (II) Drs. M. ImronRosyadi SY,S.Pd,M.Pd Kata Kunci: hubungan, penghasilan, orang tua, hasilbelajar Rendahnyahasilbelajarmerupakansalahsatumasalah yang seringdijumpaidalammasyarakatdanmasalahinihampirterdapat di seluruhjenjangpendidikan formal.Hal ini dijumpai di SDN Madyopuro 5 Kecamatan Kedungkandang yang berada pada pinggiran kota dengan penghasilan orang tua yang bervariasi.Hal ini berdampak pada kemampuan orang tua dalam memenuhi kebutuhan anaknya sehingga berdampak pula pada hasil belajar siswa.Penelitian ini dilakukan dengan tujuan (1) untuk mendeskripsikan penghasilan orang tua siswaSDN Madyopuro 5 Malang, (2) untuk mendeskripsikan hasil belajar siswa SDN Madyopuro 5 Malang, dan (3) untuk mendeskripsikan hubungan antara penghasilanorang tua dengan hasil belajar siswaSDN Madyopuro 5 Malang.Penelitianinidigunakanuntukmengujihipotesisbahwaadahubungan yang signifikanantarapenghasilan orang tuadenganhasilbelajarsiswaSDN Madyopuro 5 KecamatanKedungkandangtahunpelajaran 2015/2016. Penelitian ini dirancang menggunakan pendekatan kuantitatif dengan teknik deskriptif korelasional. Sampel penelitian ini menggunakan sampel jenuh yaitu 443 siswa. Data yang terkumpul kemudian dianalisis menggunakan analisis statistikdenganproduct moment. Dari hasil analisis dapat disimpulkan bahwa penghasilanorang tua paling banyak berada pada kategorisedangdanrendahserta nilai rata-rata hasilbelajarsiswaadalah77,58. Sementara itu, dari hasil analisis korelasional diketahui bahwa ada hubungan yang positif dan signifikan antara penghasilan orang tua dengan hasil belajar siswa. Hal tersebut dapat dilihat dari rhitungsebesar0,9781 yang lebih besardari rtabelsebesar0,0939 (0,9781 > 0,0939)padasignifikan 5%. Atas dasar itu, diberikan saran kepada guru untuk memberikan perhatian lebih kepada siswa, terutama kepada siswa yang tingkat penghasilan orang tuanyarendah. Sementara itu kepada pemerintah maupun dinas terkait, untuk memperhatikan faktor keluarga dalam membuat kebijakan yang berhubungan dengan pendidikan. Kepada peneliti lain diharapkan manambah cakupan penelitian dan menggunakan teknik analisis statistik yang lain.

Analisis buku teks IPA kelas IV yang digunakan di SD Gugus 04 Kecamatan Gading Rejo Kabupaten Pasuruan berdasarkan KTSP / Mila Amalia Afandi

 

Kata Kunci: Analisis, Buku teks, IPA SD, Kesesuaian pendekatan penulisan, Materi, Sistem evaluasi dengan kurikulum tahun 2006 Buku teks digunakan sebagai buku penunjang dalam pembelajaran. Namun saat ini masih ada beberapa buku yang belum sesuai dengan kurikulum yang ditetapkan tahun 2006 baik dari segi pendekatan penulisan, kompetensi maupun sistem evaluasi , oleh karena itu untuk mengatasi kondisi seperti itu, para guru atau calon guru harus memiliki kemampuan untuk menelaah buku teks. Dalam penelitian ini merumuskan masalah sebagai berikut (1) Bagaimana kesesuaian pendekatan penulisan buku teks dengan pendekatan yang ada dalam kurikulum tahun 2006? (2) bagaimana kesesuaian isi materi dalam buku teks dengan kompetensi dalam kurikulum yang ditetapkan tahun 2006? (3) bagaimana kesesuaian sistem evaluasi yang ada dalam buku teks yang ditetapkan tahun 2006? Untuk memecahkan masalah tersebut, penelitian dirancang dengan model deskriptif kualitatif. Sumber data dalam penelitian ini adalah buku teks IPA SD/MI kelas IV yang ditulis oleh Dudi dan Setia dan penerbit Pusat Perbukuan Depdiknas 2008. Data hasil analisis dikumpulkan menggunakan instrumen. Data yang dikumpulkan sebagai berikut: pertama kesesuaian pendekatan penulisan pada bab I, II dan IV sesuai dengan pendekatan filosofis sedangkan pada bab III dan V pendekatan konstruktif pada pada akhir pembahasan belum ada konfirmasi jawaban yang tepat dan simpulan. Tidak tertulis pendekatan kurikuler yang berupa SK dan KD ; kesesuaian materi dari 5 SK dan 14 KD dijabarkan menjadi 44 indikator, tetapi 18 indikator pembelajaran tidak dibahas; ketiga Kesesuaian sistem evaluasi terdapat 87 butir evaluasi aspek kognitif, 3 evaluasi sistem evaluasi aspek afektif dan dan tidak terdapat sistem evaluasi aspek psikomotor. Berdasarkan data tersebut dapat disimpulkan: pertama pendekatan penulisan buku teks tidak sesuai dengan pendekatan kurikulum tahun 2006; materi dalam buku teks kurang sesuai dengan kompetensi dalam kurikulum tahun 2006; sistem evaluasi dalam buku teks cenderung pada aspek kognitif, buku karangan Dudi W dan Setia kurang sesuai dengan kurikulum tahun 2006.

Efektivitas Tempat Pelelangan Ikan (TPI) di Desa Brondong Kabupaten Lamongan terhadap percepatan pergerakan hasil tangkapan (studi kasus di TPI Brondong) / Mohammad Ainul Yaqin

 

ABSTRAK Yaqin,M.Ainul. 2016.Efektivitas Tempat Pelelangan Ikan (TPI) di Desa Brondong Kabupaten Lamongan Terhadap Percepatan Pergerakan Hasil Tangkapan.Skripsi,Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Mit Witjaksono,MS.Ed. (II) Dr. Nasikh,S.E.,M.P.,M.Pd. Kata Kunci: Efektivitas, TPI Brondong, Percepatan Pergerakan Hasil Tangkapan Dalam upaya pengembangan sektor perikanan, pemerintah memainkan peran penting. Peran tersebut adalah menyediakan berbagai fasilitas penunjang yang dapat memberikan kemudahan dalam melakukan usaha perikanan. Adapun kemudahan tersebut adalah mendapatkan sarana produksi, mendaratkan hasil tangkapan, dan menjamin pemasaran, sehingga proses produksi sampai pemasarannya berjalan lancar. Dengan diberikannya kemudahan tersebut, pemerintah daerah Kabupaten Lamongan membuat sebuah jenis usaha Tempat Pelelangan Ikan (TPI) yang dapat memberikan keuntungan baik bagi pemerintah daerah Lamongan sendiri maupun masyarakat setempat. Tempat Pelelangan Ikan (TPI) dimaksudkan sebagai pusat pemasaran dan distribusi hasil perikanan. Penelitian ini menggunakan rancanganpenelitian kualitatif deskriptif. Data primer diperoleh dari wawancara data yang diperoleh dari informan secara langsung. Data sekunder diperoleh dari melihat beberapa literature, antara lain: catatan, buku, dokumen yang ada hubungannya dengan penelitian tersebut. Data sekunder berupa dokumen dari Sekretariat TPI Brondong, Dirjen Perikanan Tangkap Pelabuhan Perikanan Nusantara Brondong. Simpulan penelitian adalah: Efektivitas Tempat Pelelangan Ikan (TPI) Brondong dilihat melalui efektivitas keseluruhan bahwa TPI yang merupakan sentra kegiatan perikanan tangkap dikatakan efektif karena mampu mengatasi kendala luasan TPI yang hanya 1.080m^2 dengan sistem mengalir mulai dari kegiatan bongkar ikan, sortir, penimbangan, pelelangan hingga pendistribusian, sehingga tidak terjadi penumpukan ikan di TPI Brondong yang dapat menghambat kegiatan di TPI Brondong yang mencapai total produksi 71.626 ton pada tahun 2014 dan memiliki rata-rata produksi 196 ton per hari. Dari segi stabilitas TPI Brondong hampir selalu ada ikan dan tidak terjadi masa paceklik sehingga pasokan ikan dikatakan stabil. Selain itu produksi tahun 2014 mengalami peningkatan dari tahun 2013 ke tahun 2014 sebesar 23,21%. Selain itu segi kepuasan pengguna Tempat Pelelangan Ikan (TPI) Brondong dikatakan masih kurang karena masih terdapat banyak keluhan dari pengguna TPI Brondong yang berkaitan dengan kurangnya fasilitas dan kebersihan yang ada di TPI Brondong. 

Sumbangan mata pelajaran sejarah terhadap mata pelajaran IPS terpadu siswa kelas VII program akselerasi SMP Negeri 3 Malang / Wahid

 

Kata kunci: sumbangan mata pelajaran sejarah, mata pelajaran IPS terpadu, kelas akselerasi Permasalahan perbedaan tingkat kecerdasan siswa dalam menerima materi pelajaran membuat pihak sekolah perlu menyelenggarakan pendidikan khusus bagi siswa yang memiliki potensi kecerdasan dan bakat istimewa. Salah satu cara yang bisa ditempuh adalah dengan membentuk kelas akselerasi. Perubahan kurikulum pada tingkat sekolah menengah pertama juga berdampak pada proses belajar di kelas akselerasi. Salah satu bentuk perubahan kurikulum tersebut adalah pengintegrasian mata pelajaran sejarah dengan mata pelajaran geografi, sosiologi, dan ekonomi secara otomatis memberikan perbedaan khusunya dalam hal penilaian hasil belajar siswa. Melalui penelitian ini penulis ingin mengetahui bagaimana sumbangan mata pelajaran Sejarah terhadap mata pelajaran IPS Terpadu khususnya bagi siswa kelas VII program akselerasi SMP Negeri 3 Malang Rumusan masalah dalam penelitian ini adalah (1) Bagaimanakah nilai sejarah dibandingkan dengan nilai bidang geografi, ekonomi, sosiologi, dalam mata pelajaran IPS Terpadu di kelas VII Program Akselerasi?. (2) Bagaimana sumbangan nilai sejarah terhadap mata pelajaran IPS Terpadu kelas VII Program Akselerasi di SMP Negeri 3 Malang?. Jenis penelitian ini adalah jenis penelitian yang digunakan dalam penelitian ini adalah penelitian kuantitatif yang menggunakan metode deskriptif. Sumber data dalam penelitian ini berupa nilai raport mata pelajaran IPS Terpadu dan hasil wawancara dengan guru bidang studi IPS Terpadu. Data tersebut kemudian di analisis menggunakan analisis deskriptif pengukuran kecenderungan pemusatan (measures of central tendency). Hasil penelitian menunjukkan bahwa: (1) Nilai mata pelajaran Sejarah pada siswa kelas VII program akselerasi SMP Negeri 3 Malang lebih baik jika dibandingkan dengan mata pelajaran yang lain. Hal ini dapat dilihat dari nilai ratarata mata pelajaran Sejarah sebesar 92,5 lebih tinggi jika dibandingkan dengan rata-rata nilai mata pelajaran IPS yang lain Geografi sebesar 92, Ekonomi sebesar 89,2 dan Sosiologi sebesar 80,4. Tingginya nilai rata-rata mata pelajaran Sejarah pada kelas akselerasi menunjukkan tingginya minat siswa terhadap mata pelajaran sejarah, adanya daya saing yang tinggi serta motivasi untuk mendapatkan hasil belajar berupa nilai akademik yang baik. (2) Mata pelajaran Sejarah memberikan sumbangan yang besar bagi nilai IPS Terpadu siswa kelas VII program akselerasi SMP Negeri 3 Malang. Sumbangan tersebut tidak hanya berupa nilai kognitif yang baik (melebihi KKM yang ditentukan sekolah) tetapi juga nilai afektif dan psikomotor yang didapatnkan oleh siswa dalam mempelajari Sejarah dan mata pelajaran IPS lainnya yang terintegrasi dalam IPS Terpadu. Dari hasil penelitian ini disimpulkan bahwa pengintegrasian mata pelajaran Sejarah ke dalam mata pelajaran IPS Terpadu pada kelas akselerasi di SMP Negeri 3 Malang membawa dampak positif pada mata pelajaran yang lain. Hal ini dibuktikan dengan nilai mata pelajaran IPS Terpadu pada siswa kelas akselerasi telah mmenuhi KKM yang telah ditentukan oleh sekolah sebesar 80.

Dampak perpindahan terminal Gadang ke terminal Hamid Rusdi terhadap kehidupan sosial ekonomi masyarakat sekitar terminal Gadang / Novi Setyowati

 

Kata Kunci: Dampak, Perpindahan Terminal, Kehidupan Sosial Ekonomi, Masyarakat Keberadaan terminal di suatu daerah merupakan pemicu munculnya aktivitas ekonomi di sekitar terminal yang semakin beragam dan bertambah jumlahnya. Terminal sebagai pusat pertumbuhan pemegang peranan penting dalam usaha mencapai tujuan-tujuan pembangunan ekonomi. Terminal sebagai salah satu prasarana dalam sistem transportasi sangat dibutuhkan sekali daerah fisik yang harus disediakan. Pentingnya terminal bagi masyarakat adalah untuk kenyamanan menunggu, kenyamanan perpindahan dari satu moda atau kendaraan ke moda atau kendaraan lain, dan sebagai tempat tersedianya fasilitas-fasilitas dan informasi. Maka dari itu diperlukan sarana prasarana yang baik dari suatu terminal. Penelitian ini dilaksanakan dengan tujuan untuk menjelaskan beberapa hal, yang mencakup latar belakang dipindahnya terminal Gadang ke terminal Hamid Rusdi, kondisi sosial ekonomi masyarakat sebelum pindahnya terminal Gadang ke terminal Hamid Rusdi, kondisi sosial ekonomi masyarakat sesudah pindahnya terminal Gadang ke terminal Hamid Rusdi, dampak perpindahan terminal Gadang ke terminal Hamid Rusdi terhadap kehidupan sosial ekonomi masyarakat. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Pengumpulan data dilakukan dengan menggunakan teknik wawancara dan observasi. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri. Untuk menjaga keabsahan data dilakukan kegiatan triangulasi data. Kegiatan analisis data dimulai dari tahap reduksi data, display data, verivikasi kesimpulan. Hasil penelitian adalah: (1) Latar belakang pemindahan terminal Gadang ke terminal Hamid Rusdi di karenakan adanya permasalahan fisik berupa kemacetan lalu lintas yang disebabkan oleh padatnya arus kendaraan di sekitar terminal, (2) Masyarakat Gadang sebelum perpindahan terminal pada umumnya bermata pencaharian sebagai pedagang, selain pedagang ada beragam mata pencaharian yang lain seperti sopir, tukang becak, makelar penumpang, jasa travel dan jasa wartel serta pedagang asongan. Pendapatan masyarakat sangat beragam dari sekitar Rp 1.000.000-Rp500.000 perhari untuk masyarakat yang berprofesi sebagai pedagang dan Rp 30.000-Rp 90.000 perhari untuk masyarakat yang berprofesi sebagai sopir, tukang becak, dan makelar. Akses menuju ke tempat sekolah masyarakat Gadang sangat terbantu dengan keberadaan terminal dekat tempat tinggal mereka, tetapi untuk masalah ongkos tidak berpengaruh dengan keberadaan terminal.Suasana tempat tinggal masyarakat Gadang sebelum perpindahan terminal dirasakan tidak tenang dan tidak nyaman karena suara bising, gaduh dan ramai dari terminal, tetapi masalah keamanan mereka merasakan tidak berpengaruh dengan keberadaan terminal. Interaksi sosial masyarakat Gadang berupa kerjasama seperti tahlilan rutin, acara PKK dll, selain kerjasama juga ada persaingan, persaingan di antara sesama profesi seperti terlibat cekcok mengenai masalah penumpang atau masalah pembeli, tetapi di antara mereka tidak pernah terjadi suatu konflik, (3) Setelah perpindahan terminal sebagian masyarakat terutama yang berprofesi sebagai pedagang telah kehilangan mata pencahariannya. Dan menurunnya tingkat pendapatan masyarakat yang berprofesi sebagai sopir, tukang becak dan makelar, mereka kini berpendapatan sekitar Rp 25.000-Rp 45.000 perharinya, dan pedagang kini hanya berpendapatan sekitar Rp 200.000 perharinya.Interaksi sosial masyarakat setelah perpindahan terminal ada yang bersifat negatif dan ada yang positif, negatifnya adalah masyarakat menjadi lebih sering terjadi persaingan berupa cekcok antar sesama profesi yang di akibatkan karena berebut penumpang dan pembeli, sedangkan positifnya adalah masyarakat sesama profesi menjadi lebih kompak dan saling bertukar pikiran tentang pekerjaan mereka. Suasana tempat tinggal masyarakat menjadi sedikit lebih tenang dan tidak segaduh dulu. Setelah perpindahan terminal tidak berpengaruh terhadap masalah akses menuju ke tempat sekolah, hanya saja setelah perpindahan terminal agak sedikit lebih sulit mendapatkan angkutan, dan untuk masalah ongkos masyarakat beranggapan tidak berpengaruh terhadap perpindahan terminal, (4) Perpindahan terminal Gadang ke terminal Hamid Rusdi membawa dampak terhadap hampir seluruh masyarakat pengguna jasa terminal, masyarakat terutama yang berprofesi sebagai pedagang sebagian telah kehilangan mata pencahariannya, pendapatan yang diperoleh mayarakat setelah perpindahan terminal menjadi berkurang, pendapatan pedagang dari Rp1.000.000-Rp 500.000 perharinya, kini hanya berkisar antara Rp 200.000 perharinya, dan masyarakat yang berprofesi sebagai sopir, tukang becak, dan makelar penumpang juga mengalami penurunan pendapatan, sekarang pendapatan mereka hanya berkisar antara Rp 25.000-Rp 45.000 perharinya, Perpindahan terminal juga berdampak pada Interaksi sosial masyarakat yang mana setelah perpindahan terminal masyarakat sesama profesi menjadi lebih mudah terjadi cekcok karena perpindahan terminal menjadi lebih sepi penumpang dan pembeli. Akses menuju ke tempat sekolah masyarakat menjadi agak lebih sulit mendapatkan angkutan umum, dan suasana tempat tinggal masyarakat menjadi lebih tenang dan nyaman dengan perpindahan terminal. Saran bagi pemerintah agar pemerintah kota Malang hendaknya dapat memahami dampak dari kehidupan sosial maupun ekonomi masyarakat Gadang dengan adanya pemindahan terminal. Diharapkan pihak Pemkot Malang mampu memberikan rekomendasi mengenai kondisi, situasi dan dampak yang sebenarnya terjadi akibat pemindahan terminal khususnya terhadap aktivitas sosial ekonomi masyarakat sekitar Gadang.

Pengaruh faktor eksternal terhadap pengertian dasar ekonomi (economic literacy) siswa kelas XI IPS di SMA Negeri 1 Malang / Kharisma Eva Roslia

 

Kata Kunci : Faktor eksternal, pengertian dasar ekonomi (economic literacy) Kemampuan untuk mengerti dan memahami makna serta arti tentang ilmu ekonomi, yaitu tentang tindakan manusia untuk memenuhi kebutuhan hidupnya yang banyak bervariasi dan berkembang dengbaik masa sekarang maupun masa yang akan datang dan sumber daya yang ada melalui pilihan – pilihan kegiatan produksi , konsumsi atau distribusi yang diwujudkan dengan efisiensi dalam tindakan berkonsumsi. Economi literacy merupakan tolak ukur seberapa jauh seorang menyadari tentang adanya kekuatan yang berpengaruh terhadap kualitas hidup bermasyarakat. Salah satu cara yang bisa dilakukan seseorang agar mempunyai economic literacy adalah dengan belajar ilmu ekonomi. Dalam belajar ada beberapa faktor yang mempengaruhinya. Diantara faktor tersebut adalah faktor eksternal belajar yaitu faktor yang mempengaruhi belajar yang berasal dari luar diri siswa. Faktor eksternal belajar ada tiga, yaitu faktor keluarga , faktor sekolah dan faktor masyarakat. Ketiga faktor tersenut saling berhungungan untuk menciptakan kondisi belajar yang baik.Tujuan penelitian ini adalah (1) Untuk mendeskripsikan pengaruh faktor keluarga terhadap pengertian dasar ekonomi (economic literacy) ekonomi siswa diSMA Negeri 1 Malang. (2) Untuk mendeskripsikan pengaruh faktor sekolah terhadap pengertian dasar ekonomi (economic literacy) siswa diSMA Negeri 1 Malang. (3) Untuk mendeskripsikan pengaruh faktor lingkungan masyarakat terhadap pengertian dasar ekonomi i (economic literacy) siswa di SMA Negeri 1 Malang. (4) Untuk mendeskripsikan lingkungan keluarga,sekolah dan masyarakat terhadap pengertian dasar ekonomi i (economic literacy) siswa diSMA Negeri 1 Malang Metode penelitian deskriptif korelasional. Populasi penelitian ini adalah seluruh siswa kelas Xl IPS SMA Negeri 1 Malang yang berjumlah 93 siswa. Jumlah populasi kurang dari 100, maka penelitian ini termasuk penelitian populasi. Teknik analisis data menggunakan teknik analisis regresi linier berganda dengan uji –t untuk mengetahui pengaruh variabel bebas faktor keluarga, sekolah dan masyarakat (X1,X2,X3) secara parsial terhadap variabel terikat economic literacy (Y) dan uji f untuk mengetahui secara silmutan. Kesimpulan dari hasil penelitian ini menunjukkan bahwa faktor eksternal yang meliputi : faktor lingkungan keluarga di SMA Negeri 1 Malang tergolong tinggi dengan persentase 65,60%, faktor lingkungan sekolah diSMA Negeri 1 Malang tergolong tinggi dengan preentase 72,04% dan faktor lingkungan masyarakat di SMA Negeri 1 Malang juga tergolong tinggi dengan persentase 55,91% economic literacy di SMA Negeri 1 Malang juga tergolong tinngi dengan presentase 73,12%. Terdapat pengaruh yang signifikan antara faktor lingkungan keluarga terhadap pengertian dasar ekonomi (economic literacy). Terdapat pengaruh yang signifikan anatara faktor sekolah terhadap pengertian dasar ekonomi (economic literacy). Terdapat pengaruh yang signifikan antara faktor lingkungan masyarakat terhadap pengertian dasar ekonomi (economic literacy). Terdapat pengaruh yang signifikan antara faktor keluarga, sekolah dan masyarakat terhadap pengertian dasar ekonomi (economic literacy) diSMA Negeri 1 Malang. Saran yang dapat dikemukakan adalah ada banyak faktor yang mempengaruhi economic literacy. Oleh karena itu untuk penelitian selanjutnya diharapkan lebih menggali dan meneliti faktor - faktor eksternal yang lain demi kesempurnaan skripsi ini.

Peningkatan prestasi belajar bidang studi bahasa Indonesia siswa kelas III melalui bimbingan guru di SDN Purwosari 1 Kecamatan Purwosari Kabupaten Pasuruan / oleh Diah Prawesti

 

Penerapan demplot sebagai integrated marketing communication guna meningkatkan penjualan pupuk pada PT Petrokimia Gresik / Rachmad Eka Prasetia

 

Kata kunci : Integrated Marketing Communication, Penjualan PT Petrokimia Gresik mencobamempromosikanprodukbarunyayaituPetroganiksekaligusbertujuanuntukmeningkatkanpenjualanpupuklainnyadenganmelakukanDemplot (Demonstration Plot) yang mengintegrasikaniklan, hubunganmasyarakat, promosipenjualan, pemasaranlangsung, penjualanperseorangan.Penelitianinibertujuanuntukmengetahui (1) BagaimanapenerapanDemplotsebagaiIntegrated Marketing Communciationgunamengefektifkanpenjualanpupukpada PTPetrokimia Gresik; (2) Bagaimanakahkendala-kendalaDepartemenPelayanandanKomunikasiProdukdalampenerapanDemplot; (3) Apa yang dilakukanolehDepartemenPelayanandanKomunikasiProdukuntukmemecahkanmasalah yang dihadapidalamDemplot. Penelitianinimenggunakanpendekatandeskriptifkualitatif.Jenis data yang digunakanadalah data kualitatifdengan 2 macamsumber data yaitusumber data primer dansumber data sekunder.Pengumpulan data menggunakanTriangulasiTeknikdengancaraobservasi, wawancaradandokumentasi. Instrumendalampenelitianiniadalahpenelitisendiri.Pengamatan yang dilaksanakan dalam penelitian ini adalah pemeran serta sebagai pengamatdanpenganalisis.Pengecekankeabsahantemuandenganmengadakankonfirmasi data yang telahdiperolehterhadapsumberpenelitian, dalamhaliniadalahkepalaseksikegiatanDemplot, konfirmasiterhadappetani, konfirmasiterhadapSales Supervisor, danpengecekandengan data penjualan. Hasilpenelitianiniadalah: (1) Demplotterdiridari 3 kegiatan, FFD Awal, FFD Supervisi, dan FFD Panen, dimana 3 kegiatantersebuttelahmengkombinasikaniklan, penjualanperseorangan, pemasaranlangsung, hubunganmasyarakat, danpromosipenjualan. Penjualanpupukbersubsidijugaterusmengalamipeningkatandaritahun 2005 sampaitahun 2011.(2) Kendala eksternal Demplotmeliputi (a) musim dan cuaca; (b) bencana; (c) hama penyakit; (d) petani kurang responsif; (e) sosial budaya; kendala eksternal yaitu kurangnya SDM; (3) Pemecahanmasalaheksternalyaitu (a) memilihlokasi yang irigasinyateknisdanmemilihmasatanam yang tepat; (b) mengulangiDemplot di daerahtersebut; (c) memilihlokasi yang tidakendemikhamapenyakit, jugadilakukantanamserentak; (d) melibatkansemuapihak yang terkaitdalammemilihpetaniDemonstrator; (e) memperbanyakkegiatanDemplotdanSosialisasi di lokasitersebut; danpemecahankendala internal kurangnya SDM supervisidenganmelakukansupervisimelaluitelepon. Berdasarkanhasilpenelitianmakadapatdiambilkesimpulandalampenelitianini, yaitu: (1) Demplotsebagai IMC (Integrated Marketing Communication),meliputipenjualanperseorangan, promosipenjualan,iklan, pemasaranlangsung, danhubunganmasyarakat.Penjualanpupukbersubsidijugaterusmengalamipeningkatandaritahun 2005 sampaitahun 2011; (2)Terdapatkendalaeksternaldan internal yang masihbisadisiasatidanditanggulangi, kecualiuntukbencanaalam yang dahsyat. (3) PemecahanmasalaheksternallebihmenekankanpadakegiatanantisipasisejakawalDemplotbelumdilaksanakan, danmasalah internal tentangkurangnya SDM saatpemantauanharusdilakukanpengefektifan SDM di kegiatanDemplot. Beberapa saran yang dapatdiberikanantara lain(1) Pihak perusahaan, PT Petrokimia Gresik hendaknya lebihmengefektifkankinerjakaryawan di bagiankegiaatanpromosiDemplot agar FFD supervisibisalebihmaksimal.(2) Departemen Pelayananandan KomunikasiProduk hendaknya lebih gencar lagi melakukan Demplot dan Sosialisasi di daerah yang potensial agar penjualan lebih meningkat.(3)peneliti selanjutnya, hendaknya melakukan penelitian terhadap keefektifan program promosiDemplotterhadaphasilpertanian.

Pengaruh konsentrasi ekstrak buah terung Belanda (Cyphomandra betacea) terhadap sifat kimia, sifat fisik dan sifat organoleptik permen jelly / Dewi Asidah Mayanti

 

ABSTRAK Mayanti, Dewi Asidah. 2016. Pengaruh Konsentrasi Ekstrak Buah Terung Belanda (Cyphomandra Betacea) Terhadap Sifat Kimia, Sifat Fisik dan Sifat Organoleptik Permen Jelly. Skripsi, Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Ir. Soenar Soekopitojo, M.Si, (II) Laili Hidayati, S.Pd., M.Si. Kata Kunci: Terung Belanda, Permen Jelly, Ekstrak. Buah terung belanda (Cyphomandra Betacea) merupakan sumber makanan yang baik bagi kesehatan karena mengandung senyawa antioksidan seperti antosianin, β-karoten, vitamin C dan fenol, juga mengandung pektin. Tujuan penelitian ini untuk mengetahui pengaruh konsentrasi ekstrak buah terung belanda terhadap sifat kimia (aktivitas antioksidan, kandungan antosianin, kandungan β-karoten dan kadar air), sifat fisik (warna dan tekstur), dan tingkat kesukaan (warna, rasa, aroma dan tekstur) permen jelly buah terung belanda. Penelitian ini merupakan penelitian eksperimen. Rancangan penelitian ini adalah Rancangan Acak Lengkap (RAL). Perlakuan konsentrasi ekstrak buah terung belanda menggunakan konsentrasi 40%, konsentrasi 60% dan konsentrasi 80%. Masing-masing perlakuan diulang sebanyak dua kali dan dianalisis menggunakan ANOVA dengan dilanjutkan uji LSD. Ekstrak buah terung belanda mempunyai aktivitas antioksidan ( sebesar 46,1075 ppm, kandungan antosianin sebesar 349,97 mg/100g, serta kandungan β-karoten sebesar 61,049 mkg/100g. Permen jelly ekstrak buah terung belanda konsentrasi 80% paling disukai panelis dari aspek warna, rasa, dan aroma. Permen jelly ekstrak buah terung belanda konsentrasi 80% mempunyai aktivitas antioksidan ( sebesar 96,96 ppm, kandungan antosianin sebesar 107,141 mg/100g, kandungan β-karoten sebesar 2,7255 mkg/100g, kadar air sebesar 35,693%, sifat fisik warna yaitu kecerahan (L*) sebesar 52,85, warna kemerahan (a*) sebesar 64,55,warna kekuningan (b*) sebesar 12,85, sifat fisik tekstur sebesar 4,85 mm/50g.5s, sedangkan dari aspek tekstur yang paling disukai panelis adalah permen jelly ekstrak buah terung belanda konsentrasi 40%.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |