Pengaruh variasi waktu gelling nata de coco dan konsentrasi adsorbat terhadap adsorpsi ion NO3- dari larutan Cd(NO3)2 dan adsorpsi molekul klorofil / Sari Kurniawati


Kata kunci: adsorpsi, ion NO3-, molekul klorofil, nata de coco Adsorpsi adalah proses terserapnya suatu zat (molekul atau ion) pada permukaan adsorben. Berbagai jenis adsorben telah banyak digunakan di antaranya yaitu sekam padi, serbuk gergaji, dan arang sekam padi. Widomulyo (2007) menggunakan adsorben sekam padi dan Nurwati (2005) menggunakan serbuk gergaji untuk mengadsorpsi ion NO3- . Akhir-akhir ini telah berkembang penelitian mengenai adsorpsi dengan menggunakan nata de coco sebagai adsorben. Afrizal (2008) dan Aprilia (2009) menyimpulkan bahwa nata de coco dapat digunakan untuk menjerap ion logam Cr(III) dan Co(II). Sedangkan Wonorahardjo (2010) mempelajari penggunaan nata de coco dalam menyerap molekul organik pada ekstrak mengkudu. Penelitian ini bertujuan mengetahui pengaruh konsentrasi larutan Cd(NO3)2, larutan klorofil dan waktu gelling terhadap adsorpsi ion NO3- dan klorofil oleh gel nata de coco dengan metode batch. Penelitian ini merupakan penelitian eksperimental dan dilakukan di laboratorium Jurusan Kimia dan Jurusan Biologi Fakultas MIPA UM. Metode yang digunakan adalah metode batch dengan nata de coco sebagai adsorben dan Cd(NO3)2 serta molekul klorofil sebagai adsorbat. Nata de coco yang digunakan merupakan hasil fermentasi (gelling) 6 dan 11 hari. Proses adsorpsi menggunakan 3 gram nata de coco gelling 6 dan 11 hari. Kemudian 50 mL adsorbat NO3- ditambahkan dengan variasi konsentrasi masing-masing 10, 25, dan 50 ppm, dikocok dengan shaker 100 rpm, dan waktu kontak 20 menit. Konsentrasi larutan sebelum dan sesudah proses adsorpsi diukur menggunakan Spektrofotometer Sinar Tampak (spektronik 20D+) pada panjang gelombang 410 nm. Percobaan yang sama dilakukan pula pada molekul klorofil sebagai pengganti Cd(NO3)2. Filtrat yang diperoleh diukur dengan spektronik 20D+ pada panjang gelombang 398 nm. Hasil penelitian menunjukkan bahwa (1) kapasitas adsorpsi ion NO3- oleh nata de coco gelling 6 hari pada konsentrasi adsorbat 10, 25, dan 50 ppm sebesar 0,0016; 0,0145; dan 0,0332, (2) kapasitas adsorpsi ion NO3- oleh nata de coco gelling 11 hari pada konsentrasi adsorbat 10, 25, dan 50 ppm sebesar 0,0179; 0,0634; dan 0,5006, (3) kapasitas adsorpsi molekul klorofil oleh nata de coco gelling 6 hari pada pengenceran klorofil 5 dan 10 kali adalah 0,0150 dan 0,0199, dan (4) kapasitas adsorpsi molekul klorofil oleh nata de coco gelling 11 hari pada pengenceran klorofil 5 dan 10 kali adalah 0,0108 dan 0,0185.

Penerapan model pembelajaran snowball throwing untuk meningkatkan hasil belajar IPS siswa kelas IV SDN Madyopuro 2 Kecamatan Kedungkandang Kota Malang / Dewi K. Bothmir


Kata kunci: Model Snowball Throwing, hasil belajar, IPS SD Pembelajaran IPS model pembelajaran Snowball Throwing merupakan salah satu strategi pembelajaran yang diterapkan pada review pembelajaran sehingga dapat membantu siswa mengingat kembali materi yang telah dipelajari model snowball throwing juga merupakan salah satu model dalam pembelajaran kooperatif dimana cara pembelajaran dengan cara diskusi atau kelompok dengan permainan yang tediri dari 5 sampai 6 siswa Hasil pengamatan yang dilakukan oleh peneliti tentang matapelajaran IPS kelas IV SDN dapat diketahui bahwa siswa memiliki minat belajar yang rendah, diantaranya siswa cenderung pasif dan merasa bosan dalam pembelajaran IPS nilai rata-rata dalam hasil belajar adalah 49,78 %, masih kurang dari kriteria yang ditentukan, yaitu 65 %. Adapun rumusan masalahnya adalah 1) bagaimana penerapan model pembelajaran Snowball Throwing dalam pembelajaran IPS bagi siswa kelas IV di SDN madyopuro 2 Kecamatan Kedungkandang Kota Malang ? 2) apakah penerapan model pembelajaran Snowball Throwing dapat meningkatkan hasil belajar Ilmu Pengetahuan Sosial untuk siswa kelas IV SDN madyopuro 2 Kecamatan Kedungkandang Kota malang ? Penelitian ini menggunakan desain penelitian tindakan kelas dengan model Kemmis dan Taggart yang terdiri dari. 1) Perencanaan. 2) Pelaksanaan. 3) observasi. 4) Refleksi. Subjek penelitian adalah siswa kelas IV SDN Madyopuro II Kecamatan Kedungkandang Kota Malang yang terdiri dari 45 siswa. Instrumen yang digunakan dalam penelitian adalah soal tes,lembar Observasi dan Dokumentasi (Guru dan Siswa) Analisis data ini menggunakan deskritif kualitatif. Hasil penelitian diketahui bahwa hasil belajar siswa meningkat dari siklus I ke siklus II. Pada siklus I mengalami peningkatan siswa yang dikatakan tuntas sebanyak 25 siswa (55,56%). Pada siklus II meningkat lagi yaitu siswa yang tuntas sebanyak 42 (93.34) siswa setelah penerapan model Snowball Throwing. Penerapan model pembelajaran Snowball Throwing dengan pembelajaran IPS bagi siswa kelas IV SDN Madyopuro II Kecamatan Kedungkandang Kota Malang yaitu pada materi perkembangan teknologi transportasi karena dalam pelaksanaan pembelajaran guru sudah menyiapkan rencana pembelajaran sesuai dengan model pembelajaran yang diterapkan Peningkatan hasil belajar diperoleh dari kegiatan selama proses pembelajaran yaitu kegiatan pembahasan materi bersama guru, kegiatan belajar kelompok. Dalam kegiatan pembahasan materi secara klasikal siswa diajak bersama guru untuk mempelajari materi pokok “Perkembamgan teknologi transportasi” dengan cara guru menunjukan beberapa media gambar dan menyuruh siswa mengamati dengan cara bertanya jawab dengan guru, dalam kegiatan belajar kelompok. Model pembelajaran Snowball Throwing dapat meningkatkan hasil belajar siswa SDN Madyopuro II Kecamatan Kedungkandang Kota Malang dengan baik. Untuk itu disarankan bagi guru sebagai seorang ahli yang mampu merancang dan melaksanakan pembelajaran. dengan interaksi yang edukatif, komunikatif dan menyenangkan bagi siswa dan guru sendiri.

Pengaruh intelligence quotient (IQ), kondisi kecerdasan emosional, dan motivasi terhadap prestasi belajar siswa pada mata pelajaran akuntansi kelas XI IPS SMA Negeri 2 Selong Kabupaten Lombok Timur / Laeli Fatma Syari


Kata kunci: Intellegence Quotient (IQ), Kondisi Kecerdasan Emosional, Motivasi, dan Prestasi Belajar. Memiliki prestasi yang membanggakan merupakan harapan setiap siswa. Dan untuk mencapai kesuksesan dalam belajar, siswa tidak hanya dituntut memiliki kecerdasan intelektual dan kecerdasan emosional yang baik, tetapi juga harus memiliki motivasi belajar yang tinggi pula. Penelitian ini membahas tentang pengaruh kecerdasan intelektual (IQ), kondisi kecerdasan emosional dan motivasi yang dimiliki oleh siswa terhadap prestasi belajar yang telah dicapai oleh siswa. Penelitian ini bertujuan untuk mengetahui pengaruh kecerdasan intelektual (IQ), kondisi kecerdasan emosional dan motivasi secara parsial terhadap prestasi belajar. Penelitian ini dilakukan di SMAN 2 Selong Kabupaten Lombok Timur. Populasi penelitian ini berjumlah 214 siswa dengan jumlah sampel sebanyak 105 siswa. Pengambilan sampel dilakukan menggunakan teknik purposive sample. Sedangkan metode analisisnya menggunakan analisis regresi berganda. Berdasarkan hasil analisis data menyatakan bahwa ada pengaruh yang signifikan antara IQ terhadap prestasi belajar siswa pada mata pelajaran akuntansi. Dari hasil analisis menunjukkan hasil dan = 2,00 dengan probabilitas (Sig) 0,065 yang mana nilai signifikannya berada dibawah 0,05. Nilai koefisien regresi parsial variable IQ bernilai positif sebasar 0,196 berarti kenaikan satu satuan variable IQ akan meningkatkan prestasi belajar mata pelajaran akuntansi sebesar 0,196. Untuk variabel Kondisi kecerdasan emosional berdasarkan hasil analisis data menyatakan bahwa ada pengaruh yang signifikan antara Kondisi Kecerdasan Emosional terhadap prestasi belajar siswa dalam mata pelajaran akuntansi. Dari hasil analisis menunjukkan hasil dan dengan probabilitas (sig) 0,000 yang mana nilai signifikansinya berada dibawah 0,05. Nilai koefisien regresi parsial variabel Kondisi Kecerdasan Emosional bernilai positif sebesar 0,236 berarti kenaikan satu satuan variabel Kondisi Kecerdasan Emosional akan meningkatkan prestasi belajar siswa dalam mata pelajaran akuntansi sebesar 0,236. Dan untuk variabel motivasi dari hasil analisis menunjukkan hasil dan dengan probabilitas (sig) 0,000 yang mana nilai signifikansinya berada dibawah 0,05. Nilai koefisien regresi parsial variabel Motivasi bernilai positif sebesar 0,186 berarti kenaikan satu satuan variabel Motivasi akan meningkatkan prestasi belajar siswa dalam mata pelajaran akuntansi sebesar 0,186. Berdasarkan hasil penelitian ini, disarankan pada pihak keluarga untuk dapat mengembangkan kecerdasan emosional sejak dini karena kecerdasan emosional dapat berkembang melalui proses pembelajaran secara terus-menerus. Orang tua juga harus memberikan motivasi kepada anaknya agar prestasi yang dicapai terus meningkat.

Perancangan corporate identity disease skateboards company pada media promosi / Ozias Widijanto Irawan


Kata Kunci : Perancangan, corporate identity, media, promosi. Disease Skateboards Company adalah perusahaan skateboards pertama di Malang. Disease Skateboards Company menginginkan identitas visual yang baru dan memberikan citra baru. Oleh sebab itu, Disease Skateboards Company perlu adanya visualisasi identitas yang baru. Tujuan dari perancangan corporate identity Disease Skateboards Company ini adalah untuk mengetahui cara menghasilkan corporate identity yang dapat menyampaikan identitas Disease Skateboards Company dengan memberi pengaruh, fleksibel, serta berkomunikatif untuk masyarakat luas menggunakan metode deskriptif. Tehnik dalam mengumpulkan data menggunakan observasi, dokumentasi. Dalam konsep perancangannya diciptakan model gaya desain yang dekoratif yang mendukung tanpa menghilangkan dan mengubah icon yang sudah ada sebelumnya. Bentuk logotype Disease Skateboards Company, serta aplikasi warnanya yang melambangkan baru, kecerdasan, kepolosan dan kenyamanan diharapkan dapat meningkatkan citra positif perusahaan, termasuk di dalamnya berupa stasionery set dan promotional item. Sehingga mampu mempresentasikan suatu image perusahaan yang baik. Proses perancangan corporate identity Disease Skateboards Company menggunakan software CorelDraw X4 dan Photoshop CS3. Perancangan ini menghasilkan suatu produk berupa identitas visual baru perusahaan, mempresentasikan citra positif perusahaan, dan diaplikasikan pada atribut perusahaan guna meningkatkan citra positif perusahaan. Hasil perancangan ini diharapkan dapat menjadi acuan atau tolak ukur dalam mengadakan redesain suatu corporate identity, baik bagi mahasiswa, desainer pemula, pengajar, dan lain sebagainya.

Hubungan membacakan cepat dengan kecepatan membaca dan pemahaman siswa kelas VIII SMP Negeri 1 Gondang Tulungagung / Ratna Dupitasari


Kata Kunci: Membacakan Cepat, Kecepatan Membaca, Pemahaman Membacakan cepat adalah membaca yang dilakukan dengan menyuarakan kata per kata disertai dengan pemahaman serta dihitung kecepatannya. Membaca cepat adalah membaca yang dilakukan dengan cepat untuk mendapatkan pemahaman yang efektif. Pemahaman diperlukan untuk mengetahui sejauh mana penguasaan terhadap bacaan yang telah dibaca. Penelitian ini bertujuan untuk mengetahui hubungan membacakan cepat dengan kecepatan membaca dan pemahaman. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kuantitatif. Penelitian ini merupakan penelitian korelasional. Variabel bebas dalam penelitian ini adalah kemampuan membacakan cepat (X) dan variabel terikat adalah kecepatan membaca (Y1), pemahaman isi bacaan (Y2). Jenis penelitian yang digunakan adalah regresi sederhana. Populasi dalam penelitian ini adalah seluruh siswa regular kelas VIII SMP Negeri 1 Gondang Tulungagung yang berjumlah 322 siswa. Pengambilan sampel digunakan teknik purposive sample. Kelas yang dipilih sebagai sampel adalah kelas VIIIA sebanyak 40 siswa. Hipotesis penelitian berbunyi terdapat hubungan membacakan cepat dengan kecepatan membaca dan terdapat hubungan membacakan cepat dengan pemahaman teks. Langkah-langkah penelitian sebagai berikut. Pertama, peneliti menentukan kelas yang akan digunakan sebagai sampel populasi. Kedua, pemberian tes kemampuan membacakan cepat dan menghitung kecepatan membaca. Ketiga, pemberian tes pemahaman teks bacaan yang telah dibaca. Data dalam penelitian ini terdiri atas tiga data, yaitu (1) skor membacakan cepat, (2) skor kecepatan membaca, dan (3) skor pemahaman isi bacaan. Melalui penelitian ini dihasilkan kesimpulan. Pertama, nilai sig sebesar 0,000 lebih kecil 0,05 dan nilai Adjusted R Squere sebsesar 0,380, sehingga hipotesis hubungan membacakan cepat dengan kecepatan membaca diterima. Kedua, nilai sig sebesar 0,045 lebih kecil 0,05 dan Adjusted R Squere sebesar 0,78, sehingga hipotesis hubungan membacakan cepat dengan pemahaman isi bacaan diterima. Hal-hal yang disarankan untuk peneliti selanjutnya sebaiknya memperbanyak variabel yang digunakan untuk penelitian selanjutnya agar data yang dihasilkan lebih beragam dan tentunya akan lebih valid. Bagi guru bahasa Indonesia hendaknya melaksanakan tes kemampuan membacakan cepat kepada siswa agar kecepatan membaca siswa meningkat dan disertai dengan pemahaman yang maksimal.

Pengembangan media pembelajaran interaktif pada mata pelajaran sains kelas V pokok bahasan perubahan sifat benda di Sekolah Dasar Negeri 2 Doko Blitar / Arisa Kurniawan


Kata kunci: Pengembangan, Media Pembelajaran Interaktif, Sains Media pembelajaran interaktif merupakan salah satu bentuk media yang dapat dimanfaatkan sebagai media pembelajaran. Berdasarkan hasil observasi dalam penyampaian materi masih menggunakan media sederhana, belum menggunakan media interaktif dalam proses pembelajaran meskipun di sana tersedia sarana belajar yang memadai, banyaknya materi sains dan terbatasnya waktu yang digunakan dalam penyampaian materi membuat peserta didik merasa jenuh dalam proses pembelajaran jika hanya menggunakan media sederhana dalam penyampaianya. Oleh karena itu perlu adanya penyediaan sumber belajar yang berupa multimedia yang didesain dalam bentuk pembelajaran interaktif. Penelitian ini bertujuan untuk menghasilkan pembelajaran interaktif dalam pembelajaran sains di SDN Doko 2 Blitar kelas V pokok bahasan perubahan sifat benda yang dapat dijadikan sebagai alternatif dalam pencapaian tujuan pembelajaran. Subyek penelitian dalam uji coba pengembangan ini adalah peserta didik SD Negeri Doko 2 Blitar kelas V. jenis data yang digunakan adalah kualitatif dan kuantitatif, data kualitatif diperoleh dari validasi ahli media, ahli materi dan siswa. Sedangkan data kuantitatif diperoleh dari hasil pre-test dan post-test. Media pembelajaran interaktif ini divalidasikan oleh ahli materi sebanyak 2 orang, ahli media sebanyak 1 orang, dan peserta didik sebanyak 16 orang. Setelah dianalisis media pembelajaran interaktif ini dinyatakan valid dengan hasil perhitungan ahli media 90%, ahli materi 92,5% dan siswa individual 90% serta siswa kelompok besar 85,6%. Keefektifitasan media dapat dilihat dari perbandingan hasil belajar peserta didik secara keseluruhan data peserta didik diperoleh peningkatan sebesar 16 poin, hal ini menunjukkan media pembelajaran interaktif cukup dapat memberikan efek positif terhadap peningkatan hasil belajar peserta didik secara menyeluruh, maka dapat disimpulkan bahwa pembelajaran interaktif sangat efektif digunakan dalam pembelajaran peserta didik. Berdasarkan hasil penelitian ini dapat disarankan bagi pihak sekolah, hendaknya dapat lebih meningkatkan lagi pengadaan sarana pembelajaran interaktif menggunakan media ini, karena telah terbukti efektif meningkatkan hasil belajar peserta didik, serta membentuk sikap dan perilaku belajar peserta didik, dalam rangka situasi belajar yang kondusif.

Identifikasi keragaman genetik kerbau (Bubalus bubalis) lokal Madiun berbasis mikrosatelit sebagai bahan penyusunan bahan ajar biologi di Sekolah Menengah Atas (SMA) / Jena Andres


Tesis, Program studi Pendidikan Biologi, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Dr. agr. Mohamad Amin, S.Pd., M.Si. dan Pembimbing (2) Dr. Abdul Gofur, M.Si. Kata kunci: keragaman genetik, mikrosatelit, kerbau lokal (Bubalus bubalis). Populasi kerbau di Indonesia cenderung mengalami penurunan dari tahun ke tahun. Di Jawa Timur tahun 2003 jumlah kerbau 110.685 ekor sedangkan tahun 2007 jumlahnya 53.364 ekor. Di Kabupaten Madiun populasi kerbau, pada tahun 2003 berjumlah 8.840 ekor sedangkan tahun 2007 berjumlah 2.534 ekor. Apabila kondisi ini berlangsung terus menerus dikhawatirkan akan mengancam kelangsungan sumber daya hayati berupa kerbau. Aktivitas pengelolaan sumber daya hayati dapat dilakukan dengan mengetahui keragaman genetik. Salah satu cara untuk deteksi keragaman genetik dapat dilakukan melalui pendekatan dengan pengamatan morfologi dan molekuler. Salah satu penanda molekuler yang dapat dimanfaatkan dalam kegiatan identifikasi genetik adalah mikrosatelit. Penelitian ini bertujuan: (1) mendeskripsikan keragaman genetik kerbau lokal (Bubalus bubalis) di Jawa Timur dari wilayah Madiun (2) sebagai bahan penyusunan bahan ajar biologi pada Sekolah Menengah Atas. Jenis penelitian ini adalah deskriptif eksploratif dengan tujuan mengidentifikasi keragaman genetik kerbau lokal Madiun, dengan mengkaji ekspresi fenotip dan ekspresi genotip melalui DNA dengan teknik mikrosatelit. Pengamatan pola keragaman genetik dilakukan mulai tahapan isolasi DNA yang dilanjutkan dengan elektroforesis dengan menggunakan gel agarose setelah itu dilakukan amplifikasi hasil isolasi DNA dengan PCR, tahap selanjutnya untuk mengetahui hasil amplifikasi dilakukan dengan elektroforesis gel poliacrilamid. Amplifikasi DNA mengunakan tiga lokus mikrosatelit yaitu HEL 9, INRA 023 dan ILSTS 005. Teknik elektroforesis dengan menggunakan gel poliacrilamid akan memberikan informasi tentang frekuensi alel, tingkat heterozigositas, nilai informasi polimorfik (PIC) serta mengetahui keseimbangan hukum Hardy-Weinberg yang dianalisis menggunakan GENEPOP ver. 4.0.1d. Hasil analisis menunjukan bahwa keragaman genetik kerbau Wungu lebih tinggi apabila dibandingkan dengan kerbau Kare. Hasil ini dapat dilihat dari nilai PIC, frekuensi alel dan heterozigositas. Nilai PIC dari ketiga lokus pada kerbau Wungu yaitu HEL 09 sebesar 0, 61%, INRA 023 sebesar 0,48% dan ILSTS 005 sebesar 0,59%, sedangkan nilai PIC pada kerbau Kare yaitu HEL 09 sebesar 0,39% dan ILSTS 005 sebesar 0,37%. Nilai frekuensi alel ketiga lokus mikrosatelit pada kerbau Wungu berkisar antara 0,28 sampai 0,72, sedangkan nilai frekuensi alel ketiga lokus mikrosatelit kerbau Kare berkisar antara 0,31 sampai 0,69. Nilai rata-rata heterosigositas pada subpopulasi Wungu dari ke tiga lokus sebesar 0,74 sedangkan nilai rata-rata heterosigositas pada subpopulasi Kare dari ke tiga lokus sebesar 0,75. Sehingga dapat diartikan bahwa keragaman genetik kerbau lokal Madiun subpopulasi Wungu dan Kare masih cukup tinggi. Berdasarkan nilai frekuensi alel, heterozigositas dan polimorfisme lokus menunjukkan bahwa dari tiga lokus yang terdeteksi, semuanya bersifat polimorfik dan hal ini mengindikasikan bahwa terdapat keragaman genetik pada populasi kerbau Madiun. Hasil penelitian ini dapat diaplikasikan dalam pembelajaran terutama untuk penyusunan bahan ajar biologi khususnya materi Keanekaragaman Hayati. Bahan ajar yang telah disusun, dapat digunakan oleh guru dan siswa pada Sekolah Menengah Atas (SMA) untuk lebih mengenali keanekaragaman hayati tingkat genetik Madiun.

Pengembangan panduan latihan beban untuk otot tungkai melalui video di Sanggar Kebugaran Ilmu Keolahragaan Universitas Negeri Malang / Angga Yuli Saputro


Kata kunci:penelitianpengembangan, panduan, fitness, latihanbeban, otot tungkai, Sanggar Kebugaran Ilmu Keolahragaan UM. Berdasarkanpenelitianawal yang sudah dilakukanpeneliti di Sanggar KebugaranIlmuKeolahragaan Universitas Negeri Malangdiperolehinformasibahwa: (1) Sanggar Kebugaran Ilmu keolahragaan Universitas Negeri Malang tidak memilikipanduan latihan beban untuk otot tungkai berupa video, (2) Informasi yang disampaikan instruktur ditempat tersebut tentang cara memakai alat dan fungsi alat kepada member masih menggunakan penjelasan secara lesan, (3) 86,67% member selain melatih otot tubuh bagian atas juga memerlukan latihan untuk otot tungkai, (4) 80% member membutuhkan panduan tentang latihan beban untuk otot tungkai melalui video di Sanggar Kebugaran Ilmu Keolahragaan Universitas Negeri Malang, (5) 83,33% member kurang mengetahui macam-macam latihan beban untuk otot tungkai, (6) 96,67% member setuju dengan adanya panduan latihan beban untuk otot tungkai melalui video, (7) 75% Instruktur di Sanggar Kebugaran Ilmu Keolahragaan tidak selalu dapat mendampingi member untuk memberikan informasi tentang latihan beban, (8) Sanggar KebugaranIlmu Keolahragaan Universitas Negeri Malang memerlukan informasi latihan beban untuk otot tungkai yang berupa video. Peneliti memilih video untuk menyampaikan informasi mengenai latihan beban. Panduan ini dirancang secara sistematis dengan berpedoman pada prinsip-prinsip latihan beban yang telah ada sebelumnya sehingga memungkinkan member atau anggota Sanggar Kebugaran Ilmu Keolahragaan Universitas Negeri Malang dapat menerima informasi lebih mudah dan menarik. Panduanmelalui video termasuk media audiovisual karena selain mengandung unsur suara juga mengandung unsur gambar yang mudah untuk dimengerti. Dari hasil evaluasi uji coba kelompok kecil dengan menggunakan 10 member dan 5 instruktur diperoleh persentase 87,52% tergolong kategori valid, dan pada uji kelompok besar dengan menggunakan 30 member dan 10 instruktur diperoleh persentase 84,81% tergolong kategori valid sehingga panduan latihan beban untuk otot tungkai melalui video di Sanggar Kebugaran Ilmu Keolahragaan Universitas Negeri Malang dapat digunakan. Berdasarkan hasil penelitian tersebut, maka saran yang dapat diberikan di antaranya: instrukturataupersonal trainersebaiknyalebihkreatifdaninovatifdalamhalpengembangandanpemnfaatan media panduan. Pemanfaatan media audiovisual dalam proses pemahamaninformasiakanmerangsangmember untuklebihtertarikdenganlatihanbeban yang akhirnyabermuarapadapercepatan

Peningkatan keterampilan tolak peluru gaya O'Brien menggunakan media bola plastik pada siswa kelas XF SMA Negeri 1 Ngunut Kecamatan Ngunt Kabupaten Tulungagung / Eko Yudha Kustian


Kata kunci: Peningkatan, Keterampilan, Tolak Peluru Gaya O’Brien, Media, Bola Plastik Tolak peluru merupakan salah satu cabang olahraga atletik. Tolak peluru merupakan salah satu materi atletik yang terdapat dalam standar kompetensi Sekolah Menengah Atas kelas X. Salah satu kompetensi dasarnya yaitu siswa menguasai keterampilan tolak peluru. Berdasarkan hasil observasi awal, diperoleh hasil bahwa penguasaan keterampilan tolak peluru gaya O’Brien siswa kelas X F SMA Negeri 1 Ngunut ternyata masih banyak siswa yang melakukan kesalahan saat melakukannya. Hal ini terlihat dari jumlah siswa yang melakukan kesalahan pada saat melakukan gerakan tolak peluru gaya O’Brien yaitu, 20 siswa mengalami kesulitan pada saat awalan, 21 siswa mengalami kesulitan pada saat gerakan sebelum tolakan, 24 siswa mengalami kesulitan pada saat melakukan gerakan tolakan. Tujuan penelitian ini adalah meningkatkan keterampilan tolak peluru gaya O’Brien pada siswa kelas XF SMA Negeri 1 Ngunut. Dalam pembelajaran tolak peluru masing-masing indikator ini harus diperhatikan untuk memberikan penilaian pada siswa. Penelitian ini merupakan jenis penelitian tindakan kelas dengan pendekatan deskriptif kuantitatif. Pelaksanaan tindakan kelas ini dilakukan melalui dua siklus dimana tiap siklus terdiri dari 4 tahap yaitu: (1) Perencanaan, (2) Pelaksanaan, (3) Observasi, (4) Refleksi. Subjek dalam penelitian ini adalah siswa kelas XF SMA Negeri 1 Ngunut. Teknik pengumpulan data dalam penelitian ini menggunakan observasi (pengamatan), dokumentasi, tes dan catatan lapangan.. Hasil penelitian ini telah terbukti mampu meningkatkan keterampilan siswa dari siklus ke siklus. Pada siklus I siswa yang pada awalnya 22 orang yang belum memenuhi standar ketuntasan minimal yaitu 75 berkurang menjadi 8 siswa yang belum memenuhi standar ketuntasan minimal. Dari hasil tersebut menunjukan peningkatan terhadap penguasaan keterampilan tolak peluru gaya O’Brien yang terlihat dari perbandingan hasil pre-test yang dilaksanakan pada saat pra tindakan dengan hasil post-test yang diberikan pada akhir penerapan. Untuk hasil post-test siklus II juga menunjukkan peningkatan penguasaan keterampilan teknik tolak peluru gaya O’Brien. Dari 8 siswa yang belum memenuhi standar ketuntasan minimal yaitu 75 pada siklus 2 ini hanya tinggal 1 siswa saja yang belum memenuhi standar ketuntasan minimal. Selain hal tersebut diperoleh hasil persentasi keberhasilan sebagai berikut dari aspek cara memegang peluru sebanyak 100%, dari aspek awalan sebanyak 100% dari aspek gerakan sebelum tolakan sebanyak 91,67% , dari aspek tolakan sebanyak 91,67% dan dari aspek sikap akhir sebanyak 100%. Selain hasil persentase mengenai teknik tolak peluru gaya O’Brien, diperoleh pula hasil dari pengamatan sikap siswa pada saat proses pembelajaran, pada siklus 1 siswa ada yang terlambat, siswa tidak berpakaian dengan lengkap, dan siswa tidak memperhatikan penjelasan guru saat guru menjelaskan materi. Namun pada siklus 2 sudah terlihat peningkatan yang cukup baik dibandingkan dengan siklus I, pada siklus 2 ini sudah tidak ada siswa yang terlambat, siswa yang menyimpang menjadi lebih disiplin, siswa melakukan proses belajar dengan baik, dan siswa sudah menguasai keterampilan tolak peluru gaya O’Brien dengan baik dan benar. Walaupun pada post-test siklus II masih terdapat siswa yang belum tuntas, ini adalah wajar karena cukup sulit untuk mencapai taraf keberhasilan 100% siswa tuntas semua. Peneliti menyarankan, bagi guru dapat memperkaya pengetahuan dan model pembelajaran tolak peluru gaya O’Brien yang sudah diperbaiki, bagi siswa dapat digunakan sebagai pedoman belajar, bagi sekolah dapat digunakan sebagai tolok ukur untuk keberhasilan pembelajan Pendidikan Jasmani dan bagi peneliti dapat digunakan sebagai sumber referensi bagi mahasiswa yang melakukan penelitian yang berkaitan dengan materi pada skripsi ini.

Problematika pelayanan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan / Fairus Aditya AR Canggih


Kata kunci: Pelayanan Publik, Kualitas Pelayanan, KTP, Dinas Kependudukan dan Catatan Sipil Salah satu pelayanan pemerintah yang dibutuhkan masyarakat adalah pembuatan Kartu Tanda Penduduk (KTP). KTP merupakan dokumen bukti kependudukan di satu daerah yang disyaratkan dimiliki oleh anggota masyarakat. Adanya keluhan sebagian masyarakat terhadap pelayanan pembuatan KTP mendorongnya penelitian ini dengan tujuan untuk mengetahui persepsi masyarakat atas problematika terhadap pelayanan KTP di Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan. Permasalahan yang dikaji dalam penelitian ini adalah : (1) bagaimana pelayanan publik yang dilakukan oleh Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan dalam pembuatan KTP, (2) apakah faktor pendukung yang diperlukan oleh Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan dalam pelayanan publik pada pembuatan KTP,(3) apakah hambatan-hambatan dalam pelayanan pembuatan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan, (4) bagaimana upaya untuk mengatasi hambatan-hambatan dalam pelayanan pembuatan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan. Dengan tujuan penelitian ingin memperoleh informasi tentang problematika pelayanan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan. Penelitian mengenai Pelayanan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan ini menggunakan pendekatan gabungan kualitatif dan kuantitatif. Penggunaan gabungan pendekatan penelitian dilakukan dengan memadukan prosedur pengumpulan data kualitatif dan kuantitatif secara bersamaan. Pendekatan ini menggunakan gabungan pada prosedur penelitian, tetapi salah satu metode lebih dominan terhadap metode yang lain. Dalam hal ini dapat dikatakan, bahwa metode yang kurang dominan hanya diposisikan sebagai metode pelengkap untuk mendukung ”kekayaan data”. Pada penelitian tentang pelayanan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan, metode dominannya adalah metode kualitatif. Subyek penelitian ini adalah pegawai Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan dan masyarakat pemohon KTP. Prosedur yang dipakai dalam pengumpulan data, yaitu:, (1) observasi partisipatif, (2) wawancara mendalam, (3) angket, dan (4) dokumentasi. Instrumen dalam penelitian ini adalah peneliti sendiri. Teknik analisis data dilakukan dengan reduksi data, penyajian data, penarikan kesimpulan. Pengecekan keabsahan data menggunakan teknik ii keikutsertaan di lapangan dalam rentang waktu yang panjang, ketekunan pengamatan, triangulasi. Berdasarkan hasil analisis data tersebut, diperoleh empat simpulan hasil penelitian sebagai berikut. Pertama, Penerapan pelayanan publik terhadap pembuatan KTP di Dinas Kependudukan dan Catatan Sipil Pemerintah Daerah Kabupaten Pasuruan sudah dapat dikatakan baik, hal itu dapat diketahui dengan pelayanan yang diberikan dalam pembuatan KTP sudah sesuai dengan prosedur yang ada. Namun disini terdapat problematika yaitu pernyataan dari masyarakat bahwa dalam memperoleh KTP masyarakat diminta untuk membayar. Biaya pengurusan KTP berdasarkan Peraturan Daerah adalah gratis. Kenyataannya masih ditemukan pungutan yang dilakukan oleh aparat di tingkat Kelurahan maupun Kecamatan. Pembuatan KTP harus menunggu dalam jangka waktu yang cukup lama untuk memiliki yang namanya KTP. Kedua, faktor-faktor yang mendukung diselenggarakannya pelayanan publik pada pembuatan KTP di Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan terdapat tiga faktor, yaitu faktor petugas yang berkualitas, faktor sarana dan prasarana, dan faktor sumber dana/keuangan. Ketiga, dalam peningkatan pelayanan administrasi kependudukan dan catatan sipil khususnya pada pelayanan KTP, KK dan Akta-akta Catatan Sipil, Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan mengalami beberapa hambatan antara lain yang peneliti temui adalah (1) Sarana dan Prasarana masih belum memadai dalam penerapan standart pelayanan publik, (2) Belum terlaksananya Program Pelaksanaan SIAK ( Sistem Informasi Administrasi Kependudukan ), dan (3) Kurangnya petugas khususnya tenaga pelaksana. Keempat, upaya yang dilakukan Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan dalam mengatasi masalah tersebut adalah untuk mengatasi permasalahan kekurangan blanko KK tahun 2010 maka untuk tahun anggaran 2011 berusaha untuk menambah persediaan blanko KTP dan KK, sedangkan untuk pengadaan baru sarana dan prasarana komputer SIAK masih belum dianggarkan pada tahun 2011. Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan juga perlu meningkatkan SDM ( Sumber Daya Manusia) untuk penambahan personil kependudukan dan perluasan pengembangan gedung kantor pada Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan. Untuk penambahan pegawai Dinas Kependudukan dan Catatan Sipil Kabupaten Pasuruan bekerjasama dengan Badan Kepegawaian Dearah Kabupaten Pasuruan, Saran yang diberikan adalah dalam pelaksanaan pelayanan, jangan membuat urusan, mekanisme atau prosedur yang berbelit-belit. Berikan kemudahan, prosedur yang jelas, dapat dipahami oleh masyarakat sehingga masyarakat tidak merasakan kesulitan berhubungan dengan pelaku birokrasi yang memberikan pelayanan, perlu adanya KTP keliling, dan masyarakat hendaknya paham tentang peran penting KTP sebagai dokumen kependudukan.

Pengembangan buku panduan tahap-tahap pembelajaran keterampilan teknik senam lantai guling depan dan guling belakang untuk siswa kelas VII di UPT SMP Negeri 2 Saronggi Kabupaten Sumenep / Andi Fepriyanto


Kata kunci : pengembangan, pendidikan jasmani, buku panduan pembelajaran. Berdasarkan hasil observasi dan wawancara yang dilakukan oleh peneliti terhadap pembelajaran guru pendidikan jasmani di UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep pada tanggal 31 Januari 2011 tentang pembelajaran senam lantai guling depan dan guling belakang. Siswa terlihat letih dan kurang bersemangat belajar keterampilan gerakan teknik guling depan dan guling belakang sehingga kebanyakan siswa tidak bisa melakukan keterampilan teknik guling depan dan guling belakang dengan baik. Guru pendidikan jasmani, olahraga dan kesehatan belum mempunyai buku panduan sehingga buku panduan tersebut dibutuhkan. oleh karena itu peneliti ingin membuat pengembangan buku panduan tahap-tahap pembelajaran keterampilan teknik senam lantai guling depan dan guling belakang untuk siswa kelas VII di UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep. Dalam pengembangan buku panduan tahap-tahap pembelajaran keterampilan teknik senam lantai guling depan dan guling belakang untuk siswa kelas VII di UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep ini menggunakan model pengembangan Research & Development (R & D) dari Borg and Gall yang dimodifikasi (1983:775), yaitu peneliti hanya mengambil 7 langkah dari 10 langkah yang ada. Menurut Ardana (2002:9) bahwa Setiap pengembangan tentu saja dapat memilih dan menentukan langkah-langkah yang paling tepat bagi dirinya berdasarkan kondisi khusus yang dihadapinya dalam proses pengembangan. Penelitian ini dilakukan di UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep. Subjek uji coba terdiri dari (1) tinjauan ahli terdiri dari, 1 ahli pembelajaran pendidikan jasmani, 1 ahli senam dan 1 ahli media, (2) uji coba kelompok kecil dengan melibatkan 8 siswa kelas VII UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep, (3) uji coba kelompok besar dengan melibatkan 32 siswa VII UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep. Dari hasil uji coba (kelompok kecil) diperoleh bahwa seluruh aspek dalam pengembangan buku panduan tahap-tahap pembelajaran keterampilan teknik senam lantai guling depan dan guling belakang untuk siswa kelas VII di UPT. SMP Negeri 2 Saronggi Kabupaten Sumenep dengan persentase 87,63% dengan makna digunakan. Sedangkan hasil uji lapangan (kelompok besar) diperoleh dengan persentase 84,95% dengan makna digunakan. Berdasarkan hasil penelitian ini, disarankan sebaiknya subjek penelitian ini dilakukan pada yang lebih luas maupun kepada siswa kelas VII di sekolah lain.

The teaching and learning activities of English vocabulary at SDN Sumbersari III Malang / Yosuaten Aprillo Effata


Key words: English vocabulary, techniques of teaching vocabulary The teaching of English vocabulary to young learners is considered very important. It requires appropriate techniques which are suitable with the learning style of the children. To teach vocabulary to children need effective strategies from the teacher in order to attract the children’s attention and to help them learn. Thus, this study is expected to find out the techniques of English teaching vocabulary which are used by the teacher and also to see how the teaching and learning activities are performed. This is a descriptive research that used an English teacher of SDN Sumbersari III Malang as the subject of the study. The instruments used for the research are observation checklist, field notes, and interview guide for the teacher. The result of the study shows that the techniques of teaching English vocabulary for the 4th graders used by the teacher are content techniques. The techniques included (1) the teaching English vocabulary through mother tongue (differential procedure), (2) the teaching English vocabulary based on ostensive procedure, and (3) the teaching English vocabulary based on contextual procedure. There are also some other techniques used i.e. (a) give definition, (b) give synonym and antonym, (c) use pictures/flashcard and realia, (d) do some demonstration/gestures, (e) introduce words through context, (f) listen and repeat technique, and (g) use class aids. In selecting the materials for the teaching, the teacher had some considerations; they are the objective of the teaching English, the students’ need, interest, and preference, and the availability of the materials. The teacher also prepared some visual media such as flash cards and pictures. The flash cards or pictures which were chosen based on the topic of the teaching. There are some suggestions offered, i.e. for the English teacher of SDN Sumbersari III Malang; the teacher should have some strict rules in order to create a good condition for learning since the students are very active in terms of curiosity. The teacher is also suggested to combine all the techniques of teaching vocabulary which are considerably appropriate. This is meant to cope with the boredom of the students. For the other English teacher in Indonesia, in case the students are very active, the teacher should be well-prepared with knowledge about anything related to the topic of the teaching. At last, for the future researchers, since this study only covers the techniques of teaching vocabulary for the 4th graders, they can analyze the techniques of teaching vocabulary for other grades or schools. Thus, they can find out the difference between the techniques used for the teaching vocabulary for the 4th graders and the teaching of vocabulary for other grades or schools.

Makna ragam gerak tari baris tunggal: penerapannya pada kegiatan ekstrakurikuler di SMPN 4 Mendoyo Jembrana - Bali / Diah Rusdhiana


Kata Kunci: Ragam Gerak Tari Baris, Ekstrakurikuler Tari Baris merupakan tarian dasar putra yang harus dikuasai sebelum mempelajari tari Bali putra yang lain. Pada tari Baris, terdapat makna simbolik yang terkandung dalam setiap ragam geraknya. Tari Baris merupakan salah satu tarian wajib yang diberikan dalam pembelajaran ekstrakurikuler di SMPN 4 Mendoyo Jembrana-Bali. Dalam penerapanya dikegiatan ekstrakurikuler tersebut, makna simbolik ragam gerak tari Baris berfungsi sebagai materi yang diajarkan untuk menunjang keterampilan siswa dalam menarikan tarian ini. Rumusan masalah penelitian ini adalah (1) Bagaimanakah ragam gerak tari Baris tunggal?, (2) Bagaimanakah makna simbolik ragam gerak tari Baris tunggal?, dan (3) Bagaimanakah penerapan makna ragam gerak tari Baris tunggal pada pembelajaran ekstrakurikuler di SMPN 4 Mendoyo Jembrana-Bali? Penelitian ini menggunakan pendekatan kualitatif yang dilaksanakan di wilayah Jembrana Bali. Subjek dalam penelitian ini adalah dua seniman tari Bali dan satu guru seni tari. Pada penelitian ini peneliti sebagai instrumen atau alat pengumpul data utama. Dalam teknik pengumpulan datanya, peneliti melakukan wawancara dengan menggunakan pedoman wawancara yang telah dirancang sebelumnya. Analisis data dilakukan dengan cara mereduksi data, penyajian data serta penarikan kesimpulan. Dan untuk mengecek keabsahan data dilakukan dengan triangulasi sumber. Hasil penelitian menunjukkan bahwa (1) Ragam gerak pada tari Baris tunggal terdiri dari empat unsur utama meliputi agem, tandang, tangkep, dan tangkis. (2) Makna simbolik pada ragam gerak tari Baris tunggal antara lain: agem bermakna kegagahan seorang prajurit, malpal bermakna perjalanan seorang prajurit kesuatu tempat, ngeraja singa bermakna jiwa seorang prajurit yang garang dan bijaksana seperti singa, ambil pajeng bermakna seorang prajurit yang mengambil senjata, tayong bermakna kewibawaan seorang prajutit, napdap gelung bermakna membenahi gelungan, mungkah lawang bermakna kesiapan hati seorang prajurit sebelum berperang, dan ngombak lantang bermakna ketegasan dan kelincahan seorang prajurit saat berperang. (3) Pada kegiatan ekstrakurikuler di SMPN 4 Mendoyo Jembrana-Bali, makna ragam gerak tari Baris tunggal menjadi bahan apresiasi siswa yang bertujuan untuk membantu siswa dalam menarikan tarian ini. Dari hasil penelitian maka kepada mahasiswa Progam Studi Pendidikan Seni Tari Universitas Negeri Malang dan juga siapapun yang sedang belajar menari Baris disarankan agar mempelajari Tari Baris bukan hanya sebagai usaha perbendaharaan tari tradisi saja melainkan dapat memanfaatkan makna simbolik yang terdapat pada tiap ragamnya agar benar-benar mengerti tentang tari Baris tunggal.

Pengaruh kolaborasi model pembelajaran quantum teaching dan cooperative learning tipe TGT (Teams Games Tournament) terhadap motivasi dan hasil belajar siswa kelas VII pada mata pelajaran TIK di SMP Negeri 1 Pogalan Kabupaten Trenggalek / Novi Dyah Puspitasari


Kata Kunci: Quantum Teaching, TGT, Motivasi dan Hasil Belajar Pendidikan memiliki peranan yang sangat penting untuk menciptakan kehidupan bangsa yang cerdas, damai, terbuka, dan demokratis. Dari obeservasi awal disekolah, diketahui bahwa motivasi dan hasil belajar yang kurang pada mata pelajaran TIK di SMP Negeri 1 Pogalan, khususnya siswa kelas VIIG dan VIIH. Salah satu model pembelajaran yang dapat diterapkan untuk meningkatkan motivasi dan hasil belajar TIK yaitu Quantum Teaching dan Cooperative Learning Tipe TGT (Teams Games Tournament). Adapun tujuan penelitian ini untuk mengetahui perbedaan hasil belajar siswa yang mengalami perlakuan yang berbeda, mengetahui perbedaan motivasi belajar siswa yang mengalami perlakuan yang berbeda, mengetahui pengaruh kolaborasi model pembelajaran Quantum Teaching dan Cooperative Learning tipe TGT (Teams Games Tournament) terhadap motivasi belajar siswa dan mengetahui pengaruh kolaborasi model pembelajaran Quantum Teaching dan Cooperative Learning tipe TGT (Teams Games Tournament) hasil belajar siswa. Penelitian ini menggunakan rancangan eksperimental semu (quasy experimental design). Kemampuan awal siswa diperoleh dari hasil pretes. Populasi dari penelitian ini adalah seluruh kelas VII SMPN 1 Pogalan yang terdiri dari 9 kelas. Sampel dari penelitian ini hanya menggunakan 2 kelas, yaitu kelas VIIG sebagai kelas eksperimen dengan penerapan kolaborasi model pembelajaran Quantum Teaching dan Cooperative Learning Tipe TGT dan kelas VIIH sebagai kelas kontrol dengan penerapan model pembelajaran CTL. Teknik pengumpulan data dilakukan melalui 3 tahap, yaitu tahap persiapan, tahap pelaksanaan, dan tahap akhir. Instrumen yang digunakan yaitu instrumen perlakuan dan instrumen pengukuran. Analisis hasil penelitian yang dipakai adalah uji normalitas, uji homogenitas, uji hipotesis yang menggunakan uji-t dan uji regresi linier untuk mengetahui pengaruh. Hasil penelitian ini menunjukkan bahwa : (1) terdapat perbedaan hasil belajar antara kelas kontrol dengan kelas eksperimen sesuai dengan hasil uji t yaitu thitung (2,486) lebih besar dari ttabel (1,671). (2) terdapat perbedaan motivasi belajar antara kelas kontrol dengan kelas eksperimen sesuai dengan hasil uji t yaitu thitung (1,815) lebih besar dari ttabel (1,671). (3) terdapat pengaruh yang signifikan antara keterlaksanaan model pembelajaran dengan hasil belajar sesuai dengan hasil analisis regresi sederhana yaitu Psig.( 0,001) lebih kecil dari 0,01. (4) terdapat pengaruh yang signifikan antara keterlaksanaan model pembelajaran denga hasil belajar sesuai dengan hasil analisis regresi sederhana yaitu Psig.( 0,005) lebih kecil dari 0,01. ii Hal ini menunjukkan bahwa pembelajaran TIK dengan penerapan kolaborasi model pembelajaran Quantum Teaching dan Cooperative Learning Tipe TGT dapat diterapkan dalam proses pembelajaran TIK dan dapat meningkatkan hasil belajar dan motivasi belajar siswa.

Pengaruh penerapan model pembelajaran kooperatif tipe STAD (Student Teams Achievement Divisions) berbantuan peta konsep terhadap hasil belajar siswa pada materi atom, ion, dan molekul di SMP Negeri 4 Malang / Sari Kurniawati


Kata Kunci: model pembelajaran kooperatif tipe STAD, peta konsep, atom, ion, molekul Kimia merupakan salah satu materi pelajaran yang baru dimasukkan ke dalam kurikulum SMP. Kimia termasuk materi pelajaran IPA dan telah diajarkan di semua SMP salah satunya yaitu SMP Negeri 4 Malang. Proses pembelajaran di SMP Negeri 4 Malang telah menerapkan kurikulum KTSP. Penerapan kurikulum KTSP menuntut diterapkannya pembelajaran yang berpusat pada siswa (student centered approach). Pada pembelajaran student centered siswa dituntut lebih aktif untuk mengkonstruk pemahamannya sendiri. Pada kenyataannya siswa masih kesulitan dalam mengkonstruk pemahamannya sendiri terutama untuk materi yang bersifat abstrak. Salah satu materi yang bersifat abstrak dalam kimia adalah materi atom, ion, dan molekul. Oleh sebab itu, guru harus mencari metode pembelajaran yang sesuai dengan materi ini sehingga hasil belajar siswa dapat meningkat. Salah satu metode yang dapat diterapkan yaitu metode pembelajaran kooperatif tipe STAD berbantuan peta konsep. Tujuan penelitian ini adalah mengetahui pengaruh penerapan model pembelajaran kooperatif tipe STAD berbantuan peta konsep terhadap hasil belajar siswa pada materi kimia pokok bahasan atom, ion, dan molekul. Penelitian ini menggunakan rancangan penelitian eksperimental semu (quasi eksperiment). Populasi penelitian ini adalah siswa kelas VIII SMPN 4 Malang dengan sampel dua kelas, masing-masing kelas kontrol dan kelas eksperimen. Variabel bebasnya yaitu model STAD berbantuan Peta Konsep dan variabel terikatnya adalah hasil belajar siswa (aspek kognitif). Instrumen pengukuran yang digunakan ada dua yaitu tes dan lembar observasi. Analisis data meliputi uji normalitas, homogenitas, dan uji hipotesis. Hasil penelitian menunjukkan bahwa (1) terdapat perbedaan antara hasil belajar siswa yang diajarkan menggunakan pembelajaran kooperatif tipe STAD berbantuan peta konsep dengan siswa yang diajarkan menggunakan pembelajaran ekspositori. Hal ini terlihat dari tingkat ketuntasan dan skor rata-rata kelas eksperimen yang lebih baik daripada kelas kontrol. Skor rata-rata kelas eksperimen 81,6 dengan ketuntasan 90,2% sedangkan skor rata-rata kelas kontrol 75,3 dengan ketuntasan75%; (2) pembelajaran kooperatif tipe STAD berbantuan peta konsep pada materi atom, ion, dan molekul telah terlaksana dengan baik yaitu tingkat keterlaksanaannya diatas 75%.

Penerapan pembelajaran kooperatif model Students Teams Achievement Division (STAD) untuk meningkatkan hasil belajar geografi siswa kelas VII D semester II SMP Laboratorium UM / Aniswatin Auliyah


Kata kunci: pembelajaran kooperatif, model STAD, hasil belajar geografi Berdasarkan hasil observasi yang dilakukan mulai tanggal 8 Februari 2011 sampai 1 Maret 2011 di kelas VII D SMP Laboratorium Universitas Negeri Malang diketahui bahwa sebagian besar kegiatan pembelajaran masih didominasi oleh guru mata pelajaran, siswa hanya duduk untuk mencatat dan mendengarkan ceramah guru sedangkan untuk kegiatan tindak lanjut, siswa harus mengerjakan modul yang telah dibuat oleh guru mata pelajaran. Sedangkan pada hasil wawancara diketahui bahwa hanya 9 dari 33 siswa yang mampu tuntas dan memenuhi KKM di sekolah yaitu 65. Tujuan penelitian ini yaitu untuk meningkatkan hasil belajar geografi siswa kelas VII D SMP Laboratorium Universitas Negeri Malang. Siswa yang mempunyai nilai rendah diharapkan dapat meningkatkan hasil belajarnya melalui model pembelajaran yang diterapkan pada penelitian ini. Penelitian ini merupakan jenis Penelitian Tindakan Kelas (Classroom action research). Model yang digunakan pada penelitian ini adalah model pembelajaran kooperatif Students Teams Achievement Division (STAD) dan diberlakukan pada kelas VII D semester II di SMP Laboratorium Universitas Negeri Malang dan pada pokok bahasan mendeskripsikan pola kegiatan ekonomi penduduk, penggunaan lahan, dan pola permukiman berdasarkan kondisi fisik permukaan bumi. Hasil penelitian menunjukkan bahwa adanya peningkatan hasil belajar siswa pada mata pelajaran geografi kelas VII D SMP Laboratorium Universitas Negeri Malang setelah pelaksanaan proses pembelajaran STAD siklus I dan siklus II. Tes hasil belajar diperoleh peningkatan ketuntasan dari siklus satu yaitu 60,61% naik menjadi 90,90% pada siklus dua dari jumlah keseluruhan siswa. Dengan ratarata nilai hasil belajar pada siklus satu yaitu 64,61 menjadi 80,06 pada siklus dua. Persentase peningkatan pada penelitian ini sebanyak 23,91%. Secara umum dalam penerapan model pembelajaran kooperatif Students Teams Achievement Division (STAD) sudah baik, namun memerlukan banyak pembenahan pada beberapa tahapan pembelajaran model STAD tersebut.

Perancangan CD interaktif pengenalan alat dan bahan memasak untuk remaja menggunakan flash / Novarika Widyastuti


Kata Kunci : CD Interaktif, memasak, remaja Selama ini masyarakat hanya mendapatkan ilmu masak-memasak informal dari orang tua, buku resep masakan, dan tayangan memasak di televisi. Itupun memiliki kekurangan masing-masing yang terkadang menghambat kegiatan memasak itu sendiri. Selain itu kegiatan memasak masih dianggap sebagai suatu kegiatan yang hanya dilakukan oleh wanita. Dengan permasalahan tersebut maka dibutuhkan suatu CD interaktif yang dapat membantu remaja pria maupun wanita untuk mempelajari dasar memasak dimulai dengan hal-hal dasar yang sangat penting yaitu pengenalan alat dan bahan untuk memasak dimana keduanya merupakan unsur pokok dalam proses memasak yang jarang dipaparkan dalam media-media lain yang sudah ada. Kegiatan perancangan ini adalah untuk menghasilkan suatu produk desain komunikasi visual berupa suatu media interaktif yang memberikan pengetahuan alat dan bahan memasak untuk remaja dengan menggunakan Flash. Produk CD Interaktif Pengenalan Alat dan Bahan Memasak untuk Remaja Menggunakan Flash ini memiliki banyak halaman content yang memuat tentang alat dan bahan untuk memasak yang memuat gambar, foto dan video di dalamnya. Terdapat pula animasi sederhana dan penjelasan singkat yang mudah dipahami oleh remaja. Media ini tidak terbatas waktu karena dapat diputar kapanpun remaja mau dan berulang-ulang tanpa takut tertinggal materi yang ada di dalamnya. Selain itu media ini menggabungkan media audio dan visual sehingga lebih menarik dan menyenangkan sehingga meningkatkan semangat remaja untuk mengenal alat dan bahan memasak. Selain itu ini merupakan wujud pembelajaran kemitra sejajaran sejak dini kepada remaja Indonesia dalam contoh yang paling sederhana. Media CD interaktif merupakan suatu media baru untuk menyampaikan suatu pengenalan alat dan bahan untuk memasak sehingga dibutuhkan media pendamping yang tepat agar menarik perhatian konsumen untuk membelinya. Media utama tersebut akan ditunjang dengan media pendukung seperti poster, banner, KARMIN (KAmus Rahasia MINi), CD case, kaos untuk SPG dan merchandise berupa celemek lucu dengan tema ilustrasi yang sama dengan media utama. Dari paparan di atas maka dapat disimpulkan bahwa CD Interaktif Pengenalan Alat dan Bahan Memasak untuk Remaja Menggunakan Flash ini merupakan media yang memberikan pengetahuan baru tentang alat dan bahan untuk memasak untuk remaja, namun di dalamnya juga terdapat nilai pelajaran tentang pentingnya pendidikan kemitra sejajaran pria dan wanita sejak dini.

Pengaruh model pembelajaran make a match terhadap hasil belajar geografi materi hidrosfer kelas VII SMP BSS (Brawijaya Smart School) Kota Malang / Abidah


Kata Kunci: Make A Match, hasil belajar geografi Belajar merupakan proses internal dan melibatkan kompetensi meliputi ranah kognitif, afektif dan psikomotor. Perilaku siswa merupakan hasil belajar. Tinggi rendahnya hasil belajar dipengaruhi oleh beberapa faktor, misalnya: karakteristik siswa, kompetensi guru, dan bahan ajar. Khusus kompetensi guru, penggunaan model pembelajaran yang mampu mengaktifkan siswa sangat diperlukan agar di samping aktif, juga dapat memperoleh hasil belajar yang maksimal. Salah satu model yang dapat meningkatkan hasil belajar siswa adalah Make A Match. Keunggulan model ini adalah menghilangkan sifat mementingkan diri sendiri atau egois, menciptakan kondisi yang menyenangkan dalam kegiatan belajar mengajar, membuat siswa menjadi lebih percaya diri, membantu guru untuk menyelesaikan masalah dalam pembelajaran dan membantu guru dalam mengatasi keterbatasan sarana di sekolah. Tujuan penelitian ini adalah untuk mengetahui pengaruh penggunaan model pembelajaran Make A Match terhadap hasil belajar IPS Geografi siswa kelas VII SMP BSS (Brawijaya Smart School) materi Hidrosfer Kota Malang. Penelitian ini merupakan penelitian eksperimen semu (Quasi Eksperiment) yang dikembangkan dengan pretest-posttest control group design. Subjek penelitian ini yakni kelas VII C sebagai kelas eksperimen dan kelas VII A sebagai kelas kontrol. Instrumen yang digunakan dalam penelitian ini adalah tes subjektif. Data pada penelitian ini terdiri dari tiga jenis, yaitu data kemampuan awal siswa, data kemampuan akhir siswa dan data hasil belajar IPS Geografi siswa. Data hasil belajar siswa diperoleh dari selisih antara skor pasca tes dan skor pra tes (gain score). Gain score tersebut selanjutnya dianalisis menggunakan uji-t dua sampel tidak berpasangan (Independent-Samples t-test) yang diselesaikan dengan bantuan SPSS 14.00 for Windows. Hasil penelitian ini menunjukkan bahwa rata-rata hasil belajar kelas eksperimen lebih tinggi daripada kelas kontrol, yakni 21,51 untuk kelas eksperimen dan 19,27 untuk kelas kontrol. Hasil analisis uji-t menunjukkan bahwa nilai signifikansi sebesar 0,001 < α (0,05) sehingga dapat disimpulkan bahwa ada pengaruh penggunaan model pembelajaran Make A Match terhadap hasil belajar IPS Geografi siswa kelas VII SMP BSS (Brawijaya Smart School) Kota Malang. Berdasarkan hasil penelitian ini, disarankan bagi guru IPS Geografi untuk menggunakan model pembelajaran Make A Match sebagai variasi model pembelajaran karena dapat berpengaruh terhadap hasil belajar siswa. Bagi peneliti lain, penelitian ini hanya terbatas pada materi Hidrosfer, untuk itu disarankan untuk dilakukan pada materi yang lain.

Manajemen pembelajaran dwi bahasa pada bilingual playgroup Dunia Anak Kota Probolinggo / Evi Susanti


Kata Kunci : manajemen pembelajaran, dwi bahasa, playgroup Manajemen program pembelajaran adalah segala usaha pengaturan proses belajar mengajar dalam rangka terciptanya proses belajar mengajar yang efektif dan efisien (Aqib, 2009:68). Tujuan manajemen pembelajaran Pendidikan Anak Usia Dini adalah untuk menciptakan proses belajar mengajar yang dengan mudah direncanakan, diorganisasikan, dilaksanakan, dan dikendalikan dengan baik, sehingga dapat berlangsung secara efektif dan efisien. Perbedaan antara manajemen pembelajaran pada Bilingual Playgroup dan Playgroup konvensional yaitu pada bahasa pengantar yang digunakan. Bilingual Playgroup menggunakan dua bahasa pengantar yaitu Inggris - Indonesia. Tujuan penelitian ini mendeskripsikan tentang (1) perencanaan; (2) pengorganisasian; (3) pelaksanaan; (4) penilaian; (5) hambatan-hambatan dalam manajemen pembelajaran dwi bahasa; dan (6) alternatif pemecahan yang dilakukan. Penelitian ini dilakukan dengan menggunakan pendekatan kualitatif, yaitu suatu metode penelitian yang menghasilkan data deskriptif berupa kata-kata, dengan memaparkan dan mengolah data. Jenis penelitian ini adalah studi kasus yang dipilih satu kasus pada satu objek penelitian, yaitu Bilingual Playgroup Dunia Anak Kota Probolinggo. Peneliti sendiri yang berperan sebagai instrumen utama dalam penelitian ini, dengan subjek penelitian yaitu Kepala Bilingual Playgroup Dunia Anak, guru dan orang tua. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian pada saat wawancara, tindakan yang dilakukan oleh subjek penelitian, dan dokumen lembaga yang berkaitan dengan pembelajaran dwi bahasa di Bilingual Playgroup Dunia Anak. Setelah diperoleh data dari hasil penelitian kemudian dilakukan pemeriksaan keabsahan data dengan menggunakan metode trianggulasi. Kesimpulan dari penelitian ini menunjukkan bahwa manajemen pembelajaran dwi bahasa pada Bilingual Playgroup Dunia Anak Kota Probolinggo, meliputi tahapan-tahapan yaitu perencanaan, pengorganisasian, pelaksanaan, penilaian, hambatan-hambatan dalam pelaksanaan, dan alternatif dalam mengatasi hambatan. (1) Perencanaan pembelajaran dwi bahasa meliputi penyusunan rencana pembelajaran tahunan, rencana pembelajaran bulanan, rencana pembelajaran mingguan, dan rencana pembelajaran harian. (2) Pengorganisasian meliputi pembagian tugas mengajar guru dan pengelompokan siswa; pengelompokan siswa dibagi menjadi kelas beginner dan kelas intermediate berdasarkan usia, karakter, dan kemampuan; dua orang guru mengajar di kelas beginner dan satu orang guru yaitu kepala sekolah mempunyai tugas mengajar di kelas intermediate. (3) Pelaksanaan pembelajaran dwi bahasa meliputi outdoor playing and center preparation (bermain di luar dan persiapan sentra), body movement (senam), greeting and sharing time (salam dan anak berbagi kue), pre teaching and whilst teaching (pra kegiatan materi dan kegiatan materi), playing centers (bermain di sentra), washing hand and meal time (mencuci tangan dan makan siang), post teaching (sesudah kegiatan materi), closing and praying (penutup dan berdoa); metode yang digunakan adalah metode BCCT (sentra dan lingkaran). (4) Penilaian pembelajaran dwi bahasa yang dilakukan yaitu penilaian berdasarkan proses dan hasil yang meliputi penilaian harian, bulanan, dan semester; selain upaya untuk memacu semangat belajar anak juga diberlakukan pemberian reward meliputi reward bintang lima, reward star of the week, serta reward yang diberikan tiap akhir semester pada semua anak berupa poster yang digulung dengan indah. (5) Hambatan dalam manajemen pembelajaran dwi bahasa meliputi: ketersediaan materi dengan karakter rombongan belajar, media pembelajaran; usia dan karakter anak yang beragam, serta kualitas guru yang juga beragam; karakter dan atensi anak yang berbeda dalam kegiatan pembelajaran, serta keikutsertaan orang tua. (6) Alternatif pemecahan yang dilakukan meliputi menekankan dan memotivasi guru untuk bisa berkreativitas dalam memenuhi semua kebutuhan pembelajaran; guru harus bisa mengikuti pertumbuhan dan perkembangan anak semua tingkat usia, melakukan evaluasi dalam pengelompokan anak berdasarkan karakter dan kemampuan anak; memberikan pelatihan-pelatihan bagi guru baik pelatihan yang dikirim oleh sekolah sendiri dan juga pelatihan yang direkomendasikan oleh Departemen Pendidikan Nasional; mengadakan buku penghubung dan memberikan copy learning material kepada orang tua untuk mengikutsertakan orang tua dalam kegiatan pembelajaran dwi bahasa anak, khususnya di rumah sehingga ada kelanjutan dari proses pembelajaran di sekolah. Berdasarkan hasil penelitian ini, dapat disarankan bagi (1) Kepala Bilingual Playgroup Dunia Anak, sebaiknya dapat memenuhi kebutuhan jumlah guru sesuai pagu yang telah ditetapkan oleh Departemen Pendidikan Nasional agar kegiatan pembelajaran dapat berjalan secara efektif; (2) Guru, seyogyanya terus belajar mengenai pertumbuhan dan perkembangan anak, khususnya anak yang berkebutuhan khusus agar dapat memberikan perhatian dan pengajaran yang maksimal pada anak, serta meningkatkan profesionalisme guru; (3) Orang tua, hendaknya lebih berperan serta dalam pembelajaran dwi bahasa anak di rumah sehingga ada kelanjutan dari proses pembelajaran di sekolah karena bahasa merupakan proses pembiasaan; (4) Ketua Jurusan Administrasi Pendidikan, hasil penelitian ini dapat digunakan sebagai referensi untuk mengembangkan ilmu manajemen pendidikan khususnya dalam lingkup pendidikan nonformal seperti playgroup sebagai sekolah yang menggunakan pembelajaran dwi bahasa; (5) Peneliti lain, hasil penelitian ini dapat dijadikan salah satu acuan untuk mengembangkan penelitian yang sejenis pada berbagai aspek lain yang berbeda.

Kemampuan menyimak cerkak siswa kelas VIII SMP Negeri 1 Karangploso tahun ajaran 2010/2011 / Sesillya Devi Libdianti


Kata Kunci: menyimak, Cerkak Menyimak merupakan salah satu sarana ampuh dalam menjaring informasi. Pembelajaran bahasa Jawa di SMP terutama Cerkak (cerita cekak) sebagai salah satu materi kesastraan masih kurang mendapat perhatian. Hal ini terbukti dari sedikitnya alokasi jam pelajaran dalam pelaksanaan pembelajaran. Di SMP Negeri 1 Karangploso, pembelajaran menyimak Cerkak membutuhkan alokasi tenaga dan waktu yang lebih banyak. Satu kali pertemuan saja belum tentu cukup untuk mencapai kompetensi yang diinginkan. Penelitian ini bertujuan untuk mendeskripsikan kemampuan menyimak Cerkak siswa kelas VIII SMP Negeri 1 Karangploso, dan secara khusus tujuan penelitian ini adalah mendeskripsikan kemampuan siswa dalam menemukan tema/gagasan pokok Cerkak yang diperdengarkan, mendeskripsikan kemampuan siswa dalam menemukan amanat Cerkak yang diperdengarkan, mendeskripsikan kemampuan menyimak Cerkak dalam menemukan tokoh dan penokohan dari Cerkak yang diperdengarkan, mendeskripsikan kemampuan menyimak Cerkak dalam menemukan setting dari Cerkak yang diperdengarkan, dan mendeskripsikan kemampuan menyimak Cerkak dalam menemukan alur dari Cerkak yang diperdengarkan. Sampel dalam penelitian ini berjumlah 32 orang. Teknik analisis yang digunakan yaitu statistik deskriptif dalam rangka mendeskripsikan tentang karakteristik masing-masing variabel, kemudian dilanjutkan analisis dengan menggunakan statistik inferensial dalam rangka uji perbedaan dengan uji beda atau uji t dengan menggunakan program SPSS versi 15. Berdasarkan hasil analisis bahwa kemampuan siswa kelas VIII B SMP Negeri 1 Karangploso dalam menemukan tema/gagasan pokok Cerkak yang diperdengarkan sudah baik. Kemampuan siswa kelas VIII B SMP Negeri 1 Karangploso dalam menemukan amanat Cerkak yang diperdengarkan sudah baik. Kemampuan menyimak Cerkak siswa kelas VIII B SMP Negeri 1 Karangploso dalam menemukan penokohan dari Cerkak yang diperdengarkan sudah baik. Kemampuan menyimak Cerkak siswa kelas VIII B SMP Negeri 1 Karangploso dalam menemukan setting dari Cerkak yang diperdengarkan sudah baik. Kemampuan menyimak Cerkak siswa kelas VIII B SMP Negeri 1 Karangploso dalam menemukan alur dari Cerkak yang diperdengarkan cukup baik. Berdasarkan hasil analisis dengan menggunakan uji t menunjukkan bahwa terdapat perbedaan penilaian kemampuan menyimak Tes pilihan ganda dengan Tes isian yang dibuktikan dengan sebagian besar responden (65,6%) termasuk dalam kategori sangat baik, sedangkan untuk Tes isian sebagian besar responden (53,1%) termasuk dalam kategori baik.

Karakteristik bahasa gaul dalam akun facebook mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah Universitas Negeri Malang / Fajar Rahmadi


Kata Kunci: bahasa gaul, facebook, Mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah Universitas Negeri Malang Bahasa gaul remaja bukanlah bentuk bahasa baru. Bahasa gaul berasal dari bahasa Indonesia yang mengalami perubahan bentuk kata, interferensi baik dari bahasa daerah maupun bahasa asing, penggunaan istilah, perubahan struktur kalimat dan bentuk penulisannya (ejaan). Bahasa gaul adalah salah satu bentuk ragam bahasa nonbaku bahasa Indonesia. Tujuan penelitian ini ialah untuk memperoleh deskripsi karakteristik bahasa gaul yang digunakan dalam akun facebook Mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah Universitas Negeri Malang, khususnya tentang (1) pilihan kata (diksi), (2) bentukan dan perubahan bentuk kata, dan (3) penggunaan ejaan. Penelitian ini menggunakan metode kualitatif yang bertujuan untuk mendiskripsikan suatu kondisi apa adanya. Sumber data penelitian ini adalah “status” yang ditulis dalam sepuluh akun facebook Mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah Universitas Negeri Malang pada 01 Januari—28 Februari 2011. Data penelitian diklasifikasikan berdasarkan penggunaan (1) pilihan kata (diksi), (2) bentukan dan perubahan bentuk kata, dan (3) penggunaan ejaan. Teknik pengumpulan data dilakukan dengan (1) mengumpulkan data dari sepuluh subjek penelitian, (2) pengumpulan data dilakukan dengan teknik simak dan catat, dan (3) pendistribusian data. Ada pun tahapan analisis data yang digunakan adalah (1) mengidentifikasi data yang akan digunakan dalam penelitian, (2) kodifikasi data dan (3) data di klasifikasikan dan dideskripsikan sesuai dengan klasifikasi masing-masing data. Penelitian ini menghasilkan tiga temuan. Pertama, karakteristik bahasa gaul pada akun facebook Mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah Universitas Negeri Malang menggunakan pilihan kata (diksi) bahasa gaul. Pilihan kata atau diksi tersebut yaitu, (1) penggunaan istilah asing. (2) adanya penggunaan jargon dan slang, serta diksi yang ke (3) penggunaan kosakata prokem. Kedua, karakteristik bahasa gaul dalam akun facebook menggunakan pola bentukan dan perubahan bentuk kata yang berbeda dengan bahasa Indonesia baku. Bentukan kata dan perubahan bentuk kata pada kosakata bahasa gaul pada akun facebook Mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah ii Universitas Negeri Malang terjadi melalui enam proses, yaitu (1) afiksasi, (2) abreviasi, (3) adisi, (4) asimilasi, (5) monoftongisasi, dan (6) metatesis. Bentukan kata melalui afiksasi yang terdapat pada bahasa gaul remaja berbeda dengan afiksasi pada bahasa Indonesia baku. Proses afiksasi yang terdapat dalam bahasa gaul yaitu, (a) afiks yang dimanifestasikan dengan nasalisasi bentuk dasar (simulfiks), (b) kombinasi simulfiks dengan akhiran –in, dan (c) awalan di- + –in. Ketiga, karakteristik ejaan (tata penulisan) bahasa gaul pada akun facebook Mahasiswa Prodi Pendidikan Bahasa, Sastra Indonesia dan Daerah Universitas Negeri Malang berbeda dengan ejaan bahasa Indonesia baku dalam EYD. Perbedaan tersebut terlihat pada (1) penggunaan huruf yang berlebihan, (2) penggunaan huruf kapital yang bersifat suka-suka, (3) penulisan kata ulang yang tidak ditulis seutuhnya, dan (4) penggunaan spasi yang bersifat suka-suka. Bentuk-bentuk penulisan pada bahasa gaul remaja terkesan tidak ingin terpaku pada tata ejaan yang menurut mereka kaku dan membatasi kreatifitas dalam menulis. Berdasarkan penelitian ini, saran ditujukan bagi pengajar bahasa Indonesia untuk menggunakan hasil pembahasan penelitian ini sebagai bahan pembelajaran tentang wujud ragam bahasa nonbaku. Ragam nonbaku digunakan untuk memperkuat dan memperjelas pemahaman dan pengetahuan siswa tentang penggunaan ragam bahasa Indonesia baku. Saran bagi peneliti selanjutnya, peneliti yang berminat untuk melakukan penelitian tentang bahasa gaul, dapat menindaklanjuti dengan mengambil masalah dan sumber data yang lain. Peneliti selanjutnya disarankan untuk mengambil masalah yang menjadi cakupan karakteristik bahasa gaul, misalnya tentang struktur kalimat, penggunaan partikel atau penggunaan tanda baca pada bahasa gaul. Bagi mahasiswa Jurusan Bahasa dan Sastra Indonesia disarankan untuk lebih memerhatikan penggunaan bahasa gaul dan jangan sampai terbawa ketika diharuskan menggunakan bahasa baku. Penggunaan bahasa gaul bukan merupakan kesalahan jika digunakan pada waktu, tempat dan tujuan yang tepat.

Pengaruh pemanfaatan media internet, perpustakaan, dan media pembelajaran terhadap prestasi belajar mata pelajaran ekonomi antara siswa kelas 7 RMBI dan siswa kelas 7 reguler MTs Negeri Malang 3 / Ryan Hanggara Kusuma


Kata kunci: Media Internet, Perpustakaan, Media Pembelajaran, Kelas RMBI, Kelas Reguler, Prestasi Belajar Media internet, perpustakaan, dan media pembelajaran (audio, visual, audio-visual) merupakan jenis-jenis fasilitas belajar yang diberikan sekolah untuk menunjang pembelajaran agar siswa dapat meningkatkan prestasi belajarnya. Tujuan penelitian ini adalah mengetahui (1) Pengaruh pemanfaatan media internet, perpustakaan, dan media pembelajaran terhadap prestasi belajar mata pelajaran ekonomi siswa kelas 7 RMBI dan siswa kelas 7 Reguler MTs Negeri Malang 3, (2) Perbedaan pengaruh pemanfaatan media internet, perpustakaan, dan media pembelajaran terhadap prestasi belajar mata pelajaran ekonomi antara siswa kelas 7 RMBI dan siswa kelas 7 Reguler MTs Negeri Malang 3. Jenis penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Sampel dalam penelitian yaitu siswa kelas 7 RMBI dan kelas 7 Reguler yang diambil secara proporsional. Instrumen yang digunakan adalah angket. Analisis regresi berganda dengan variabel dummy digunakan untuk melihat pengaruh dan perbedaan pengaruh media internet (X1), perpustakaan (X2), media pembelajaran (X3), dan variabel dummy kelas (dK) terhadap prestasi belajar mata pelajaran ekonomi (Y) antara kelas 7 RMBI dan kelas 7 Reguler. Dari hasil analisis diketahui bahwa media internet, perpustakaan, dan media pembelajaran mempunyai pengaruh terhadap prestasi belajar mata pelajaran ekonomi siswa kelas kelas 7 RMBI dan siswa kelas 7 Reguler MTs Negeri Malang 3. Namun tidak ada perbedaan pengaruh media internet, perpustakan, dan media pembelajaran terhadap prestasi belajar mata pelajaran ekonomi antara kelas 7 RMBI dan kelas 7 Reguler. Bertolak dari hasil penelitian ini, diajukan saran (1) Bagi sekolah diharap memberi pemahaman kepada siswa agar memanfaatkan media internet, perpustakaan, dan media pembelajaran sebagai sumber belajar, (2) Bagi guru diharapkan lebih sering mengajak siswa untuk menggunakan internet, perpustakaan, dan media internet dalam proses belajar mengajar, (3) Bagi peneliti lain untuk meneliti faktor- faktor lain yang mempengaruhi prestasi belajar.

Pembuatan busana wanita dengan variasi opnaisel / Kurnia Suyanti


Kata Kunci: Busana, Busana Wanita, Opnaisel Busana merupakan salah satu kebutuhan pokok manusia yang dikenakan dengan tujuan untuk melindungi diri baik secara fisik, etik, maupun estetik, arti busana adalah segala sesuatu yang dikenakan dari ujung rambut sampai ujung kaki, termasuk pelengkap busana, tata rias wajah dan tata rias rambutnya. Busana wanita adalah segala sesuatu yang dikenakan oleh seorang wanita dari ujung rambut sampai ujung kaki, termasuk pelengkap busana, tata rias wajah dan tata rias rambutnya yang mendukung penampilan serta cenderung menimbulkan kesan feminin untuk menunjukkan identitas sebagai seorang wanita. Contoh busana wanita misalnya rok dan gaun. Busana kurang lengkap apabila tidak disertai dengan hiasan-hiasan atau variasi yang selaras dan seimbang. Beberapa macam hiasan yang biasanya dipakai dalam busana yaitu bordir, manic-manik, sulam pita, opnaisel, serta masih banyak lagi hiasan yang lainnya, dari berbagai macam hiasan tersebut, penulis memilih opnaisel sebagai hiasan yang akan dibahas pada penulisan tugas akhir kali ini. Pengertian dari opnaisel adalah “lipatan kain lurus vertical yang dijahit tindas sebagai variasi pada baju, lebarnya bervariasai, ada yang 0.5cm, 1cm atau menurut keinginan”. Tujuan yang ingin dicapai dalam penulisan Tugas Akhir ini adalah untuk menjelaskan proses pembuatan busana wanita dengan variasi opnaisel. Manfaat yang ingin diperoleh antara lain menambah pengetahuan mengenai pembuatan busana wanita. Proses pembuatan busana wanita dengan variasi opnaisel antara lain: pembuatan desain, pengukuran, pembuatan pola, fitting, cutting, sewing, final fitting, finishing. Biaya yang dikeluarkan sebesar Rp 96, 250. 00. Hasilnya yang diperoleh adri pembuatan busana ini adalah sebuah busana wanita dengan variasi opnaisel. Akseroris yang digunakan yaitu anting dan cincin. Berdasarkan hasil tersebut dapat disarankan bahwa perhitungan ukuran yang tepat pada pembuatan pola sangat dibutuhkan sehingga tepat saat memotong bahan, dan hasil jadi busana yang kita buat sesuai dengan desain.

Pengaruh pelatihan penalaran terhadap pemahaman teks argumentasi pada mahasiswa Program Studi Pendidikan Bahasa Indonesia Universitas Tanjungpura / Henny Sanulita


Tesis Jurusan Pendidikan Bahasa Indonesia, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. H. Dawud, M.Pd, (II) Dr. H. Nurhadi, M.Pd. Kata kunci: Penalaran. membaca pemahaman, teks argumentasi. Penalaran diperlukan dalam kegiatan membaca. Hal ini dikarenakan dalam kegiatan membaca juga melibatkan proses kognitif pembaca dalam menangkap pesan atau gagasan yang disajikan melalui tulisan. Dari hasil obsevasi terhadap sejumlah mahasiswa dan diri sendiri dalam tugas memahami teks bacaan khususnya teks argumentasi, dapat disimpulkan bahwa pemahaman teks baik literal maupun kritis bukanlah suatu yang mudah dan sederhana bahkan kerap menjadi permasalahan serius yang dapat memengaruhi prestasi akademis.. Oleh karena itu, kemampuan memahami teks argumentasi merupakan hal penting bagi mahasiswa sebuah perguruan tinggi yang kelak akan memasuki dunia kerja, yang tentunya menuntut taraf kemampuan intelektual tinggi, antara lain kemampuan berpikir abstraktif atau konseptual yang termanifestasi dalam bahasa lisan atau tulis. Masalah yang diangkat dalam penelitian ini adalah 1) Adakah pengaruh pelatihan penalaran terhadap pemahaman teks argumentasi pada mahasiswa Program Studi Pendidikan Bahasa Indonesia Universitas Tanjungpura? dan 2) Adakah pengaruh pelatihan penalaran terhadap pemahaman kritis teks argumen-tasi pada mahasiswa Program Studi Pendidikan Bahasa Indonesia Universitas Tanjungpura? Penelitian ini menggunakan rancangan eksperimen semu (quasi-experiment) yang digunakan untuk mengkaji perbedaan pemahaman teks argumentasi pada mahasiswa yang diberi pelatihan penalaran dengan mahasiswa yang diberi pelatihan secara konvensional. Penelitian ini menggunakan dua variabel, yaitu variabel bebas dan variabel terikat. Variabel bebas dalam penelitian ini yaitu pelatihan penalaran, sedangkan variabel terikat dalam penelitian ini adalah pemahaman teks argumentasi. Sampel dalam penelitian ini adalah mahasiswa semester II Program Studi Pendidikan Bahasa Indonesia UNTAN tahun akademik 2010/2011 yang terdiri dari dua kelas. Kelas IIa dengan jumlah mahasiswa sebanyak 25 orang yang diberikan pelatihan penalaran, sedangkan IIb yang digunakan sebagai kelas kontrol, terdiri dari 24 orang mahasiswa. Jenis instrumen yang digunakan dalam penelitian ini yaitu instrumen tes pemahaman terhadap teks argumentasi. berbentuk soal pilihan ganda yang berjumlah 10 dan esai yang berjumlah 8 soal. Dari 10 soal pilihan ganda tersebut, 5 soal digunakan untuk mengukur pemahaman literal dan 5 soal digunakan untuk mengukur pemahaman kritis, sedangkan dari 8 soal esai 4 soal digunakan untuk mengukur pemahaman lieral dan 4 soal untuk mengukur pemahaman kritis.. Data di-kumpulkan dengan menggunakan tes. Tes sebelum perlakuan eksperimen (prates), digunakan untuk mendapatkan data tentang pemahaman mahasiswa sebelum diberikan pelatihan penalaran. Tes setelah perlakuan eksperimen (pascates), digunakan untuk mendapatkan data tentang pemahaman mahasiswa setelah eksperimen dilakukan. Data yang telah dikumpulkan dari pngukuran variabel terikat dan variabel bebas dianalis dengan menggunakan t-test Sebelum data dianalisis, terlebih dahulu dilakukan uji prasyarat, meliputi uji normalitas dan homogenitas varians. Berdasarkan hasil analisis dengan menggunakan uji t, pelatihan penalaran berpengaruh secara signifikan dalam meningkatkan pemahaman teks argumentasi pada mahasiswa Program Studi Pendidikan Bahasa Indonesia Universitas Tan-jungpura. Berdasarkan hasil analisis data tersebut, diperoleh dua simpulan hasil penelitian sebagai berikut. Pertama, ada pengaruh pelatihan penalaran terhadap pemhaman literal teks argumentasi pada mahasiswa. Pelatihan penalaran lebih efektif dalam meningkatkan pemahaman literal teks argumentasi dibandingkan pelatihan secara konvensional dengan taraf signikansi 0,001. Berdasarkan hasil tersebut, dalam penelitian ini Ho ditolak dan Ha yang diajukan dalam penelitian diterima (terbukti), dan kedua, ada pengaruh pelatihan penalaran terhadap pe-mahaman kritis teks argumentasi pada mahasiswa. Pelatihan penalaran lebih efektif dalam meningkatkan pemahaman kritis teks argumentasi dibandingkan pelatihan secara konvensional dengan taraf signikansi 0,000. Berdasarkan hasil tersebut, dalam penelitian ini Ho ditolak dan Ha yang diajukan dalam penelitian diterima (terbukti),

Pelestarian nilai-nilai kearifan lokal dalam seni tari gelipang sebagai budaya daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang / Resi Lestari


Kata Kunci: Pelestarian Nilai-Nilai Kearifan Lokal, Seni Tari Gelipang, Budaya Daerah Gelipang adalah suatu bentuk tarian tradisional yang menggambarkan sosok seorang kesatria dengan membawa senjata lengkap berjalan dengan tegapnya serta melakukan gerakan seolah-olah seperti prajurit. Tari Gelipang biasanya dipentaskan apabila ada orang yang mempunyai hajat, misalkan perkawinan, khitanan dan lain-lainnya. Tari gelipang merupakan kesenian budaya Daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang yang hampir punah dan harus di dilestarikan karena mempunyai nilai-nilai kearifan lokal dalam setiap gerakannya. Penelitian ini bertujuan untuk mengetahui; (1) Asal-usul seni tari gelipang sebagai budaya daerah di desa Karangsari Kecamatan Sukodono Kabupaten Lumajang; (2) wujud gerak seni tari gelipang sebagai budaya Daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang; (3) Nilai-nilai kearifan lokal apa yang terkandung dalam gerak seni tari gelipang sebagai budaya daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang; (4) Persepsi masyarakat terhadapa seni tari gelipang sebagai budaya daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang; (5) Kendala dan bagaimana upaya mengatasi kendala pelestarian seni tari gelipang sebagai budaya daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang Metode yang digunakan dalam penelitian ini adalah menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Teknik pengumpulan data yang digunakan adalah observasi, wawancara dan dokumentasi. Jadi data yang digunakan berasal dari hasil observasi dari penari tari gelipang di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang, hasil observasi, wawancara dari para informan, dan temuan peneliti di lapangan. Hasil penelitian menunjukkan (1) Asal-usul seni tari gelipang sebagai budaya daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang yaitu sudah ada sekitar tahun 1912. Kandar ini adalah seorang pencetus pertama kali berdirinya Seni Kalipang atau Gelipang, tahun 1937. Kandar membentuk suatu perkumpulan dengan tujuan awal menyusun kekuatan melawan penjajah. (2) Wujud atau bentuk seni tari gelipang sebagai budaya daerah di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang; Tahap-tahap dalam tari Gelipang yaitu; (a) Bagian Awal, (b) Bagian Inti, (c) Bagian Akhir. (3) Nilai-nilai kearifan lokal yang terkandung dalam gerak seni tari gelipang bagi masyarakat desa Karangsari Kecamatan Sukodono Kabupaten Lumajang yaitu nilai pendidikan, nilai moral, nilai hiburan, nilai religius, nilai seni, nilai i       ii   perjuangan, nilai pandangan hidup.(4) Persepsi masyarakat terhadapa seni tari gelipang sebagai budaya daerah di desa Karangsari Kecamatan Sukodono Kabupaten Lumajang yaitu Tari Gelipang berfungsi untuk menghibur masyarakat setempat. Kesenian tersebut harus dipertahankan dan harus dijaga kelestariannya.(5) Kendala yang ada yaitu Arus, globalisasi yaitu menimbulkan dampak yang tidak baik bagi masyarakat atau penarinya. Upaya mengatasi kendala pelestarian seni tari gelipang yaitu mengenalkan kembali seni tari gelipang kepada masyarakat dengan melakukan pelatihan di saanggar-sanggar dan sekolah dasar yang ada di Desa Karangsari Kecamatan Sukodono Kabupaten Lumajang. Berdasarkan hasil penelitian ini disarankan kepada masayarakat desa Karangsari hendakanya tetap dilestarikan. Kepada pemerintah daerah khususnya Dinas kebudayaan dan pariwisata lebih memperhatikan dan ikut serta dalam pelestarian adat yang sudah turun temurun.

Perancangan media promosi untuk relaunching Singosari Lounge Bandara Udara Juanda Surabaya / Gading Ramadhani


Kata Kunci: Perancangan, Promosi, Relaunching, Lounge. Singosari Lounge adalah perusahaan swasta yang menyediakan tempat untuk bersantai serta ruang tunggu bagi pengunjung maupun orang yang bepergian dengan menggunakan pesawat terbang. Corporate identity dan interior design sebagai bentuk visual dan ekspresi grafis dari identitas suatu perusahaan seringkali digunakan sebagai cermin dari citra perusahaan yang hendak disampaikan kepada konsumen. Namun sayangnya hal ini kurang terorganisir dengan baik di Singosari Lounge yang berlokasi di ruang tunggu Terminal Domestik Bandara Internasional – Juanda Surabaya. Meskipun sudah berdiri cukup lama, identitas dari Singosari Lounge sendiri belum terbentuk dan melekat baik dalam benak masyarakat. Oleh karena itu perlu adanya pembaharuan dalam segala sektor yang mendukung adanya peningkatan penjualan dari Singosari Lounge termasuk diantaranya sektor desain (media komunikasi, interior design dan web design). Maka dibutuhkan perancangan visualisasi Media promosi untuk relaunching Singosari Lounge dengan menggunakan konsep ekletik (konsep yang memaduan desain tradisional dan modern) dan menghasilkan rancangan media promosi sebagai media pendukung relaunching yang mampu membangun brand awareness dan lebih mengangkat citra Singosari Lounge daripada sebelum dilakukan relaunching di ulang tahun perusahaan yang ke 11. Metode perancangan yang dipakai adalah perancangan prosedural yang menerangkan langkah-langkah yang dilakukan untuk menghasilkan produk, diawali dari penulisan latar belakang, pengidentifikasian tujuan, dilanjutkan dengan pengumpulan data, perancangan konsep hingga pembuatan karya final. Data yang menjadi acuan adalah data-data yang bersumber dari hasil survei, wawancara, dan buku-buku literatur. Kesimpulan perancangan ini adalah merancang media promosi untuk relaunching Singosari Lounge meliputi aplikasi corporate identity, interior design dan web design sebagai media promosi dengan bentuk visualisasi yang sesuai dengan ciri khas warna, ilustrasi, fotografi, tipografi serta media yang digunakan. Saran penulis adalah dalam me-relaunching Singosari Lounge, bukan hanya memperhatikan segi visualisasi namun juga memperhatikan konsep yang akan dirancang, sehingga tujuan dari relaunching Singosari Lounge itu sendiri dapat terwujud.

Perancangan media promosi Rumah Sakit Umum Daerah "Kanjuruhan" Kepanjen / Gendhy Dwi Harlyan


Kata kunci :Perancangan, Media Promosi, RSUD “Kanjuruhan”Kepanjen. RSUD “Kanjuruhan”KepanjenadalahRumahSakitUmumDaerah Kabupaten Malangdibangununtukmemenuhikebutuhanmasyarakatdalampelayanankesehatan. AdanyaRSUD“Kanjuruhan” Kepanjeninidiharapkanmasyarakatsekitarakanterbantudalammemperolehkemudahanpelayanankesehatan.Agar masyakaratpercayadantertarikuntukdatangke RSUD “Kanjuruhan”Kepanjen, makadiperlukanpromosidengan media promosi yang tepat agar RSUD “Kanjuruhan”Kepanjendapatmenjadipilihanutamabagimasyarakat. Tujuanperancanganmediapromosiiniadalahuntukmenghasilkansebuahsaranayang memberikaninformasikepadaaudiencetentangkeunggulan-keunggulandanfasilitas RSUD “Kanjuruhan”Kepanjen.Dalamprosedurperancangandipaparkanlangkah-langkahprocedural yang ditempuhdenganmenetapkanlangkah-langkah yang harusdiikutiuntukmenghasilkanproduk yang beruparancangan media, langkah-langkahdalammetodeperancanganmeliputi (1) perumusanmasalah, (2) pengumpulandananalisis data, (3) penetapankonsepperancangandan (4) program perancangan. HasildariperancanganiniberupaIklanTelevisi, Iklan Koran, DesainBaliho, Poster, Brosur, Flyer, dan X-banner diharapkanmampumemberikanmasukanuntukdapatmengoptimalkanpenggunaan media komunikasi visual sebagai media promosi yang efektifdanefisienuntukpencitraandanmenanamkanbrand imagedalambenak target audien.

Pemanfaatan komoditas apel (Malus Sylvestris Mill Famili Rosaceae) untuk bahan dasar pembuatan sale apel dengan proses pengasapan / Devi Indriani


Kata Kunci: Sale, Buah Apel, Pengasapan, dan Pengeringan, Uji Hedonik. Sale merupakan produk makanan yang dibuat dengan proses pengeringan dan pengasapan. Sale yang dikenal masyarakat umum adalah sale yang terbuat dari pisang. Pada kesempatan kali ini akan di buat sale yang berbahan dasar apel, apel dijadikan sale dengan tujuan menambah variasi pemanfaatan buah apel yang jumlahnya berlimpah. Apel yang digunakan untuk membuat sale apel adalah apel manalagi, untuk membuat sale apel teknik yang digunakan adalah pengasapan. Pengasapan yang digunakan adalah pengasapan panas dengan lama pengasapana 1-3 jam. Bahan bakar yang digunakan adalah tempurung dan sabut kelapa. Untuk penyelesaiannya dilakukan pengeringan dengan menggunakan oven, lama pengeringannya 3-4 hari, suhu yang digunakan ± 100ºC. Jenis laporan ini adalah penelitian uji kesukaan terhadap sale apel. Adapun kriteria yang diuji dari segi warna, aroma, rasa, dan tekstur. Hasil uji kesukaan menunjukkan bahwa responden menyukai sale apel, dilihat dari segi warna 34,4%, responden yang menyukai aroma dari sale apel 71,1%, responden yang menyukai rasa dari sale apel 42,2%, dan responden yang menyukai tekstur dari sale apel 41,1%. Berdasarkan hasil penelitian yang telah dilakukan, disarankan bagi peneliti selanjutnya untuk mengembangkan olahan sale apel sehingga dapat menjadi peluang usaha.

Studi tentang kerajinan kuningan di Central of Bronzes milik H. Istono / Basuki Rahmat


Kata Kunci : Studi kasus, Kerajinan Kuningan, Central of Bronzes Kerajinan kuningan merupakan salah satu warisan peninggalan nenek moyang yang sudah turun temurun. Sejak jaman kerajaan Majapahit dulu, kuningan banyak dipakai untuk bahan membuat alat-alat perlengkapan makan dalam kerajaan atau kaum bangsawan. Kerajinan kuningan di Central of Bronzes terbuat dari limbah kuningan yang diolah kembali menjadi barang baru yang lebih berguna dan bernilai seni tinggi. Dalam penciptaannya memperhatikan nilai fungsi serta kegunaan untuk memenuhi kebutuhan hidup sehari-hari yang sifatnya kebutuhan individu dan kebutuhan social. Sampai saat ini, kerajinan cor logam masih dipertahankan bahkan dikembangkan hingga menjadi wira usaha dan mata pencaharian penduduk setempat. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui beberapa hal, tentang desain, perkembangan desain dan pembuatan kerajinan kuningan di Central of Bronzes. Penelitian ini menggunakan pendekatan kualitatif dengan metode deskriptif. pengumpulan data di lakukan dengan menggunakan teknik wawancara dan observasi. Untuk menjaga keabsahan data, dilakukan kegiatan trianggulasi data. Tahap analisis data yang digunakan dalam penelitian ini meliputi reduksi data, penyajian data dan menarik kesimpulan/ verifikasi. Berdasarkan hasil penelitian, diperoleh tiga kesimpulan hasil penelitian sebagai berikut. Pertama, desain yang digunakan memiliki fungsi sebagai pelengkap estetik interior maupun benda pakai yang memiliki unsur hias di dalamnya. Bentuk desainnya mengambil dari bentuk-bentuk tiruan alam seperti hewan, tumbuhan dan replika benda peninggalan zaman kerajaan maupun zaman purba. Kedua, perkembangan desain kerajinan kuningan di Central of Bronzes, dipengaruhi oleh minat dan permintaan dari konsumen serta perkembangan zaman. Pada awalnya yang hanya sebatas membuat pakaian kuda, alat-alat dapur dan klintingan kini menjadi benda hias interior yang juga lebih fungsional dan estetik. Selain itu pengrajin sekarang menerima pesanan desain yang dibuat konsumen sendiri. Ketiga, proses pembuatan masih menggunakan teknik manual yang mengandalkan tenaga manusia. Mulai dari tahap pembuatan cetakan hingga finishing semuanya dikerjakan secara manual. Disarankan dari hasil penelitian ini agar pengrajin terus menggali ide-ide baru untuk menciptakan desain baru. penelitian ini perlu diadakan tindak lanjut lagi dalam penelitian yang serupa, tetapi pada sasaran yang berbeda.

Perilaku pemilih dan partisipasi politik masyarakat dalam pilkada Kabupaten Malang 2010 / Eko Wahyudi


Kata Kunci: perilaku pemilih, partisipasi politik, pilkada Perilaku pemilih merupakan bagian dari partisipasi politik karena dalam perilaku pemilih menunjukkan sikap, tingkah laku, tindakan dan keputusan politik dari seseorang. Sikap, tingkah laku, tindakan, dan keputusan politik diwujudkan dalam berbagai aktivitas mulai dari masa sebelum pemilihan (pre-election period) seperti keterlibatan dalam kampanye, partisanship, keterlibatan dalam mengawal jalannya pemilu, sampai pada proses pemilu, masa ketika pemilihan (in-election period) yaitu partisipasi dalam pemilihan (voter-turnout), perilaku memilih (voting), dan aktivitas tidak memilih (non-voting) yang di Indonesia, meskipun sesungguhnya penggunaan istilah itu sangat tidak tepat, populer dengan istilah golput. Tujuan dari penelitian ini antara lain: (1) untuk menjelaskan perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010, (2) untuk menjelaskan partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010, (3) untuk mengidentifikasi faktor yang mempengaruhi perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010, (4) untuk mengidentifikasi faktor yang mempengaruhi partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010. Penelitian ini menggunakan rancangan penelitian kualitatif dengan jenis penelitian studi kasus. Lokasi penelitian di Kabupaten Malang. Sumber data dalam penelitian ini adalah manusia dan dokumen. Teknik pengumpulan data yang digunakan adalah wawancara (interview) dan studi dokumentasi. Analisis data yang digunakan adalah model interaktif melalui tiga tahap yaitu: (1) reduksi data, (2) penyajian data, dan (3) penarikan kesimpulan. Temuan penelitian dalam penelitian ini antara lain: (1) perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010 diantaranya: (a) mendirikan kelompok pendukung pasangan calon, ikut memasang baliho calon, serta membangun posko pemenangan, (b) menggunakan pernak-pernik pasangan calon, (c) memakai kaos yang bergambarkan pasangan calon, (d) ikut mengarak calon dari kediamaannya menuju tempat digelarnya acara, (e) menempelkan beberapa stiker di mobil dan sepeda motor mereka, (f) menerima bantuan berupa sembako dan uang, (g) melakukan perusakan alat peraga, (h) mengikuti kampanye dan menghadiri acara debat calon yang disiarkan oleh stasiun televisi lokal dan swasta, (i) mengikuti penghitungan suara, (j) bertepuk tangan ketika ketika calon yang dijagokannya mendapatkan suara, (k) mengikuti suara petugas TPS dengan mengucapkan kata-kata “sah”, (l) berkumpul di posko pemenangan pasangan calon, (m) sujud syukur bersama-sama, (n) pemilih memangkas rambutnya dan melakukan syukuran dengan memotong tumpeng, (2) partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010 antara lain: (a) mengikuti sosialisasi Pilkada oleh KPUD Kabupaten Malang, (b) mengikuti perkembangan pelaksanaan Pemilihan Kepala Daerah (Pilkada) 2010 melalui media massa, (c) menjadi anggota aktif dari partai politik atau kelompok kepentingan, (d) menghadiri acara diskusi politik, (e) mengikuti kegiatan kampanye, (f) memberikan suara dengan memilih Bupati dan Wakil Bupati, dan (g) masyarakat yang menggunakan hak pilihnya sebanyak 1.112.187 orang dari jumlah Daftar Pemilih Tetap (DPT) sebanyak 1.882.452 orang atau sekitar 59,56 %, (3) faktor yang mempengaruhi perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah Kabupaten Malang 2010 antara lain: (a) loyalitas pemilih terhadap partai politik, (b) figur pasangan calon, (c) pertimbangan untung rugi atau imbalan, dan (d) keberadaan tokoh masyarakat, dan (4) faktor yang mempengaruhi partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah Kabupaten Malang 2010 diantaranya: (a) kesadaran politik dari masyarakat, (b) tingkat pendidikan, (c) keberadaan tokoh masyarakat, dan (d) rendahnya pendidikan politik masyarakat. Berdasakan hasil penelitian saran yang diajukan adalah: (1) sebaiknya sosialisasi yang dilakukan KPUD Kabupaten Malang mencakup semua golongan masyarakat, (2) sebaiknya ada kerjasama antara lembaga penyelenggara Pemilihan Kepala Daerah yaitu KPUD Kabupaten Malang, partai politik serta organisasi kemasyarakatan untuk meningkatkan pendidikan politik bagi masyarakat Kabupaten Malang, (3) perlu adanya kerjasama antara KPUD Kabupaten Malang, Panwaslu, organisasi kemasyarakatan, LSM yang bertindak sebagai pemantau pelaksanaan Pilkada untuk mengawasi pelaksanaan Pilkada, (4) sebaiknya masyarakat memanfaatkan pelaksanaan Pilkada sebagai salah satu sarana menyampaikan aspirasi dan hak politiknya serta menggunakan hati nuraninya dalam menyalurkan aspirasi untuk mewujudkan proses demokrasi di Kabupaten Malang, dan (5) sebaiknya KPUD Kabupaten Malang perlu mengadakan evaluasi mengenai pelaksanaan Pilkada Kabupaten Malang 2010 sehingga pelaksanaan Pilkada berikutnya dapat berjalan lebih baik lagi.

Kolaborasi model pembelajaran STAD (Student Teams Achievement Divisions) dengan Group Investigation (GI) untuk meningkatkan aktivitas dan hasil belajar siswa (studi pada siswa kelas XI Program Keahlian Pemasaran, mata pelajaran menata produk di SMK Negeri 1 Malang) / Da


Kata Kunci: Kolaborasi Model Pembelajaran STAD dengan Group Investigation (GI), Aktivitas & Hasil Belajar Siswa Kolaborasi Model Pembelajaran STAD dengan Group Investigation dilakukan untuk meningkatkan aktivitas dan hasil belajar siswa, menjadikan siswa lebih aktif dalam proses pembelajaran. Kolaborasi model pembelajaran STAD dengan Group Investigation merupakan variasi dalam pembelajaran agar pembelajaran tidak monoton dengan hanya menggunakan metode ceramah sehingga siswa tidak merasa bosan dan lebih termotivasi dalam belajar. Penelitian dilakukan untuk mengetahui perbandingan aktivitas dan hasil belajar sebelum dan setelah diimplementasikan kolaborasi model pembelajaran STAD dengan Group Investigation pada pokok bahasan memonitor penataan atau display produk pada siklus I dengan model pembelajaran STAD dan materi menjaga display agar sesuai dengan standar perusahaan dan perencanaan pada siklus II dengan model pembelajaran Group Investigation. Tujuan penelitian ini adalah: (1) untuk mengetahui bagaimanakah penerapan kolaborasi model pembelajaran STAD dengan Group Investigation; (2) Untuk mengetahui aktivitas dan hasil belajar siswa kelas XI sebelum dan setelah diimplementasikan model pembelajaran STAD dengan Group Investigation; (3) Untuk mengetahui hambatan beserta solusi dalam penerapan kolaborasi model pembelajaran STAD dengan Group Investigation. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang dilakukan dalam dua siklus. Setiap siklus terdiri dari beberapa tahap yaitu perencanaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian adalah kelas XI PM SMK Negeri 1 Malang. Pengumpulan data dilakukan dengan menggunakan tes, panduan observasi, format penilaian, wawancara dan angket untuk mengetahui respon siswa terhadap kolaborasi model pembelajaran STAD dengan Group Investigation. Hasil penelitian menunjukkan bahwa penerapan kolaborasi model pembelajaran STAD dengan Group pada mata pelajaran Menata Produk berjalan dengan lancar, walaupun pada saat pelaksanaan masih terdapat beberapa kekurangan. Selain itu, hasil belajar siswa juga terjadi peningkatan cara belajar. Peningkatan cara belajar siswa tersebut dapat dilihat dari antusiasme dan kerjasama siswa dalam belajar kelompok. Di samping itu, siswa tampak aktif, dalam belajar. Kemampuan siswa dalam aspek afektif pada mata pelajaran Menata Produk juga mengalami peningkatan. Dari 40 orang siswa yang menjadi subyek penelitian, sebanyak 27,5% (29 orang) sudah tuntas belajar. Sebelumnya, siswa yang tuntas di siklus I hanya 14 siswa (35%). Nilai rata-rata kelas pada aspek kognitif mengalami kenaikan, yaitu dari 65,74 di siklus I menjadi 70,41 di siklus II. Hal ini berarti terjadi kenaikan sebesar 4,67 yang berarti terjadi peningkatan meskipun hanya sedikit. Sedangkan nilai rata-rata kelas pada aspek afektif juga mengalami kenaikan. Terjadi kenaikan persentase hasil belajar aspek afektif dari siklus I ke siklus II. Di siklus I rata-rata kelas sebesar 71,34 sedangkan di siklus II sebesar 81,50. Berarti terjadi kenaikan sebesar 10,16. Adapun saran yang dapat diberikan peneliti dari penelitian yang telah dilakukan ini adalah agar pihak SMK Negeri 1 Malang tidak hanya memakai metode konvensional dalam pembelajaran sehari-hari, tetapi juga memakai metode kooperatif agar siswa lebih aktif. Berdasarkan kecenderungan peningkatan yang terjadi pada setiap siklus meskipun hanya sedikit, apabila siswa diberikan kesempatan untuk mengembangkan kompetensinya secara rutin, maka dapat diyakini kemampuannya akan bisa lebih ditingkatkan. Karena itu, untuk meningkatkan aktivitas, kreativitas, dan produktivitas berpikir siswa, pemecahan masalah dalam mata pelajaran Menata Produk perlu diberikan secara rutin dalam pembelajaran.

Perbedaan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama dan perkawinan campuran (Jawa-Madura) / Rian Hidrya W.


Kata Kunci: Jawa-Madura, Perkawinan Antarbudaya, Depresi Istri Perkawinan antarbudaya merupakan perkawinan yang kompleks, sejalan dengan hal tersebut dalam perkawinan antarbudaya akan terdapat dua karakteristik budaya yang berbeda dan memungkinkan untuk terjadi konflik. Dalam menghadapi suatu masalah memiliki kecenderungan depresi yang terdiri dari gejala emosional, kognitif, motivasional dan fisik. Tujuan penelitian ini (1) menggambarkan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama; (2) menggambarkan depresi istri bersuku Jawa pada perkawinan berlatar belakang perkawinan campuran (Jawa-Madura); (3) mengetahui perbedaan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama dan perkawinan campuran (Jawa-Madura). Penelitian ini menggunakan metode kuantitatif dengan desain deskriptif dan komparatif. Subjek penelitian terdiri dari 30 istri bersuku Jawa pada perkawinan sama suku dan 30 istri bersuku Jawa pada perkawinan campuran (Jawa-Madura) di Malang dan Situbondo dengan menggunakan teknik aksidental. Penelitian ini menggunakan instrumen Beck Depression Inventory (BDI) dengan reliabilitas 0,93. Hasil penelitian menunjukkan (1) Skor mean depresi istri bersuku Jawa pada perkawinan sama suku sebesar 4,97. Depresi istri bersuku Jawa pada perkawinan sama suku yang teridentifikasi depresi minimal sebanyak 26 orang (86,67%), depresi ringan sebanyak 3 orang (10%), dan depresi sedang sebanyak 1 orang (3,33%). (2) Skor mean depresi istri bersuku Jawa pada perkawinan campuran (Jawa-madura) sebesar 13,50 dan depresi istri bersuku Jawa pada perkawinan campuran (Jawa-Madura) yang teridentifikasi depresi kategori minimal sebanyak 18 orang (60%), depresi ringan sebanyak 4 orang (13,33%), depresi sedang sebanyak 6 orang (20%), dan depresi berat sebanyak 2 orang (6,67%). (3) Berdasarkan analisis komparatif diperoleh hasil skor U = 197,500 Sig 0,000 < 0,05 hal ini berarti terdapat perbedaan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama dan perkawinan campuran (Jawa- Madura). Disarankan (1) untuk pasangan yang melakukan perkawinan campuran sebaiknya memahami kebiasaan dan mengetahui budaya pasangannya dengan cara membaca berbagai buku mengenai budaya pasangannya, selain itu bisa juga melakukan konsultasi perkawinan, agar masalah dapat terselesaikan dengan tepat. (2) Untuk penelitian selanjutnya diharapkan menggunakan metode kualitatif agar dapat mendeskripsikan aspek-aspek dengan lebih jelas. Jika menggunakan metode kuantitatif, diharapkan memperluas subjek penelitian agar hasil penelitian yang diperoleh menjadi lebih variatif dan lebih akurat.

Studi daerah rawan kecelakaan lalu lintas jalur Karanglo-Purwosari / Yudha Sucianto


Kata kunci: rawan kecelakaan, lalu lintas. Jalan raya jalur Karanglo (Malang)-Purwosari (Pasuruan) sebagai jalan arteri primer harus sebanding dengan jumlah kendaraan yang lewat, sehingga beban lalu-lintas tidak menjadi menumpuk dari bermacam-macam tipe kendaraan dan berujung pada keselamatan lalu lintas. Lokasi rawan kecelakaan adalah suatu lokasi dimana angka kecelakaan tinggi dengan kejadian kecelakaan berulang dalam suatu ruang dan rentang waktu yang relatif sama yang diakibatkan oleh suatu penyebab tertentu. Penelitian ini merupakan penelitian deskriptif kuantitatif, yang akan menggali data mengenai kecelakaan lalu lintas disepanjang jalur Karanglo-Purwosari dengan mengutip data kepolisian dan survei lalu lintas di jalan raya. Selain itu tujuan yang ingin dicapai yaitu untuk mengetahui gambaran kondisi dan lokasi rawan kecelakaan, serta nantinya diharapkan dapat digunakan untuk kebijakan instansi terkait. Hasil penelitian ini menunjukkan bahwa pada kurun waktu tahun 2008 sampai dengan 2010, terdapat 326 kali kecelakaan yang mengakibatkan 432 luka ringan, 16 luka berat, dan 122 meninggal dunia pada usia terbanyak 31-40 tahun (24,39%). Kecenderungan kecelakaan terjadi pada hari Sabtu (17,48%), bulan April (11,87%), antara jam 06.00-12.00 (36,8%). Tabrakan samping- samping berpeluang (38,96%) sebagai kecelakaan ganda (64,11%) dengan melibatkan kendaraan terbanyak yaitu sepeda motor (57%) pada cuaca yang cerah (74,54%). Disamping itu kerugian material yang ditimbulkan mencapai Rp. 440.445.000,-. Selain itu berdasarkan hasil perhitungan angka Upper Control Limmit (UCL) = 45,529 dapat ditentukan posisi blackspot dan blacksite berada pada STA 14 + 000 s/d 15 + 000 (KM 67-66) AR/FR = 60,62/47,38, STA 16 + 000 s/d 17 + 000 (KM 65- 64) AR/FR = 128,82/124,55, dan STA 18 + 000 s/d 19 + 000 (KM 63-62) AR/FR = 70,09/48,31. Dimana penentuan patok KM adalah arah menuju kota Surabaya dari titik awal stationing pada KM 81 SBY (pertigaan Karanglo). Berdasarkan hasil penelitian ini, dapat disarankan agar dilakukan penambahan pos jaga pada titik rawan. Terlebih lagi pemberian jalur khusus sepeda motor serta pembinaan cara berkendara yang baik. Selain itu penyempurnaan sistem identifikasi dan rekam kecelakaan juga perlu dilakukan, agar tercipta dan terjaga keselamatan lalu lintas.

Pengembangan kartu kuartet sebagai media pembelajaran kemahiran berbicara bahasa Arab bagi siswa kelas XI Madrasah Aliyah / Jumiati


Kata Kunci: kartu kuartet, pembelajaran kemahiran berbicara, MA Bahasa Arab merupakan mata pelajaran wajib di madrasah, mulai tingkat dasar sampai tingkat menengah. Untuk menjadikan siswa menyerap, memahami, serta menguasai materi bahasa Arab diperlukan usaha yang terencana dan sistematik. Salah satu upaya yang dapat dilakukan adalah dengan mengembangkan media pembelajaran untuk menarik minat siswa agar lebih menyukai pelajaran bahasa Arab. Media Kartu Kuartet sebagai media pembelajaran kemahiran berbicara dirancang dengan tehnik permainan, dan dapat memberikan suasana belajar yang menyenangkan serta meningkatkan semangat siswa. Cara menggunakannya sangat mudah, sehingga membuat siswa senang bermain sambil memikirkan jawaban dari berbagai pertanyaan dalam permainan edukatif ini. Karena pada saat siswa melakukan aktivitas permainan kartu kuartet siswa akan aktif bertanya jawab dan tanpa mereka sadari bahasa Arab yang mereka gunakan berangsur-angsur menjadi lebih familiar. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal yang mancakup pembuatan media kartu kuartet, tampilan produk media kartu kuartet, dan cara penggunaan media kartu kuartet. Data yang telah dikumpulkan yaitu berupa data validasi dari hasil uji ahli media dan uji materi, serta hasil validasi dari uji lapangan yaitu dari guru dan siswa kelas XI MA Nurul Ulum Malang. Data tersebut diperoleh melalui angket dan hasil dari pengisian angket tersebut dirangkum dalam bentuk tabel validasi/ tinjauan hasil penelitian. Berdasarkan hasil analisis data, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, pembuatan media kartu kuartet telah dilaksanakan melalui beberapa tahap dalam proses pengembangannya, yaitu (1) analisis kebutuhan, (2) memilih materi, (3) mengembangkan produk, (4) tahap produksi, (5) tahap validasi, (6) tahap revisi, (7) uji lapangan. Kedua, tampilan produk media kartu kuartet memiliki empat komponen yaitu tema, tema/judul, pertanyaan, 1 gambar inti yang dimaksudkan didalam pertanyaan, tiga gambar yang ukurannya lebih kecil terletak dibagian paling bawah kartu untuk menerangkan materi-materi dalam satu tema. Untuk mempermudah pengelompokan pengembang memberikan warna yang berbeda pada setiap kelompok tema. Kartu kuartet yang telah dikembangkan memiliki 8 tema dengan 4 pasang gambar pada setiap kartu. Ketiga, cara penggunaan media kartu kuartet yaitu kegiatan pendahuluan, kegiatan inti, dan kegiatan penutup. Dalam setiap tahap pembelajaran tersebut siswa tidak hanya diajarkan berbicara menggunakan bahasa Arab akan tetapi dari media kartu kuartet ini perbendaharaan kosakata yang didapatkan siswa menjadi bertambah. Berdasarkan hasil penelitian ini disarankan kepada guru mata pelajaran bahasa Arab untuk menggunakan permainan kartu kuartet sebagai sarana untuk meningkatkan motivasi belajar siswa, dan disarankan kepada pengembang selanjutnya untuk mengembangkan kartu kuartet dengan variasi, teknis permainan, dan penggunaan kemahiran berbahasa yang berbeda.

Analisis faktor yang menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi Universitas Negeri Malang / Devi Wulan Febriarto


Kata kunci: Kepuasan Mahasiswa, Pelayanan Salah satu usaha yang paling penting dalam menciptakan kepuasan pelanggan adalah melalui pemberian pelayanan yang baik. Kualitas pelayanan yang diberikan oleh perusahaan dapat menciptakan suatu persepsi positif dari pelanggan terhadap perusahaan dan menghasilkan suatu keputusan serta loyalitas pelanggan. Ada lima dimensi yang berperan besar dalam kualitas pelayanan, yaitu aspek bukti langsung (bukti fisik), keandalan, daya tanggap, jaminan, serta empati. Tujuan dari penelitian ini yaitu untuk mengetahui: (1) apa saja pelayanan yang diberikan oleh Fakultas Ekonomi dalam memenuhi kebutuhan mahasiswa, (2) faktor apa saja yang menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan Fakultas Ekonomi, (3) faktor mana yang dominan menjadi pertimbangan dalam menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi. Variabel dalam penelitian ini adalah kualitas pelayanan, dimana dibagi dalam lima subvariabel yaitu bukti fisik, keandalan, daya tanggap, jaminan, dan empati. Populasi yang digunakan adalah seluruh mahasiswa Fakultas Ekonomi yang melakukan registrasi semester gasal 2010/2011. Sampel yang diambil menggunakan teknik proportional sampling, pengambilan sampel dari setiap strata atau wilayah ditentukan seimbang atau sebanding dengan banyaknya subjek dalam masing-masing strata atau wilayah. Pengumpulan data dilakukan dengan cara memberikan kuesioner kepada responden dan mencari data dari beberapa sumber tertentu, misalnya pegawai tata usaha dan katalog Fakultas Ekonomi. Dari hasil penelitian menunjukkan bahwa (1) Kelima faktor dari variabel kualitas pelayanan menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi, (2) Faktor bukti fisik I dan Keandalan adalah faktor yang mempunyai pengaruh paling besar dalam menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi, (3) ada faktor yang sangat kurang memenuhi kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi antara lain ruangan kelas yang luas dan representative, kecepatan pegawai dalam melayani mahasiswa, sikap sopan yang ditunjukkan pegawai, dan keamanan dalam penitipan barang di perpustakaan. Dari hasil penelitian disarankan bagi Fakultas Ekonomi agar lebih terbuka dalam menerima saran dan kritik dari mahasiswa baik itu melalui pengadaan kotak saran, call center, maupun melalui saran online di website, meningkatkan keamanan baik didalam perpustakaan maupun di tempat parkir, lebih cepat dalam menanggapi keluhan dari mahasiswa, dan pegawai selalu bersikap sopan dan ramah ketika memberikan pelayanan kepada mahasiswa.

Otomatisasi penanggulangan kebakaran yang disebabkan konsleting sistem kelistrikan pada mobil / Aditya Firmansyah, Anindita Andy Sasmoko


Kata Kunci: Kebakaran, Sensor Gas MQ-9, Mikrokontroler AT89S51 Teknologi membuat segala sesuatu yang dilakukan oleh manusia agar menjadi lebih mudah. Manusia selalu berusaha untuk menciptakan sesuatu yang dapat mempermudah aktifitasnya, hal inilah yang mendorong perkembangan teknologi yang telah banyak menghasilkan alat sebagai piranti untuk mempermudah kegiatan manusia bahkan menggantikan peran manusia dalam suatu fungsi tertentu. Perkembangan kendaraan bermotor terutama kendaraan roda empat di Indonesia semakin hari semakin pesat. Hal ini tentunya membuat kejadian kecelakaan juga semakin tinggi. Akhir-akhir ini kita mendengar banyak sekali sebab terjadinya kecelakaan pada mobil antara lain terjadi karena konsleting pada sistem kelistrikan yang mengakibatkan mesin terbakar,yang tentunya sangat merugikan bagi para pemilik atau pengguna kendaraan tersebut. Salah satu teknologi yang kami buat ini adalah suatu alat yang befungsi untuk meminimalisir terjadinya kebakaran yang disebabkan oleh konsleting kelistrikan pada mobil. Bagaimana membuat alat penanggulangan kebakaran yang disebabkan oleh konsleting sistem kelistrikan pada mobil.Bagaimana sistem kerja dari alat penanggulangan kebakaran yang disebabkan oleh konsleting sistem kelistrikan pada mobil. Tujuan dalam pembuatan rancangan ini antara lain adalah untuk mengetahui bagaimana pembuatan alat dan cara kerja dari system penanggulangan kebakaran yang disebabkan konsleting sistem kelistrikan dan memperkecil resiko kebakaran saat terjadi konsleting pada mobil. Metode perancangan dari sistem ini meliputi dua perancangan yaitu: (1) Perancangan perangkat keras (hardware), (2) Perancangan perangkat lunak (Software). Perancangan hardware meliputi : (1) Perancangan sistem minimum mikrokontroler AT89S51, (2) Perancangan rangkaian sensor gas MQ-9, (3) Perancangan rangkaian relay, (4) Perancangan rangkaian valve solenoid, dan (5) Perancangan rangkaian buzzer. Sedangkan perancangan perangkat lunak (sotware) kami menggunakan bahasa pemrograman BASCOM. Kesimpulannya Alat otomatisasi ini dirancang untuk mengurangi resiko kebakaran pada mobil yang disebabkan oleh konsleting sistem kelistrikan. Dalam perencanaan alat ini penulis menggunakan sensor gas MQ-9 sebagai komponen utama berupa sensor semikonduktor yang dapat mendeteksi gas CO atau asap sebagai indikator awal akan timbulnya api. Selain itu kesimpulan lain yang didapat dari perancangan ini adalah Driver relay valve solenoid digunakan untuk mengendalikan membuka dan menutupnya katup pada valve solenoid agar fluida bertekanan yang sudah diberi tekanan dapat keluar ke objek yang terjadi kebakaran.

The perceptions of Indonesian speakers of English toward speaker's age as reflected in the choice of words / Krisnawati Lisandi


Keywords: group of age, speaker’s age, choice of words, associated words. It has been a common fact that somebody categorizes himself into a particular group through one of many media, that is language. Somebody or a group of people use language as a media, in terms of the use of definite terms or particular vocabularies within the group, in order to show their identities. Age is a group where people can decide which group they belong to, young or old group. Age is also seen as an influencing factor that has a significance toward the language use, that is in people’s choice of words. Thus, it is assumed there are some words that are associated as the vocabularies of certain group. In this study, group of age is divided into two groups, those are: Old Group and Young Group. Both groups are believed to have difference in the use or choice of words in their daily conversation. Through a quantitative method, this study used questionnaire as the instrument, and took 80 respondents from two groups of age as the subject of the study. The researcher could see the tendency of both group in selecting the word through the provied vocabularies that were believed to show the differences of age-graded words. In addition, the words had been set in the form of casual/ informal conversation. The results of the study are used to find out the answers of general research problem, that is about the perception of speakers’ age of English words, especially seen on the associated words of Old or Young group. This perception is viewed from Indonesian speakers as EFL learners. From this study, the researcher obtained the list of the most frequently occuring words among the speakers of each group of age. In casual converstion, there are 15 words that occur the most within old speakers’ conversation, while there are 18 words appear as the most used words among young speakers. Besides explaining about the words that are associated as the most frequently used words by each group, the results of the study also show the words that are used by both group and words that is called data balance in term of its balanced usage by the speakers in a group of age. From the analysis, it can be obtained a conclusion that young speakers shows such a pattern in choosing the word rather than old speakers. It has answered of how Indonesian speakers’ perspective about the associated words related with the speaker who use it. The research can conclude that within Indonesian speakers as the EFL learner, it is not significantly found a sense of speakers’ choice of words related to the difference of speakers’ age.

Penggunaan media benda konkrit untuk meningkatkan pembelajaran siswa kelas IV tentang gaya di SDN Rampal Celaket 2 Malang / Erna Juwariyah


Kata Kunci : Media Benda Konkrit, Pembelajaran IPA, HasilBelajar Pembelajaran IPA denganmenggunakanmetodeceramahmenjadikansiswasebagaisubyekbelajar yang pasifkarenahanyamendengardanmencatat, sehingga rata-rata nilai yang dicapaisiswamasih di bawahkriteriaketuntasan yang ditetapkan di KTSP. Hal inimendorongpenelitimenerapkan model pembelajarandenganmenggunakan media bendakonkrituntukmengatasipermasalahantersebut.Denganmenggunakan media bendakonkritdalampembelajaran IPA diharapkansiswadapatterlibatsecaraaktif. Penelitianinibertujuanuntukmendeskripsikan : (1) Penerapan media padapembelajaran IPA, (2) Aktivitassiswadalampembelajaran IPA, (3)hasilbelajarsiswa yang diajarkandengan media bendakonkrit, (4) tanggapan guru tentangpembelajaran IPA yang menggunakan media bendakonkrit, dan (5) tanggapansiswatentangpembelajaran IPA yang menggunakan media konkrit. Rancanganpenelitianinimenggunakanjenis PTK dengan model KemmisdanMc Taggart. Penelitianinidilaksanakandalamduasiklus.Subyekpenelitianadalahsiswakelas IV SDN RampalCelaket 2 Malang semester genaptahunajaran 2010/2011 yang berjumlah 35 siswa. Data penelitiandikumpulkanmelaluiobservasi , tes, wawancara, dandokumentasisedang data hasilbelajarsiswadiperolehdengantes yang dilaksanakanpadasetiapakhirsiklus. Hasilpenelitianmenunjukkanadanyapeningkatanpembelajaransiswakelas IV SDN RampalCelaket 2 Malang. Hal inidapatdilihatdarikeberhasilantindakan guru padasiklus I rata-rata 68% danmeningkatpadasiklus II menjadi 86%, hasilbelajarsiswajugameningkatpadasiklus I sebesar 64,70 danmeningkatpadasiklus II menjadi76,29. Aktivitassiswajugamengalamipeningkatanpadasiklus I. Aktivitassiswamengalamipeningkatan rata-rata padasiklus I adalah 53% menjadi 72% padasiklus II.Tanggapan guru pemanfaatan media sesuaidengankarakteristiksiswadandapatmeningkatkanaktivitassiswa. Tanggapansiswapenggunaan mediadapatmeningkatkanhasilbelajar. Saran dariadanyapenelitianiniadalah guru hendaknyamenggunakan media bendakonkritpadapembelajarangunamencapaihasilbelajar yang lebih baik. Selainitudiharapkanhasilpenelitianiniditindaklanjutigunamemperolehhasil yang lebihbaik.

Pengembangan buku panduan belajar mewarnai dengan bahan alam dalam pembelajaran seni rupa di TK / Windy Uswatun Chasanah


Kata Kunci: Pengembangan, Panduan Mewarnai, Bahan Alam, Seni Rupa, TK Pembelajaran seni rupa di TK identik dengan mewarnai bentuk-bentuk sederhana karena disesuaikan dengan kemampuan anak TK yang masih tahap belajar. Kegiatan mewarnai di TK selalu menggunakan crayon, spidol, dan pensil warna karena dianggap praktis dan mudah di dapat. Tetapi tidak ada salahnya, sekali waktu kegiatan mewarnai di TK menggunakan pewarna yang berasal dari bahan alam yang tersedia di sekitar tempat tinggal anak-anak. Sementara itu panduan mewarnai yang ada dan dijual di toko-toko buku adalah panduan mewarnai dengan crayon, spidol, dan pensil warna, oleh karena itu agar anak-anak dapat mengenal pewarna alam dengan baik, guru perlu mengenalkan bahan alam melalui buku panduan mewarnai. Tujuan dari pengembangan ini adalah untuk menghasilkan buku panduan belajar mewarnai dengan bahan alam dalam pembelajaran seni rupa mewarna bentuk-bentuk sederhana di TK. Dalam pengembangan ini akan dikembangkan model pengembanngan prosedural sebagai dasar pengembangan produk. Model pengembangan seperti yang dijelaskan di atas. Selain menghasilkan produk pengembangan prosedural juga menghasilkan komponen-komponen produk yang akan dikembangkan serta keterkaitan antara komponen tersebut. Langkah-langkah tersebut antara lain: Studi pustaka, survey lapangan, penyusunan draft produk, uji coba kelompok kecil, revisi, dan produk siap digunakan. Hasil validasi subjek ahli menyatakan buku valid dan dapat digunakan meskipun ada sedikit revisi atau perbaikan pada bagian-bagian tertentu. Sedangkan hasil penelitian pengembangan ini menunjukan produk buku diterima dan mendapat respon baik dari guru-guru yang menjadi subjek penelitian. Bahkan 88% responden akan mencoba menerapkan isi yang terkandung dalam Buku Panduan mewarnai dengan bahan alam ini. Tanggapan yang baik juga ditunjukan anak yang mengikuti kegiatan belajar mewarnai dengan bahan di TK 2 Mei 1 salah satu TK di kecamatan Sempu, Banyuwangi, yang begitu antuas dan semangat dalam kegiatan mewarnai dengan bahan alam. Kegiatan mewarnai dengan bahan alam memang sedikit sulit tapi akan menyenangkan bagi anak. Demi kelancaran kegiatan mewarnai ini ada beberapa saran yaitu memilih bahan alam yang mudah didapat, memahami isi buku panduan sehingga mengurangi kesulitan dalam pembelajaran, dan memilih bahan alam yang tidak meninggalakan noda pada baju anak untuk menjaga kebersihan dan protes dari orang tua. Upaya penyebarluasan buku panduan ini dapat dilakukan melalui IGTKI (Ikatan Guru TK republik Indonesi) dan melalui jurnal ilmiah. Hal ini dikarenakan karya ilmiah yang berhubungan dengan pewarna alam masih sedikit dan perlu untuk dilakukan pengembangan lebih lanjut untuk tambahan ilmu pengetahuan.

Peningkatan hasil belajar PKn melalui model deep dialogue/critical thinking pada siswa kelas V di SDN Arjowilangun 07 Kalipare Kabupaten Malang / Ike Wahyu Puspita Dewi


Kata kunci: Pembelajaran Terprogram, Hasil Belajar, IPS Hasil pengamatan pratindakan menunjukkan terdapat beberapa permasalahan dalam pelaksanaan pembelajaran IPS pada siswa kelas V SDN Boro Kec. Kedungwaru Kab. Tulungagung yaitu: (1) pelaksanaan pembelajaran menggunakan model pembelajaran konvensional yang tidak memperhatikan perbedaan yang ada pada setiap siswa, (2) pelaksanaan pembelajaran didominasi guru, (3) nilai rata-rata hasil belajar siswa adalah 58,08, (4) siswa yang mencapai hasil belajar di atas KKM sebanyak 7 siswa atau 28% dari 25 siswa. Penelitian ini bertujuan (1) untuk mendeskripsikan penerapan pembelajaran terprogram pada siswa kelas V SDN Boro Kec. Kedungwaru Kab. Tulungagung, (2) untuk mendeskripsikan peningkatan hasil belajar IPS pada siswa kelas V SDN Boro Kec. Kedungwaru Kab. Tulungagung. Pendekatan yang digunakan adalah Penelitian Tindakan Kelas (PTK) dengan model Kemmis dan Taggart. PTK termasuk penelitian kualitatif, meskipun data yang di kumpulkan bisa saja bersifat kuantitatif, di mana uraiannya bersifat deskriptif dalam bentuk kata-kata. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Hasil penelitian yang dilakukan selama dua siklus pembelajaran menunjukkan adanya peningkatan hasil belajar IPS secara bertahap. Persentase siswa tuntas pada pratindakan sebesar 28%, siklus I 68%, dan siklus II 88%. Peningkatan persentase ketuntasan dari pratindakan ke siklus I yaitu sebesar 40%, sedangkan peningkatan dari siklus I ke siklus II sebesar 20%. Berdasarkan data tersebut dapat disimpulkan bahwa penerapan pembelajaran melalui pembelajaran terprogram dapat meningkatkan hasil belajar IPS siswa. Dari hasil penelitian tersebut diharapkan agar senantiasa meningkatkan kualitas dan kinerjanya dengan menambah pengetahuan dan keterampilannya dalam menerapkan pembelajaran yang baru

Peranan anggota Dewan Perwakilan Rakyat Daerah terhadap peningkatan mutu pendidikan (studi tentang kebijakan bidang pendidikan di Kota Malang) / Dwi Putera Kusuma


Kata Kunci : peranan DPRD, kebijakan pendidikan, mutu pendidikan Pendidikan merupakan hak asasi setiap Warga Negara Indonesia dan untuk itu setiap Warga Negara Indonesia berhak memperoleh pendidikan yang bermutu sesuai dengan minat dan bakat yang dimilikinya tanpa memandang status sosial, ras, etnis, agama, dan gender. Pemerataan akses dan peningkatan mutu pendidikan akan membuat Warga Negara Indonesia memiliki kecakapan hidup (life skills), sehingga mendorong tegaknya pembangunan manusia seutuhnya serta masyarakat madani dan modern yang dijiwai nilai-nilai Pancasila. Menteri Pendidikan Nasional (Mendiknas) sebagai penanggung jawab sistem pendidikan nasional memiliki Rencana Strategis (Renstra) sebagai pedoman pengelolaan dan penyelenggaraan pendididkan bagi semua tingkatan pengelola pendidikan, mulai dari pemerintah pusat, pemerintah provinsi, pemerintah kabupaten/kota, satuan pendidikan, dan masyarakat. Dewan Perwakilan Rakyat Daerah (DPRD) merupakan lembaga perwakilan rakyat daerah yang berkedudukan sebagai unsur penyelenggara pemerintahan daerah kabupaten/kota membentuk peraturan daerah yang dibahas bersama bupati/walikota untuk mendapat persetujuan bersama yang nantinya diberlakukan kepada rakyat dengan segala ketentuan yang ditetapkan DPRD Kabupaten/Kota mempunyai fungsi: 1) Fungsi legislasi, 2) Fungsi anggaran, dan 3) Fungsi pengawasan. Tugas yang diemban oleh DPRD Kabupaten/Kota adalah: 1) Membentuk peraturan daerah yang dibahas dengan bupati/walikota, 2) Menetapkan APBD Kabupaten/Kota bersama-sama dengan bupati/walikota, 3) Melaksanakan pengawasan terhadap pelaksanaan peraturan daerah dan peraturan perundang-undangan lainnya, 4) Mengusulkan pengangkatan dan pemberhentian bupati/wakil bupati atau walikota/wakil walikota kepada Menteri Dalam Negeri melalui gubernur, 5) Memberikan pendapat dan pertimbangan kepada pemerintah daerah Kabupaten/Kota, 6) Meminta laporan keterangan pertanggungjawaban bupati/walikota. Berkaitan dengan itu, diperlukan pembahasan mengenai peranan yang dimiliki DPRD sebagai unsur penyelenggara pemerintahan daerah Kabupaten/Kota dalam upaya peningkatan mutu pendidikan bagi masyarakat. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui gambaran umum Kota Malang sebagai Kota Pendidikan, mengetahui kondisi pendidikan di Kota Malang, mendeskripsikan peranan anggota DPRD dalam kepeduliannya meningkatkan mutu pendidikan di Kota Malang, menjelaskan aspirasi masyarakat menyangkut upaya peningkatan mutu pendidikan yang ditampung oleh para anggota DPRD Kota Malang, dan mengetahui upaya yang dilakukan para anggota DPRD Kota Malang dalam rangka meningkatkan mutu pendidikan di Kota Malang. Penelitian ini menggunakan rancangan penelitian deskriptif, memberikan gejala-gejala, fakta-fakta, atau kejadian-kejadian secara sistematis dan akurat mengenai peranan Aggota DPRD Kota Malang. Pengumpulan data dilakukan dengan menggunakan instrumen angket yang diberikan kepada seluruh Anggota DPRD Kota Malang serta wawancara tidak terstruktur dengan Ketua Komisi D DPRD Kota Malang. Analisis data menggunakan tes Kolmogorov-Smirnov (K-S) untuk menguji kesesuaian peranan yang dilakukan oleh Anggota DPRD Kota Malang (distribusi observatif atau hasil pengamatan) dengan frekuensi yang diharapkan (distribusi teoretis) dalam meningkatkan mutu pendidikan. Berdasarkan hasil analisis data tersebut, diperoleh tiga simpulan hasil penelitian. Pertama, Peranan Anggota DPRD Kota Malang sebagai badan anggaran memiliki pengaruh yang signifikan terhadap kebijakan pendidikan di Kota Malang, sedangkan peranan sebagai legislasi dan pengawasan tidak memiliki pengaruh yang signifikan. Secara deskriptif, mereka memiliki peranan yang tinggi terhadap peningkatan mutu pendidikan di Kota Malang. Kedua, aspirasi masyarakat yang ditampung oleh DPRD Kota Malang terkait upaya peningkatan mutu pendidikan adalah menginginkan pendidikan murah melalui dana BOS, menuntut pendidikan gratis bagi anak tani dan buruh, serta menghentikan komersialisasi pendidikan. Ketiga, upaya yang dilakukan oleh para anggota DPRD Kota Malang dalam rangka meningkatkan mutu pendidikan adalah memperjuangkan anggaran pendidikan hingga 10% dari APBD, karena pada tahun-tahun sebelumnya tidak mencapai angka tersebut. Selain itu ada pembiayaan pendidikan tinggi Poltekom, meningkatkan BOSDA, memberikan BKSM di jenjang pendidikan menengah, memberikan bantuan khusus bagi sekolah yang jumlah peserta didiknya sedikit, menggratiskan PPDB, dan memberikan kuota 20% untuk peserta didik miskin.

Makna simbolis ragam gerak tari Lengger di Kelurahan Mangunharjo Kecamatan Mayangan Kota Probolinggo / Rizky Novitasari


Kata Kunci: Makna Simbolis, Ragam Gerak, Tari Lengger Kesenian lengger merupakan kesenian tradisional kota Probolinggo yang berfungsi sebagai hiburan. Alasan peneliti memilih kesenian lengger dikarenakan pemahaman masyarakat umum terhadap kesenian Lengger masih sebatas dengan sesuatu yang tekstual (tertulis), tetapi pada dasarnya dalam ragam gerak tari lengger mengandung makna-makna simbolis yang berkaitan dengan nilai-nilai kehidupan. Oleh karena itu penelitian ini bertujuan untuk mendeskripsikan: 1) Sejarah, 2) Bentuk penyajian dan 3) Makna simbolis ragam gerak tari lengger. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Subjek dalam penelitian ini adalah ibu Karni, ibu Lastri, ibu Sariana selaku ledhek dan Drs. Peni Priyono selaku seniman. Lokasi penelitian berada di Pasar Mangunharjo Kota Probolinggo. Prosedur pengumpulan data dilakukan dengan observasi (pengamatan), wawancara, dan studi dokumen. Sedangkan analisis data dilakukan dengan cara seleksi data (data reduction), penyajian data (data display), dan penyimpulan data (conslusion drawing). Dan untuk mengecek keabsahan data dilakukan dengan perpanjangan pengamatan peneliti, ketekunan/keajegan pengamatan peneliti, dan trianggulasi yang terdiri dari trianggulasi sumber serta trianggulasi metode. Hasil penelitian ini menunjukan bahwa: (1) Kesenian lengger dipimpin oleh Waris (alm) sejak tahun 1980-1984 dan pada tahun 1984 diwariskan pada Karni sampai saat ini, (2) Bentuk penyajian meliputi pembuka/pambuka, inti penyajian, penutup dan unsur-unsur pendukung meliputi: Iringan, tata rias, tata busana/kostum, tata lampu (lighting), tata suara (sound), properti, dan tempat pertunjukan dan, (3) Ragam geraknya meliputi gerak Majeg melambangkan kemantapan dalam melakukan gerak, egolan melambangkan keerotisan wanita, lembehan melambangkan sikap pasrah mendekatkan diri kepada Sang Khaliq, untal tali melambangkan pertentangan baik dan buruk, egol muter melambangkan manusia sedang memutari kiblat (jagad/ dunia), kipatan melambangkan kewaspadaan agar terlindung dari segala sesuatu yang kurang baik, penthangan melambangkan penyatuan tujuan dari segala penjuru, arah gerak/langkah, dan seblak sampur melambangkan gambaran dalam menghalau zat-zat yang negatif. Berdasarkan hasil penelitian ini, penulis menyarankan kepada pihak-pihak terkait untuk mensosialisasikan makna simbolis ragam gerak tari lengger kepada masyarakat, agar masyarakat tidak selalu mamandangnya negatif, serta agar kesenian lengger terus dikembangkan dan dilestarikan sebagai produk budaya.

Penerapan permainan kartu bilangan untuk meningkatkan kemampuan kognitif anak dalam mengenal konsep bilangan 1-10 kelas A di TK Dharma Wanita Persatuan 2 Karanganyar Keraton Pasuruan / Endriati


Kata kunci : Permainan kartu bilangan, kemampuan kognitif, konsep bilangan Taman kanak-kanak merupakan salah satu bentuk pendidikan prasekolah yang menyediakan program pendidikan usia dini bagi anak 4 tahun sampai memasuki pendidikan dasar. Sesuai dengan tingkat perkembangan anak usia dini lebih menyukai kegiatan pembelajaran dengan bermain. Dengan bermain anak anak-anak memiliki kesempatan untuk berekplorasi, memecahkan masalah, sehingga perkembangan kognitif anak-anak meningkat, akan tetapi kenyataannya di TK Dharma Wanita Persatuan II Karanganyar ditemukan bahwa perkembangan kognitif anak kurang berkembang secara optimal dikarenakan guru kurang kreatif dalam pembelajaran khususnya dalam memahami konsep bilangan 1-10. Oleh karena itu permaenan kartu bilangan sangat tepat digunakan sebagai alternatif pemecahan masalah, karena dengan permainan kartu bilangan anak akan mudah memperoleh pengalaman yang menyenangkan sehingga dapat secara mudah memahami tentang konsep bilangan. Penelitian ini bertujuan (1) Mendiskripsikan penerapan bermain kartu bilagan untuk meningkatkan kemampuan kognitif dalam mengenal konsep bilangan. (2) Mendiskripsikan peningkatan kemampuan kognitif anak melalui bermain kartu bilangan. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) yang terdiri dari dua siklus. Tiap siklus terdiri atas perencanaan, pelaksanaan observasi dan refleksi. Subyek penelitian ini adalah anak kelompok A di TK Dharma Wanita Persatuan II Karanganyar sebanyak 20 anak. Teknik pengumpulan data yang digunakan adalah observasi secara langsung terhadap anak. Hasil penelitian menunjukkan bahwa permainan kartu bilangan dapat meningkatkan kemampuan kognitif anak kelompok A di TK Dharma Wanita Persatuan II Karanganyar terbukti hasil rata-rata observasi anak mulai dari pratindakan (49%) dengan prosentase (15%), meningkat siklus I (63) dengan prosentase (35%) dan meningkat siklus II (83) (85%) yang terus mengalami peningkatan. Saran yang di sampaikan pada guru yaitu agar dapat menerapkan permainan kartu bilangan untuk meningkatkan kemampuan kognitif maupun kemampuan yang lain. Metode pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian lain. Sebagai bahan perbandingan, sehingga di kemudian hari menjadi lebih baik.

Pengembangan paket bimbingan ke arah penerimaan diri untuk siswa SMP / Khuriyatul Ikrimah


Kata Kunci: Paket Bimbingan, Penerimaan diri, siswa SMP Siswa SMP yang berada dalam usia remaja sering mengalami masalah terkait penerimaan diri. Penerimaan diri yang rendah akan memicu tindakan-tindakan yang tidak tepat. Kondisi ini tentu saja tidak boleh dibiarkan, apalagi remaja sebagai individu yang sedang berada dalam proses berkembang ke arah kematangan atau kemandirian. Berdasarkan hasil wawancara dengan konselor di SMP negeri 2 Turen sebagai tempat penelitian, diketahui bahwa paket bimbingan ke arah penerimaan diri belum dimiliki. Selain itu layanan bimbingan ke arah penerimaan diri juga belum diberikan oleh konselor, khususnya di kelas 7. Dari hasil analisis need assessment yang dilakukan kepada siswa kelas VII, diketahui bahwa siswa sangat membutuhkan informasi tentang penerimaan diri bentuk paket bimbingan. Tujuan pengembangan ini yaitu menghasilkan Paket Bimbingan ke Arah Penerimaan Diri yang terdiri dari 2 buah buku, yaitu buku panduan bimbingan ke arah penerimaan diri (untuk konselor) dan buku modul bimbingan ke arah penerimaan diri (untuk siswa), yang sesuai standar akseptabilitas. Prosedur pengembangan paket bimbingan ke arah penerimaan diri ini diadaptasi dari model Borg & Gall (1983). Penulis mengembangkan paket bimbingan tersebut hanya sampai pada tahap uji ahli dan uji calon pengguna produk (uji coba lapangan awal). Uji ahli dilakukan oleh 2 orang ahli BK. Uji calon pengguna produk dilakukan oleh 2 orang konselor SMP. Data yang diperoleh dari uji ahli dan uji calon pengguna produk berupa data kuantitatif dan kualitatif. Teknik pengumpulan data melalui skala penilaian akseptabilitas dan masukan/saran perbaikan yang ditulis dalam lembar saran yang tersedia. Hasil penilaian dari 2 ahli BK dan 2 calon pengguna produk terhadap draft paket bimbingan ke arah penerimaan diri, diperoleh rata-rata nilai kegunaan 3,4, rata-rata nilai kepraktisan 3,10, rata-rata nilai ketepatan 3,30, dan rata-rata nilai kemenarikan 3,15, dalam rentang nilai 0-4. Hal ini dapat disimpulkan bahwa produk yang telah dikembangkan sangat berguna, sangat praktis, sangat tepat dan sangat menarik, memiliki keberterimaan segi teoritis. Paket bimbingan ke arah penerimaan diri ini dapat digunakan oleh siswa SMP sebagai sarana memperoleh wawasan dan pengetahuan tentang penerimaan diri dengan sangat praktis, tepat, dan menarik. Paket bimbingan ini juga dapat digunakan oleh konselor SMP sebagai salah satu alternatif media dalam memberikan layanan bimbingan tentang penerimaan diri dengan sangat praktis, tepat dan menarik. Saran-saran yang diberikan oleh Penulis untuk pemanfaatan paket bimbingan ke arah penerimaan diri ini antara lain: (1) konselor sekolah tempat pengembangan, dapat memanfaatkan paket bimbingan ini sebagai salah satu media dalam memberikan layanan bimbingan tentang penerimaan diri. (2) untuk peneliti selanjutnya, perlu melakukan penelitian lebih lanjut sampai pada uji coba produk pada sasaran yaitu siswa, agar diketahui keefektifan paket bimbingan ke arah penerimaan diri yang dihasilka

Kebijakan ordonansi guru dan pendidikan Islam di Jawa Timur 1905-1942 / Akhmad Fajar Ma'rufin


Kata kunci: Ordonansi Guru, Pendidikan Islam, Jawa timur Penelitian ini didasari oleh beberapa hal mengenai pendidikan Islam masa Hindia Belanda. Penerapan Ordonansi Guru diharapkan dapat menekan timbulnya revivalis. Perubahan politik pada 1900 mempengaruhi arah kebijakan pemerintah Hindia Belanda, terutama masalah agama. Kebijakan yang semula netral terhadap agama berubah hingga mendeskritkan salah satu agama. Adanya perlawanan dari umat Islam yang dipimpin haji atau guru agama pada abad XIX hingga XX menjadi alasan pemerintah Hindia Belanda memberlakukan kebijakan Ordonansi Guru. Kebijakan ini ini merupakan pengawasan terhadap pendidikan Islam terutama mengenai administrasinya revivalisme (kebangkitan) Islam, yang kita ketahui sebelumnya Islam pernah berjaya sekitar abad XVI dengan berkembangnya kerajaan-kerajaan Islam di Nusantara seperti Aceh, Demak, Mataram, Cirebon, Banten dan sebagainya. Hal tersebut memiliki dampak tersendiri bagi pendidikan Islam terutama pesantren yang kelembagaannya saat itu non administratif dan pada abad XX perkembangannya meluas di Pulau Jawa terutama di wilayah Jawa Timur. Dampak Ordonansi Guru salah satunya yaitu nampak pada pondok pesantren di Jombang yaitu Tebuireng, pengasuhnya yakni K.H Hasyim Asy’ari sebelum melakukan pengajaran harus ijin terlebih dahulu terhadap bupati Surabaya, hal tersebut tentunya mempersulit siar dari seorang guru agama dan pada akhirnya muncul penentangan terhadap Ordonansi Guru oleh organisasi NU yang berbasis di Jawa Timur. Berawal dari uraian diatas masih banyak hal yang dapat digali dan dikaji. Namun pokok tulisan ini diarahkan pada rumusan masalah sebagai berikut. Pertama, Bagaimana Pendidikan Islam masa pemerintahan Hindia Belanda. Kedua, Apa latar belakang perumusan Ordonansi Guru (1905-1942). Ketiga, Bagaimana Dampak Ordonansi Guru bagi pendidikan Islam di Jawa Timur (1905-1942). Tulisan ini merupakan kajian historis maka metode yang digunakan adalah metode sejarah. Metode sejarah meliputi beberapa langkah: pemilihan topik, heuristik, kritik, interpretasi, dan historiografi dengan menggunakan pendekatan kualitatif. Disamping itu melalui wawancara dan mencermati tradisi lisan yang berkembang dikalangan pondok pesantren, kekurangan sumber tertulis bisa diatasi. Hasil penelitian dan pembahasan menunjukkan bahwa (1) Pendidikan Islam di Jawa pada abad XIX hingga XX yakni pesantren mengalami perkembangan yang pesat, khususnya di wilayah Jawa Timur. Meski berada diatas tekanan dan pengawasan pemerintah Hindia Belanda, banyak pesantren besar yang lahir pada abad XX seperti pesantren Tebuireng, Pesantren Tambak Beras, dan Pesantren Gontor dan sebagainya; (2) Latar belakang diberlakukannya Ordonansi Guru yaitu akibat banyak timbulnya perlawanan berbasis tarekat yang dipimpin oleh Haji dan guru agama pada abad XIX hingga abad XX. Ordonansi guru 1905 mewajibkan guru agama meminta izin kepada bupati sebelum mengajar dan diubah pada 1925; (3) Ordonansi Guru memiliki dampak terhadap guru agama dan pesantren. Kebebasan guru agama dalam siar agama menjadi terhambat sedangkan bagi pesantren ordonansi ini tidak mudah dijalankan karena pesantren memiliki kelemahan dalam hal administrasi namun hal ini berdampak positif terhadap perbaikan administrasi pondok pesantren di Jawa Timur yang dipelopori oleh Tebuireng dengan dibentuknya sistem madrasah atau klasikal. Berlakunya Ordonansi Guru menimbulkan reaksi agar peraturan ini dihapuskan. Penentangan ini muncul dari organisasi Islam seperti SI, Muhammadiyah, dan NU. Khusus di Jawa Timur reaksi penentangan yang dilakukan oleh NU yang notabene anggotanya adalah orang-orang dari kalangan pesantren di Jawa Timur. Jadi dapat dikaitkan bahwa pondok pesantren di Jawa Timur juga ikut menentang Ordonansi Guru ini. Berdasarkan penelitian ini, terdapat beberapa saran: (1) Berkenaan dengan pendidikan Islam yakni pesantren diharapkan mampu bertahan dan eksis di era modern ini serta terus membenahi kekurangan terutama pada aspek administrasi. Walaupun kini sudah cukup baik namun tetap perlu adanya inovasi dan kedisplinan dalam menegakkannya.(2) Di harapkan bagi peneliti selanjutnya dapat mengembangkan penelitian ini terutama yang berkaitan dengan pendidikan Islam yakni pesantren. Banyak ruang kosong mengenai Ordonansi Guru yang masih dapat dikaji lebih lanjut dengan diadakannya penelitian yang lebih fokus pada pondok pesantren tertentu. Sekiranya penelitian tersebut berguna khususnya bagi pengembangan pesantren dimasa-masa mendatang.

Profil kader Pos Pelayanan Terpadu (Posyandu) Kecamatan Jombang Kabupaten Jombang / Asif Nizaruddin


Kata Kunci: Profil, Kader Posyandu, Jombang Posyandu merupakan salah satu bentuk peran serta masyarakat dalam bidang kesehatan. Keberhasilan Posyandu tidak lepas dari kerja keras kader yang dengan sukarela mengelola Posyandu di wilayahnya masing-masing. Disisi lain Peserta Posyandu ternyata masih banyak yang tidak hadir dalam kegiatan Posyandu, hal ini dibuktikan dengan presentase pencapaian peserta KB di Kecamatan Jombang yang menempati urutan ke-19. Agar menarik minat peserta Posyandu untuk datang ke kegiatan Posyandu maka dibutuhkan pelatihan atau training kader Posyandu. Pelatihan atau training yang akan diadakan dapat lebih maksimal jika telah diketahui informasi tentang kader Posyandu. Berkaitan dengan itu, maka diperlukan pembahasan mengenai profil kader Posyandu. Penelitian ini bertujuan untuk mengetahui karakteristik kader Posyandu, pelaksanaan tugas kader Posyandu, kategori profil kader Posyandu, dan respon peserta posyandu terhadap kinerja kader Posyandu di Kecamatan Jombang Kabupaten Jombang. Penelitian ini merupakan jenis penelitian survey, data penelitian diperoleh dari observasi langsung terhadap responden dengan menggunakan kuesioner serta data sekunder yang diperoleh dari instansi terkait. Pengumpulan data dilakukan dengan menggunakan teknik wawancara dan observasi. Instrumen penelitian yang digunakan adalah pedoman kuesioner dan wawancara. Teknik skor dan skala yang digunakan adalah skala likert dengan kategori baik, sedang, dan buruk atau kurang baik. Analisis datanya menggunakan analisis deskriptif berupa distribusi frekuensi atau tabulasi frekuensi. Berdasarkan analisis data tersebut, diperoleh empat kesimpulan hasil penelitian sebagai berikut. Pertama, karakteristik kader Posyandu se-Kecamatan Jombang Kabupaten Jombang memiliki kategori sedang. Kedua, pelaksanaan tugas kader Posyandu Kecamatan Jombang Kabupaten Jombang sebagian besar memiliki kategori baik. Ketiga, kategori profil kader Posyandu Kecamatan Jombang Kabupaten Jombang sebagian besar memiliki kategori sedang. Keempat, kategori respon peserta Posyandu terhadap kinerja kader Posyandu Kecamatan Jombang Kabupaten Jombang sebagian besar memiliki kategori baik.

Penerapan model pembelajaran card sort untuk meningkatkan keaktifan siswa pada mata pelajaran IPS-Geografi materi keragaman bentuk muka bumi, proses pembentukan, dan pengaruhnya terhadap kehidupan di kelas VII MTs Surya Buana Malang / Saiful Arif


Kata Kunci: penerapan, Card Sort, keaktifan, hasil belajar. Salah satu penyebab rendahnya kualitas pembelajaran adalah proses pembelajaran yang kurang maksimal. Hal tersebut disebabkan karena pemilihan model pembelajaran yang kurang sesuai dengan karakter siswa dan materi pelajaran, sehingga menyebabkan siswa tidak begitu antusias dalam mengikuti proses pembelajaran di kelas. Permasalahan tersebut dapat menyebabkan keaktifan dan hasil belajar siswa menurun. Berdasarkan observasi awal yang dilakukan di kelas VII B didapatkan data bahwa nilai rata-rata keaktifan siswa sebelum penelitian yaitu 58. Rendahnya keaktifan siswa berpengaruh terhadap hasil belajar ranah kognitif. Pada ranah kognitif, nilai rata-rata siswa sebesar 48 dengan ketuntasan klasikal sebesar 21,7%. Sehingga, perlu upaya untuk meningkatkan keaktifan dan hasil belajar ranah kognitif siswa, salah satu cara yang dapat dilakukan adalah menerapkan model pembelajaran Card Sort. Tujuan penelitian ini adalah untuk meningkatkan keaktifan siswa kelas VII B MTs Surya Buana Malang pada mata pelajaran IPS-Geografi materi “Keragaman Bentuk Muka Bumi, Proses Pembentukan, dan Pengaruhnya Terhadap Kehidupan” dengan model pembelajaran Card Sort. Penelitian ini merupakan Penelitian Tindakan Kelas yang terdiri dari tahap perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian ini terdiri dari 2 siklus yang masing-masing siklus terdiri dari 2 kali pertemuan. Penelitian ini dilakukan pada bulan Juli-Agustus 2010. Data dalam penelitian ini terdiri dari data keaktifan dan hasil belajar ranah kognitif siswa. Instrument penelitian yang digunakan terdiri dari lembar observasi dan soal tes. Teknik pengumpulan data terdiri dari dokumentasi, observasi, dan tes tulis. Teknik analisis data dalam penelitian ini yaitu analisis data kuantitatif. Data yang diperoleh dianalisis dengan cara membandingkan nilai rata-rata keaktifan dan hasil belajar ranah kognitif siswa pada saat Observasi Awal, Siklus I, Siklus II, dan siklus selanjutnya. Hasil penelitian menunjukkan bahwa jumlah skor keaktifan siswa pada saat observasi awal hanya 161, sedangkan pada Siklus I meningkat menjadi 268. Setelah dilakukan Siklus II, jumlah skor keaktifan siswa meningkat menjadi 287. Penerapan model pembelajaran Card Sort ternyata juga dapat meningkatkan hasil belajar ranah kognitif siswa. Berdasarkan dokumen nilai siswa pada saat observasi awal, nilai rata-rata siswa sebesar 48 dengan ketuntasan klasikal sebesar 21,7%. Pada Siklus I nilai rata-rata meningkat menjadi 68,7 dengan ketuntasan klasikal sebesar 55,6% dan pada Siklus II meningkat menjadi 83 dengan ketuntasan klasikal sebesar 93%. Ketuntasan klasikal pada Siklus II telah melebihi 85%, sehingga tidak perlu dilakukan siklus selanjutnya. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa model pembelajaran Card Sort dapat meningkatkan keaktifan dan hasil belajar siswa. Disarankan kepada guru IPS¬-Geografi di MTs Surya Buana Malang agar menggunakan model pembelajaran Card Sort untuk materi pelajaran yang sesuai sebagai salah satu strategi untuk meningkatkan keaktifan dan hasil belajar siswa, agar kualitas pembelajaran semakin meningkat.

Dampak penambangan bahan galian golongan C terhadap tingkat kerusakan lingkungan dan sosial ekonomi masyarakat di Kecamatan Aikmel dan Kecamatan Pringgasela Kabupaten Lombok Timur / Astuti Handayani


Kata Kunci: penambangan, bahan galian golongan C, kerusakan lingkungan, sosial ekonomi Pertambahan penduduk telah meningkatkan kebutuhan hidup diantaranya adalah kebutuhan bahan galian. Kebutuhan akan bahan galian untuk konstruksi dan industri seperti bahan galian golongan C semakin meningkat seiring dengan semakin berkembangnya pembangunan. Tingginya permintaan akan bahan galian tersebut akan memacu kegiatan pertambangan. Industri pertambangan mempunyai potensi besar untuk menciptakan kesejahteraan masyarakat. Namun, di sisi lain industri ini juga menimbulkan berbagai perubahan lingkungan yang mengancam kelestarian fungsi lingkungan dan kehidupan sosial budaya masyarakat. Hal ini terjadi di Kecamatan Aikmel dan Kecamatan Pringgasela Kabupaten Lombok Timur yang mempunyai potensi bahan galian golongan C yang tinggi sehingga terdapat banyak lokasi penambangan yang bisa berdampak negatif terhadap lingkungan dan sosial ekonomi masyarakat. Penelitian ini bertujuan untuk menganalisis hubungan antara kepadatan penduduk dengan intensitas penambangan, menganalisis hubungan antara intensitas penambangan dengan kerusakan lingkungan, dan mengkaji dampak kegiatan penambangan terhadap kondisi sosial ekonomi masyarakat di Kecamatan Aikmel dan Kecamatan Pringgasela Kabupaten Lombok Timur. Metode penelitian yang digunakan adalah metode survei. Teknik pengambilan sampel dalam penelitian ini adalah purposive sampling untuk pengambilan data daerah, sedangkan untuk data responden menggunakan proporsional random sampling. Analisis data dalam penelitian ini adalah analisis korelasi product moment pearson untuk mengetahui hubungan antara kepadatan penduduk dengan intensitas penambangan dan hubungan antara intensitas penambangan dengan tingkat kerusakan lingkungan. Adapun analisis tabel frekuensi digunakan untuk menganalisis dampak penambangan terhadap sosial ekonomi masyarakat. Berdasarkan hasil analisis data dapat disimpulkan bahwa tidak terdapat hubungan yang signifikan antara kepadatan penduduk dengan intensitas penambangan. Hal ini karena intensitas penambangan ditentukan oleh faktor-faktor lain. Namun, terdapat hubungan yang signifikan antara intensitas penambangan dengan tingkat kerusakan lingkungan. Dampak positif penambangan terhadap sosial ekonomi masyarakat yaitu mengurangi jumlah pengangguran, meningkatkan pendapatan masyarakat, meningkatkan kemampuan masyarakat dalam mengembangkan pendidikan anak sedangkan dampak negatifnya yaitu meningkatnya intensitas terkena penyakit, dan kurangnya keamanan dan keselamatan penambang dalam bekerja sehingga mengakibatkan sering terjadi kecelakaan kecil pada sebagian penambang.

Penerapan model teka-teki silang (crossword puzzle) untuk meningkatkan hasil belajar IPS-Geografi siswa kelas VII-A MTs Surya Buana Malang / Anita


Kata Kunci: Teka-teki Silang, Hasil Belajar Geografi Hasil observasi yang dilakukan di MTs Surya Buana Malang diketahui bahwa hasil belajar Geografi siswa kelas VII-A masih rendah. Kriteria Ketuntasan Minimal (KKM) yang ditetapkan di MTs Surya Buana Malang adalah 70. Dari 30 siswa, yang memiliki nilai di atas 70 sebanyak 13 siswa, sedangkan yang memiliki nilai di bawah 70 sebanyak 17 siswa. Dengan demikian, hanya 43,3% siswa dalam satu kelas yang mampu mencapai ketuntasan belajar. Sedangkan berdasarkan hasil wawancara dengan siswa diketahui faktor penyebab hasil belajar yang rendah yaitu (1) siswa malas membaca (2) siswa malas belajar (3) pembelajaran di kelas membosankan. Tujuan penelitian ini untuk meningkatkan hasil belajar IPS-Geografi siswa kelas VII-A MTs Surya Buana Malang melalui penerapan model teka-teki silang (crossword puzzle). Penelitian ini merupakan penelitian tindakan kelas yang dilaksanakan dalam dua siklus. Tindakan yang dilakukan yaitu dengan menerapkan model tekateki silang (crossword puzzle). Penelitian ini dilakukan di kelas VII-A MTs Surya Buana Malang. Teknik pengumpulan data hasil belajar dengan menggunakan tes yang dilakukan satu atau dua minggu setelah akhir masing-masing siklus, sedangkan pengamatan terhadap kegiatan siswa menggunakan lembar observasi dan format catatan lapangan. Hasil penelitian ini menunjukkan bahwa hasil belajar IPS-Geografi siswa kelas VII-A mengalami peningkatan. Peningkatan hasil belajar dari pra tindakan ke siklus I sebesar 50% dan siklus I ke siklus II sebesar 6,7%. Pada pra tindakan persentase siswa yang tuntas sebesar 43,3%, pada siklus I meningkat menjadi 93,3% dan siklus II meningkat menjadi 100%. Sedangkan menurut penggolongan kelas, persentase siswa pada kelas atas sebelum tindakan (pra tindakan) sebesar 26,7%, kelas tengah sebesar 50% dan kelas bawah sebesar 23,3%. Pada siklus I kelas atas meningkat menjadi 56,7%, kelas tengah menurun menjadi 43,3% dan kelas bawah menurun menjadi 0%. Pada siklus II siswa kelas atas meningkat menjadi 90%, kelas tengah menurun menjadi 10% dan kelas bawah 0%. Adapun saran yang diberikan yaitu: (1) Bagi guru geografi disarankan untuk menerapkan model teka-teki silang (crossword puzzle) untuk meningkatkan hasil belajar siswa. (2) Guru hendaknya memperhatikan dan melakukan manajemen waktu dengan sebaik-baiknya, supaya pembelajaran dapat berjalan dengan lancar sesuai yang direncanakan dan selesai tepat pada waktunya (3) Bagi peneliti selanjutnya hendaknya melakukan penelitian sejenis dalam rangka memperbaiki kualitas pembelajaran dengan model teka-teki silang (crossword puzzle) untuk materi pelajaran yang berbeda.

Peningkatan aktivitas dan hasil belajar IPS melalui media crossword pada siswa kelas V SDN Pisang Candi 3 Kota Malang / Nuraini


Kata Kunci : Media crosswords, aktivitas belajar, hasil belajar, IPS SD Berdasarkan observasi awal siswa kelas V SDN Pisang Candi 3 Kota Malang, ditemukan beberapa permasalahan pada pembelajaran IPS materi Proklamasi Kemerdekaan Republik Indonesia, yaitu (1) siswa kurang tertarik pada pelajaran; (2) siswa cenderung pasif terhadapa pembelajaran; (3) siswa merasa bosan terhadap pembelajaran; (4) aktivitas belajar siswa yang tidak bervariasi; (5) rendahnya hasil belajar siswa. Hal tersebut dikarenakan tidak adanya media yang digunakan untuk proses pembelajaran guru hanya menggunakan metode ceramah dan mendominasi pembelajaran. Untuk mengatasi hal tersebut diadakan pembaharuan dalam hal media pembelajaran. Media pembelajaran yang digunakan adalah media crosswords umumnya di Indonsesia dinamakan Teka-Teki Silang, yaitu suatu permainan dimana harus mengisi ruang-ruang kosong (berbentuk kotak-kotak) dengan huruf sehingga berbentuk sebuah kata sesuai dengan petunjuk. Penelitian ini bertujuan (1) Mendeskripsikan penerapan media crosswords yang dapat meningkatkan aktivitas dan hasil belajar dalam pembelajaran IPS kelas V SDN Pisang Candi; (2) Mendeskripsikan penerapan media crosswords dapat meningkatkan aktivitas belajar IPS siswa kelas V SDN Pisang Candi 3. (3) Mendeskripsikan penerapan media crosswords dapat meningkatkan hasil belajar IPS siswa kelas V SDN Pisang Candi . Rancangan yang digunakan adalah Penelitian Tindakan Kelas (PTK). PTK ini dilaksanakan dalam dua siklus, dari yang diadopsi dari Kemmis dan Taggart. Setiap siklus terdiri dari dua pertemuan, dan empat tahap yaitu perencanaan, tindakan dan obeservasi, refleksi, dan perbaikan rencana. Subjek penelitian ini adalah siswa kelas V SDN Pisang Candi 3 Kota Malang, yang berjumlah 13 siswa yang terdiri dari 11 siswa laki-laki dan 2 siswa perempuan. Instrumen yang digunakan adalah pedoman observasi, wawancara, tes, dan dokumentasi. Hasil penelitian ini menunjukkan bahwa penerapan media crosswords dapat meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Pisang Candi 3 Kota Malang. Perolehan rata-rata aktivitas meningkat dari siklus I ke siklus II untuk komponen Visual Activities sebesar 3,84%, Oral Activities sebesar 17,3%, Listening Activities sebesar 13,4%, Writing Activities sebesar 7,69%, Motor Activities sebesar 11,54%, Mental Activities sebesar 7,69%, dan Emotional Activities sebesar 7,69%. Sedangkan hasil belajar meningkat dari siklus I ke siklus II sebesar 11,53%. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa penerapan media crosswords dapat meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Pisang Candi 3 Kota Malang, Disarankan media ini dapat menjadi salah satu alternatif media pembelajaran yang dapat meningkatkan aktivitas dan hasil belajar.

Implementing numbered head together strategy to improve the speaking ability of the tenth graders of Marketing Department in SMKN 1 Lumajang / Maria Videlis TE.


TThesis, English Department, Graduate Program in English Language Teaching, State University of Malang. Advisor 1: Dr. Johannes A. Prayogo, MPd., M.Ed and advisor 2: Prof. M. Adnan Latief, M.A., Ph.D. Key words : Improving speaking ability, Numbered Head Together Strategy. Many Vocational High School, students find speaking hard to master. Based on a preliminary study, in SMKN I Lumajang, it was identified that the students of Marketing X graders find it hard to speak in English. As a result, they had difficulty to answer questions following the dialogue. Besides, they did not participate actively in classroom activities. To solve the problems, the implementation of Numbered Heads Together Strategy was proposed to be applied in teaching speaking, because some researchers have proven the strategy effective to help students to both students’ speaking ability and students’ participation. The objective of this study was to describe how the implementation of Numbered Head Together Strategy can improve the students’ speaking ability. This study used collaborative classroom research. The collaborative English teacher acted as the observer when the researcher implemented the strategy. The research was conducted in two cycles, which consists of three meetings and covers planning, implementing, observing and reflecting. The subjects were 38 students of Marketing X graders in SMKN I Lumajang in 2010-2011 academic years. The instruments used to collect the data were interview guides, questionnaire, observation sheets, field notes, and speaking test. The results of the research show that Numbered Head Together Strategy improved students’ speaking ability and participation. The improvement of the students’ speaking ability could be seen from the increase of students' speaking test from pre test to cycle 1 and cycle 2. In Cycle 1, 57.89% of the students got poor score, 36.84% of the students got average score, 5.26% of the students got good score. In cycle 2, 21.05% of the students got poor score, 68.42% of the students average score, and 10.52% got very good score. Besides, the finding showed that using Numbered Head Together Strategy in asking and giving direction was effective in improving the students’ involvement in the teaching and learning process. Implementing Numbered Head Together Strategy for teaching speaking involved the following steps: The first phase was pre-activities; (1) introducing others. (2) asking the students to predict what the topic will be discussed, (3) asking the students to mention words that might be used in speaking and asked the students to write the words on the board. The second phase was whilst-activities; (1) asking the students to speak about giving direction, (2) asking the students to make groups of four and giving a number, (3) showing the map to the students and discussion, (4) explaining the way on the map, (5) giving time to students for asking something that they still don’t understand. (6) asking the students to answer questions orally, (7)asking the groups to discuss of some questions and encouraging the students to help each other, monitoring and providing assistance if necessary, (8) asking the groups to report their answer. The third phase was post activities, (1) rechecking the students’ answers, (2) writing down the answer on the paper, and (3) making conclusions of the topic and closing the class. The model of Numbered Head Together Strategy includes the following activities: 1) the lesson is explained briefly, 2) students are grouped in each member and is given a different number. Each group is given the same set of questions. Each group member is responsible to answer question(s) whose number is the same as their number. All members answer the questions they are responsible for. They are assigned to discuss their answers with their teammates in order to find the most accurate answer. When the group discussion is over, a number is called. All members in every group whose numbers are the same as the called number raise their hands. One of the students is asked to present and to answer the question. The other students who have the same number as the presenting students were encouraged to give response towards the presented students’ answer, and the answers are concluded. Based on the result of this study, it is recommended that Numbered Head Together Strategy can be used to improve both the students’ speaking ability and the students’ participation in the teaching learning process. Therefore, it is suggested to the English teacher implement it as an alternative strategy in their English class particularly in the speaking activities. For other researchers, it is suggested that they conduct Numbered Head Together Strategy in other school levels and for other language skills such as listening and writing and use the results of this study as a reference.

Perkembangan pementasan kesenian tradisional wayang kulit bagi masyarakat Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung / Kiky Arisandy


Kata kunci: Perkembangan Pementasan Wayang Kulit. Wayang kulit merupakan salah satu budaya yang telah lama ada di Indonesia, terutama di pulau Jawa. Di dalam wayang mengandung beberapa unsur yaitu drama, seni sastra (cerita), seni suara (sulukan, dan lagu-lagu pengiringnya), seni musik (gending) dan seni rupa (wujud wayang). Oleh karena itu perlu diusahakan usaha peningkatkan lebih lanjut pelestariannya pewayangan tersebut. Salah satunya dengan mengadakat penelitian.Perkembangan pewayanan di Indonesia terus ditingkatkan sehingga pewayangan tidak hanya di kenal oleh masyarakat Jawa saja namun telah dikenal di seluruh Indonesia, bahkan sampai ke mancanegara. Obyek penelitian ini adalah pementasan wayang kulit yang berada di Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung. Tujuan penelitian adalah untuk mengetahui latar belakang perkembangan pementasan kesenian tradisional wayang kulit di Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung. Pengambilan data dilakukan terhadap informan, analisis data dilakukan secara deskriptif kualitatif. Penelitian ini dilakukan mulai bulan Januari sampai dengan bulan Juli 2011. Data penelitian yang berupa paparan kebahasaan dalam bentuk visual yang terdapat dalam pertujukan ini yang diperoleh dari pementasan wayang kulit dengan lakon “Pandawa Kalah Main Dadu dan Semar Munggah Kahyangan”. Pengumpulan data dilakukan dengan menggunakan teknik wawancara dan observasi. Instrument yang digunakan untuk mengumpulan data berupa informan. Untuk menjaga keabsahan data, dilakukan kegiatan Trianggulasi data. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, dan tahap evaluasi data. Temuan penelitian ini adalah bagaimana perkembangan pementasan kesenian tradisional wayang kulit di Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung. Perkembangan pementasan wayang kulit ternyata selalu mengalami pasang surut dari tahun ke tahun. Dari hasil penelitian ini dapat diambil kesimpulan bahwa dalam perkembangan pementasan wayang kulit dari tahun 1970an mengalami kemunduran, yang menyebabkan wayang kulit berada diujung tanduk kepunahan, kemudian sekitar tahun 1990an pementasan wayang kulit sudah mulai menunjukkan eksistensinya kembali di tengah-tengah masyarakat, akan tetapi perkembangan wayang kulit tersebut tidak bertahan lama karena adanya krisis moneter yang berkepanjangan. Dan pada tahun 2000 sampai sekarang ini wayang mengalami perkembangan yang cukup pesat dan sekarang didukung juga banyaknya pementasan wayang kulit yang diadakan di stasiunstasiun TV besar.

Prediksi laju erosi dengan menggunakan model water erosion prediction project (WEPP) di Sub Das Junggo Hulu Kecamatan Bumiaji Kota Batu / Ichwan Dwi Pratomo


Kata Kunci: erosi, sedimen, Model WEPP Seiring dengan pertambahan jumlah penduduk, maka akan mendorong peningkatan kebutuhan hidup, baik secara kualitas maupun kuantitas. Tuntutan pemenuhan kebutuhan manusia tersebut selanjutnya menyebabkan meningkatnya kebutuhan akan lahan untuk tempat tinggal maupun kegiatan pertanian.Pembukaan lahan baru berlangsung secara berlebihan, sehingga mempercepat proses erosi.Kerugian akibat erosi berdampak sangat luas, karena tidak hanya menyebabkan kerusakan di daerah hulu saja, tetapi juga di daerah yang dialiri aliran endapan (daerah tengah), dan di bagian hilir. Jenis penelitian ini adalah penelitian survey dimana teknik pengambilan sampel menggunakan metode purposive samplingyang berdasarkan pada kemiringan lereng, sifat tanah, dan penggunaan lahan, sehingga diperoleh sampel daerah sebanyak dua unit lahan. Penelitian ini bertujuan untuk mengetahuilaju erosi dengan menggunakan model WEPP yang terjadi di sub DAS Junggo bagian hulu, Kecamatan Bumiaji, Kota Batu. Hasil penelitian menunjukkan bahwa sub DAS Junggo hulu yang terbagi ke dalam dua unit lahan, memiliki nilai total sedimen terangkut yang bervariasi, dimana pada unit lahan AKK 26-45% berdasarkan hasil pengukuran pertama berturut-turut sampai pada pengukuran keempat adalah sebagai berikut: (1) pengangkutan sedimen sebesar 7,461677 kg/dt, (2) pengendapan sedimen sebesar -0,69208502 kg/dt (3) pengendapan sedimen sebesar -3,08392743 kg/dt, dan (4) pengendapan sedimen sebesar -0,82869316 kg/dt. Sedangkan total sedimen terangkut di unit lahan AKK 16-25% pada pengukuran pertama berturut-turut sampai pada pengukuran keempat adalah sebagai berikut: (1) pengangkutan sedimen sebesar 10,55165627 kg/dt, (2) pengangkutan sedimen sebesar 1,86448370 kg/dt (3) pengendapan sedimen sebesar -1,13330122 kg/dt, dan (4) pengangkutan sedimen sebesar 0,71693563 kg/dt. Untuk menekan besarnya laju erosi yang terjadi di sub DAS Junggo bagian hulu, maka peneliti merasa perlu memberikan saran yang ditujukan kepada masyarakat setempat agar tidak menggunakan lahan yang memiliki kemiringan lereng curam (16-45%) secara berlebihan dan untuk lahan yang belum diolah sebaiknya tidak dibiarkan terbuka. Sedangkan kepada pemerintah daerah diharapkanagar segera memberi penyuluhan kepada masyarakat daerah setempat dan pembuatan kebijakan-kebijakan khusus yang dapat mencegah erosi agar tidak terjadi lebih besar lagi dan sebagai upaya konservasi terhadap penyelamatan lingkungan.

Manajemen penjaminan mutu guru (studi kasus di SMA Negeri 4 Malang) / Widya Study Sagala


Kata kunci: manajemen penjaminan mutu dan penjaminan mutu guru. Manajemen penjaminan mutu guru penting diterapkan di sekolah karena dengan adanya manajemen ini, diharapkan kualitas guru semakin meningkat. Berkaitan dengan hal tersebut, maka lembaga pendidikan membutuhkan suatu manajemen yang dapat mengatur bagaimana agar sekolah dalam manajemen penjaminan mutu dapat berjalan secara efektif dan efisien. Penelitian ini bertujuan untuk mendeskripsikan: (1) manajemen penjaminan mutu guru di SMA Negeri 4 Malang; (2) perencanaan mutu guru di SMA Negeri 4 Malang; (3) pengendalian mutu guru di SMA Negeri 4 Malang; dan (4) perbaikan mutu guru di SMA Negeri 4 Malang . Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian ini adalah studi kasus. Instrumen kunci adalah peneliti sendiri dan subyek penelitian adalah Ketua Unit penjamin mutu (UPM), anggota Unit penjamin mutu (anggota UPM), waka kurikulum dan guru. Data diperoleh melalui wawancara, observasi dan dokumentasi. Data yang telah didapatkan dianalisis selama pengumpulan data, kemudian diklasifikasikan, disaring dan ditarik sebuah kesimpulan. Keabsahan data yang telah dianalisis menggunakan ketercukupan referensial, triangulasi sumber data dan triangulasi metode. Kesimpulan penelitian meliputi: (1) manajemen penjaminan mutu guru yaitu membentuk tim UPM, memiliki tujuan yaitu meningkatkan mutu SMA Negeri 4 Malang sesuai dengan visi misi sekolah dan pemberian tugas kepada Tim UPM oleh Kepala Sekolah. Dalam manajemen, ada beberapa tahap yaitu: a) perencanaan mutu guru yaitu dengan melakukan sosialisasi konsep penjaminan mutu kepada semua warga sekolah, menganalisis SWOT berdasarkan keadaan dan kebutuhan sekolah, mengadakan sharing dengan guru, Tim UPM merencanakan kegiatan mutu guru dan memilih kegiatan-kegiatan yang akan dilaksanakan, dan kegiatan-kegiatan yang direncanakan adalah mengadakan kursus/pelatihan Bahasa inggris dengan Dosen pendamping mata pelajaran dari Universitas Negeri Malang dan pembinaan ESQ dan penguatan kompetensi antara lain outbound, workshop penguatan dan PCC (Positive Character Camp), b) pengendalian mutu guru yaitu dengan melakukan pengamatan atau penilaian kepada guru, dilaksanakan sepanjang tahun ajaran dan aspek-aspek yang dinilai ada 4 kompetensi sosial, paedagogik, kepribadian dan profesional; c) perbaikan mutu guru yaitu dapat meningkatkan kemampuan guru dalam menggunakan Bahasa Inggris dan mengaplikasikan teknologi dalam melaksanakan pembelajaran dan menjadikan hasil pengamatan sebagai acuan pada program selanjutnya ke arah yang lebih baik lagi yang dilaksanakan pada akhir tahun. (2) perencanaan mutu guru yaitu a) sosialisasikan konsep penjaminan mutu kepada semua warga sekolah, b) menganalisis SWOT berdasarkan keadaan dan kebutuhan sekolah, c) mengadakan sharing dengan guru, d) Tim UPM merencanakan kegiatan mutu v guru dan memilih kegiatan-kegiatan yang akan dilaksanakan (disesuaikan dengan anggaran yang ada) dan e) kegiatan-kegiatan yang direncanakan adalah mengadakan kursus/pelatihan Bahasa inggris dengan Dosen pendamping mata pelajaran dari Universitas Negeri Malang dan pembinaan ESQ dan penguatan kompetensi antara lain outbound, workshop penguatan dan PCC (Positive Character Camp); (3) pengendalian mutu guru yaitu a) melakukan pengamatan atau penilaian kepada guru, b) dilaksanakan sepanjang tahun ajaran dan c) aspek-aspek yang dinilai ada 4 kompetensi sosial, paedagogik, kepribadian dan profesional; 4) perbaikan mutu guru yaitu dapat meningkatkan kemampuan guru dalam menggunakan Bahasa Inggris dan mengaplikasikan teknologi dalam melaksanakan pembelajaran dan menjadikan hasil pengamatan sebagai acuan pada program selanjutnya ke arah yang lebih baik lagi yang dilaksanakan pada akhir tahun. Berdasarkan kesimpulan penelitian tersebut, dapat disarankan bagi: (1) Kepala sekolah diharapkan dapat membuat perbaikan baru yang lebih baik dengan menyusun program-program yang lebih inovatif dan lebih variatif dan membina guru agar dapat meningkatkan kompetensinya; (2) Ketua Tim Unit Penjamin Mutu diharapkan dapat menjadi masukan sebagai bahan pertimbangan dalam melaksanakan program kegiatan yang telah direncanakan untuk meningkatkan mutu di SMA Negeri 4 Malang sesuai dengan tahap manajemen yang dimulai dari perencanaan, pengendalian dan perbaikan mutu guru di sekolah; (3) Diharapkan guru memiliki kesadaran dan komitmen yang tinggi dalam melaksanakan kegiatan mutu guru agar dapat menjadi seorang pendidik yang berkompeten; (4) Ketua jurusan diharapkan lebih memperbanyak pengembangan ilmu manajemen dan mengadakan sosialisasi mengenai pentingnya penjaminan mutu guru; (5) Peneliti lain dapat dijadikan sebagai bahan referensi dan sebagai bahan tambahan dalam pengembangan manajemen penjaminan mutu ini.

Layanan transportasi sekolah untuk menekan tidak masuk dan terlambat ke sekolah bagi siswa (studi kasus di Sekolah Dasar Islam Terpadu Al-Hikmah Bence Garum Blitar) / Kariono


Kata Kunci : layanan transportasi, transportasi sekolah, tidak masuk dan terlambat Layanan transportasi sekolah merupakan sarana transportasi bagi siswa untuk kelancaran proses belajar mengajar. Siswa akan merasa aman dan dapat masuk atau pulang sekolah dengan waktu yang tepat. Penyelenggara transportasi sekolah adalah sekolah itu sendiri atau pihak swasta yang bekerja sama dengan sekolah tersebut. Layanan transportasi ini biasa disebut dengan layanan antar jemput siswa karena transportasi ini selalu menjemput dan mengantar siswa mulai dari rumah ke sekolah sampai siswa tersebut pulang ke rumahnya. Adanya layanan transportasi sekolah ini, siswa tidak akan terlambat ke sekolah dan tentunya para orang tua akan merasa terbantu. Penelitian ini dilaksanakan untuk mendeskripsikan fokus penelitian tentang layanan transportasi sekolah, meliputi: (1) Keragaman radius/jarak dan geografis dari tempat tinggal siswa ke sekolah; (2) Transportasi yang digunakan siswa; (3) Siswa yang membutuhkan transportasi sekolah; (4) Pengelolaan layanan transportasi di SD IT Al-Hikmah; (5) faktor pendukung dan penghambat serta upaya mengatasinya; (6) Kegiatan yang dilakukan sekolah untuk meningkatkan layanan transportasi; (7) Kedisiplinan siswa terkait dengan ketepatan waktu masuk sekolah setelah adanya layanan transportasi; (8) Transportasi yang disediakan sekolah menekan terlambat dan tidak masuk siswa di sekolah. Penelitian ini menggunakan rancangan kualitatif. Data penelitian ini dikumpulkan dan dinyatakan dalam bentuk kata-kata, melalui metode observasi, wawancara, dan dokumentasi, sehingga dengan informasi yang diperoleh bisa diketahui bagaimana layanan transportasi sekolah untuk menekan tidak masuk dan terlambat ke sekolah bagi siswa. Instrumen yang digunakan untuk mengumpulkan data yaitu peneliti sendiri. Penjagaan keabsahan data, dilakukan melalui triangulasi data. Analisis data dimulai dari tahap penelaahan, tahap identifikasi dan klarifikasi, dan tahap evaluasi. Berdasarkan hasil analsis data, diperoleh simpulan hasil penelitian sebagai berikut: (1) Keragaman radius/jarak tempat tinggal siswa berbeda-beda, jarak terdekat ± 5 km dan jarak terjauh ± 25 km; (2) Transportasi yang digunakan siswa kebanyakan adalah L300; (3) Siswa yang membutuhkan transportasi ini adalah siswa yang orang tuanya sibuk; (4) Pengelolaan layanan transportasi, yang meliputi perencanaan, pengorganisasian, pengontrolan, dan pengevaluasian. Dalam layanan ini, fungsi menjemen ini sering terlupakan, sehingga proses kegiatan transportasi menjadi kurang maksimal; (5) Pendukung transportasi ii adalah sikap kekelurgaan semua pihak, penghambat meliputi seringnya kemacetan di jalan yang membuat sopir harus mencari jalan pintas, seringnya mobil mogok yang harus dapat diantisipasi dengan selalu mengontrol kondisi mobil; (6) Upaya sekolah meningkatkan transportasi dengan memperketat seleksi mobil, mobil harus keluaran tahun 2000 ke atas, pemberian sangsi yang tegas terhadap pelanggaran; (7) Kedisiplinan siswa tentang terlambat dan tidak masuk ke sekolah berkurang karena adanya layanan transportasi yang selalu berupaya untuk meningkatkan kedisiplinan siswa supaya dapat meningkatkan kualitas pendidikan; dan (8) Transportasi ini menekan tidak masuk dan terlambat siswa ke sekolah karena semua pihak menerapkan kedisiplinan yang tinggi. Berdasarkan implikasi hasil penelitian, maka dikemukakan saran bagi (1) Kepala SD IT Al-Hikmah, pentingnya layanan transportasi sekolah dalam menekan tidak masuk dan terlambat siswa sekolah, disarankan bagi kepala sekolah untuk ikut meningkatkan layanan ini dengan baik, karena layanan ini juga akan berpengaruh terhadap kemajuan sekolah karena layanan ini cukup jarang ada. Secara tidak langsung layanan ini akan menjadi jati diri sekolah dan juga akan meningkatkan kualitas dalam layanan khususnya sehingga akan mampu untuk menyerap peserta didik baru yang lebih banyak; (2) Koordinator, harus lebih bisa mengkondisikan sopir-sopir dan juga aktif mengontrol pelaksanaan antar jemput guna untuk meningkatkan layanan transportasi ini ke arah yang lebih baik; (3) Bagi Siswa, menjadi bahan sumbangan mengenai menejemen layanan transportasi sekolah; (4) Bagi Orang tua, menjadi bahan masukan dalam memilih layanan transportasi; (5) Bagi Sopir, menjadi bahan masukan dalam menjalankan kendaraan agar selamat, juga gambaran dalam melayani transportasi anak usia sekolah dasar.; (6) Bagi Ketua Jurusan Administrasi Pendidikan, hasil penelitian ini bisa dijadikan tambahan referensi bagi jurusan Administrasi Pendidikan dan lebih meningkatkan kompetensi mahasiswa dalam memahami konsep dan manfaat yang diperoleh dari layanan ini; dan (7) Bagi Peneliti selanjutnya, agar lebih menyempurnakan hasil penelitian sehingga dapat mengembangkan kualitas dari layanan transportasi sekolah.

pengaruh computer anxiety dan prestasi belajar mata kuliah pengantar akuntansi terhadap penguasaan komputer akuntansi (MYOB accounting) pada mahasiswa Jurusan Akuntansi Universitas Negeri Malang / Praptiwi Suryaning Tias


Kata kunci: Computer Anxiety, Pengantar Akuntansi, Komputer Akuntansi (Myob Accounting) Mengingat pentingnya penguasaan Myob Accounting bagi seorang akuntan, maka mahasiswa akuntansi dituntut tidak hanya mampu menguasai teori-teori akuntansi melainkan juga harus mampu menguasai teknologi komputer. Tujuan pertama dalam penelitian ini yaitu, untuk menjelaskan pengaruh computer anxiety terhadap penguasaan komputer akuntansi (Myob Accounting). Tujuan kedua yaitu, untuk menjelaskan pengaruh prestasi belajar mata kuliah pengantar akuntansi terhadap penguasaan komputer akuntansi (Myob Accounting) Variabel dalam penelitian ini terdiri dari computer axiety (X1), prestasi belajar matakuliah pengantar akuntansi (X2) dan penguasaan komputer akuntansi (Myob Accounting) (Y). Populasi yang digunakan dalam penelitian ini adalah seluruh mahasiswa akuntansi Universitas Negeri Malang angkatan tahun 2006/2007, 2007/2008 dan 2008/2009 dengan diperoleh sampel sebanyak 97 responden yang dipilih berdasarkan Stratified Random Sampling. Angket yang digunakan untuk mengukur tingkat computer anxiety pada mahasiswa akuntansi adalah CARS (Computer Anxiety Rating Scale) dengan skala likert. Teknik analisis data dalam penelitian ini adalah regresi ganda dengan uji hipotesis yang meliputi uji t dan uji F. Hasil analisis data dari penelitian ini menunjukkan bahwa (1) Computer anxiety berpengaruh negatif terhadap penguasaan komputer akuntansi (Myob Accounting).Hasil tersebut berarti bahwa semakin rendah tingkat computer anxiety maka penguasaan komputer akuntansi yang dimiliki tinggi. 2) Prestasi belajar matakuliah pengantar akuntansi berpengaruh positif dan signifikan terhadap penguasaan komputer akuntansi (Myob Accounting) yang berarti, semakin tinggi prestasi matakuliah pengantar akuntansi, maka semakin tinggi pula penguasaan komputer akuntansi. Kesimpulan dari penelitian ini yaitu, computer anxiety berpengaruh negatif terhadap penguasaan komputer akuntansi dan prestasi belajar matakuliah pengantar akuntansi berpengaruh positif terhadap penguasaan komputer akuntansi. Adapun keterbatasan dalam penelitian ini adalah (1) variabel berpengaruh yang digunakan hanya terbatas pada dua variabel saja, (2) mensejajarkan antara variabel computer anxiety dan prestasi matakuliah Pengantar Akuntansi, (3) instrumen CARS tidak diadaptasikan pada kalimat yang mengarah pada software Myob Saran yang dapat diberikan yaitu, (1) hendaknya dosen akuntansi lebih mengintegrasikan setiap materi akuntansi dengan teknologi komputer dan lebih mengefektifkan pembelajaran matakuliah pengantar akuntansi (2) Mahasiswa akuntansi diharapkan mampu meningkatkan keterampilan berkomputer dan meningkatkan prestasi belajar matakuliah pengantar akuntansi, (3) peneliti selanjutnya hendaknya menambahkan variabel diluar penelitian ini, menjadikan variabel computer anxiety sebagai variabel moderating ataupun intervening dan mengadaptasi kalimat yang digunakan pada instrumen CARS

Pengaruh harga saham, trading volume activity dan risk of return terhadap bid-ask spread (studi pada perusahaan LQ-45 periode 2007-2009) / Novie Asri Rahmawati


Kata kunci : Harga saham, trading volume activity, risk of return, bid-ask spread Pasar modal merupakan tempat pertemuan antara penawaran dan permintaan surat berharga. Investasi pada hakekatnya merupakan penempatan sejumlah dana pada saat ini dengan harapan untuk memperoleh keuntungan dimasa yang akan datang. Dari tempat inilah para pelaku pasar yaitu individu-individu atau badan usaha yang mempunyai kelebihan dana (surplus funds) melakukan investasi dalam surat berharga berupa saham, obligasi dan beberapa derivatif lain. Perdagangan di pasar modal atau bursa efek menggunakan order driven market system dan continuous auction system. Order driven market system adalah sistem perdagangan atau transaksi sekuritas di pasar modal yang harus melalui perantara broker atau pialang yang menjadi anggota bursa efek. Para broker atau pialang saham akan melakukan transaksi perdagangan dan membuat penawaran jual dan penawaran beli sehingga kedua penawaran tersebut akan memunculkan perbedaan atau selisih yang disebut dengan bid-ask spread. Penelitian ini bertujuan untuk menganalisis pengaruh harga saham, trading volume activity, dan risk of return terhadap bid-ask spread. Penelitian ini menggunakan sampel perusahaan yang tergabung dalam kategori indeks LQ-45 periode 2007 – 2009 sebanyak 19 perusahaan. Pemilihan sampel dilakukan dengan purposive sampling. Teknik analisis yang digunakan untuk menguji hipotesis yang diajukan adalah teknik analisis regresi linear berganda. Hasil penelitian ini menunjukkan bahwa secara parsial harga saham dan trading volume activity berpengaruh negatif signifikan terhadap bid-ask spread, sedangkan risk of return berpengaruh positif signifikan terhadap bid-ask spread. Dari hasil penelitian ini diharapkan bagi investor yang akan melakukan transaksi di pasar modal hendaknya memperhatikan harga saham, trading volume activity , risk of return dan bid-ask spread sebagai acuan dalam pengambilan keputusan investasi. Bagi peneliti selanjutnya yang ingin melakukan penelitian sejenis, hendaknya menambah jumlah sampel dan jenis perusahaan lain yang tidak hanya tergabung dalam indeks LQ-45 dan menggunakan peristiwa seperti stock split, right issue dan kebijakan deviden yang lebih memberikan informasi bagi pelaku pasar modal.

Penerapan model belajar tuntas guna meningkatkan hasil belajar mata diklat pendidikan dasar teknik bangunan pada siswa kelas X TKB 1 di SMKN 1 Singosari / Indavul Khoirunnikmah


Kata Kunci: penerapan, model belajar tuntas, hasil belajar, pendidikan dasar teknik bangunan Pendidikan Dasar Teknik Bangunan merupakan salah satu bidang ilmu yang menjadi tumpuan bagi kemajuan teknologi teknik sipil. Dalam rangka transformasi teknologi pada bidang teknik sipil menuju masyarakat maju dan modern hendaknya disadari bahwa pembelajaran Pendidikan Dasar Teknik Bangunan tidak semata mata hanya berupa alih pengetahuan saja, tetapi diharapkan siswa mampu menerapkan pengetahuan yang diperolehnya sehingga dapat memecahkan permasalahan yang dihadapinya. Sesuai dengan cita-cita dari tujuan pendidikan nasional juga, guru perlu memiliki beberapa prinsip mengajar yang mengacu pada peningkatan kemampuan internal peserta didik di dalam merancang strategi dan melaksanakan pembelajaran. Peningkatan potensi internal itu misalnya dengan menerapkan jenis-jenis strategi pembelajaran yang memungkinkan peserta didik mampu mencapai kompetensi secara penuh, utuh dan kontekstual. Penerapan model belajar tuntas ini bertujuan untuk meningkatkan hasil belajar siswa pada mata diklat Pendidikan Dasar Teknik Bangunan yang menurut penelitian awal peneliti terdapat nilai-nilai yang kurang. Pada penelitian ini diharapkan dapat meningkatkan hasil belajar siswa dan mengetahui model belajar yang sesuai untuk pembelajaran mata diklat Pendidikan Dasar Teknik Bangunan. Metode pengumpulan data yaitu metode observasi/pengamatan, metode wawancara, metode tugas serta tes. Data tersebut kemudian akan dibandingkan dengan kajian pustaka sehingga dapat diambil kesimpulan dan saran. Hasil penelitian ini menunjukkan bahwa ada peningkatan hasil belajar siswa pada mata diklat Pendidikan Dasar Teknik Bangunan kelas X TKB1. Berdasarkan penelitian in dapat disarankan dalam proses pembelajaran Pendidikan Dasar Teknik Bangunan digunakan model belajar tuntas untuk meningkatkan hasil belajar siswa.

Peran komite sekolah dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan (studi kasus di SD Negeri Pandesari 1 Pujon) / Chandra Febrian Ika Wati


Kata Kunci: peran komite sekolah, pengadaan sarana dan prasarana, kualitas pendidikan. Keberadaan dan peran komite sekolah dalam upaya mendukung kualitas pendidikan sekolah sangat bervariasi, baik dari segi status, kinerja, peran, kualitas SDM, sarana dan prasarana yang dimiliki komite sekolah. Berkaitan dengan kelembagaan tersebut perlu adanya dukungan pemerintah terhadap keberadaan Komite sekolah. Dukungan yang diharapkan dalam peningkatan kualitas pendidikan adalah terpenuhinya kebutuhan dan kelengkapan sarana dan prasarana belajar. Peran Komite sekolah merupakan kunci keberhasilan dalam memberi dukungan terhadap kualitas pendidikan melalui pengadaan sarana dan prasarana. Berdasarkan uraian tersebut di atas, penelitian difokuskan pada: (1) usaha Komite sekolah dalam pengadaan sarana dan prasarana pendidikan untuk mendukung kualitas pendidikan, (2) peran komite sekolah dalam mendukung kualitas pendidikan melalui pengadaan sarana dan prasarana pendidikan, (3) faktor yang mendukung dan menghambat peran komite sekolah dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan, (4) solusi komite sekolah menghadapi hambatan dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan. Penelitian ini dilakukan di SD Negeri Pandesari 1 Pujon dengan pendekatan deskriptif kualitatif dengan rancangan studi kasus. Prosedur pengumpulan data dilakukan melalui: (1) observasi, (2) interview, dan (3) dokumentasi. Analisis data yang digunakan adalah analisis data kualitatif. Untuk mengetahui keabsahan data peneliti menggunakan beberapa teknik, yaitu: (1) triangulasi, (2) pengecekan sejawat melalui diskusi, dan (3) kecukupan referensial. Hasil penelitian menunjukkan bahwa usaha yang dilakukan komite sekolah dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan di SD Pandesari Negeri 1 Pujon adalah dengan (1) penyediaan sarana dan prasarana yang dibutuhkan dalam proses belajar mengajar, (2) menjalin hubungan antara sekolah dengan masyarakat, dan (3) mengoptimalkan sumber daya yang ada. Dalam hal ini komite sekolah berperan sebagai (1) pemberi pertimbangan (advisory agency), (2) pendukung (supporting agency), (3) pengontrol (controlling agency), dan (4) mediator. Dalam menjalankan fungsinya, komite sekolah banyak mendapatkan dukungan dari berbagai pihak, khususnya dalam rangka pengadaan sarana dan prasarana untuk peningkatan kualitas pendidikan, namun juga mengalami beberapa hambatan, diantaranya: (1) keterbatasan waktu dan kemampuan SDM anggota komite sekolah, (2) keterbatasan dana dari swadaya masyarakat termasuk orangtua siswa, (3) seringnya berganti guru yang pindah karena pengangkatan menjadi Pegawai Negeri Sipil, dan (4) kurang semangatnya siswa dalam menghadapi UAN. Berdasarkan hasil penelitian tersebut dimana komite sekolah dalam menjalankan perannya mengalami beberapa hambatan sehingga dapat dikemukakan saran berikut: (1) perlunya dibangun kerja sama yang baik antar warga sekolah, masyarakat, dan pemerintah, (2) mencari terobosan baru yang dapat menggali dan menghasilkan dana untuk menunjang keberhasilan program peningkatan mutu/kualitas pendidikan, (3) perlu adanya monitoring dan mengevaluasi demi peningkatan kualitas pelayanan pendidikan di lembaga, (4) para guru dan anggota komite sekolah, perlu diikutsertakan dalam pelatihan, seminar dan kegiatan-kegiatan lainnya yang dapat menumbuhkan motivasi dan mengembangkan profesionalisme dalam meningkatkan kualitas pendidikan

Classroom interaction in the teaching of speaking to eleventh graders at SMAN 2 Pare / Nani Trisnawati


Kata kunci: Interaksi Kelas, FLINT system, pola interaksi kelas. Interaksi merupakan aspek yang penting untuk meningkatkan kemampuan berkomunikasi siswa sebagai tujuan pembelajaran dalam proses pembelajaran bahasa. Komunikasi itu sendiri sangat bergantung pada interaksi dimana segala sesuatu yang terjadi di kelas melalui proses interaksi untuk meningkatkan keterampilan berkomunikasi siswa. Siswa akan dianggap terampil jika mereka mampu berkomunikasi secara lesan yang dikembangkan melalui kegiatan speaking. Oleh karenanya, penelitian terhadap interaksi kelas di pengajaran speaking sangat patut untuk diselenggarakan. Penelitian ini menganalis interaksi kelas dalam pengajaran speaking untuk kelas sebelas di SMAN 2 Pare. Secara rinci, penelitian ini bertujuan untuk menjawab tiga pokok pembahasan yaitu: (1) Kategori dari ungkapan yang digunakan guru (teacher talk) (2) Kategori partisipasi lesan siswa (student talk) (3) dan pola-pola interaksi dalam pembelajaran speaking. Kategori untuk teacher talk dan student talk berdasarkan model FLINT yang dikemukakan oleh Flanders and Mozkowitz yang telah dikutip oleh Brown (2001: 165) yang mencakup masing masing tujuh kategori dari teacher talk dan student talk. Sedangkan pola interaksi menerapkan model dari Thomas (in Mingzhi, 2005: 59) yang mencakup tujuh pola interaksi. Penelitian ini menggunakan metode diskriptif kulitatif dan tempat penelitian ini di SMA Negeri 2 Pare. Subjek penelitian ini adalah guru yang mengajar speaking di kelas XI IA 2 dan siswa di kelas XI IA 2. Data didapat dari observasi selama enam kali pertemuan dalam kelas tersebut. Instrumen yang digunakan dalam penelitian ini adalah: catatan lapangan, lembar observasi, kuesioner, dan pedoman wawancara. Hasil penelitian menunjukkan bahwa subjek menerapkan semua kategori teacher talk dan student talk yang termuat dalam model FLINT. Selain itu, pola interaksi di dalam kelas di dominasi oleh interaksi antara guru dan seluruh siswa di kelas. Namun, inisiasi siswa untuk berinteraksi dengan guru tidak ditemukan dalam penelitian ini. Sehubungan dengan interaksi kelas, guru trampil untuk mengelola suasana kelas menjadi menyenangkan dengan menerapkan kategori Praise and Encouragement. Dan kategori Student Response Specific mendominasi interaksi siswa karena hampir semua pertanyaan guru membutuhkan jawaban yang sifatnya pasti dan dalam kalimat yang sederhana. Selain itu pola interaksi yang mendominasi kelas adalah interaksi antara guru dengan seluruh siswa. Sedangkan pola interaksi yang lain seperti interaksi antara guru dengan salah seorang siswa atau guru dengan siswa dalam kelompok terjadi saat guru memberi masukan terhadap penampilan siswa. Interaksi antara siswa dengan siswa lain dalam kelompok terjadi saat siswa melaksanakan penampilan drama. Kemudian untuk interaksi antara seorang siswa dengan seluruh kelas terjadi saat siswa melakukan kegiatan kelas untuk menceritakan kembali sebuah cerita dan saat mereka tampil dalam drama. Singkatnya, subjek penelitian menerapkan semua kategori untuk teacher talk dan student talk yang diusulkan oleh Flanders dan Mozkowitz. Serta, menerapkan hampir semua kategori untuk pola interaksi yang diusulkan oleh Thomas. Berdasarkan hasil penelitian, peniliti menyarankan kepada guru untuk menerapkan kategori praise and encouragement untuk meningkatkan kategori student response open ended, supaya waktu yang diberikan siswa untuk berbicara lebih banyak. Selain itu, guru disarankan supaya memberikan waktu kepada siswa untuk mengawali interaksi pada awal pemberian materi agar pola interaksi tidak didominasi oleh interaksi antara guru dan kelas. Dengan demikian, interaksi kelas akan lebih efektif untuk meningkatkan kemampaun komunikatif siswa

Dinamika Lembaga Dakwah Kampus Badan Dakwah Masjid Al Hikmah IKIP MALANG tahun 1982-1999 / Hendri Dharmawan


Penerapan strategi bertanya dengan media gambar untuk meningkatkan pemahaman tentang pengaruh lingkungan fisik terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya / Ahmad Murdi


Kata kunci : strategi bertanya, media gambar, lingkungan Kurangnya pemahaman siswa tentang pengaruh lingkungan fisik terhadap daratan disebabkan kurang tepatnya strategi model pembelajaran yang diterapkan guru. Guru belum menggunakan strategi bertanya dan memanfaatkan media dalam pembelajaran secara maksimal, misalnya media gambar. Padahal penggunaan media gambar akan membantu siswa untuk lebih mudah mencerna dan memahami materi yang diajarkan. Penelitian ini bertujuan untuk meningkatkan pemahaman tentang pengaruh lingkungan fisik seperti erosi, banjir, abrasi dan tanah longsor terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya melalui strategi bertanya dengan media gambar. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang terdiri dari dua siklus. Pada masing-masing siklus dilaksanakan tahap perencanaan, pelaksanaan tindakan, pengamatan, dan refleksi. Subyek dalam penelitian ini adalah siswa kelas IV SDN Kandangan III/621 Surabaya yang berjumlah 30 orang siswa. Pelaksanaan penelitian dilaksanakan dalam rentang waktu dua bulan, mulai bulan April sampai Mei 2010. Pengumpulan data dilakukan dengan menggunakan pedoman observasi, tes, dan catatan lapangan. Analisis data dilakukan secara deskriptif kualitatif dan kuantitatif. Hasil penelitian menunjukkan bahwa strategi bertanya dengan media gambar yang digunakan dalam pembelajaran IPA pada pokok bahasan pengaruh lingkungan fisik terhadap daratan dapat meningkatkan pemahaman siswa. Penugasan membuat pertanyaan juga dapat membuat siswa lebih leluasa untuk mengungkapkan rasa keingintahuannya, sehingga tingkat pemahaman siswa pun ikut meningkat. Berdasarkan hasil tersebut dapat disimpulkan bahwa penerapan strategi bertanya bertanya dengan media gambar dapat meningkatkan pemahaman tentang pengaruh lingkungan fisik terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya. Untuk memperoleh hasil yang maksimal diharapkan dalam penerapan strategi ini digunakan gambar yang lebih kompleks dan penggunaan pertanyaan dalam bentuk uraian.

Kinerja kepala desa dalam upaya pembinaan generasi muda untuk menciptakan partisipasi terhadap pembangunan desa di Desa Ngadirojo Kec. Ngadirojo Kab. Pacitan / Cahya Purnama


Kata Kunci: Kinerja Kepala Desa, Pembinaan Generasi Muda, Pembangunan Desa Pembangunan di tingkat desa perlu didukung oleh adanya peran serta masyarakat yang melibatkan peran serta generasi muda, karena hanya dengan dukungan masyarakat itulah pembangunan wilayah desa dapat berjalan secara lebih efektif. Pembangunan desa adalah upaya meningkatkan kemampuan manusia mempengaruhi masa depannya yang memiliki beberapa implikasi utama meliputi: (1) pembangunan berarti membangkitkan kemampuan manusia secara optimal, baik individu maupun kelompok; (2) pembangunan berarti mendorong tumbuhnya kebersamaan, kemerataan nilai dan kesejahteraan; (3) pembangunan berarti menaruh kepercayaan kepada masyarakat membangun dirinya sesuai dengan kemampuannya; (4) pembangunan berarti membangkitkan kemampuan membangun secara mandiri. Dalam hal ini kepala desa mempunyai peranan yang sangat penting dalam menggerakkan partisipasi generasi muda dalam bidang pembangunan. Sesuai dengan tugas, wewenang, dan kewajiban kepala desa, kepala desa mempunyai tanggung jawab yaitu menggerakkan partisipasi masyarakat. Tanggung jawab tersebut menyangkut penyelenggaraan urusan pemerintah desa dan urusan pemerintah umum termasuk pembinaan ketenteraman dan ketertiban serta menumbuh dan mengembangkan jiwa dan semangat gotong royong masyarakat sebagai sendi utama pelaksanaan pemerintahan desa sesuai peraturan perundang-undangan yang berlaku Tujuan dari penelitian ini adalah: (1) mendeskripsikan kinerja kepala desa dalam upaya pembinaan generasi muda, (2) mendiskripsikan partisipasi generasi muda terhadap pembangunan, (3) mendiskripsikan kinerja kepala desa dalam upaya pembinaan generasi muda untuk menciptakan partisipasi terhadap pembangunan desa di desa Ngadirojo Kecamatan Ngadirojo Kabupaten Pacitan. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Kehadiran peneliti dalam penelitian ini dibagi menjadi 3, yaitu studi pendahuluan, pengambilan data, dan pengecekan keabsahan data. Lokasi penelitian di Desa Ngadirojo. Sumber data dalam penelitian ini adalah manusia, peristiwa, sumber tertulis yang berupa sumber buku dan dokumen resmi, foto. Prosedur pengumpulan data, yaitu observasi, wawancara, dan dokumentasi. Teknik yang digunakan dalam analisis data, yaitu reduksi data, penyajian data, dan kesimpulan. Temuan yang diperoleh dalam penelitian ini yaitu: (1) kinerja kepala desa Ngadirojo berdasarkan kepemimpinanannya dalam program pembinanaan ii generasi muda selalu melayanai generasi muda dan berupaya mengarahkan, membimbing, menumbuhkan serta mengembangkan potensi yang dimiliki oleh generasi muda. Berdasarkan komunikasinya adalah melalui komunikasi langsung dan terbuka Sedangkan dalam memotivasi generasi muda dalam pembinaan tersebut kepala desa memberikan dorongan yang berbeda dalam masing-masing bidang. Kepala desa berpartisipasi dalam bidang-bidang pembinaan yaitu sebagai pemimpin dalam penyuluhan masing-masing bidang sekaligus sebagai pembina dan pengarah bagi generasi muda, (2) partisipasi generasi muda terhadap pembangunan desa Ngadirojo didasarkan keinginannya untuk telibat adalah cukup tinggi. Hal ini dibuktikan dengan kesediaaan untuk hadir pada musyawarah rencana pembangunan dan keinginannya untuk terlibat dalam segala bentuk pembangunan yang terjadi di desa Ngadirojo. Ditinjau dari kesadaran untuk terlibat dalam kegiatan pembangunan desa Ngadirojo dapat dilihat dari kesadaran generasi muda dalam memberikan ide atau masukan tentang program pembangunan yang perlu diprioritaskan. Dalam praktek, adanya keterlibatan generasi muda dalam pembangunan dapat diwujudkan dengan kesediaan generasi muda untuk terjun langsung dalam pembangunan-pembangunan desa, (3) kinerja kepala desa dalam membina generasi muda untuk meningkatkan partisipasi terhadap pembangunan terkait dengan kepemimpinannya adalah dengan memberikan kesempatan kepada generasi muda untuk terlibat dalam program pembangunan sesuai bidang-bidang pembinaan. Cara berkomunikasi, kepala desa dan generasi muda terjalin hubungan komunikasi yang baik dalam arti kepala desa mau mengajak generasi muda untuk berkomunikasi terkait pembangunan yang ada di desa. Dalam memotivasi generasi muda agar berpartisipasi dalam pembangunan desa. Partisipasi kepala desa dengan tujuan meningkatkan partisipasi generasi muda terhadap pembangunan desa, kepala desa sebagai pembina sekaligus sebagai pemimpin dalam kegiatan pembangunan yang sedang berlangsung baik pembangunan fisik ataupun nonfisik. Berdasarkan temuan diatas, saran yang diajukan adalah: (1) Bagi Kepala Desa Ngadirojo selain memberikan motivasi pada masing-masing bidang pembinaan, maka diperlukan adanya pertemuan rutin dengan generasi muda dan dilakukan dengan diskusi dengan menghadirkan perangkat desa untuk membahas kebutuhan atau permasalahan yang ada dalam mengembangkan kepemudaan, (2) bagi generasi muda selain berpartisipasi menyumbangkan ide dan tenaga alangkah baiknya dibuat catatan untuk penyempurnaan tertib administrasi, seperti pencatatan kegiatan yang telah dilaksanakan pada setiap bidang pembangunan untuk laporan triwulan, (3) dalam meningkatkan partisipasi generasi muda terhadap pembangunan, usaha kepemudaan yang bersifat ekonomi perlu ditingkatkan lagi sehingga hasilnya dapat untuk mengisi kas organisasi atau untuk keperluan pengadaaan fasilitas yang dibutuhkan dalam pembangunan.

Peranan pemerintah dalam meningkatkan kehidupan sosial ekonomi masyarakat nelayan di Desa Mayangan Kecamatan Mayangan Kota Probolinggo / Vinta Nurul Yuliastutik


Kata Kunci: Peranan Pemerintah, kehidupan Sosial Ekonomi, dan masyarakat nelayan Masyarakat nelayan masih hidup dalam keterbatasan baik keterbatasan dalam bidang pendidikan. Keterbatasan ekonomi itu nampak pada tingkat pendapatan nelayan yang pada umumnya masih rendah. Tujuan dari penelitian ini adalah: (1) Mendiskripsikan keadaan sosial ekonomi masyarakat nelayan, (2) Mendiskripsikan upaya yang dilakukan pemerintah dalam ikut mengatasi masalah sosial ekonomi masyarakat nelayan, (3) mendiskripsikan program pemerintah untuk meningkatkan kehidupan sosial ekonomi masyarakat nelayan, (4) hambatan yang dihadapi pemerintah dalam mengatasi masalah sosial ekonomi masyarakat nelayan, (5) Upaya yang dilakukan oleh pemerintah untuk mengatasi hambatan dalam masalah sosial ekonomi masyarakat nelayan Desa Mayangan Kecamatan Mayangan Kota Probolinggo. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Kehadiran peneliti dalam penelitian ini yaitu pada saat studi pendahuluan, pada saat pengambilan data, dan pada saat pengecekan keabsahan data. Teknik yang digunakan dalam prosedur pengumpulan data, yaitu observasi, wawancara, dan dokumentasi. Teknik yang digunakan dalam analisis data, yaitu reduksi data, penyajian data, dan kesimpulan. Kriteria yang digunakan dalam pengecekan keabsahan temuan, yaitu kepercayaan, triangulasi, keteralihan, kebergantungan, dan kepastian. Tahap-tahap yang dilakukan dalam penelitian ini, yaitu tahap persiapan penelitian, tahap pelaksanaan, dan tahap pelaporan. Temuan yang diperoleh dalam penelitian ini yaitu sesuai dengan rumusan masalah: (1) Kehidupan sosial ekonomi masyarakat nelayan di Desa Mayangan berdasarkan pendidikan dapat dilihat dari tingkat pendidikan para nelayan sendiri yang rata-rata sebagian besar tingkat pendidikannya hanya sampai Sekolah Dasar (SD). Hubungan komunikasi antar sesama nelayan dan antar juragan dengan nelayan terjalin dengan sangat baik. Hal ini terbukti dengan jarang ada salah paham dan pertengkaran. Masyarakat nelayan Desa Mayangan mengutamakan kerja sama. Hal ini terlihat dari kegiatan bergotong royong dan saling membantu apabila ada yang membutuhkan. Tingkat pendapatan masyarakat nelayan di Desa Mayangan tergantung dari hasil tangkapan ikan. (2) Upaya yang dilakukan oleh pemerintah Kota Probolinggo untuk mengatasi masalah sosial ekonomi yang timbul dalam masyarakat nelayan di Desa Mayangan sesuai dengan lima kriteria diantaranya dari segi pendidikan, komunikasi antar nelayan, kerja sama, persaingan antar nelayan dan pendapatan. (3) Pemerintah telah memberikan macam-macam program dan kegiatan diantaranya yaitu program PEMP, kegiatan vi beach clean up, dan bantuan langsung pemerintah. (4) Hambatan yang dihadapi Pemerintah Kota Probolinggo dalam mengatasi masalah sosial ekonomi masyarakat nelayan yaitu terbagi sesuai dengan kriteria yaitu hambatan dalam segi pendidikan, komunikasi antar nelayan, kerja sama, persaingan antar nelayan, pendapatan, hambatan dalam administrasi, dan hambatan teknis (5) Upaya yang dilakukan oleh pemerintah melalui dinas perikanan dan kelautan untuk mengatasi hambatan dalam masalah sosial ekonomi masyarakat nelayan ada beberapa tindakan diantaranya yaitu: Perda tahun 2007 tentang restribusi tempat pelelangan ikan, kunjungan pemerintah kepada para nelayan di pelabuhan tanjunga tembaga, hal ini dimaksudkan agar antara pemerintah dengan nelayan tidak ada kesenjangan sosial sehingga hubungan diantara kedua bisa lebih dekat dan pemerintah bisa lebih mengerti apa saja yang dibutuhkan warganya, melakukan pencocokan kembali atas data-data nelayan. Berdasarkan temuan diatas, saran yang diajukan adalah (1) Bagi Pemerintah Kota Probolinggo disarankan dalam mengatasi masalah sosial ekonomi masyarakat nelayan khususnya nelayan di Desa Mayangan dari segi Pendidikan Pemerintah lebih meningkatkan perhatian pada generasi muda yang kurang mampu untuk meneruskan pendidikannya dengan pemberian bermacam-macam bentuk bea siswa agar generasi muda lebih termotivasi untuk tetap mencpai cita-citanya. Dari segi komunikasi antar nelayan, pemerintah lebih giat secara aktif lagi untuk melakukan pendekatan secara langsung kepada masyarakat nelayan dengan melakukan berbagai penyuluhan kepada masyarakat nelayan tentang pentingnya komunikasi yang baik antar sesama. Segi kerja sama, pemerintah lebih giat secara aktif lagi untuk melakukan pendekatan secara langsung kepada masyarakat nelayan dengan melakukan berbagai penyuluhan kepada masyarakat nelayan tentang pentingnya kerja sama dan bergotong royong. Dari Persaingan antar nelayan, pemerintah lebih tertib melaksanaan peraturan daerah mengenai persaingan yang terjadi antar nelayan sehingga masyarakatnya pun ikut tertib. Dari pendapatan, pemerintah berusaha lagi untuk menciptakan berbagai macam lapangan kerja baru bagi masyarakat nelayan khususnya nya agar bisa mengatasi masalah perekonomian masyarakatnya dengan pemberian bermacam-macam keterampilan sehingga bisa membuka peluang usaha yang baru. Bagi peneliti lanjutan disarankan hasil penelitian ini dapat dijadikan acuan, titik tolak, dan tindak lanjut bagi peneliti yang relevan dengan judul yang dibahas pada penelitian yang akan datang. Bagi masyarakat nelayan disarankan para masyarakat nelayan diharuskan lebih memperhatikan kehidupannya sendiri, lebih semangat dan kerja keras demi mempertahankan hidupnya tanpa harus menunggu peran serta dari pemerintah untuk memberi bantuan. Nelayan juga harus mentataati dan tidak melanggar peraturan yang dibuat oleh pememerintah. Semua kegiatan dan program yang dibuat leh pemerintah harus dilaksanakan dengan sebaik-baiknya dengan penuh tanggung jawab.

Penerapan pendekatan pembelajaran kontekstual untuk meningkatkan prestasi belajar kompetensi keahlian membuat gambar rencana balok beton bertulang pada siswa XI GB di SMKN 6 Malang / Anna Zahrotul Fatah


Kata kunci: pembelajaran kontekstual, prestasi belajar. Berdasarkan pengamatan hasil belajar siswa kelas XI GB 2 SMK Negeri 6 Malang pada kompetensi keahlian membuat gambar rencana balok beton ber-tulang hanya mencapai Kriteria Ketuntasan Minimal (KKM) saja, yaitu 76,22. Kondisi ini menunjukkan bahwa perlu adanya peningkatan hasil belajar siswa. Pada pengamatan awal pembelajaran, guru menggunakan pendekatan ceramah untuk menyampaikan materinya. Pendekatan yang diterapkan tersebut belum dapat mengaitkan antara materi pembelajaran yang dijelaskan dengan kenyataan yang ada di lapangan atau dengan kehidupan sehari-hari. Untuk meningkatkan hal tersebut maka diperlukan suatu pendekatanpembelajaran yang tepat, yaitu dengan cara menerapkan pendekatan pembelajaran kontestual. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK), dimana penelitian tersebut terdiri dari dua siklus. Adapun teknik pengumpulan data yang digunakan dengan cara observasi dan tes/ penugasan. Prosedur peneliti-an tindakan kelas yang dilakukan terdiri dari empat tahap, yaitu: (1) perencanaan, (2) tindakan, (3) observasi, dan (4) refleksi. Hasil penelitian menunjukkan bahwa pada pelaksanaan siklus I prosentase siswa yang mendapatkan nilai ≤ 76,22 sebanyak 60,87% dan siswa yang men-dapatkan nilai ≥ 76,22 sebanyak 39,13%. Ketuntasan kelulusan siswa secara klasikal pada siklus I ≤ 76%, sehingga dilakukan remidial untuk satu kelas. Pada siklus II nilai yang diperoleh telah mencapai KKM. Hal ini ditunjukkan dengan prosentase siswa yang mendapatkan nilai ≤ 76,22 sebanyak 13,05% dan siswa yang mendapatkan nilai ≥ 76,22 sebanyak 86,95%. Siklus I ke siklus II yang telah dilakukan, mengalami peningkatan prestasi belajar sebesar 47,82 %. Perkembang-an siswa setelah pelaksanaan tindakan adalah: (1) siswa aktif dalam pembelajaran, (2) siswa aktif dalam mengajukan pertanyaan dan pendapat, (3) kerjasama dalam kelompok meningkat, (4) siswa sudah berani mempresentasikan hasil belajarnya kedepan kelas, dan(5) siswa bisa mengerjakan tugas dari guru. Dari hasil penelitian tersebut dapat disimpulkan bahwa: (1) penerapan pendekatan pembelajaran kontekstual dapat menciptakan pembelajaran yang efektif dan efisien, dan (2) penerapan pendekatan pembelajaran kontekstual pada kompetensi keahlian membuat gambar rencana balok beton bertulang dapat meningkatkan prestasi belajar siswa XI GB 2 SMK Negeri 6 Malang.

Test development by English teachers at SMAN 3 Malang / Ririn Indah Prastiwi


This study is intended to find out the test development by English teachers in SMAN 3 Malang in terms of (1) the teachers’ knowledge of test development, (2) the stages of test development by English teachers, and (3) the supporting factors and obstacles faced by the teachers in test development. This research design is descriptive qualitative. This study is a case study and four certified English teachers are chosen as the subjects of this study. The instruments are used to collect the data, namely, interview, the school documents, and questionnaire. The findings of the study are as follows. First, the English teachers in SMAN 3 Malang lack the knowledge of stages in test development. The second, the stages of test development by English teachers do not follow the standard procedure in test development. Third, the factors that supported the teachers in test development are the availability the material and rich experience in test development. And the last, the obstacles or problems faced by the teachers in the test development are mostly due to the limitation of time Key words: test development, English teachers, supporting factors, obstacles

Penggunaan permainan tata angka untuk meningkatkan aktifitas belajar mengenal bilangan di kelompok A TK Satu Atap SDN Tulusrejo 3 Kota Malang / Ida Fariani


Perancangan instalasi penerangan pada stadion sepak bola / Januar Saraswanto


Kata Kunci: Perancangan Penerangan Stadion, cahaya. Sepak bola merupakan salah satu olahraga yang banyak digemari oleh semua kalangan baik yang kaya maupun yang miskin. Dalam sebuah pertandingan, olahraga ini dimainkan oleh dua kelompok berlawanan yang masing-masing berjuang untuk memasukkan bola ke gawang kelompok lawan. Masing-masing kelompok beranggotakan sebelas pemain, dan karenanya kelompok tersebut juga dinamakan kesebelasan, selain itu dala sebuah kelompok juga terdapat seorang pelatih. Menurut Zubaidi (2009), Olahraga Sepak bola saat ini bukan lagi hanya sekadar olahraga atau permainan, namun telah menjadi industri di berbagai kejuaraan dunia. Salah satunya di ajang Euro 2008, pertandingan sepak bola di kalangan negara-negara Eropa yang telah berlangsung di Swiss dan Austria. Dalam event yang berlangsung empat tahun sekali itu ada mekanisme yang mempertemukan hukum permintaan dan penawaran. Di sana ada tim, pemain, pelatih, dan penyelenggara sebagai pemasok. Di sana ada pula pemirsa yang membeli permainan, tontonan, drama, dan hiburan sebagai komoditas. Oleh karena itu, kenyamanan bagi penonton dalam menonton pertandingan menjadi hal yang penting dalam kelancaran penyelenggaraan pertandingan. Salah satunya yang mempengaruhi kenyamanan penonton adalah sistem penerangan suatu stadion pada malam hari. Penerangan yang baik adalah penerangan yang tidak menyebabkan silau pada mata pemain maupun penonton. Pada perancangan instalasi penerangan sebuah stadion banyak hal yang mempengaruhi kualitas penerangan, diantaranya jenis lampu yang digunakan, posisi lampu dan sebagainya. Perancangan ini menggunakan sistem 6 tiang dan dibuat dengan sebuah simulasi 3D. Perhitungan sudut yang dihasilkan jika lampu pertama memiliki sudut sebesar 600 , maka sudut dari lampu kedua adalah sebesar 62.10. pada sistim 6 tiang rasio kerataan lebih mendekati nilai 1 dibanding sistim 2 dan 4 tiang dengan jumlah dan jenis lampu yang sama tiap tiang, karena semakin banyak terjadi perpotongan cahaya lampu sorot menjadikan pencahayaan pada permukaan lapangan semakin merata.

Pengaruh kebiasaan belajar, kepercayaan diri siswa, dan lingkungan keluarga terhadap hasil belajar mata pelajaran akuntansi (SMA Negeri 1 Sumberpucung Kabupaten Malang) / Nur Khasanah


Kata Kunci: Kebiasaan Belajar, kepercayaan diri siswa, dan lingkungan Keluarga, Hasil Belajar. Upayah mencetak sumberdaya manusia yang berkualitas dapat dilakukan dengan melakukan peningkatan mutu di bidang pendidikan. Dalam hal ini peserta didik dan hasil belajar memiliki peran yang sangat penting posisinya dalam meningkatkan mutu pendidikan. Untuk mendapatkan hasil belajar yang baik ada beberapa faktor yang mempengaruhinya yaitu: kebiasaan belajar, kepercayaan diri siswa dan lingkungan keluarga. Dengan demikian, penelitian ini ingin menguji tentang pengaruh kebiasaan belajar, kepercayaan diri siswa, dan lingkungan keluarga terhadap hasil belajar siswa jurusan IPS di SMA Negeri 1 Sumberpucung. Metode penelitian yang digunakan adalah jenis rancangan penelitian eksplanatif dengan desain penelitian menunakan analisis regresi linier berganda. Teknik pengumpulan data dilakukan dengan mengunakan angket dan dokumentasi nilai rapor. Hasil penelitian ini menunjukkna bahwa: 1) ada pengaruh kebiasaan belajar terhadap hasil belajar siswa jurusan IPS di SMA Negeri 1 Sumberpucung dengan melihati hasil uji t yang menunjukkan sig 0,023 < 0,05, 2) ada pengaruh kepercayaan diri siswa terhadap hasil belajar siswa jurusan IPS di SMA Negeri 1 Sumberpucung dengan melihati hasil uji t yang menunjukkan sig 0,005 < 0,05, dan 3) ada pengaruh lingkungan keluarga terhadap hasil belajat siswa jurusan IPS di SMA Negeri 1 Sumberpucung dengan melihati hasil uji t yang menunjukkan sig 0,037 < 0,05. Berdasarkan hasil penelitian yang telah dilakukan, Guru diharapkan mampu memberikan contoh perilaku/kebiasaan belajar yang baik di dalam kelas untuk membentuk disiplin belajar siswa, guru juga diharapkan dapat menggali kepercayaan diri siswa demi kesuksesan proses belajar, sehingga siswa bisa lebih maksimal lagi dalam belajarnya dan dapat memperoleh hasil belajar yang lebih maksimal lagi.

Pengaruh pembuangan limbah cair pabrik bir terhadap kualitas air sungai Cumpleng di Kecamatan Kutorejo Kabupaten Mojokerto / Suprianto


Kalimat Kunci: Limbah Industri, Kualitas Air Sungai Di Desa Sampang Agung Kecamatan Kutorejo Kabupaten Mojokerto terdapat pabrik bir yang menghasilkan limbah cair yang di buang ke sungai Cumpleng. Padahal pabrik ini berada pada ketinggian kurang lebih 350m dpl dengan ketinggian tersebut kemungkinan pencemaraan air oleh limbah pabrik ini berdampak secara luas, Dampak pembuangan limbah cair ini sering dikeluhkan oleh warga yang berada di daerah aliran sungai. Karena air sungai menjadi bau dan ada endapan warna hitam. Tujuan dari penelitian adalah untuk mengkaji kualitas limbah industri bir, mengkaji kualitas sungai Cumpleng, dan bagaimanakah hubungan antara jarak dengan kualitas air. Penelitian ini merupakan penelitian survei lapangan dengan pengambilan sampel berupa limbah industri bir dan air sungai Cumpleng. Pengambilan sampel menggunakan metode Purposive Sampling. Analisis data berupa analisis komparasi dan analisis korelasi. Analisis komparasi limbah cair pabrik menggunakan standar baku mutu limbah cair pabrik bir sesuai dengan SK Gubenur Jawa Timur no 45 tahun 2002 dan analisis kualitas air sungai Cumpleng sesuai dengan baku mutu air golongan II berdasarkan PP.RI. No 82 tahun 2001. Analisis korelasi menggunakan korelasi product-moment Berdasarkan hasil uji laboratorium kualitas limbah industri bir tidak memenuhi standar baku mutu limbah industri berdasarkan SK Gubenur Jawa Timur no 45 tahun 2002 hal ini disebabkan 3 parameter tidak memenuhi standar baku mutu meliputi parameter COD sebesar 1088,6 Mg/L, parameter BOD5 sebesar 238 Mg/L dan parameter TSS sebesar 2827 Mg/L sedangkan parameter pH dan fenol memenuhi standar baku mutu yaitu nilai pH sebesar 8,03 dan Fenol sebesar 0,016 µg/L.Berdasarkan hasil uji laboratorium kualitas air sungai Cumpleng nilai pH masih dibawah standar baku mutu kualitas air golongan II, nilai BOD5 titik 2-6 melebihi standar baku mutu, nilai COD titik 2-6 melebihi standar baku mutu, nilai TSS titik 2-6 melebihi standar baku mutu dan nilai fenol masih di bawah standar baku mutu. Terdapat hubungan jarak dengan tingkat pencemaran. Besar kecilnya korelasi menunjukan nilai yang berbeda-beda pada setiap parameter. Untuk korelasi sangat tinggi terdapat pada parameter pH dengan nilai -0,916 dan Fenol dengan nilai -0,904 dan TSS dengan nilai -0,903, korelasi sedang terdapat pada parameter COD dengan nilai -0,779 dan parameter BOD5 dengan nilai -0,714. Pabrik industri bir di kecamatan Kutorejo Kabupaten Mojokerto diharapkan lebih memperhatikan proses pengolahan limbah sebelum dibuang ke sungai harus diolah secara maksimal dan memenuhi prosedur yang ada selain itu diharapkan pemerintah melakukan pengawasan secara intensif terhadap proses-proses pengolahan limbah industri agar limbah tersebut tidak berbahaya apabila dibuang ke sungai

Hubungan pola asuh ibu terhadap status gizi balita di Desa Lenteng Timur Kabupaten Sumenep / Eline Wijaya Rukmi


Kata Kunci: Pola Asuh, Status Gizi, Balita Penyebab kurang gizi dipengaruhi oleh faktor langsung yaitu makanan dan penyakit infeksi, tidak langsung yaitu ketahanan pangan keluarga, perawatan kesehatan, dan pola asuh. Pola asuh meliputi feeding (pelaksanaan pemberian makanan balita), caring (perawatan kesehatan balita), pelaksanaan hygiene dan sanitasi lingkungan, dan rangsangan psikososial. Tujuan penelitian ini ialah untuk mengetahui hubungan faktor-faktor pola asuh, caring, hygiene sanitasi lingkungan, dan rangsangan psikososial terhadap status gizi balita. Hipotesis alternatif (Ha) dalam penelitian ini adalah ada hubungan yang signifikan antara pola asuh ibu terhadap status gizi balita. Penelitian ini termasuk dalam penelitian survey dengan metode pendekatan cross sectional. Variabel bebas dalam penelitian ini ialah pola asuh Ibu diukur menggunakan kuesioner tertutup, dan variabel terikat ialah status gizi balita diukur dengan antropometri BB/U dan diinterpretasikan melalui standar baku WHO/NHCS. Uji coba validitas instrument menggunakan pearson product moment, dan uji reliabilitasnya menggunakan rumus cronbach alpha. Koefisien korelasi menggunakan korelasi rank spearman. Hasil penelitian menunjukkan sebagian besar (95,6%) pelaksanaan pemberian makan balita (feeding) pada kategori baik, pelaksanaan perawatan kesehatan (caring) dan pelaksanaan hygiene dan sanitasi lingkungan seluruhnya (100%) pada kategori baik, sebagian besar (92,2%) rangsangan psikososial dalam kategori baik. Pada hasil data pengukuran status gizi balita menunjukkan sebagian besar (77,8%) balita berada pada status gizi baik, masih ditemukan sebagian kecil (1,1%) balita berstatus gizi buruk, hal ini disebabkan riwayat persalinan Ibu yang tidak optimal. Hasil analisis data penelitian menunjukkan nilai koefisien korelasi feeding dan caring oleh ibu terhadap status gizi balita sebesar 0,609, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Sedangkan korelasi antara hygiene dan sanitasi lingkungan terhadap status gizi terhadap status gizi balita sebesar 0,526, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Korelasi antara rangsangan psikososial terhadap status gizi balita sebesar 0,549, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Korelasi antara pola asuh ibu terhadap status gizi balita sebesar 0,625, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Karena keterbatasan peneliti, beberapa faktor lain yang mempengaruhi status gizi belum diteliti dalam penelitian ini yaitu tingkat ekonomi, tingkat pengetahuan/keterampilan ibu, jumlah anak/keluarga. Pada penelitian lebih lanjut hal tersebut akan lebih baik jika diteliti langsung seberapa kuat hubungannya terhadap status gizi melalui metode lain dalam pengukuran status gizi yaitu antropometri TB/U, atau BB/TB, dan LLA (Lingkar Lengan Atas), apabila biaya dan waktu penelitian mencukupi bisa melalui pengukuran Biokimia, dan Biofisika.

Pembuatan video berbasis animasi tiga dimensi sebagai media pendamping materi front office untuk siswa Jurusan Akomodasi Perhotelan Sekolah Menengah Kejuruan Cor Jesu Malang / Daniel Arya Yudhanta


Kata kunci: Front Office, SMK Cor Jesu, Pembuatan Video Animasi Tiga Dimensi Kantor Depan (Front office) adalah cermin dari kualitas hotel pertama kali bagi tamu. Itulah mengapa kantor depan merupakan salah satu materi penting yang harus disampaikan pada siswa terutama pada jurusan akomodasi perhotelan. Sekolah Menengah Kejuruan Cor Jesu adalah salah satu sekolah menengah kejuruan yang menyediakan jurusan akomodasi perhotelan di kota Malang. Sehingga sekolah ini menggunakan materi front office sebagai salah satu materi penting yang harus disampaikan. Hal ini dirasa penting oleh sekolah sebagai salah satu bentuk usaha sekolah mempersiapkan siswa agar mampu menjadi tenaga professional ketika telah menyelesaikan pendidikannya. Proses penyampaian materi front office di SMK Cor Jesu masih menggunakan metode belajar konvensional dimana guru yang mendominasi kelas sedangkan siswa hanya mendengarkan. Adapun media yang sering digunakan adalah power point, dan hand out. Cara belajar yang demikian dirasa masih kurang efektif ketika diterapkan karena cenderung membosankan bagi siswa dan kurang inovatif. Maka perlu dibentuk sebuah cara belajar baru yang lebih menyenangkan dan inovatif. Salah satu alternatif yang dapat digunakan adalah dengan mengembangkan media yang digunakan. Adapun media yang dapat ditawarkan adalah dengan menggunakan video berbasis animasi tiga dimensi sebagai media pendamping dalam proses belajar mengajar. Dalam tugas akhir ini dihasilkan sebuah video berbasis animasi tiga dimensi sebagai media pendamping materi front office untuk siswa jurusan akomodasi perhotelan di SMK Cor Jesu Malang. Diharapkan dengan adanya video ini dapat meningkatkan efektiffitas belajar siswa dan mampu membantu guru dalam penyampaian materi.

Analisis penggunaan pola draping pada gaun mode draperi / Siti Firdausiah


Kata kunci: pola draping, gaun mode draperi Menurut sejarahnya, pakaian yang dikenakan manusia awalnya berupa sehelai kain berbentuk segi empat yang diberi lubang tengahnya untuk memasukkan kepala, namun dengan perkembangan mode masa kini, begitu banyak variasi dan mode pakaian baik yang longgar dibadan maupun yang pas badan sehingga menunjukkan lekuk tubuh. Membuat pakaian yang bervariasi tersebut membutuhkan sebuah pola, karena tanpa menggunakan pola suatu pakaian dapat dibuat tetapi hasilnya tidak sesuai dengan yang diharapkan. Ketepatan, kecermatan, dan kemampuan dalam menganalisa posisi titik, garis tubuh si pemakai dan pemilihan media pola akan menentukan kualitas sebuah pola. Ada beberapa macam pola yang dapat digunakan dalam membuat busana diantaranya pola konstruksi dan pola draping. Pola konstruksi membutuhkan banyak ukuran dan dikerjakan pada kertas pola di atas meja datar, pola yang dihasilkan masih berupa pola dasar sehingga harus dibuat pecah pola agar sesuai dengan desain. Pola ini dianggap lebih rumit dibanding pola draping sehingga banyak desainer atau praktisi busana yang lebih condong memakai pola draping karena pembuatan polanya mudah dan hasilnya langsung siap pakai sesuai dengan desain (Sugiyem, 2008). Mode draperi merupakan mode beraliran klasik yang digemari sepanjang masa oleh pecinta mode sehingga desainer maupun praktisi busana dituntut untuk memenuhi kebutuhan konsumen busana mode draperi. Kemudahan dalam penggunaan pola draping pada pembuatan gaun mode draperi sangat dibutuhkan desainer maupun praktisi busana, maka penting kiranya menganalisis penggunaan pola draping pada gaun mode draperi. Draperi yang akan diteliti pada bagian garis leher dan panggul. Penelitian ini merupakan penelitian deskriptif yang bertujuan untuk mendeskripsikan penggunaan pola draping pada gaun mode draperi. Gaun yang diproduksi untuk penelitian ini menggunakan ukuran paspop S standar internasional. Validasi gaun oleh 3 panelis dengan instrumen lembar pengamatan yang terdiri dari beberapa kriteria penilaian. Teknik analisisnya menggunakan analisis persentase. Berdasarkan hasil validasi dari 3 panelis, penggunaan pola draping pada gaun mode draperi dileher, tingkat keluwesan/fleksibilitasnya diperoleh sebesar 77 % karena badan bagian depan menggunakan bahan serong sampai dengan batas potongan rok sedangkan penggunaan pola draping pada gaun mode draperi panggul, tingkat keluwesan/fleksibilitas diperoleh sebesar 100 %. Penggunaan pola draping tepat digunakan pada pembuatan gaun mode draperi pada leher dan panggul dengan ketepatan sebesar 93%.

Manajemen pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Dadapan Bondowoso / Fatahillah Arrozi


Tesis, Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing : (1) Prof. Dr. Ahmad Sonhadji, K.H., M.A., Ph.D. (II) Prof. Dr. Willem Mantja, M. Pd. Kata kunci: manajemen, pembiayaan pendidikan, anak kurang mampu Kendala utama dari lembaga pendidikan islam khususnya pesantren dalam menghadapi persaingan saat ini adalah ketidaksiapan sumber daya manusia juga meliputi kemampuan finansial. Hingga saat ini, tidak sedikit yang menjalankan proses belajar mengajarnya dengan SDM (Sumber Daya Manusia) pengajar dibawah rata-rata dan dukungan finansial seadanya. Jumlah santri yang berasal dari golongan tidak mampu terkadang lebih banyak daripada santri mampu, sehingga pondok pesantren pun tidak bisa beharap banyak terhadap sumbangan mereka untuk pelaksanaan pembiayaan pendidikan. Berangkat dari keingintahuan mengenai bagaimana pembiayaan pendidikan dikelola oleh sekolah-sekolah swasta di lembaga mereka, khususnya bagi anak-anak kurang mampu tersebut, maka peneliti tertarik untuk melakukan penelitian lebih mendalam di sebuah lembaga pendidikan swasta berbentuk pondok pesantren modern di sebuah kota kecil yaitu Kabupaten Bondowoso, pondok pesantren tersebut adalah Al-Ishlah Dadapan Bondowoso. Fokus dalam penelitian ini adalah manajemen pembiayaan pendidikan bagi anak-anak kurang mampu di pondok pesantren Al-Ishlah Bondowoso. Dari fokus tersebut diuraikan sebagai berikut: (1) Perencanaan pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Bondowoso, (2) Pengorganisasian pembiayaan pendidikan bagi anak-anak kurang mampu Pondok Pesantren Al-Ishlah Bondowoso, (3) Pelaksanaan pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Bondowoso, dan (4) Pengawasan pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Bondowoso. Pendekatan yang digunakan oleh peneliti yaitu pendekatan kualitatif dan jenis penelitiannya yaitu studi kasus. Pendekatan model ini digunakan karena permasalahan berupa bagaimana manajemen pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Dadapan Bondowoso masih belum jelas, kompleks dan penuh makna. Lokasi penelitian adalah Pondok Pesantren Al-Ishlah yang beralamatkan di Jl. Raya Jember No.17-18 Dadapan Grujugan Bondowoso Jawa Timur 68261. Dalam penelitian ini, sampel sumber data dipilih secara purposive dan bersifat snowball sampling. Penentuan sumber data disini masih bersifat sementara, dan akan berkembang kemudian sampai ke titik jenuh informasi setelah peneliti berada di lapangan. Agar diperoleh data yang lebih lengkap dan sesuai dengan fokus dan tujuan penelitian, maka teknik pengumpulan data dalam penelitian ini dilakukan dengan menggunakan tiga cara, yaitu : (1) Wawancara mendalam, (2) observasi partisipan, dan (3) dokumentasi. Dalam penelitian ini ada empat langkah yang dilakukan peneliti untuk menganalisis data yaitu analisis domain, taksonomi, komprehensial, dan analisis tema. Uji keabsahan data dilakukan dengan berbagai cara, yaitu uji kredibilitas data, uji dependabilitas data, uji transferabilitas, dan uji konfirmabilitas. Yang utama dilakukan adalah uji kredibilitas melalui perpanjangan waktu pengamatan, meningkatkan ketekunan, trianggulasi, diskusi dengan teman sejawat, memberi cek dan analisis kasus negatif. Berdasarkan uraian data dan temuan penelitian di lapangan maka peneliti dapat menarik kesimpulan sebagai berikut: (1) Pimpinan Pondok pesantren Al-Ishlah dalam menyusun perencanaan pembiayaan pendidikan bagi anak-anak kurang mampu mengedepankan hal-hal seperti (a) Melibatkan semua pengurus, (b) Merumuskan perencanaan yang fleksibel, dan (c) Mendasarkan kepedulian terhadap anak-anak kurang mampu agar supaya tercapai visi, misi dan tujuan pondok pesantren. (2) Pengorganisasian pembiayaan pendidikan bagi anak-anak kurang mampu dijalankan dengan: (a) Pembagian tugas yang jelas serta pendelegasian wewenang, (b) Penempatan personel yang amanah dan kompeten, dan (c) Melakukan pembinaan personel secara rutin dan berkala. (3) Pelaksanaan pembiayaan pendidikan bagi anak-anak kurang mampu meliputi: (a) Membagi santri ke dalam tiga golongan, yaitu Banuh, Basa dan Taba, (b) Penerimaan sumber pembiayaan pendidikan yang berasal dari sumbangan santri mampu dan BUMP, (c) Alokasi penggunaan pembiayaan pendidikan yang terprogram, dan (d) Prosedur pencairan pembiayaan pendidikan yang terorganisir dan rapi. (4) Pengawasan pembiayaan pendidikan bagi anak-anak kurang mampu dilakukan dalam dua tahap: (a) Dijalankan oleh biro pengawasan secara insidental dan berkala, dan (b) Dijalankan oleh pimpinan pondok dan wakil secara insidental dan berkala. Hasil penelitian ini disarankan kepada: (1) Pemerintah agar lebih memperhatikan pembiayaan pendidikan bagi anak-anak kurang mampu, dalam hal ini khususnya Kementrian Agama agar supaya dalam pembuatan keputusan dapat berkontribusi langsung dalam pembiayaan pendidikan terutama bagi lembaga pendidikan swasta, (2) Kepada penyelenggara pendidikan atau pondok pesantren lain, hasil penelitian ini dapat dijadikan model atau acuan dalam pengelolaan manajemen pembiayaan pendidikan yang tepat terutama bagi anak-anak kurang mampu, agar cita-cita pemerataan pendidikan di Indonesia bisa cepat tercapai,(3) Kepada pengamat pendidikan atau masyarakat pendidikan. Hasil penelitian ini dapat dimanfaatkan untuk memberikan wawasan dan kesadaran masyarakat luas dan masyarakat sekitar pondok bahwa diperlukan manajemen yang tepat dalam pengelolaan pembiayaan pendidikan bagi anak-anak kurang mampu. Secara konseptual dapat memperkaya teori tentang manajemen pembiayaan pendidikan, (4) Kepada peneliti lain, penelitian ini bisa dijadikan bahan referensi untuk memperluas wawasan pengetahuan dan keterampilan dalam kaitannya dengan manajemen pembiayaan pendidikan khususnya bagi anak-anak kurang mampu.

Launching program tabunganku dalam rangka promosi gemar menabung Bank Jatim / Decky Zakariiyah


Kata kunci : Launching, TabunganKu, Gemar Menabung Saat ini Bank Jatim telah mengadakan program ”TabunganKu” untuk kalangan Pelajar SD. untuk mulai membidik nasabah kecil melalui program tabungan bersama TabunganKu. Program ini diluncurkan pada tanggal 20 Februari 2010 bersamaan dengan pencanangan Tahun Menabung Nasional. TabunganKu merupakan terobosan program pemerintah guna meningkatkan tingkat menabung di tanah air. karena, tingkat menabung masyarakat saat ini tergolong masih rendah dibandingkan negara-negara tetangga. Harapannya TabunganKu ini bisa mengulang sukses seperti produk Tabanas. Untuk itu, melalui TabunganKu bisa menjadi alternatif produk pilihan investasi. Dalam hal ini Bank Jatim juga memperkenalkan kebiasaan menabung kepada anak sejak dini sebagai awal pembelajaran mereka tentang investasi.Kegiatan perancangan yang dilakukan bertujuan untuk menghasilkan buku cerita bergambar, untuk siswa kelas sekolah dasar dan menengah Bentuk dari media yang dirancangan antara lain : buku bergambar dari 11 buah cerita. Setiap gambar memiliki cerita yang terdiri dari kurang lebih satu sampai dua kalimat. Fasilitas pendukung berupa atm, buku tabungan, penggaris, pembatas buku, magnet lemari es, gantungan kunci yang di rancang khusus special untuk nasabah baru dalam promosi gemar menabung. media pendukung launching berupa poster, dan X banner. Model Perancangan dalam cerita bergambar Gemar Menabung, yang digunakan adalah model perancangan yang membutuhkan data untuk dianalisis mejadi sebuah konsep yang bertolak dari masalah dan hasil dari analisis data, yang bersifat linier dan berurutan langkah-langkah kerjanya atau disebut model prosedural atau rasional. Dalam model perancangan ini, langkah-langkah perancangan dilakukan dengan sitematik serta rasional dan terstruktur dengan menggunakan pendekatan ilmiah dari awal hingga akhir. Hasil dalam perancangan ini adalah buku cerita bergambar, untuk siswa kelas sekolah dasar dan menengah. Fasilitas pendukung berupa atm, buku tabungan, penggaris, pembatas buku, magnet lemari es, gantungan kunci yang di rancang khusus special untuk nasabah baru dalam promosi gemar menabung. media pendukung launching berupa poster, dan X banner. Penulis menyarankan agar perancang selanjutnya dapat membuat media yang lain agar dapat menarik nasabah agar gemar menabung di Bank Jatim

Pengembangan media cakram dari bahan kayu bekas dengan lapisan aluminium untuk pembelajaran lempar cakram kelas VII SMP Negeri 4 Kraksaan Kabupaten Probolinggo / Adhitya Yudha Putra


Kata kunci: Pengembangan, Pembelajaran, Lempar cakram, Cakram kayu Di dalam dunia pendidikan, pelajaran Pendidikan Jasmani Olahraga dan Kesehatan merupakan satu mata pelajaran yang harus dimasukan dalam kurikulum di semua jenis dari jenjang pendidikan mulai dari Taman Kanank-kanak (TK), Sekolah Dasar (SD), Sekolah Menengah Pertama (SMP), Sekolah Menengah Atas (SMA), sampai dengan Perguruan Tinggi (PT). Aktifitas jasmani dalam pendidikan jasmani telah mendapat sentuhan didaktik-metodik sehingga dapat di arahkan pada usaha pencapaian tujuan pembelajaran yaitu mengembangkan organik, neuromoskuler, intelektual dan emosional. Salah satu kendala dalam mengembangkan tujuan pembelajaran adalah rendahnya rasa partisipasi pembelajaran siswa khususnya kualitas hasil belajar. Oleh sebab itu, perlu adanya upaya-upaya guna meningkatkan minat dan motivasi pada siswa dalam aktifitas proses pembelajaran, yang pada gilirannya dapat meningkatkan kualitas hasil belajar. Salah satu upaya yang dilakukan adalah merancang pembelajaran secara sistematis, dengan cara memberdayakan teknologi pembelajaran dan media pembelajaran di kelas. Dengan demikian, perlu adanya komitmen tinggi bagi para guru yang lebih menekankan pada pemberdayaan teknologi pembelajaran dan media pembelajaran di kelas. Salah satu yang kurang diperhatikan dalam pengembangan pembelajaran Pendidikan Jasmani Olahraga dan kesehatan adalah pelajaran atletik. Banyak berbagai cabang atletik diantaranya adalah jalan, lari, lompat, lempar. Dalam nomor lempar juga terdapat banyak cabang diantaranya adalah tolak peluru, lempar lembing, lontar martil dan lempar cakram. Dari keempat golangan diatas yang akan dibahas lebih lanjut adalah lempar cakram. Untuk mendukung keberhasilan tujuan pembelajaran lempar cakram di sekolah, tentunya diperlukan adanya sarana dan prasarana yang memadai, hal ini yang menjadi salah satu faktor menghambat proses pembelajaran Pendidikan Jasmani Olahraga dan Kesehatan lempar cakram di sekolah. Dari hasil observasi dan wawancara terhadap guru pendidikan jasmani SMP Negeri 4 Kraksaan, pada saat pembelajaran lempar cakram cakram yang digunakan adalah cakram yang standart, berkaitan dengan jumlah media cakram yang tidak memungkinkan dan dirasakan media cakram terlalu berat yang digunakan dalam proses pembelajran lempar cakram. Hal inilah yang menghambat keberlangsungan pembelajaran dan rendahnya rasa partisispasi siswa dalam pembelajaran lempar cakram. Dari hasil angket siswa yang berkaitan dengan pembelajran lempar cakram di SMP 4 Negeri Kraksaan terdapat banyak keluhan diantaranya adalah: (1) 80% siswa merasa tidak senang dengan pembelajaran lempar cakram dan 20% siswa merasa menyenangkan dengan

Perancangan iklan layanan masyarakat tentang lutung jawa dari ancaman kepunahan / Jangkung Imam Fadli


Kata Kunci: Perancangan, Iklan Layanan Masyarakat, Lutung Jawa. Perancangan iklan layanan masyarakat tentang Lutung Jawa dari ancaman kepunahan ini menggunakan model perancangan prosedural. Proses perancangan diawali dengan mempelajari latar belakang dan fakta-fakta tentang Lutung Jawa yang ada di Indonesia pada umumnya. Tahap berikutnya adalah dilakukan pengumpulan data yang dibutuhkan, baik data pustaka maupun data lapangan yang akan dianalisis dan disintesis menjadi sebuah konsep kreatif dan konsep media. Iklan layanan masyarakat yang telah diaplikasikan sesuai dengan target audience diharap akan menekan angka perdagangan Lutung Jawa . Untuk itu perlu dilakukan sebuah evaluasi program kampanye yang telah dilakukan dengan cara mengamati perkembangan dari aktifitas-aktifitas yang merugikan tersebut, kemudian melakukan follow up terhadap semua program kampanye yang dilakukan sehingga kampanye yang dilakukan tidak hanya semata-mata dilakukan pada saat itu saja. Lutung Jawa yang memiliki nama latin (Trachypithecus auratus) merupakan salah satu satwa endemik Indonesia yang dilindungi oleh undang-undang tetapi masih terus diperdagangkan dan populasinya berkurang. Melihat latar belakang tersebut maka perlu dilakukan tindakan untuk melestarikannya, seperti memperbanyak media yang mengangkat tentang permasalahan Lutung Jawa. Bertujuan membantu masyarakat untuk mengetahui permasalahan Lutung Jawa yang terjadi di Indonesia. Keseluruhan menjadi media informasi kepada khalayak atau publik, pentingnya perlindungan, kepedulian, perundangan, antisipasi, kepunahan, da harapan media yang ada menjadi sebuah pembelajaran agar berubah menjadi suatu perubahan yang menuju kebaikan (Sebagai pilihan). ii Imam Fadli, Jangkung. 2011. “Designing Public Service advertising About Java Monkey from the Threat of Extinction”. Thesis, Visual Communications Design Studies Program, Department of Art and Design, Faculty of Arts, State University of Malang. advisors: (I) Rudi Irawanto, S.Pd, M.Sn (II) Mohammad Sigit, S.Sn

Sistem otomatisasi perlengkapan rumah tinggal berbasis PLC / Benny Eko Puji Pramono


Kata Kunci: Rumah tinggal, otomatis, kendali PLC. Dewasa ini diketahui perlengkapan pada rumah tinggal pada umumnya masih banyak yang diaktifkan secara manual. Seperti untuk membuka dan menutup pintu gerbang dilakukan dengan mendorong pintu tersebut dengan tangan. Selain itu pengisian air pada tandon yang sering tumpah karena kelalaian pemilik rumah yang lupa tidak mematikan pompa air. Walaupun sudah ada otomatisasi tetapi sifatnya masih manual misalnya menggunakan pelampung saja. Kemudian untuk menyalakan dan memadamkan lampu pada penerangan luar ruangan juga sering lupa melaksanakan tepat waktu akibatnya penggunaan energi listrik tidak optimal. Perlengkapan pada rumah tinggal yang diaktifkan secara manual ini membutuhkan tenaga dan waktu yang sebenarnya dapat dihemat dengan sebuah peralatan elektronik yang otomatis yaitu dengan menggunakan PLC. PLC merupakan salah satu alat otomatis yang biasa digunakan sebagai alat pengendali. Untuk mengatasi masalah pada perlengkapan rumah tinggal seperti lampu penerangan luar ruangan, pompa air, dan pintu gerbang yang masih diaktifkan secara manual, salah satu solusinya adalah dengan sistem otomatisasi perlengkapan rumah tinggal berbasis PLC. Rumah dengan sistem otomatisasi perlengkapan rumah tinggal ini berguna untuk mengontrol penerangan luar ruangan secara otomatis sesuai tingkat kegelapan, level tandon air dan buka tutup pintu gerbang secara otomatis. Keseluruhan dari sistem otomatisasi perlengkapan rumah tinggal ini dikendalikan oleh PLC. Dalam sistem otomatisasi perlengkapan rumah tinggal berbasis PLC terdapat tiga sumber tegangan, yaitu 24 VDC untuk kontak input PLC dan input pada sensor photodioda, 12 VDC untuk input LDR dan 220 VAC untuk output dari relay. Jika PB 1 diaktifkan maka sistem RUN, jika PB 2 diaktifkan maka berfungsi untuk mematikan sistem RUN. Jika Sensor 1 / Sensor 2 aktif maka akan mengaktifkan output PUTAR 1. Selain itu juga jika Limit Switch 1 aktif akan mematikan output PUTAR 1. Jika Sensor 3 aktif akan mengaktifkan output PUTAR 2. Selain itu juga jika Limit Switch 2 aktif maka akan mematikan output PUTAR 2. Jika Sensor 4 aktif maka akan mengaktifkan dan mematikan LAMPU. Jika Limit Switch 3 aktif maka akan berfungsi untuk mengaktifkan POMPA

Pengaruh tingkat suku bunga BI (BI Rate), DER (Debt to Equity Ratio), ROA ( Return on assets), dan CR (Current ratio) terhadap bagi hasil pihak ketiga non Bank pada Bank Umum Syariah periode 2008-2010 / Sukardiono


Kata Kunci: BI Rate, Debt to Equity Ratio (DER), Return on Assets (ROA), dan Current Ratio (CR), bagi hasil pihak ketiga non bank. Perbankan syariah mengalami perkembangan yang semakin pesat, hal ini ditunjukkan dengan banyaknya bank konvensional yang mulai membuka unit usaha syariah. Hal ini menunjukkan bahwa sistem bagi hasil menjadi daya tarik bagi kreditor untuk menggunakan jasa perbankan syariah. Sistem bagi hasil merupakan sistem di mana dilakukan perjanjian dalam melakukan kegiatan usaha, dimana dalam usaha tersebut diperjanjikan adanya pembagian hasil atas pendapatan yang akan didapat antara pihak-pihak yang berkepentingan. Ada banyak faktor yang dapat digunakan untuk memprediksi bagi hasil, beberapa diantaranya adalah BI Rate, DER, ROA, dan CR. Permasalahan yang akan dikaji dalam penelitian ini adalah apakah terdapat pengaruh BI Rate, DER, ROA, dan CR terhadap bagi hasil pihak ketiga non bank pada bank umum syariah secara simultan maupun secara parsial. Populasi yang digunakan dalam penelitian ini adalah bank umum syariah yang ada di seluruh Indonesia yang berjumlah 10 pada tahun 2010, sedangkan teknik pengambilan sampel menggunakan purposive sampling. Dari metode tersebut diperoleh tiga bank umum syariah yaitu PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mandiri dan PT Bank Syariah Mega Indonesia. Jenis data yang digunakan adalah data sekunder yang diperoleh dari PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mandiri, dan PT Bank Syariah Mega Indonesia periode 2008-2010. Alat analisis yang digunakan adalah analisis regresi berganda. Hasil penelitian menunjukkan secara parsial BI Rate, DER, dan CR berpengaruh terhadap bagi hasil pihak ketiga non bank dengan tingkat signifikansi masing-masing sebesar 0,035, 0,000, dan 0,000, sedangkan ROA tidak berpengaruh terhadap bagi hasil pihak ketiga non bank dengan tingkat signifikansi sebesar 0,837. Secara simultan BI Rate, DER, ROA, dan CR berpengaruh terhadap bagi hasil pihak ketiga non bank dengan tingkat signifikansi sebesar 0,000. Saran yang dapat diberikan penulis dalam penelitian ini adalah: (1) perusahaan harus selalu menjaga kinerja keuangan yang terdiri dari DER, ROA, dan CR karena rasio tersebut digunakan oleh kreditor sebagai bahan pertimbangan dalam menanamkan modal, selain itu perusahaan harus memperhatikan faktor ekonomi lain seperti inflasi dalam mengambil keputusan, (2) untuk penelitian selanjutnya diharapkan dapat menambah periode observasi dan menambah sampel penelitian, serta menggunakan rasio keuangan lain dalam mengukur kinerja keuangan perbankan.

Pengembangan bahan ajar berorientasi pengajaran kuantum (Quantum teaching) pada materi alat-alat optik untuk sekolah menengah atas (SMA) kelas X / Farid Fatoni Setyawan


Kata Kunci : bahan ajar, quantum teaching, alat-alat optik. Proses pembelajaran fisika perlu dilakukan dengan cara yang menarik dan menyenangkan, mengingat pembelajaran fisika merupakan kegiatan yang mempelajari ilmu pengetahuan tentang gejala alam di sekitar kita. Keadaan menarik, santai, dan menyenangkan akan membantu siswa untuk menyerap materi pelajaran dengan baik. Quantum teaching merupakan model pembelajaran yang menekankan pada penciptaan suasana belajar yang efektif dan menyenangkan serta menekankan terciptanya interaksi antara siswa dengan lingkungan. Terciptanya suasana belajar yang menarik dan menyenangkan, dipengaruhi oleh persiapan perangkat pembelajaran yang baik, salah satunya adalah bahan ajar. Bahan ajar yang baik disusun dengan bahasa yang mudah dimengerti dan menarik sehingga dengan bahan ajar yang baik akan mempermudah siswa dalam memahami konsep-konsep fisika. Berdasarkan uraian tersebut maka dikembangkan bahan ajar berorientasi Quantum Teaching pada materi alat-alat optik. Penelitian ini bertujuan untuk mengembangkan bahan ajar berorientasi Quantum Teaching pada materi alat-alat optik untuk SMA kelas X agar mempermudah siswa dalam mempelajari konsep alat-alat optik. Penelitian ini juga bertujuan untuk mendeskripsikan kelayakan produk dan mengetahui karakteristik produk yang dihasilkan. Penelitian ini menggunakan rancangan penelitian & pengembangan dengan langkah-langkah meliputi tahap penelitian dan pengumpulan data, perencanaan, pengembangan produk awal, uji coba lapangan awal dan revisi produk akhir. Penelitian ini menggunakan teknik validasi isi yang dilakukan oleh validator yang berasal dari pihak dosen dan guru sebagai ahli serta dilakukan uji coba awal terhadap siswa. Pengumpulan data dilakukan dengan menggunakan angket yang disertai rubrik. Jenis data penelitian meliputi data kuantitatif berupa penilaian validator berdasarkan Skala Likert dan data kualitatif berdasarkan komentar dan saran dari validator. Produk akhir penelitian ini adalah bahan ajar berorientasi Quantum Teaching pada materi alat-alat optik. Berdasarkan hasil analisis data, produk akhir yang dihasilkan sudah memenuhi kriteria layak dan sudah direvisi pada beberapa bagian berdasarkan komentar dan saran dari validator. Produk akhir yang dihasilkan memiliki karakteristik yang berbeda dari bahan ajar yang lain, diantaranya: setiap awal materi diawali pembahasan yang memotivasi belajar siswa dan pertanyaan-pertanyaan sederhana, terdapat kata mutiara di setiap halaman, setiap pembahasan diperjelas dengan gambar, pembahasannya sederhana dan mudah dimengerti siswa, terdapat Web Link dan Mind Mapping serta desain isi lebih menarik dan full colour.

Pengembangan matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman 1 Kecamatan Tongas Kabupaten Probolinggo / Akhmad Hidayat


Kata Kunci: Pengembangan, Matras modifikasi, Pendidikan Jasmani, Senam Lantai Matras modifikasi merupakan salah satu alat bantu belajar yang dapat digunakan dalam pembelajaran pendidikan jasmani dan kesehatan khususnya pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo. Pembuatan matras modifikasi ini memanfaatkan potensi lingkungan alam khususnya daerah Probolinggo yang kaya akan kelapa, sehingga matras modifikasi ini berbahan dasar sabut kelapa. Matras ini dikembangkan sesuai dengan kebutuhan guru serta siswa pada matras yang selama ini sudah rusak. Matras modifikasi yang berbahan dasar sabut kelapa ini diolah, dikembangkan, serta diuji kelayakannya guna mendapatkan hasil yang optimal. Dengan adanya matras modifikasi ini diharapkan dapat membantu pembelajaran serta sebagai pengganti matras yang sudah tidak dapat digunakan lagi. Sesuai dengan latar belakang diatas penelitian dan pengembangan ini bertujuan untuk mengembangkan matras modifikasi sesuai dengan karakteristik siswa sekolah dasar yang memiliki fungsi sebagai pengganti matras matras standar pada senam lantai pada umumnya. Penelitian ini menggunakan metode penelitian dan pengembangan dari Borg and Gall (1983:775). Peneliti tidak menggunakan keseluruhan dari langkah-langkah Borg and Gall tetapi hanya menggunakan 7 langkah yang berpedoman pada Ardhana (2002:9). Adapun 7 langkah yang dipilih oleh peneliti untuk pengembangan matras modifikasi ini adalah sebagai berikut: 1) Riset dan pengumpulan informasi termasuk mengkaji pustaka dan observasi lapangan. 2) Perencanaan bentuk pengembangan matras modifikasi. 3) evaluasi para ahli dengan menggunakan 1 ahli senam lantai dan 1 ahli pembelajaran pendidikan jasmani. 4) Revisi rancangan produk berdasarkan evaluasi para ahli (hasil rancangan berupa produk awal). 5) Uji coba kelompok kecil yang diadakan di sekolah dengan 6-14 subyek dalam yang diteliti menggunakan kuesioner kemudian di analisa. 6) Uji coba lapangan diadakan di sekolah dengan 10-80 subyek yang diteliti. 7) Revisi produk dari hasil uji coba lapangan dengan menggunakan kelompok besar, yang menghasilkan produk berupa matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo. Hasil revisi produk dari tinjauan para ahli menyatakan bahwa produk yang dikembangkan sudah baik dan dapat digunakan untuk uji produk. Dari hasil analisis uji coba (kelompok kecil) diperoleh bahwa pengembangan matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo memenuhi kriteria baik yaitu antara 80-100%. Sedangkan dari hasil analisis uji lapangan (kelompok besar) di atas, maka diperoleh bahwa pengembangan matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo tersebut telah memenuhi kriteria baik yaitu antara 80-100%. Berdasarkan hasil analisis data uji coba kelompok kecil terhadap 14 siswa dan uji kelompok besar yang berjumlah 72 siswa kelas IV dan V SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo dinyatakan dapat digunakan. Produk pengembangan berupa matras modifikasi sebagai pengganti matras standar yang memiliki harga lebih ekonomis diharapkan dapat dijadikan alat bantu pembelajaran pendidikan jasmani khususnya pada materi senam lantai.

Pengaruh keaktifan berorganisasi terhadap prestasi akademik mahasiswa Jurusan Teknik Sipil Fakultas Teknik Universitas Negeri Malang / Erik Susanto


Kata Kunci: Keaktifan Berorganisasi, Prestasi Akademik Aktivitas berorganisasi merupakan kegiatan yang dilakukan mahasiswa diluar jam belajar dalam rangka mengembangkan minat dan bakat yang dimiliki oleh mahasiswa. Organisasi tersebut diperlukan oleh mahasiswa sebagai wadah untuk mengembangkan dan mengasah kemampuan yang dimiliki. Tidak dapat dipungkiri banyak pengaruh positif dan negatif dari keikutsertaan mahasiswa dalam organisasi kemahasiswaan. Pengaruh positif dari keikutsertaan mahasiswa kedalam organisasi adalah mahasiswa dapat mengaktualisasikan dirinya, mengembangkan kemandiriannya, dan mempunyai cara berpikir yang matang jika berada di tengah masyarakat, sedangkan pengaruh negatif yang mungkin timbul adalah mahasiswa lambat dalam menyelesaikan perkuliaahnya, bahkan mahasiswa yang terlalu idealis terhadap organisasinya rawan drop out (DO). Pandangan ini perlu dikaji lebih jauh karena tidak semua mahasiswa yang aktif dalam berorganisasi tidak dapat meraih prestasi akademik yang baik. Penelitian ini dilakukan untuk mengetahui perbedaan prestasi akademik antara mahasiswa yang sangat aktif, aktif, kurang aktif, dan tidak aktif berorganisasi, serta besar pengaruh keaktifan berorganisasi terhadap prestasi akademik. Populasi dalam penelitian ini adalah seluruh mahasiswa Jurusan Teknik Sipil FT-UM tahun 2008-2009, dan sampelnya adalah 30% dari populasi. Teknik pengumpulan data untuk variabel keaktifan berorganisasi menggunakan angket dan variabel prestasi akademik menggunakan teknik dokumentasi. Teknik analisis data menggunakan analisis varian satu jalan(one way anava). Hasil penelitian diketahui terdapat perbedaan prestasi akademik antara mahasiswa yang sangat aktif, aktif, kurang aktif, dan tidak aktif berorganisasi. Kelompok tidak aktif dengan kelompok sangat aktif berbeda secara signifikan dengan bilangan signifikansi sebesar 0,005 < 0,05. Kelompok sangat aktif mempunyai prestasi lebih tinggi (IPK rata-rata 3,03) dari kelompok tidak aktif (IPK rata-rata 2,75). Kelompok tidak aktif dengan kelompok kurang aktif berbeda secara signifikan, dengan bilangan signifikansi 0,026 0,05. Hasil dari pengujian untuk mencari besar pengaruh dari keaktifan berorganisasi terhadap prestasi akademik, didapatkan hasil nilai R square 0,119. Hal ini berarti 11,9% prestasi akademik dipengaruhioleh keaktifan berorganisasi, sedangkan 88,1% dipengaruhi oleh faktor-faktor lain. Kesimpulan dari penelitian ini adalah terdapat perbedaan prestasi akademik antara mahasiswa yang sangat aktif, aktif, kurang aktif, dan tidak aktif berorganisasi. Prestasi akademik mahasiswa yang sangat aktif berorganisasi lebih tinggi dari mahasiswa yang aktif, kurang aktif, dan tidak aktif berorganisasi. Sedangkan pengaruh dari keaktifan berorganisasi terhadap prestasi akademik relatif kecil (11,9%). Saran yang dapat diberikan adalah (1) bagi mahasiswa khususnya yang terlibat secara aktif di organisasi harus bisa mencermati pembagian waktu yang tersedia untuk kuliah dengan kegiatan organisasi guna meninggkatkan kualitas dan prestasi akademik, (2) bagi peneliti selanjutnya yang ingin melakukan penelitian yang sejenis, maka disarankan agar menggunakan subjek yang lebih luas agar didapatkan hasil yang lebih baik.

Implementasi keselamatan dan kesehatan kerja pada praktikum teknik sepeda motor program studi teknik otomotik di SMK Negeri 2 Negara / I Putu Gde Raka Putra


Kata kunci: Keselamatan dan Kesehatan Kerja (K3), Praktikum Keselamatan Kerja adalah keselamatan yang berhubungan dengan peralatan, tempat kerja, lingkungan kerja, serta cara-cara dalam melaksanakan pekerjaan. Keselamatan kerja tidak hanya melindungi karyawan yang sedang bekerja di tempat kerja tersebut, tetapi juga orang dari luar perusahaan yang sedang berada di dalam lingkungan tempat kerja untuk keperluan tertentu. Penelitian ini bertujuan untuk mendeskripsikan beberapa hal mengenai implementasi keselamatan dan kesehatan kerja (K3) pada praktikum teknik sepeda motor program studi teknik otomotif di SMK Negeri 2 Negara. Rancangan penelitian ini adalah deskriptif dengan pendekatan kuantitatif. Data dianalisis dari hasil observasi, kuesioner, dan wawancara menggunakan metode statistik deskriptif. Hasil penelitian menunjukan bahwa implementasi keselamatan dan kesehatan kerja (K3) pada praktikum teknik sepeda motor program studi teknik otomotif di SMK Negeri 2 Negara sebagai berikut: a) fasilitas K3 pada ruang praktikum teknik sepeda motor di SMK Negeri 2 Negara rata-rata baik yang mencakup tata tertib praktikum, penerangan dan pencahayaan, penyediaan alat-alat praktikum, tata letak engine stand dan peralatan kerja, dan ketersediaan bahan dan alat pembersih dan tempat sampah. b) pelaksanaan K3 pada praktikum teknik sepeda motor di SMK Negeri 2 Negara rata-rata baik yang mencakup beberapa hal seperti melakukan praktek dengan berdoa terlebih dahulu, senam pemanasan, dan meminta ijin dari guru, menggunakan pakaian praktik lengkap, mengoperasikan peralatan dengan benar dan aman, guru memberikan briefing pra-praktikum, perlakuan pengawasan guru terhadap semua praktikan, instruksi metode yang aman dan c) terdapat kendala implementasi K3 yang dihadapi sekolah, guru dan siswa yaitu; minimnya dana yang dianggarkan untuk pengadaaan dan perbaikan sarana praktikum dan K3, kondisi lingkungan kerja yang tidak aman, dan sebagian siswa tidak mematuhi peraturan pada saat praktik. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa implementasi keselamatan dan kesehatan kerja (K3) pada praktikum teknik sepeda motor program studi teknik otomotif di SMK Negeri 2 Negara tergolong kategori baik, terlihat dari implementasi K3 sudah mencakup sebagian besar aspek dari sub variabel yang meliputi fasilitas K3, pelaksanaan K3, namun masih terdapat kendala. Hal lain yang perlu mendapatkan perhatian khusus adalah aspek perlengkapan K3 pada ruang praktik. Pengawasan yang ketat juga perlu ditingkatkan oleh guru selama kegiatan praktikum, mengingat siswa masih butuh pengawasan dan bimbingan demi kelancaran proses belajar mengajar.

Pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa anak kelompok B di TK PGRI III Kebotohan Kecamatan Kraton / Endang Andayani


Kata Kunci : Media gambar, Kemampuan bahasa anak, TK. Taman kanak-kanak adalah salah satu bentuk pendidikan jalur formal yang menyediakan program pendidikan usia dini. Untuk mencapai tujuan pendidikan tidaklah mudah karena diperlukan sarana dan prasarana yang dapat mendukung tercapainya tujuan pendidikan. Keberhasilan pendidikan tidak terlepas dari peran serta guru dalam mengelola pengajaran sehingga siswa dapat belajar dengan tenang dan memungkinkan untuk mencapai prestasi dalam belajar. Kemampuan berbahasa Indonesia pada usia pra sekolah kurang untuk itu peneliti memanfaatkan media gambar untuk mengembangkan kemampuan berbahasa anak. Penelitian ini bertujuan mendeskripsikan pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa dan mendeskripsikan perkembangan kemampuan berbahasa dengan menggunakan media gambar. Rancangan dalam penelitian ini menggunakan penilitian tindakan kelas yang terdiri dari dua siklus, tiap siklus terdiri dari perencanaan, pelaksanaan, observasi dan refleksi. Instrumen pengumpulan data berupa observasi anak dan format, penilaian. Penilaian acuan yang digunakan adalah ketuntasan kelas ( 75 % ) subyek penelitian adalah anak kelompok B di TK PGRI III Kebotohan. Hasil penelitian menunujukkan bahwa pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa anak pada siklus I rata – rata anak mendapatkan nilai 73,95 % pada siklus II meningkat menjadi rata – rata anak mendapat nilai 88,54 %. Kesimpulan yang dapat diperoleh dari penelitian ini adalah : (1) Pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa anak kelompok B di TK PGRI III kebotohan, (2) Pemanfaatan media gambar dapat mengembangkan kemampuan berbahasa anak kelompok B di TK PGRI III Kebotohan. Berdasarkan hasil penelitian ini dapat disarankan kepada guru agar dapat memanfaatkan media gambar untuk mengembangkan kemampuan berbahasa anak dengan mengembangkan pengembangan yang lain. Kegiatan pembelajaran yang akan digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian sebagai bahan perbandingan, sehingga dikemudian hari menjadi lebih baik.

Pengembangan permainan tradisional gedrik untuk pembelajaran fisik motorik anak kelompok B di TK Dharma Wanita 1 Kaibatur Kecamatan Kalidawir Kabupaten Tulungagung / Andriyani


Kata kunci: Pengembangan, Permainan, Gedrik, Fisik Motorik Gedrik merupakan permainan tradisional yang sering dilakukan oleh anakanak kampung yang terdiri dari komponen kekuatan, keseimbangan, dengan ukuran lapangan dan jumlah pemain yang beragam antara pelaku yang satu dan yang lain. Pemain akan melempar sebuah pecahan genting (jawa=kreweng) ke dalam kotakkotak tersebut dan pemain akan berjalan melewati kotak-kotak selain yang ada pecahan gentingnya (baik miliknya sendiri atau milik peserta lain) dengan menggunakan kaki satu, merupakan salah satu alternatif kegiatan fisik motorik kasar yang diharapkan dapat dilaksanakan oleh anak-anak kelompok B. Guru di TK Dharma Wanita 1 Kalibatur Kab. Tulungagung belum pernah menerapkan pembelajaran permainan tradisional Gedrik. Tujuan yang ingin dicapai adalah untuk mengembangkan permainan tradisional gedrik yang diharapkan dapat menyenangkan anak, dan mudah untuk dilakukan anak. Prosedur pengembangan permainan tradisional gedrik adalah: 1) Melakukan penelitian dan pengumpulan informasi, 2) Melakukan perencanaan, selanjutnya dievaluasi oleh para ahli, 3) Mengembangkan bentuk produk awal, 4) Melakukan uji coba kelompok kecil dengan 6 subyek, 5) Melakukan revisi terhadap produk awal, 6) Melakukan uji lapangan utama dengan 23 subyek, 7) Melakukan revisi produk. Intrumen yang digunakan adalah berisi tentang rancangan produk dan produk yang telah dibuat. Teknik analisis data yang digunakan adalah analisis kualitatif dan deskriptif berupa persentase. Hasil pengembangan ini berupa model pembelajaran permainan tradisional gedrik untuk pembelajaran fisik motorik pada anak kelompok B di TK Dharma Wanita 1 Kalibatur Kab. Tulungagung, yang mudah, dan menyenangkan anak. Diharapkan hasil pengembangan ini dapat diujicobakan kepada kelompok yang lebih luas dan dapat disosialisasikan kepada sekolah-sekolah dan lembaga pendidikan yang terkait sehingga dapat digunakan sebagaimana mestinya. Selain hal tersebut karena penelitian ini hanya terbatas pada pengembangan produk, diharapkan ada penelitian selanjutnya untuk menguji tingkat keefektifitas dari produk yang dikembangkan.

Penerapan model pembelajaran assure untuk meningkatkan hasil belajar siswa kelas V pada mata pelajaran PKn SDN Madyopuro 3 kota Malang / Ludia Kailem


Kata kunci: Model ASSURE, Hasil Belajar PKn SD. Mata pelajaran Pendidikan Kewarganegaraan merupakan mata pelajaran yang memfokuskan pada pembentukan warganegara yang memahami dan mampu melaksanakan hak-hak dan kewajibannya untuk menjadi warganegara Indonesia yang cerdas, terampil, dan berkarakter yang diamanatkan oleh Pancasila dan UUD 1945. Permasalahan yang dialami oleh para siswa kelas V SDN Madyopuro 3 Kota Malang adalah rendahnya pemahaman tentang Berorganisasi. Hal ini disebabkan karena pemanfaatan media yang belum maksimal pada diri guru, dan guru belum mampu mengantarkan para siswa pada konteks kehidupan riil, selain itu guru masih dominan dengan menggunakan metode ceramah sehingga siswa menjadi pasif, dan pembagian kelompok masih identik dengan menggabungkan siswa berdasarkan satu jenis kelamin. Oleh karena itu peneliti merasa perlu untuk diterapkan pembelajaran yang inovatif, kreatif, dan menyenangkan yaitu dengan menerapkan Model Pembelajaran ASSURE. Penelitian ini dilakukan dengan menggunakan pendekatan kualitatif dan kuantitatif menggunakan 2 siklus, dengan standar nilai ketuntasan 70 dan ketuntasan belajar kelas 75%, jenis penelitian tindakan kelas (PTK) yang dikemukakan oleh Kemis & Taggart, melalui tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Subjek penelitian adalah siswa kelas V SDN Madyopuro 3 Kota Malang yang berjumlah 47 siswa. Teknik pengumpulan data menggunakan tes observasi wawancara dan dokumentasi selama proses pembelajaran. Hasil penelitian ini menunujakan bahwa Penerapan model ASSURE dapat meningkatkan hasil belajar siswa pada mata pelajaran PKn materi pokok “Berorganisasi” di kelas V SDN Madyopuro 3 Kota Malang dikategorikan baik,dengan melihat dari peningkatan hasil belajar siswa yang diperoleh siswa dari pra tindakan, siklus I, dan siklus II, yaitu dari rata-rata kelas sebesar 66,70 %, meningkat menjadi 77,44 % dan meningkat lagi menjadi 81,48 %. Berdasarkan hasil penelitian ini maka peneliti mennyarankan bahwa tidak hanya mata pelajaran PKn saja yang menggunakan model pembelajaran ASSURE tetapi juga untuk mata pelajaran lain dapat juga menggunakan model pembelajaran ini.

Isolasi sekuen internal transcribed spacer (ITS 1 -5.88-ITS 2) dari didymoplexis paliens griff. / Mo Awwanah


Kata kunci: Isolasi Sekuen, Internal Transcribed Spacer (ITS1-5.8S-ITS2), Didymoplexis pallens Griff. Didymoplexis merupakan salah satu anggrek di Pulau Jawa yang memiliki karakter morfologi serta pola hidup yang menarik untuk dipelajari. Didymoplexis banyak ditemukan di rumpun bambu. Didymoplexis yang ditemukan di Taman Nasional Alas Purwo, Jawa Timur, tumbuh di rumpun Gigantochloa hasskarliana (Kurz) Back dan Bambusa spinosa auct. non Hamilt. Hasil identifikasi secara morfologi terhadap Didymoplexis yang tumbuh di dua rumpun bambu yang berbeda menunjukkan bahwa keduanya tergolong dalam Didymoplexis pallens Griff. ITS adalah salah satu penanda genetik dari gen ribosomal 45S rDNA. Data sekuen ITS pada D. pallens Griff. belum dilaporkan. Penelitian ini dilakukan untuk mengetahui sekuen ITS1-5.8S-ITS2 D. pallens Griff. yang tumbuh di rumpun G. haskarliana (Kurz) Back dan B. spinosa auct. non Hamilt. Sekuen ITS1-5.8S-ITS2 diisolasi dengan metode amplifikasi Polymerase Chain Reaction (PCR) dilanjutkan dengan sekuensing. Sekuen yang diperoleh dianalisis secara deskriptif menggunakan program Peak Trace, BioEdit, BLAST dan Clustal X. Hasil isolasi dari sampel D. pallens Griff. yang tumbuh di rumpun G. hasskarliana (Kurz) Back fragmen DNA sepanjang 377 basa pada dan dari sampel D. pallens Griff di rumpun B. spinosa auct. non Hamilt sepanjang 339. Perbandingan sekuen dari kedua sampel menunjukkan perbedaan pada beberapa basa nukleotida penyusunnya. Hasil analisis dengan BLAST menunjukkan bahwa sekuen yang berhasil diisolasi memiliki kecocokan yang rendah dengan sekuen ITS1-5.8S-ITS2 dari data GeneBank. Kesimpulan dari penelitian ini menunjukkan bahwa sekuen ITS1-5.8S-ITS2 dari kedua sampel tidak diperoleh sehingga penelitian ulang perlu dilakukan untuk mengisolasi sekuen ITS1-5.8S-ITS2 D. pallens Griff. secara utuh dengan rancangan primer dan siklus PCR yang lebih tepat.

Perancangan aplikasi untuk try out Sekolah Menengah Pertama berbasis PHP dan MYSQL / Adistra Candra Pamungkas


Kata kunci: aplikasi, try out, Mysql, PHP. Pada saat ini kemajuan teknologi semakin berkembang pesat. Persaingan teknologi antara negara berkembang maupun negara maju semakin ketat. Sebagai negara berkembang supaya tidak ketinggalan kemajuan teknologi harus memiliki sumber daya manusia yang berkualitas dan berdaya saing global. Untuk mewujudkan itu semua diperlukan pendidikan yang berkualitas dan bermutu tinggi agar dapat menghasilkan sumber daya manusia yang berkualitas dan berdaya saing global. Untuk dapat mewujudkan pendidikan yang berkualitas dan bermutu tinggi ada banyak jalan yang bisa ditempuh diantaranya dengan melalui aplikasi try out yang dapat digunakan oleh siswa untuk melakukan latihan soal-soal mata pelajaran dengan adaya aplikasi try out ini. Tujuan pembuatan Tugas Akhir ini untuk peningkatan mutu pendidikan sehingga dapat digunakan pelajar untuk latihan mengerjakan soal-soal UAN sehinga siswa lebih terbiasa pada saat melaksanakan UAN sehingga dapat mengerjakan secara maksimal. Diharapakan aplikasi ini dapat meningkatkan mutu pendidikan sehingga dapat menghasilkan sumber daya manusia yang berkualitas dan memiliki daya saing global. Metode perancangan meliputi: (1)Spesifikasi produk yang dijelaskan dalam entitas dan atribut sistem. (2)Menggambarkan arus data dalam DFD (Data Flow Diagram ). (3)Menggambarkan struktur data dan hubungan antar entitas sebagai pembentuk sistem dalam ERD (Entity Relationship Diagram). (4)Mendeskripsikan hubungan antara entitas dengan relationship antar tabel. (5)Menggambarkan desain antar muka aplikasi. (6)Prosedur pengujian aplikasi Hasil yang didapat dari pembuatan aplikasi try out SMP berbasis PHP dan MySQL adalah aplikasi untuk try out latihan soal mata pelajaran Matematika, Bahasa Indonesia, Bahasa Inggris, IPA. Kesimpulan dari pembuatan tugas akhir ini adalah (1) dalam perancangan aplikasi try out SMP berbasis PHP dan MySQl adalah (a) menentukan sistem kerja alat yang akan dibuat, (b) menentukan desain utama, dan, (c) menentukan hasil yang diinginkan. (2) Dalam pembuatan aplikasi try out SMP berbasis PHP dan MySQl agar dapat bekerja sesuai dengan yang diharapkan adalah (a) menentukan alat yang akan dipakai (software dan hardware), (b) melakukan pemrograman dengan PHP, (3) Pengujian aplikasi try out SMP berbasis PHP dan MySQl dilakukan dengan login sebagai siswa di dua komputer dengan username dan password yang berbeda dan melakukan proses try out apakah hasilnya sama dengan yang diharapkan apa belum.

The Effectiveness of using authentic texts in the teaching of reading comprehension / Jauharotus Sholichatin


Key words: authentic text, inauthentic text (artificial text), reading comprehension, effectiveness This study was conducted to investigate whether the use of authentic texts in the teaching of reading comprehension is effective. The problem of the study is "Are the reading comprehension scores of students who are taught using authentic text significantly higher than those who are taught using inauthentic text?. As a tentative answer to the problem stated above, the hypothesis for this study is stated as follows: "The reading comprehension score of students who are taught using authentic texts is significantly higher than those who are taught using inauthentic texts." The design of the study was quasi-experimental with non-randomized pretest-posttest control group. The samples of this study were taken from the population of the eight graders of SMP N 1 Playen Gunungkidul Yogyakarta in the 2010/2011 academic year. The populations were 190 students; distributed in six classes; class VIIIA - VIIIF. In the present study, the sampling technique applied was simple random sampling which was taken by using lottery. The lottery was done toward the sixth groups of the populations. Hence, each of the groups basically had the same possibility to be the sample of the research. The result of the lottery showed that class VIII D was chosen as the experimental group and class VIII F as the control group. In collecting data, the instrument used was in the form of multiple choice test which covered the subject matter of reading comprehension. Pretest was administered to both groups at the same day before the treatment. The same test used in the pretest was also used as post test which was administered after the treatment to both groups at the same day. The experimental group was, then, taught reading comprehension by using authentic texts in the treatment. Meanwhile, the control group was taught reading comprehension by using inauthentic texts in the treatment. The pretest means of both groups were analyzed statistically by using Lavene's. Lavene's Test revealed the significant value is .553 that is higher than .05. This result indicates that the difference between variances is not significant. This indicates that the subjects of experimental and control groups are not significantly different before the experiment in their pretest scores of reading comprehension test. Therefore, an independent t-test was used to analyze the posttest means. On the statistical computation for posttest by using independent t-test revealed that t-value for df 62 is 4.17. It is bigger than t-critical value (1.671) at the level of significance of 0.05 for a one tailed test (t-value: 4.17 > t-critical value: 1.671). This indicates that there is a significant difference of means scores between students who are taught using authentic texts and those who are taught using inauthentic texts in teaching reading comprehension. The gain of reading comprehension means scores of experimental group is significantly higher than the gain of reading comprehension means scores of control group. Therefore, Ho was rejected and the hypothesis works. Based on the result of research findings, it can be concluded that using authentic texts in teaching reading comprehension proved to be effective in increasing the students' reading comprehension achievement. Thus, it is suggested that English teachers/instructors to utilize authentic texts in teaching reading comprehension. Besides, for future researchers, it is suggested to conduct research on authentic texts in higher level. Since for those of higher level students are having much more linguistic knowledge and having much wider world knowledge than students of Junior High, suitable and challenging authentic materials with miscellaneous topics is much easier to find. Moreover using authentic materials in ‘authentic' presentation becomes possible. "Authentic" presentation means we do not present the materials (articles/texts) in copies, instead we present it as the way it is. For example when we are going to use articles from newspaper, we should bring the newspaper consist of the articles in class not in copies. This enable for future researcher to give authentic materials taken from magazines or newspaper (printed/not on-line) to the students as the way they are. Using "authentic" presentation helps put the text into a context.

Pengaruh efikasi diri terhadap stres menjelang sertifikasi pada guru SD di Kecamatan Bantur / Putri Azizah Kholidatun Nikmah


Kata kunci : efikasi diri, stres guru sertifikasi Dalam proses sertifikasi, para peserta akan mengalami kejadian-kejadian yang mungkin saja tidak terduga sebelumnya. Kejadian-kejadian tidak terduga ini akan menghambat jika para peserta tidak memiliki efikasi diri. Hal ini dapat menimbulkan stres bagi sebagian guru. Stres bagi guru dapat disebabkan oleh faktor eksternal maupun internal. Salah satu faktor internal stres yang akan diteliti adalah efikasi diri. Penelitian ini bertujuan untuk mengetahui seberapa besar pengaruh efikasi diri terhadap stres guru SD saat mengikuti sertifikasi. Subjek penelitian sebanyak 44 guru, diambil dengan teknik purposive sampling dari guru SD di Kecamatan Bantur pada tahun 2011. Instrumen penelitian yang digunakan adalah skala efikasi diri dan skala DSI. Reliabilitas skala efikasi diri sebesar 0.924. Data hasil penelitian di analisis dengan teknik regresi linier sederhana. Hasil penelitian besarnya pengaruh atau koefisien determinasi efikasi diri terhadap stres guru menjelang sertifikasi dengan menggunakan model regresi linier sederhana adalah R2 = 0,361. Berarti bahwa ada pengaruh efikasi diri terhadap stres saat mengikuti sertifikasi pada guru SD di Kecamatan Bantur sebesar 36,1%, sedangkan 63,9% yang lainnya dipengaruhi oleh variabel-variabel atau faktor-faktor lain yang mempengaruhi stres. Disarankan kepada: (1) guru yang sedang mengikuti sertifikasi memiliki efikasi diri yang tinggi, hal itu akan mempengaruhi tingkat stres guru tersebut. Meningkatkan efikasi diri dengan cara percaya dan yakin pada kemampuan diri, menumbuhkan motivasi diri, mencari dukungan emosional dari orang-orang di sekitar (2) bagi peneliti selanjutnya disarankan meneliti variabel-variabel lain yang diduga mempengaruhi stres, mengingat stres saat mengikuti sertifikasi tidak hanya dipengaruhi oleh efikasi diri saja. Dan mencari subjek dari daerah lain, dengan subjek yang lebih banyak.

Pelaksanaan strategi promosi pada PT. Astra Internasional TBK Auto 2000 malang Sutoyo / Rizky Primadhani


Kata kunci : Strategi Promosi. Memasuki era globalisasi yang semakin kompleks dan kompetitif menyebabkan terjadinya perkembangan yang luar biasa dalam bidang bisnis, dimana semua kegiatan-kegiatan yang berhubungan dengan bisnis semakin modern dan maju. Perusahaan baru bermunculan untuk menambah persaingan dengan perusahaan-perusahaan yang telah berdiri sebelumnya. Kondisi persaingan itulah yang menyebabkan perusahaan harus dapat berpikir cerdas dan kreatif agar selalu dapat menciptakan keunggulan kompetitif dari pesaing-pesaingnya, maka dari itu diperlukan strategi promosi yang baik guna memperkenalkan produk perusahaan agar produk tersebut menjadi produk pilihan konsumen. PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo adalah perusahaan yang bergerak di bidang penjualan mobil, penjualan suku cadang asli Toyota, dan servis kendaraan Toyota. Auto 2000 telah memenuhi 3S, yaitu : Sales, Service, Spare part sehingga merupakan jaringan jasa penjualan, perawatan, perbaikan dan penyediaan suku cadang asli Toyota yang manajemennya ditangani penuh PT. Astra Internasional Tbk. Dalam aktifitas bisnisnya, Auto 2000 bergabung dengan PT. Toyota Astra Motor yang menjadi agen tunggal pemegang merek Toyota. Penulisan Tugas Akhir ini bertujuan untuk (1) mengetahui strategi promosi yang telah diterapkan pada PT. Astra Internasional Tbk - Auto 2000 Malang Sutoyo, (2) mengetahui jenis promosi yang paling efektif diterapkan pada PT. Astra Internasional Tbk - Auto 2000 Malang Sutoyo, (3) mengetahui faktor pendukung dan penghambat dalam pelaksanaan strategi promosi pada PT. Astra Internasional Tbk - Auto 2000 Malang Sutoyo. Jenis promosi yang digunakan oleh PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo dalam mempromosikan produk Toyota adalah (1) Periklanan, dengan menggunakan media: televisi, spanduk dan umbul-umbul, koran, brosur, kaos dan seragam, dan simbol atau logo. (2) Promosi Penjualan, dengan cara promosi konsumen dan promosi tenaga penjual. Promosi konsumen dilakukan dengan cara pemberian kupon, promosi harga, demonstrasi, persaingan, pengembalian uang ganti rugi. Sedangkan promosi tenaga penjual dilakukan dengan cara pemberian bonus, kontes tenaga penjual, dan pertemuan penjual. (3) Pejualan perseorangan, dilakukan dengan cara seminar dan customer gathering, FGD (Focus Group Discussion). (4) Hubungan Masyarakat, dilakukan dengan cara mengadakan pameran (exhibition), showroom event, dan pemberian souvenir. Dari jenis promosi yang digunakan PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo terdapat strategi promosi yang paling efektif dalam mempromosikan produk Toyota yaitu promosi penjualan dan hubungan masyarakat. Faktor pendukung dalam pelaksanaan strategi promosi pada PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo diantaranya (1) Nama PT. Astra Internasional Tbk yang sudah dikenal sehingga Auto 2000 merupakan salah satu perusahaan otomotif yang telah dipercaya oleh masyarakat. (2) Adanya biaya yang disediakan oleh Auto 2000 Malang Sutoyo sehingga berbagai program promosi bisa dilaksanakan. (3) Sarana media komunikasi yang medukung pelaksanaan kegiatan promosi sehingga promosi dapat dilakukan secara gencar dan rutin. (4) Terciptanya kerjasama yang harmonis antara pimpinan, staf dan karyawan Auto 2000 Malang Sutoyo sehingga karyawan maupun pimpinan merasa nyaman dalam bekerja. Sedangkan faktor penghambat dalam pelaksanaan strategi promosi pada PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo diantaranya (1) Pelanggan kurang merespon dengan baik kegiatan promosi yang dilakukan oleh Auto 2000 Malang Sutoyo karena waktu pelaksanaan promosi kurang tepat. (2) Saat ini di wilayah Malang bermunculan perusahaan-perusahan otomotif seperti Honda, Daihatsu, dan Isuzu sehingga Auto 2000 Malang Sutoyo harus lebih gencar dalam mempromosikan produk Toyotanya. (3) Biaya promosi yang besar sehingga promosi tidak dapat dilakukan secara terus-menerus. (4) Penyebaran brosur yang tidak merata di setiap wilayah di Malang sehingga konsumen yang ingin mengetahui informasi tentang produk Toyota dari brosur tidak tersampaikan. (5) Kurang luasnya area yang digunakan untuk test drive sehingga test drive hanya bisa dilakukan pada tempat-tempat tertentu. Berdasarkan Praktik Kerja Lapangan (PKL) yang dilakukan penulis, maka saran yang ingin disampaikan penulis kepada PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo, adalah (1) Hendaknya PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo terus berupaya untuk meningkatkan strategi promosinya dengan lebih memperbanyak mengadakan kegiatan promosi yang berhubungan langsung dengan masyarakat, dimana dalam acara tersebut terdapat permainan dan pembagian souvenir, hadiah atau door prise. (2) Waktu pelaksanaan promosi dilakukan dengan baik dan direncanakan dengan matang. Hendaknya Auto 2000 Malang Sutoyo mengadakan survei untuk mengetahui kondisi pasar, hal ini dikarenakan agar dapat menarik lebih banyak pelanggan. Selain itu Auto 2000 Malang Sutoyo harus terus mengikuti perkembangan mengenai produk dan harus jeli melihat peluang pasar yang ada sehingga mampu memenuhi kebutuhan pasar sebaik-baiknya. (3) Hendaknya Auto 2000 Malang Sutoyo memberikan pelatihan secara berkelanjutan kepada karyawan khususnya kepada tenaga penjual atau sales. Pelatihan ini bisa bertujuan untuk menambah pengetahuan tentang produk yang akan dipasarkan, bagaimana cara berkomunikasi yang tepat dengan pelanggan karena karakter setiap pelanggan berbeda-beda. (4) Penyebaran brosur sebaiknya dibagikan secara merata khususnya pada wilayah kota Malang. (5) Hendaknya area diperluas sehingga test drive dapat dilakukan di Auto 2000 Malang Sutoyo.

Using picture series to improve the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text / Syamsia


Thesis. English Language Education, Graduate Program of State University of Malang. Advisors: (1) Prof. Ali Saukah, M.A,Ph.D. (2) Dr. Suharmanto, M.Pd Keywords: Writing Ability, Recount Text, Picture Series Based on the preliminary study, the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text was still unsatisfactory. The students were unable to express their ideas in a good paragraph. They made a number of mistakes in their writing in terms of content, organization, vocabulary, grammar, and mechanic. To overcome this problem, to proposed one of the appropriate strategies in the teaching of English writing recount text using picture series. This research, which aimed at improving the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text using picture series. the research problem is how can picture series be used to improve the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text the research design was a collaborative Classroom Action Research (CAR) that was a process in which researcher herself conducts the teaching to improve the students’ learning and to recover the students’ problems or difficulties in the process of writing instruction. The researcher and the collaborator worked together through the cyclic process which consists of four steps, namely planning, implementing, observing, and reflecting. Based on the result of students’ final writing, it was found that the students have a significant improvement. It means that the use of picture series strategy has positive impact in teaching and learning English. The students’ ability in generating ideas, organizing ideas, choosing words, using grammar and mechanic developed better than before the strategy implemented. Additionally, the improvement also can be seen in the gain of 10 points from the preliminary score. In the preliminary study, Most of the students got the score below 5.5 that is minimum criteria/Kriteria Ketuntasan Minimal (KKM). Only 16% (6 of 31) students who pass. In the cycle I, there were 15 students or 49 % of the students reached the criteria of success and the rest (16 students) or about 51 % of the students got under 6.0. Meanwhile, in the cycle II, there were 29 students or 95% students had reached the score greater than 6.0, and 2 students or 5% students got under 6.0. After the picture series strategy is implemented in two cycles, the researcher concludes that a suitable model of the strategy using picture series in teaching writing to the students prove to be very affective to attract the students to get involved in the teaching and learning activity.

Rancang bangun pendeteksi tiket dan pengontrolan kapasitas stadion sepak bola / Heru Prasetyo


Kata Kunci : pendeteksi tiket, pengontrolan kapasitas stadion, barcode Olahraga sepak bola merupakan salah satu olahraga yang sangat di gemari dan di minati oleh seluruh rakyat Indonesia. Hal ini dibuktikan dengan semakin banyaknya antusias penonton sepak bola yang datang langsung ke stadion untuk menyaksikan para idola mereka serta memberikan dukungan kepada club ataupun tim kesayangan mereka. Antusias penonton yang besar ini terkadang tidak mendapatakan pelayanan yang baik oleh para penyelenggara pertandingan, sehingga penonton yang datang ke stadion tidak mendapatkan kenyamanan ketika menyaksikan pertandingan sepakbola tersebut. Beberapa kasus yang terjadi di Indonesia antara lain kapasitas stadion yang tidak sesuai dengan jumlah penonton yang hadir. Jumlah penonton biasanya 2x lipat lebih banyak dari jumlah atau batas maksimal yang sudah ditentukan. Satu hal lagi yang tidak kalah meresahkannya adalah adanya tiket palsu yang di jual oleh para calo. Pada alat ini dirancang suatu alat pendeteksi tiket dan pengontrolan kapasitas stadion sepak bola. Alat ini bekerja pada saat penonton akan masuk dengan menggunakan tiket resmi yang memiliki nomor seri. Nomor seri pada tiket resmi difungsikan ketika penonton melewati alat pendeteksi tiket. Tiket yang terdeteksi akan membuka pintu masuk secara otomatis dan setelah penonton melewati pintu tersebut, pintu akan menutup kembali secara otomatis pula. Selain itu, pada alat tersebut juga dilengkapi dengan sensor yang akan menghitung jumlah penonton yang memasuki stadion, sehingga pada saat kapasitas stadion sudah terpenuhi maka pintu masuk tidak akan bisa membuka lagi. Alat ini dapat mencegah penonton yang memaksa masuk ke stadion dengan menggunakan tiket palsu. Pengontrolan kapasitas penonton yang masuk ke stadion pun menjadi lebih baik dan terkendali sehingga penonton tidak perlu berdesak-desakan lagi dan merasa lebih nyaman dalam menyaksikan pertandingan sepak bola. Disarankan sebelum merancangan alat ini hendaknya memeriksa lagi seluruh komponen yang akan digunakan sebelum dirakit, sehingga pada saat alat dioperasikan tidak akan terjadi trouble dalam prosesnya. Dalam pengembangan selanjutnya perangkat keras yang dibuat perlu adanya penambahan tampilan indikator digital.

Penerapan strategi pelayanan untuk meningkatkan kepuasan pelanggan pada Auto 2000 malang Sutoyo / Susanti


Kata kunci : strategi pelayanan, kepuasan Pelanggannya. Proses pelayanan yang baik didalam suatu perusahaan akan menciptakan kepuasan bagi pelanggan karena pelanggan merasa puas terhadap produk dan jasa yang telah di terima. Pada dasarnya kepuasan pelanggan mencakup perbedaan antara tingkat kepentingan dengan kinerja atau hasil ynag dirasakan. Hal ini dapat dilihat pada Dealer Auto 2000 Malang Sutoyo yang melaksanakan berbagai strategi pelayanan untuk mendapatkan kepuasan dari pelanggannya. Subyek yang dipergunakan sebagai sumber data laporan adalah Auto 2000 Malang Sutoyo. Tujuan laporan yang saya lakukan pada Auto 2000 Malang Sutoyo yaitu ” (1)Bagaimana strategi pelayanan pada Dealer Auto 2000 Malang Sutoyo, (2)Bagaimanakah bentuk pelayanan yang diberikan oleh Dealer Auto 2000 Malang Sutoyo, (3)Apakah yang menjadi faktor pendukung dan penghambat pada Dealer Auto 2000 Malang Sutoyo Auto 2000 Malang Sutoyo bertujuan untuk memberikan pelayanan dan meningkatkan kepuasan pelanggan. Dalam hal ini strategi pelayanan yang dilakukan pada Auto 2000 Malang Sutoyo (1) Strategi Relationship Marketing (hubungan masyarakat), (2)Strategi Superior Customer Service (pelayanan konsumen yang unggul), (3)Strategi Unconditional Guarantees (jaminan jasa), (4)Startegi penanagan keluhan yang efektif, (5)Strategi peningkatan kinerja perusahaan Strategi pelayanan yang bertujuan untuk memuaskan pelanggan sangatlah penting untuk diterapkan dalam suatu perusahaan dengan tujuan utama perusahaan itu sendiri yaitu mempertahankan suatu usaha. Ada beberapa bentuk strategi pelayanan yang bertujuan untuk meningkatkan kepuasan pelanggan pada Auto 2000 Malang Sutoyo (1) Toyota Home Service, (2) Booking Service, (3) Layanan One Stop Service, (4) Kontak Service, (5) Gratis jasa servis sampai dengan tiga tahun Faktor-faktor yang mempengaruhi pelayanan Auto 2000 Malang Sutoyo terbagi menjadi 2 bagian yang sangat berpengaruh guna kelangsungan usaha Dealer Auto 2000 Malang Sutoyo kedepannya nanti yang digunakan sebagai acuan dan pedoman. Bagian tersebut yaitu faktor pendukung yang dimiliki dan faktor penghambat yang harus dihadapi Auto 2000 Malang Sutoyo. Adapun beberapa keunggulan pelayanan yang dimiliki oleh Dealer Auto 2000 Malang Sutoyo adalah sebagai berikut : (1) Manajemen Auto 2000 ditangani penuh oleh PT. Astra Internasional Tbk, (2) Auto melayani pelanggan secara profesional, (3)Auto memberikan kemudahan bagi pelanggan sebelum dan setelah melakukan servis, (4) Auto 2000 memiliki karyawan yang handal dan memiliki sertifikat Toyota Internasional, (5) Tersedianya toilet, (6) Auto 2000 berada berada di lokasi jalan raya yang sangat strategis, (7)Gratis layanan cuci mobil selesai servis, (8) Tersedianya fasilitas yang memadai. Walaupun memiliki kekuatan dalam pelayanan yang tidak diragukan lagi oleh para konsumen, penerapan strategi pelayanan pelanggan pada Auto 2000 Malang Sutoyo tentunya memiliki beberapa kelemahan yang perlu diatasi dengan segera. Beberapa kelemahan itu antara lain : (1) Masih kurangnya pemahaman karyawan tentang konsep dan prinsip-prinsip pelayanan, (2) Sistem komputerisasi pembayaran di kasir yang pengoperasiannya kurang cepat , (3) Penempatan posisi kerja yang tidak sesuai dengan keahlian mengakibatkan kinerja karyawan tidak sesuai Berdasarkan hasil laporan yang penulis lakukan ini dapat dijadikan bahan pertimbangan oleh seluruh karyawan Auto 2000 Malang Sutoyo dalam penerapan strategi pelayanan pada periode selanjutnya agar mendapatkan hasil yang optimal dari penerapan strategi pelayanan tersebut.

Perilaku komunikasi interpersonal pada kaskuser dengan kecenderungan internet addiction disorder / Aldila Putri Karindra


Kata Kunci: Komunikasi Interpersonal, Kecenderungan Internet Addiction Disorder, Kaskuser Perilaku komunikasi interpersonal merupakan semua tindakan atau aktivitas manusia yang secara khusus mengacu pada kegiatan untuk mengungkapkan perasaan, kebutuhan, dan pikiran antara pemberi dan penerima pesan dan mendapatkan timbal balik secara langsung. Internet addiction disorder merupakan tingkat penggunaan Internet secara patologis dan kompulsif, yang muncul pada orang yang merasa bahwa dunia maya (virtual reality) pada layar komputernya lebih menarik daripada dunia nyata kehidupannya sehari-hari yang dilihat berdasarkan kriteria diagnostik. Penelitian ini dilaksanakan dengan tujuan untuk mengungkap perilaku komunikasi interpersonal pada kaskuser dengan kecenderungan Internet addiction disorder, dengan menggunakan metode kualitatif yang dikembangkan dengan model deskriptif-interpretif yang bertujuan untuk memberikan gambaran mengenai suatu fenomena dan menemukan makna serta memberikan interpretasi dan dengan menggunakan teknik analisis isi. Subjek penelitian dalam penelitian ini sebanyak 3 orang kaskuser dengan kecenderungan Internet addiction disorder. Penelitian ini dilakukan dengan wawancara dan observasi. Teknik validasi yang digunakan adalah triangulasi sumber data. Hasil penelitian ini adalah 1) adanya keengganan (unwillingness) untuk ikut terlibat dalam komunikasi langsung (face to face) karena merasa cemas yang disebabkan oleh adanya penilaian serta identifikasi fisik. Sehingga mereka lebih memilih untuk berkomunikasi secara online (mediated interpersonal communication), 2) perilaku anonimitas dalam konteks komunikasi interpersonal bermedia tidak hanya bertujuan menyembunyikan identititas, namun secara tidak langsung merupakan semacam aturan yang tidak tertulis dan ahirnya telah menjadi budaya bagi penggunanya, namun yang lebih pada kondisi dimana seorang individu dapat mengkomunikasikan idenya tanpa harus dilihat dan juga melihat perubahan atau lebih tepatnya reaksi verbal maupun reaksi non verbal, 3) komunikator dapat lebih membuka dirinya, menceritakan sesuatu yang bersifat pribadi atau bahkan mengandung resiko ketika berkomunikasi secara online karena lebih merasa nyaman dan aman sehingga komunikasi dapat berjalan dengan lebih akrab dan terbuka, 4) bahasa gaul kaskus hanya mereka gunakan saat berkomunikasi secara online saja atau ketika menyapa seorang kaskuser dan bahasa gaul kaskus lebih berfungsi sebagai sarana memelihara identitas dan solidaritas kelompok kaskus. Berdasarkan hasil penelitian maka disarankan bagi: 1) kaskuser, untuk mengurangi aktivitasnya dalam mengakses Internet dan lebih menyibukkan diri dalam kegiatan nyata, dapat terhindar dari dampak negatif penggunaan Internet secara patologis. Serta dapat berkomunikasi sebagaimana mestinya dan dengan baik, 2) anggota keluarga atau kerabat, dapat lebih berperan aktif memberikan kontrol terhadap penggunaan Internet, mengajak berkomunikasi secara langsung, memberikan perhatian dan menanamkan rasa percaya diri serta menghindari suatu evaluasi dan identifikasi fisik atas diri kaskuser. 3) peneliti selanjutnya, dapat menggunakan metode lain, misalnya dengan metode eksperimen yakni dengan membuat suatu desain pelatihan komunikasi. Peneliti juga perlu memperbanyak jumlah subyek penelitian agar memperoleh data data yang lebih bervariasi untuk menambah informasi yang dibutuhkan dalam penelitian tersebut.

Improving students' understanding to solve math story problems writen in english thourgh aktivation, exposure, repetition, and producyion (AERP) strategy at public junior high school 8 Malang / Frida Unsiah


Graduate Program in English Language Education, State University of Malang. Advisors: (1) Prof. Drs. Bambang Yudi Cahyono, M.Pd, M.A., Ph.D., (2) Dr. Gunadi Harry Sulistyo, M.A. Key Words: Math story problems, AERP Strategy This study was conducted on the basis of the problems faced by the bilingual students of grade seven at Public Junior High School 8 Malang dealing with solving Math story problems written in English. The basic problems were mostly on students’ lack of English vocabularies on technical Math words, phrases, sentences and expressions; and students’ lack of learning experiences in a bilingual program which made it difficult for them to solve Math story problems written in English. In overcoming the problems, a strategy for teaching Mathematics written in English called AERP strategy comprising four stages: Activation, Exposure, Repetition, and Production was implemented. Therefore, the problem of the study was formulated as follows: “How can students’ understanding to solve Math story problems written in English be improved through the AERP Strategy at SMPN 8 Malang?” This study was collaborative action research which was intended to implement AERP strategy to improve the students’understanding to solve Math story problems written in English. The AERP strategy was chosen as the strategy since through the AERP strategy, students’ understanding can be improved significantly because they are provided with schemata activation that will help them to construct their understanding in the present topic. They also get so much exposure on English language focusing on mathematical words and expressions; and the basic concept of a particular topic followed by drilling their pronunciation repeatedly on English words in order to let them produce correct pronunciation. At last, they are equipped with tasks on Math story problems which require them to produce Math problem solving both in oral and written forms. The subjects of the study were 32 bilingual students of grade 7 at Public Junior High School 8 Malang in the 1st semester. Two cycles were conducted in this study applying the procedures of the classroom action research: planning, implementing, observing, and reflecting. The first cycle of this study encompassed three meetings and the second one required four meetings. The data of the study were collected through observation checklists, field notes, Math story problem tests (written and oral forms), and questionnaire. The findings of the study revealed that the implementation of the AERP strategy was successful to meet the objective of the study after the revision and the modification were made to conduct Cycle 2. The stages of the AERP strategy in Cycle 1 were Activation, Exposure and Repetition in meeting 1, Production in written form in meeting 2, and Production in oral form in meeting 3. It was different from the one in Cycle 2. In Cycle 2, Exposure and Repetition were done twice in meeting 1 and meeting 2. Some good points in the implementation of the AERP strategy in Cycle 2 could be noticed from the students’ active participation in joining the activities in every stage of the strategy and achievement in doing the Math story problems either in written or oral form. It was due to the fact that they got much more time in getting exposure on the language and content; and they had experienced in the learning process that they had not gained before. As a result, these learning activities were very helpful for the students to improve their understanding to solve Math story problems written in English. It was shown by their score improvements that in Cycle 1, the average score of the students was 71 that was still below the minimum passing grade and it increased to be 78 in Cycle 2 that passed the minimum passing grade. Furthermore, this is supported by the results of the questionnaire showing that most of the students agreed that learning Mathematics written in English as well as learning English simultaneously, introducing English Mathematical terms and basic concept of the materials by providing examples or illustration as activation, modeling and drilling pronunciation on English words make them able to solve Math story problems written in English better. They also agreed that after having learned Math through the AERP strategy, their understanding to solve Math story problems written in English improved. Referring to the findings above, the following suggestions are proposed. First, Math teachers are suggested to apply the AERP strategy collaboratively with English teachers by following the stages: Activation, Exposure, Repetition, and Production since these stages have successfully worked in this study. Second, considering the limitation in the current study and that the AERP strategy can be employed not only in Math written in English but also in other content subjects such as Science written in English, the future researchers are suggested to conduct research on the other content subjects with some modifications or developments. It is because the AERP strategy has been proven to be useful to improve the quality of the teaching and learning process focusing on content subjects written in English.

Keefektifan reinforcement dalam menurunkan kebiasaan mebolos siswa kelas X SMK Negeri 1 Probolinggo / Kiki Amalia


Kata kunci: Reinforcement, kebiasaan membolos Perilaku membolos sebenarnya bukan merupakan hal yang baru lagi bagi banyak pelajar, setidaknya bagi mereka yang pernah mengenyam pendidikan. Membolos merupakan tingkah laku pergi meninggalkan sekolah tanpa alasan yang tepat pada jam pelajaran dan tanpa ijin terlebih dahulu pada pihak sekolah yang dilakukan secara berulang-ulang. Tingkah laku membolos yang dilakukan para siswa di sekolah dapat dipahami sebagai tingkah laku penghindaran, di mana siswa menyelesaikan masalahnya melalui jalan pintas yang menurut mereka sebagai solusi terbaik atas masalah yang mereka alami. Salah satu teknik bimbingan yang dapat dilakukan sebagai upaya untuk menurunkan frekuensi membolos siswa SMK yaitu melalui penggunaan reinforcement. Penelitian ini bertujuan untuk mengetahui keefektifan reinforcement dalam menurunkan kebiasaan membolos siswa kelas X SMK Negeri 1 Probolinggo. Jenis penelitian yang digunakan dalam penelitian ini adalah eksperimen semu, dengan desain eksperimen kasus tunggal (Singgle Case Experimental Desain / SCED) jenis A-B-A'dimana alat ukur yang digunakan sebelum dan setelah perlakuan adalah sama. Subjek penelitian adalah siswa SMK N 1 Probolinggo kelas X yang memiliki frekuensi membolos tinggi. Instrumen penelitian berupa study dokumentasi dengan rekapitulasi absen yang dilengkapi dengan format observasi, dan data penskoran,. Teknik analisis data yang digunakan adalah t-test wilcoxon. Hasil penghitungan didapatkan nilai zhitung sebesar 2,060 dengan signifikansi 0,039. Dari hasil analisis nilai thitung mempunyai signifikansi 0,039 kurang dari 0,05 (sig < 0,05), maka dapat disimpulkan bahwa terdapat perbedaan yang signifikan frekuensi membolos sebelum dan sesudah perlakuan. Kesimpulan penelitian ini adalah penggunaan reinforcement efektif untuk menurunkan frekuensi kebiasaan membolos siswa kelas X SMK N 1 Probolinggo. Berdasarkan hasil penelitian ini, disarankan bagi konselor untuk menggunakan reinforcement sebagai salah satu alternatif dalam menurunkan kebiasaan membolos siswa. Saran yang diberikan pada penelitian ini adalah Guru menggunakan penguatan (reinforcement) secara bervariasi dalam pemberian penguatan baik penguatan secara verbal dan nonverbal dalam kegiatan pembelajaran sehingga siswa tidak merasa jenuh dengan pola pengajaran. Sekolah dapat memfasilitasi dalam memberikan penguatan (reinforcement) kepada siswa sehingga siswa merasa lebih diperhatikan dan lebih bersemangat dalam mengikuti proses pembelajaran. Penelitian eksperiment ini hendaknya dapat dikembangkan dengan meningkatkan desain yang ada, misalnya dengan menggunakan desain A-B-A'-B', ataupun A-B-A-B-C. Bentuk reinforcement yang diberikan hendaknya tidak hanya sebatas reinforcement sosial.

Penerapan metode pembelajaran outdoor study objek lereng gunung kelud guna meningkatkan aktivitas, hasil belajar, dan kemampuan menyusun karya tulis geografi materi pemanfaatan sumberdaya alam siswa kelas XI IPS-2 SMA Negeri 3 Blitar / Moch. Budi Harsono


Tesis, Program Studi Pendidikan Geografi, Program Pasca Sarjana Universitas Malang. Pembimbing: (I) Prof. Dr. Sugeng Utaya, M.Pd, (II) Dr. Achmad Amirudin, M.Pd. Kata kunci: outdoor study, aktivitas siswa, hasil belajar, karya tulis , sumberdaya alam. Metode outdoor study atau metode pembelajaran di luar ruangan kelas merupakan metode pembelajaran yang mampu memupuk kreatifitas, inisiatif, kerjasama atau gotong royong dan mengakrapkan siswa dengan lingkungan sekitarnya. Peran guru pada pembelajaran outdoor adalah sebagai motivator, artinya guru sebagai pemandu agar siswa belajar secara aktif, efektif, kreatif dan akrab dengan lingkungaan. Materi geografi yang sesuai dengan metode outdoor study adalah materi kelas XI IPS semester dua yang membahas pemanfaatan sumberdaya alam. Untuk itu peneliti mencoba menerapkan metode pembelajaran outdoor ini pada siswa kelas XI IPS-2 SMA Negeri 3 Blitar dengan objek lokasi bekas aliran lahar gunung Kelud di wilayah Blitar. Tujuan utama dari penelitian ini adalah untuk mengetahui efektifitas penerapan metode outdoor study dalam meningkatkan aktifitas, hasil belajar, dan menyusun karya tulis pada pelajaran geografi, siswa kelas XI IPS-2 SMA Negeri 3 Blitar tahun ajaran 2010-2011. Penelitian ini merupakan penelitian tindakan kelas (clasroom action research) yang dilaksanakan dalam 2 siklus tindakan, sedangkan subjek yang digunakan dalam penelitian tindakan kelas ini adalah siswa kelas XI IPS SMA Negeri 3 Blitar, yang berjumlah 37 siswa, terdiri dari 21 perempuan dan 16 laki-laki. Aktifitas siswa diukur dengan menggunakan descriptor dimana semua kegiatan siswa dicatat, hasil belajar siswa diukur berdasarkan selisih nilai tes pada saat pratindakan, siklus1 dan siklus 2, sedangkan kemampuan menyusun karya tulis diukur berdasarkan selisih nilai pada siklus satu dengan siklus dua. Instrumen yang digunakan adalah soal tes, lembar observasi aktifitas siswa dan format penilaian karya tulis. Berdasakan hasil penelitian diketahui adanya peningkatan aktifitas siswa, hasil belajar, dan kemampuan menyusun karya tulis siswa kelas XI IPS-2 SMA Negeri 3 Blitar. Peningkatan aktifitas siswa ditunjukkan pada siklus I yang mencapai keberhasilan terdapat 51,3% yang terdiri dari 8,1% dengan kriteria baik sekali, 43,2% dengan kriteria baik, sedangkan sisanya 48,7% dapat dikatagorikan belum berhasil. Pada siklus II yang mencapai keberhasilan terdapat 86,4% yang terdiri dari 40,5% dengan kriteria baik sekali, 45,9% dengan kriteria baik sedangkan sisanya 13,6% dapat dikatagorikan belum berhasil. Peningkatan hasil belajar siswa ditunjukkan pada saat pratindakan terdapat 27,0% atau 10 siswa, siklus I terdapat 67,6% atau 25 siswa dan pada siklus II terdapat 89,2% atau 33 siswa yang sudah mencapai ketuntasan belajar. Sedangkan siswa yang belum tuntas belajarnya pratindakan 73,0% atau 27 siswa, siklus I terdapat 32,4% atau 12 siswa dan pada siklus II terdapat 10,8% atau 4 siswa. Sedangkan peningkatan kemampuan menyusun karya ilmiah terlihat pada siklus I terdapat 3 kelompok atau 0,43% yang nilainya dibawah 75 dan pada siklus 2 seluruh kelompok atau 100% nilai rata-ratanya di atas 75.

Pengaruh penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi terhadap hasil belajar di SMA Negeri 8 Malang / Trio Andi Cahyono


Kata Kunci: penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi, hasil belajar siswa. Penerapan pembelajaraan kontekstual adalah pendekatan pembelajaran dimana guru menghadirkan situasi dunia nyata ke dalam kelas yang membantu siswa mencari makna isi pembelajaran dalam materi yang sedang dipelajari. Dalam menerapkan pembelajaran kontekstual seorang guru memerlukan alat pemusat perhatian untuk menyampaikan materi. Alat pemusat perhatian tersebut menggunakan bantuan media berbasis teknologi informasi. Dalam penelitian ini media berbasis teknologi informasi menggunakan internet. Melalui keberadaan internet, siswa bisa mendapatkan informasi yang dibutuhkan dimanapun dan kapanpun waktu yang diinginkan. Sebagai sebuah sumber informasi yang hampir tak terbatas, maka jaringan internet dijadikan sebagai salah satu sumber pembelajaran. Penelitian ini bertujuan untuk mengetahui pengaruh penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi terhadap hasil belajar. Sampel dalam penelitian ini adalah siswa kelas XI IPS SMA Negeri 8 Malang yang berjumlah 52 siswa. Jenis penelitian ini adalah penelitian kuantitatif, sedangkan data yang digunakan adalah data primer berupa angket penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi, sedangkan data sekunder berupa nilai ulangan harian. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi linier sederhana. Hasil dari penelitian yang telah dilakukan adalah penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi berpengaruh terhadap hasil belajar siswa dengan nilai signifikansi sebesar 0,625.Berdasarkan hasil analisis tersebut dapat disimpulkan bahwa penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi berpengaruh terhadap hasil belajar siswa. Berdasarkan hasil penelitian tersebut, saran yang dapat diberikan adalah: (1) bagi pihak sekolah sebaiknya meningkatkan fasilitas teknologi informasi dan kelengkapan internet untuk menunjang pembelajaran siswa; (2) guru sebaiknya tetap melaksanakan pembelajaran kontekstual dengan menggunakan media teknologi informasi kerena siswa lebih paham terhadap materi yang disampaikan dan dapat meningkatkan hasil belajar siswa.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 |