Analisis persepsi matematika terhadap hasil belajar matematika ditinjau dari segi gender siswa di SMP se Kecamatan Camplong Kabupaten Sampang Madura / oleh Yeni Triasmaning Tias

 

Pengembangan model pembelajaran kooperatif jigsaw modifikasi dari Aronson dan Slavin serta pengaruhnya terhadap keterampilan metakognisi dan hasil belajar biologi siswa berkemampuan akademik berbeda di SMA Kota Denpasar / Cornelius Sri Murdo Yuwono

 

Kata kunci: Jigsaw Modifikasi, keterampilan metakognisi, hasil belajar biologi. Pelajaran Biologi berupaya membekali siswa dengan berbagai kemampuan tentang cara “mengetahui” berupa aspek produk, dan cara “mengerjakan” berupa aspek proses dalam kehidupan sehari-hari yang menuntut siswa menjadi pebelajar mandiri (Self-regulated learner). Aspek penting yang kurang mendapatkan perhatian adalah keterampilan metakognisi, dan bagaimana mensejajarkan siswa berkemampuan akademik bawah (AB) dengan siswa berkemampuan akademik atas (AA). Menurut Vygotsky, siswa AA dan AB dapat sejajar prestasi belajarnya, jika memperoleh scaffolding dari guru dan teman sebayanya. Hasil survei 97,50% pembelajaran berpusat pada guru, dan 100% tidak pernah memberdayakan keterampilan metakognisi siswa, disebabkan guru tidak mempunyai pemahaman keterampilan metakognisi. Model pembelajaran yang dapat meningkatkan keterampilan metakognisi dan hasil belajar adalah model pembelajaran kooperatif Jigsaw. Tujuan penelitian dan pengembangan adalah: (1) Mendeskripsikan gambar an pembelajaran biologi SMA di kota Denpasar, (2) Mengembangkan perangkat pembelajaran biologi berupa silabus, RPP, LKS, dan assesmen dengan model pembelajaran kooperatif Jigsaw Modifikasi dari Aronson dan Slavin yang dikembangkan melalui kegiatan Lesson Study, (3) Menguji keterampilan metakognisi dan hasil belajar kognitif biologi terhadap model pembelajaran, (4) Menguji keterampilan metakognisi dan hasil belajar kognitif biologi antara siswa berkemampuan akademik berbeda terhadap model pembelajaran, dan (5) Menguji keterampilan metakognisi dan hasil belajar kognitif biologi terhadap interaksi model pembelajaran dan kemampuan akademik. Prosedur pengembangan merujuk pada model 4-P (Pendefinisian, Perancangan, Pengembangan, dan Penyebaran (Define, Design, Develop, dan Desseminate) dari Thiagarajan. Tahap pendefinisian dilakukan dengan penelitian survei. Tahap perancangan menghasilkan produk Silabus, RPP, LKS, dan Assesmen, Tahap pengembangan dilaksanakan melalui Workshop Lesson Study (LS) guru biologi SMA kota Denpasar dan peer teaching dalam tahap Plan, Do, dan See. Tahap penyebaran melalui uji coba kelas sebenarnya diawali dengan LS, dan diteruskan dalam penelitian eksperimen. Rancangan eksperimen menggunakan kuasi eksperimen pretes-postes non equivalent control group design. Variabel bebas adalah model pembelajaran dan kemampuan akademik. Variabel terikat keterampilan metakognisi dan hasil belajar kognitif. Populasi penelitian adalah seluruh siswa kelas XI IPA SMA Negeri dan Swasta di kota Denpasar. Penarikan sampel menggunakan Stratifield random sampling untuk menetapkan delapan sampel sekolah. Setiap sampel sekolah diambil satu sampel kelas secara acak. Sampel penelitian 190 siswa masing-masing terdiri dari 95 siswa AA dan AB. Keterampilan metakognisi diukur berdasar rubrik yang terintegrasi dengan soal uraian, kesadaran metakognisi menggunakan MAI (Metacognitive Awareness Inventory), dan hasil belajar kognitif dengan soal tes uraian diukur dengan skala Hart. Instrumen terlebih dahulu diuji validitas, reliabilitas, tingkat kesukaran, dan daya beda. Data diambil saat pretes dan postes. Analisis data menggunakan analisis deskriptif dan anakova dilanjutkan uji Least Significance Different. Sebelum uji anakova, dilakukan uji asumsi normalitas dan homogenitas varians, menggunakan uji One-Sample Kolmogorov Smirnov Test.dan uji Levene’s Test. Semua penghitungan menggunakan program SPSS versi 16,0 pada taraf signifikansi 0,05 (p < 0,05). Hasil pengembangan perangkat pembelajaran melalui LS menunjukkan, (1) Pembelajaran biologi di SMA Kota Denpasar dididik oleh guru biologi SMA sesuai Standar Nasional Pendidikan, (2) Produk perangkat pembelajaran berupa Silabus, RPP, LKS, dan assesmen andal dalam meningkatkan keterampilan metakognisi dan hasil belajar kognitif. Hasil LS menunjukkan, (1) Keterampilan metakognisi berdasar rubrik pada model pembelajaran terjadi peningkatan kategori kualitatif at risk-not really menjadi kategori developing-ok., (2) Hasil belajar kognitif pada model pembe-lajaran terjadi peningkatan kategori kualitatif kurang (0-39) menjadi kategori baik (60-79). Hasil eksperimen sebagai berikut, (1) Model pembelajaran kooperatif Jigsaw Modifikasi dan Jigsaw II Slavin berpengaruh setara dalam meningkatkan keterampilan metakognisi berdasar rubrik, (2). Model pembelajaran tidak berpengaruh terhadap kesadaran metakognisi diukur menggunakan MAI. (3) Model pembelajaran kooperatif Jigsaw Modifikasi, Jigsaw Asli Aronson, Jigsaw II Slavin berpengaruh setara dalam meningkatkan hasil belajar kogitif (4) Terdapat pengaruh keterampilan metakognisi berdasar rubrik, kesadaran metakognisi menggunakan MAI, dan hasil belajar kognitif pada kemampuan AA dan AB, dan (5) Terdapat pengaruh interaksi model pembelajaran dengan kemampuan akademik terhadap keterampilan metakognisi berdasar rubrik, kesadaran metakognisi diukur menggunakan MAI, dan hasil belajar kognitif Model pembelajaran kooperatif Jigsaw Modifikasi dan Jigsaw Asli Aronson berpotensi setara dalam meningkatkan keterampilan metakognisi berdasar rubrik. pada kemampuan akademik bawah (AB). Model pembelajaran cenderung mampu meningkatkan kesadaran metakognisi menggunakan MAI pada kemampuan akademik atas (AA). Model pembelajaran kooperatif Jigsaw Modifi-kasi, Jigsaw Asli Aronson, mampu mengangkat hasil belajar kognitif yang dimiliki siswa berkemampuan AB. Sebaiknya guru mencoba mengimplementasikan model pembelajaran kooperatif Jigsaw Modifikasi bagi siswa berkemampuan AB dalam meningkatkan keterampilan metakognisi dan hasil belajar kognitif siswa. Pembentukan kelas dengan kemampuan akademik homogen perlu dipertimbangkan, karena menyebabkan tidak efektifnya proses scaffolding.

Studi pelaksanaan pekerjaan plumbing dan instalasi listrik pada proyek pembangunan gedung DPRD Kabupaten Probolinggo / Reza Cholid Yanuan Perdana

 

Kata Kunci: plumbing, air bersih, air kotor, instalasi listrik. Utilitas bangunan merupakan kelengkapan dari suatu bangunan gedung agar bangunan gedung tersebut dapat berfungsi secara optimal. Salah satu bagian dari utilitas bangunan adalah plumbing dan instalasi listrik. Plumbing adalah seni, teknologi perpipaan dan peralatan untuk menyediakan air bersih ke tempat yang dikehendaki, baik dalam hal kualitas, kuantitas dan kontinuitas yang memenuhi syarat dan membuang air bekas (kotor) dari tempat-tempat tertentu tanpa mencemari bagian penting lainnya untuk mencapai kondisi higienis dan kenyamanan yang diinginkan. Sedangkan instalasi listrik sendiri merupakan satu kesatuan dari rangkaian energi listrik. Studi Pelaksanaan Pekerjaan Plumbing dan Instalasi Listrik ini dilakukan pada Proyek Pembangunan Gedung DPRD Kab.Probolinggo. Teknik yang digunakan dalam pengumpulan data pada studi lapangan ini adalah: (1) observasi lapangan, (2) wawancara/interview, dan (3) dokumentasi. Setelah semua data terkumpul, kemudian dianalisa dan selanjutnya dideskripsikan. Studi lapangan ini bertujuan untuk mengetahui metode pelaksanaan pekerjaan plumbing dan instalasi listrik pada proyek pembangunan Gedung DPRD kabupaten Probolinggo oleh PT. Bangkit Lestari Jaya JO. Hasil Studi lapangan dan pembahasan menunjukkan bahwa, tahapan pelaksanaan pekerjaan plumbing adalah: (1) melakukan persiapan terlebih dahulu yaitu pengadaan bahan-bahan yang dibutuhkan atau material untuk pekerjaan plumbing baik instalasi air bersih dan kotor, biasanya pekerjaan plumbing ini dikerjakan setelah pekerjaan struktur selesai, (2) pemasangan instalasi pipa air bersih maupun air kotor sebelumnya marking jalur pipa sesuai shop drawing dan koordinasikan dengan jalur pekerjaan instalasi plumbing yang lain beserta pemasangan, pemasangan alat sanitair dilakukan setelah pemasangan pipa instalasi air kotor selesai, (3) Pengujian instalasi pipa, (4) perawatan secara berkala terhadap instalai plumbing. Sedangkan hasil studi lapangan dan pembahasan tahapan pelaksanaan pekerjaan instalasi listrik adalah: (1) pekerjaan persiapan alat dan bahan dalam pelaksanaan pekerjaan instalasi listrik, (2) pekerjaan pemasangan instalasi listrik, (3) Pengujian instalasi listrik. (4) perawatan instalasi listrik secara berkala.

Penanganan masalah pendidikan oleh reliever dalam aplikasi riliv / Amanah Dianrahmah Putri

 

ABSTRAK Putri, Amanah Dianrahmah. 2016. Penanganan Masalah Pendidikan oleh Reliever dalam Aplikasi Riliv..Skripsi, Jurusan Teknologi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Henry Praherdhiono, M.Pd., (II)Eka Pramono Adi, S.IP, M.Pd. Kata Kunci:Masalah Pendidikan, Aplikasi Riliv. Rilivadalahaplikasi mobile gratis yang dirancangkhususuntuksemua orang agar memberitahumasalahpribadimereka secara anonim dengan psikolog. Orang dapatberbicaraapapuntentangmasalah yang sedangdihadapi, entahmasalahkeluarga, pendidikan, karir, cinta, sosialbahkangangguanpsikologis. Berdasarkanhasilobservasipra-penelitianiniadalahaplikasirilivmenyediakanlayanankonsultasimengenaimasalahpendidikan yang ditanganioleh para psikolog (reliever), di dalamnyadibagimenjadiexpert relieverdanreguler reliever. Expert relieveradalahpsikolog professional yang terdaftarpadaHimpunanPsikolog Indonesia danpatuhpadaperaturanatauundang-undang yang relevanmengenaitenagakesehatan (Psychologists, Psychyatrist, Counsellor, Psychology Lecturer) sedangkanregular relieveradalahmahasiswapsikologiatauindividu yang berpengalamanuntukmenawarkankonsultasipsikologi. Sesuaidenganmisiriliv “Kami percayabahwasetiap orang memilikimasalahdanmembutuhkan orang lain. Rilivbertujuanuntukmerealisasikanketenanganpikiranpadasemua orang di dunia” yang nantinyaakandibuktikan di lapanganapakah reliever yang berlatarbelakangpsikologimampumenanganimasalahbelajarpembelajaransesuaidenganteoribehavioristik, kognitifsosial, pengolahaninformasidankonstruktivisme. Karenadalamurusanpendidikan, masalahbelajarbukanhal yang sepeledantidakdapatdipecahkandengansembarangan. Tujuandaripenelitianiniuntukmengetahuiapakah reliever yang berlatarbelakangpsikologimampumenanganimasalahbelajarpembelajaransesuaidenganteoribehavioristik, kognitifsosial, pengolahaninformasidankonstruktivisme. Penelitianinimengguanakanmetodedeskriptifkualitatif.Subjekpenelitianiniadalahbeberapasiswasertamahasiswadaribeberapajurusan yang sudahpenelitipilih, diantaraitusemuapenelitihanyaakanmengambil 1 darisetiapsubjek agar terdapatperbedaandalampermasalahan yang merekahadapi. Kemudianmerekaakanmengkonsultasikanmasalahnyakepadareliever.Pengumpulan data dilakukandenganmenggunakanteknikwawancaradandokumentasi. Untukmenjagakeabsahan data, dilakukandengankegiatantriangulasi. Berdasarkanhasilpenelitiansecarakeseluruhan, penangananmasalahpendidikanoleh reliever dalamaplikasirilivmasihbelumseefektif yang diharapkan. Selainkarena slow respon, reliever yang jarang Online, juga penanganannyalebihcenderungkepadamenanganimasalahbelajarsecarapsikisbukanmasalahpendidikansecarakeseluruhan yang sesuaidenganteoribelajar.Berbeda juga denganmisiriliv “Kami percayabahwasetiap orang memilikimasalahdanmembutuhkan orang lain. Rilivbertujuanuntukmerealisasikanketenanganpikiranpadasemua orang di dunia” (riliv.co), sedangkanketenangansajatidakcukupuntukmenyelesaikanmasalahpendidikan, paling tidak client diarahkanuntukmenemukanmasalahnyasendiridengan stimulus-stimulus yang sesuaidenganteori-teripendidikan.

Efektivitas pelaksanaan sosialisasi program pemerintah tentang pentingnya memiliki izin usaha kepada pengusaha kecul di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar / Rahajeng Gandyni

 

Kata kunci : Efektivitas, Sosialisasi, Program Pemerintah, Izin Usaha, Kota Blitar dikenal sebagi kota pariwisata, yang terbagi menjadi tiga kecamatan yaitu Kecamatan Sukorejo, Kecamatan Kepanjenkidul, dan Kecamatan Sananwetan. Dari tiga kecamatan yang ada, Kelurahan Bendogerit yang paling terkenal dengan obyek wisatanya. Tidak heran apabila di Kelurahan Bendogerit banyak berdiri industri kecil yang tumbuh yang menjadi daerah industri. Peneliti memilih tempat penelitian di Kelurahan Bendogerit karena selain obyek wisatanya yang lebih terkenal juga karena terdapat banyaknya industri – industri yang menjadi tulang punggung perekonomian keluarga.Karena faktor letak lokasi yang strategis untuk memproduksi barang dan lokasi pemasaran yang mudah. Permasalahannya, dari observasi awal di lapangan banyak berdiri usaha kecil bahkan ada yang telah menyuplai produknya ke obyek wisata di nusantara tetapi belum memiliki izin usaha. Permasalahan yang diangkat dalam penelitian ini adalah (1) Bagaimana pelaksanaan sosialisasi program pemerintah untuk pentingnya memiliki izin usaha kepada pengusaha kecil di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar ? (2) Bagaimana respon pelaku usaha kecil terhadap pelaksanaan sosialisasi program pemerintah untuk pentingnya memiliki izin usaha kepada pengusaha kecil di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar? (3) Bagaimana efektivitas pelaksanaan sosialisasi program pemerintah untuk pentingnya memiliki izin usaha kepada pengusaha kecil di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar? Respondennya ada dua yaitu Dua pengusaha dan dua Pegawai Kantor Pelayanan Terpadu. Dua type pengusaha yaitu pengusaha yang telah memiliki izin tetapi tidak diperpanjang dan pengusaha yang belum pernah memiliki izin usaha. Data yang dikumpulkan pada penelitian ini dianalisis dengan teknik analisa data kualitatif. Data hasil wawancara mendalam kemudian diolah, karena data yang didapat dari lapangan sifatnya sangat luas dan tidak semua data tersebut dibutuhkan untuk memperkuat analisa data dan mendukung tujuan penelitian. Informasi yang telah didapatkan dari lapangan dikelompokkan dan diolah secara sistematis untuk deskripsi yang jelas dalam menggambarkan proses pelaksanaan sosialisasi program pemerintah tentang pentingnya memiliki izin usaha kepada pengusaha kecil di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar, sehingga jawaban yang relevan pada saat wawancara dapat dipakai dalam analisis data. Hasil dari penelitian ini adalah: Pertama, Pelaksanaan sosialisasi yang dilakukan oleh KPT bermacam – macam cara yaitu dengan Pertemuan di tingkat kecamatan hingga tingkat kota, Pembuatan Baleho, brosur, spanduk dan leaflate, Media Elektronik , Gebyar Layanan Publik di PIPP, Melalui pihak Bank yang ada di Kota Blitar. Kedua, Dapat disimpulkan mengapa pengusaha tidak / belum memiliki izin usaha yaitu Faktor Ekonomi dalam usaha, Kemauan Pemohon Izin, Persepsi klasik tentang mengurus izin perlu waktu lama, mengurus izin mahal dan terjadi. Ketiga, Efektivitas sosialisasi apabila dilihat media yang digunakan, efektifitas menggunakan media pihak Bank paling efektif karena pengusaha kecil membutuhkan legalitas usaha untuk meminjam modal di Bank. Sedangkan apabila menggunakan media yang lain dinilai masih kurang efektif. Saran yang dapat diberikan berdasarkan hasil penelitian di atas yaitu: (1) Pelaksanaan sosialisasi yang dilakukan pemerintah, sebaiknya dilakukan secara merata dan melibatkan seluruh pengusaha atau perwakilan pengusaha dari setiap kelurahan atau paguyupan. (2) Perlunya sosialisasi yang lebih mendekat ke pengusaha kecil tentang pentingnya memiliki usaha dan merubah persepsi yang ada. (3) Adanya kompensasi kepada pengusaha yang telah mengurus izin usaha. Misalnya dengan diikutkan dadal program pemberian kredit lunak, pelatihan – pelatihan, dan program lain yang menunjang perekonomian usaha kecil.

Peningkatan pembelajaran apresiasi cerpen dengan strategi resiprokal di kelas II SMP Negeri 2 Sumberpucung Malang / oleh Farid Bahwerets

 

Peningkatan kemampuan menyerap ion Cd(II) dari mikroselulosa hidrolis ampas kelapa dengan bantuan ultrasonikasi / Dian Agustin

 

Kata kunci : Mikroselulosa, hidrolisis selulosa, ultrasonikasi, adsorpsi. Produksi serat mikroselulosa dan aplikasinya sebagai material komposit telah berkembang dan banyak diminati. Pada penelitian, dilakukan hidrolisis selulosa dengan menggunakan asam serta hidrolisis asam yang disertai ultrasonikasi. Mikroselulosa sebenarnya merupakan selulosa yang mempunyai dimensi berukuran mikrometer. Selulosa dapat berfungsi sebagai adsorben pada proses adsorpsi ion logam berat Cd2+ karena memiliki situs aktif (-OH) yang dapat mengikat ion Cd2. Dari latar belakang tersebut, diperoleh tujuan penelitian sebagai berikut : (1) Mengetahui perbedaan metode hidrolisis selulosa dengan atau tanpa ultrasonikasi terhadap ukuran dan tekstur mikroselulosa yang dihasilkan.; (2) Mengetahui kemampuan mikroselulosa yang dihasilkan dari kedua metode hidrolisis selulosa terhadap kemampuannya sebagai adsorben ion Cd2+. Penelitian yang dilakukan merupakan penelitian eksperimental yang terdiri dari tiga tahap yaitu hidrolisis selulosa, karakterisasi mikroselulosa serta adsorpsi. Hidrolisis selulosa menjadi mikroselulosa menggunakan H2SO4 55 % selama 4 jam serta hidrolisis asam (H2SO4 55 %) yang dikombinasikan dengan ultrasonikasi selama 1 jam. Mikroselulosa yang dihasilkan dari masing-masing metode hidrolisis kemudian dikarakterisasi yang meliputi uji kadar air, uji kadar abu, pengukuran massa jenis, daya serap terhadap larutan Iod (blanko yang digunakan adalah air) serta dilihat kenampakan permukaan dengan Scanning Electron Microscopy (SEM). Setelah proses karakterisasi, mikroselulosa dilarutkan dalam 50 ml larutan Cd(NO3)2 dengan variasi konsentrasi 4,9; 8,9; dan 25,7 ppm dan dikocok selama 20 menit, disaring, filtrat yang diperoleh kemudian dianalisis dengan Spektrosfotometri Serapan Atom (SSA). Berdasarkan penelitian yang telah dilakukan, hasil yang diperoleh yaitu : (1) Mikroselulosa yang dihasilkan dari metode hidrolisis asam yang disertai ultrasonikasi memiliki ukuran yang lebih kecil yaitu berkisar antara 1,0108-4,547 m serta mempunyai tekstur permukaan yang membentuk kawah, sedangkan mikroselulosa yang dihasilkan dari metode hidrolisis asam saja memiliki ukuran 2,8-5,290 m serta memiliki tekstur permukaan yang halus, (2) Hidrolisis selulosa yang disertai ultrasonikasi menghasilkan mikroselulosa yang memiliki kemampuan menyerap ion Cd2+ lebih baik dibandingkan dengan mikroselulosa yang dihasilkan dari hidrolisis asam saja.

Pelaksanaan strategi saluran distribusi pada Jawa Pos Radar Malang / Hetty Nilawati

 

Kata Kunci: Strategi, Saluran, Distribusi. Setiap perusahaan barang dan jasa tidak akan terlepas dari masalah penyaluran barang yang dihasilkan suatu barang yang akan di jual ke masyarakat. Para produsen berhak menentukan kebijaksanaan distribusi yang akan di sesuaikan dengan jenis barang serta luasnya armada penjualan yang akan digunakan. Suatu perusahaan dikatakan berhasil di dalam marketing apabila perusahaan tersebut dapat memasarkan barang – barangnya secara luas dan merata dengan mendapatkan keuntungan yang maksimal. Dalam upaya memperkenalkan produk dari produsen tersebut diperlukan beberapa strategi yang meliputi strategi marketing mix, meliputi: price (harga), promotion (promosi), place (tempat), dan product (produk). Saluran distribusi pada Jawa Pos Radar Malang menggunakan saluran distribusi tidak langsung dalam proses distribusinya melainkan melalui perantara agen yang tersebar di beberapa titik di kota Malang dan kemudian ada yang langsung ke konsumen akhir yang dalam hal ini adalah pembaca. Penulisan laporan ini bertujuan untuk mengetahui Pelaksanaan Sistem Strategi Saluran Distribusi Pada Jawa Pos Radar Malang, faktor–faktor yang mempengaruhi Kegiatan Distribusi Pada Jawa Pos Radar Malang, dan Faktor pendukung dan penghambat kegiatan distribusi Pada Jawa Pos Radar Malang. Strategi Saluran Distribusi yang digunakan Jawa Pos Radar Malang adalah mengacu pada saluran distribusi tidak langsung (Indirect Channel Of Distribution) dimana perusahaan tidak melakukan kegiatan distribusi langsung kepada konsumen melainkan melalui perantara agen. Serta menggunakan strategi cakupan distribusi dalam hal ini Jawa Pos Radar Malang menggunakan jenis distribusi intensif. Pelaksanaan saluran distribusi yang menggunakan banyak perantara atau penyalur yang dalam hal ini adalah agen. Faktor–faktor yang mempengaruhi kegiatan saluran distribusi pada Jawa Pos Radar Malang yaitu: Karakteristik Pelanggan, Karakteristik Produk, Karakteristik Perantara, dan Karakteristik Lingkungan. Faktor pendukung dalam kegiatan Distribusi Jawa Pos Radar Malang adalah munculnya isu–isu maupun berita–berita yang menarik dan aktual di kalangan masyarakat, kedatangan truk. Sedangkan yang menjadi penghambat kegiatan Disribusi Jawa Pos Radar Malang adalah Kondisi ekonomi masyarakat, pembayaran agen, kondisi lingkungan, terjadinya kecelakaan.

Kualitas air sungai Arbes dan potensi tumbuhan air sebagai agen fitoremediator dalam pengembangan buku penunjang pengetahuan lingkungan berbasis riset di IAIN Ambon / Muhammad Rijal

 

ABSTRAK Rijal, Muhammad. 2016. Kualitas Air Sungai ArbesdanPotensiTumbuhan Air sebagaiAgenFitoremediatordalamPengembanganBukuPenunjangMatakuliahPengetahuanLingkunganBerbasisRiset di IAIN Ambon. Disertasi, Program StudiPendidikanBiologi, Pascasarjana, UniversitasNegeri Malang. Pembimbing (I). Prof. Dr. agr. H. Mohamad Amin, M. Si., (II). Dr. H. FatchurRohman, M. Si., (III). Dr. Hj. EndangSuarsini, M. Ked. Kata Kunci: sungaiarbes, fitoremediator, pengetahuanlingkungan Arbesmerupakansalahsatusungai yang digunakanolehMasyarakat Ambon sebagaisumberbaku air minum. Selainsebagaisumberbaku air minum, sungaiinidigunakansebagaitempatuntukmencuci, mandi, objekwisata, pembuanganlimbahdomestik, danpembuanganakhirlimbahtinja. Tingginyaaktivitasmasyarakat yang bermukim di sekitaraliransungaimengakibatkanmasuknyaberbagaijenislimbah yang berbahayasepertilogamberatdankoliform. Pengujiankualitas air secarafisik, kimia, danbiologisangatperludilakukanuntukmenentukan status mutu air berdasarkanperuntukannya. Air yang mengalamipencemaranolehlogamberatdankoliformtidaklayakuntukdikonsumsi, sehinggauntukmengatasihaltersebutdiperlukanagenhayati yang potensialuntukmeremediasilimbah. Hasilpengujiankualitas air, pertumbuhandankemampuanagenfitoremediatordalammeremdiasilimbahmerupakandasardalammengembangkanbukupenunjangpengetahuanlingkunganberbasisriset. Pengembanganbukuberbasisrisetmerupakansalahsatustrategi yang dapatditerapkanuntukmemadukan proses pembelajarandenganhasilriset. Hal inidiharapkandapatmembantumahasiswadalammemahami ide, konsep, danteorisehinggadapatmeningkatkanpemahamantentangmateri yang dipelajari. Proses risetakanmelahirkan proses pembelajaran yang kontekstual. Pembelajarankontekstualadalahpembelajaran yang nyatayaitumenghadirkansuatufenomenaataukasus yang benar-benarterjadi di lapangan. Salah satufenomena yang kontekstualdandapatdiajarkanpadamatakuliahpengetahuanlingkungandenganmenggunakanmetodeeksperimenadalahpencemaran air, sepertimelihataktivitasmasyarakat yang menyebabkanterjadinyapencemaran, mengujikualitas air, danmengujiagenhayatidalammeremediasi air darilimbah. Tujuandalampenelitianiniadalah: mendeskripsikanaktivitasmasyarakat yang bermukim di sekitar DAS Arbes yang menyebabkanmenurunnyakualitas air sungai, menganalisiskualitas air sungai, menganalisispertumbuhandankemampuanPistiastratiotes, Limnocharisflava, danHydrillaverticillatadalammeremediasilogamberat (Pb, Cd, Cr, dan Hg) dankoliform, sertamenghasilkanbukupenunjangpengetahuanlingkunganberbasisriset.Metode yang digunakandalampenelitianyaitu: survei, eksperimen, danpengembangan. Penelitiansurveidilaksanakanpadabulan Mei-Juni 2015, penelitianeksperimendilaksanakanpadabulanJuni-September 2015, danpenelitianpengembangandilaksanakanpadabulan September-Desember 2015. Hasilpenelitianmenunjukkanbahwaaktivitasmasyarakat yang menyebabkanmenurunnyakualitas air sungaiArbesadalahpertanian, mandi, mencuci, buang air besar, danmembuanglimbahdomestik.Kualitas air sungaiArbesdidasarkan parameter TSS, COD, DO, NO3,dan NO2 masihmemenuhikriteriabakumutu air yang peruntukannyasebagaisumberbaku air minum; didasarkan parameter suhu, pH, BOD, fenolat, detergendalam MBAS, dankoliformmemenuhikriteriabakumutu air yang peruntukannyauntuksaranarekreasidanbudidayaikanartawar; dandidasarkan parameter Pb, Cd, Cr, Hg, dan total lemakmemenuhikriteriabakumutu air yang peruntukannyauntukpeternakandanmengairilahanpertanian. Menurunnyakualitas air membutuhkansolusibiologiyaitumenggunakantumbuhan yang memilikikemampuandalammeremediasilogamberat B3 dankoliform. P.stratiotes, L.flava, dan H.verticillatamemilikikemampuandalammeremediasiPb, Cd, Cr, dan Hgserta total koliform. KemampuanH.verticillatadalammeremediasilogamberatlebihbaikbiladibandingkandenganL.flavadanP.stratiotes, tetapiP.stratiotesmemilikikemampuanmeremediasikoliformlebihbaikbiladibandingkandenganL.flavadanH.verticillata.H.verticillatadanP.stratiotesmerupakanagenfitoremediator yang memilikikemampuantumbuhdenganbaikpadakondisitercemarbiladibandingkandenganL.flava. Hasilsurveidaneksperimenmerupakanbahandalammengembangkanbukupenunjangpengetahuanlingkunganberbasisriset. Dengankeunggulanadalahbahasa yang digunakanlebihmudahdipahami, materi yang disajikanlebihnyata, dilengkapidenganhasilpenelitian, ujikompetensi, danmampumeningkatkanhasilbelajarkognitif.Rekomendasidaritemuaniniadalah agar masyarakat yang bermukim disekitaraliransungaiArbesuntukmenggunakanP. stratiotesdan H. verticillatadalammembersihkan air sungai yang tercemarolehlimbahlogamberatdankoliform. Selainitu, bukuhasilpengembangandapatdigunakansebagaibahan ajar padamatakuliahpengetahuanlingkungankarenadapatmeningkatkanhasilbelajarkognitifmahasiswa.

Pengembangan paket pembelajaran mata kuliah fisika dasar II pada Program Studi Pendidikan Fisika Universitas Kanjuruhan Malang dengan model Dick Carey & Carey / Sholikhan

 

Tesis, PSSJ Teknologi Pembelajaran, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Nyoman Sudana Degeng, M. Pd (II) Dr. H. Sulton, M.Pd., Kata Kunci: Pengembangan, Paket Pembelajaran, Fisika Dasar II, Model Dick, Carey & Carey Hingga saat ini materi fisika masih dianggap sebagai materi yang sulit dan kurang diminati oleh mahasiswa, yang berdampak pada proses pembelajaran yang tidak kondusif dan rendahnya hasil belajar mahasiswa. Demikian pula yang terjadi di program studi Pendidikan Fisika Universitas Kanjuruhan Malang, khususnya pada mata kuliah Fisika Dasar II. Berdasarkan studi pendahuluan hasil observasi dan wawancara dengan beberapa mahasiswa dan dosen diketahui bahwa hasil pembelajaran mata kuliah Fisika Dasar II kurang memuaskan, IP rata-rata mahasiswa hanya 2,51. Tingkat ketidaklulusan rata-rata 10-15%. Penguasaan konsep-konsep dasar kelistrikan, kemagnetan, gelombang, dan atom oleh mahasiswa nampak lemah. Latihan soal yang hanya diganti angka sudah membuat repot mahasiswa. Kenyataan ini terjadi karena berbagai faktor, diantaranya bahan ajar yang digunakan untuk mata kuliah Fisika Dasar II jumlahnya sangat terbatas. Buku ajar yang tersedia sebagian besar menggunakan bahasa terjemahan, yang sulit difahami. Gambar yang berfungsi untuk memperjelas konsep-konsep yang abstrak tidak sesuai dengan harapan mahasiswa. Di samping itu referensi yang tersedia tidak disusun berdasarkan analisis kebutuhan dan karakteristik mahasiswa. Untuk menciptakan sebuah proses pembelajaran yang efektif, efisien dan memiliki daya tarik diperlukan sumber-sumber belajar yang dapat digunakan untuk mendukung pembelajaran yang lebih berkualitas. Sumber-sumber belajar tersebut dapat berupa pesan, orang, bahan, alat, tekhnik dan lingkungan (AECT, 1994). Pembelajaran mata kuliah Fisika Dasar II harus segera mendapat perhatian dan pemecahan masalah. Bila tidak, maka kompetensi mahasiswa dalam menguasai konsep-konsep dasar fisika akan semakin lemah. Pemecahan masalah terpenting yang harus segera ditangani adalah pengadaan bahan ajar yang sesuai dengan kebutuhan dan karakteristik mahasiswa. Oleh karena itu, penelitian pengembangan ini bertujuan untuk mengembangkan paket pembelajaran Fisika Dasar II yang sesuai dengan kebutuhan dan karakteristik mahasiswa. Model yang digunakan dalam pengembangan ini adalah model Dick, Carey & Carey (2001). Pengembangan ini hanya dilakukan sembilan langkah, yakni: (1) mengidentifikasi tujuan pembelajaran, (2) melakukan analisis pembelajaran, (3) mengidentifikasi perilaku awal dan karakteristik pebelajar, (4) menulis tujuan pembelajaran khusus, (5) mengembangkan butir-butir tes acuan patokan, (6) mengembangkan strategi pembelajaran, (7) mengembangkan dan memilih materi pembelajaran, (8) mendesain dan melakukan evaluasi formatif, dan (9) merevisi pembelajaran. Hasil pengembangan berupa draft paket pembelajaran diujicobakan. Uji coba yang telah dilakukan meliputi uji coba ahli isi mata kuliah, ahli desain pembelajaran, uji coba ahli media pembelajaran, uji coba perorangan, uji coba kelompok kecil dan uji coba lapangan. Hasil penilaian/tanggapan dari masing-masing tahap digunakan sebagai masukan proses penyempurnaan paket pembelajaran. Hasil uji coba ahli untuk bahan ajar berada dalam kategori sangat baik. Dari hasil uji coba perorangan pengembang banyak mendapatkan perbaikan, saran dan masukan. Berdasarkan hasil uji coba kelompok kecil, bahan ajar termasuk kategori sangat tepat/sangat jelas/sangat menarik. Dengan rerata persentase ketepatan 87.65%, kejelasan 87.1% dan kemenarikan 86.0%. Panduan mahasiswa juga termasuk kategori sangat baik, dengan rerata persentase 86.98%. Untuk uji coba lapangan bahan ajar termasuk kategori sangat tepat/sangat jelas/ sangat menarik, dengan rerata persentase ketepatan 86.27%, kejelasan 86.07% dan kemenarikan 85.48%. Bahan ajar juga mampu menumbuhkan motivasi mahasiswa dalam katagori baik (84.87%). Penilaian/tanggapan dosen pembina mata kuliah terhadap bahan ajar temasuk kategori sangat tepat (92.7%)/ sangat jelas (92%) dan sangat menarik (97.8%). Panduan mahasiswa berada dalam kategori sangat baik (87.14%). Panduan dosen dikategorikan sangat baik (91%). Peningkatan hasil belajar mahasiswa sangat signifikan, terbukti dengan adanya perbedaan nilai pretes dan postes sebesar 35.9. Artinya paket pembelajaran sangat efektif untuk meningkatkan hasil belajar. Kekuatan paket pembelajaran yang telah disusun adalah (1) paket pembelajaran disusun secara sistematis untuk digunakan dosen dan mahasiswa dalam kegiatan pembelajaran; (2) paket pembelajaran dapat menimbulkan minat baca; (3) paket pembelajaran disusun berdasarkan pola belajar yang fleksibel; (4) paket pembelajaran memberi kesempatan pada mahasiswa untuk berlatih; (5) paket pembelajaran mengakomodasi kesulitan mahasiswa; (6) paket pembelajaran memberikan rangkuman, sehingga mempermudah proses belajar mahasiswa; (7) gaya penulisannya komunikatif dan semi formal; (8) Kepadatan isinya berdasarkan kebutuhan mahasiswa; (9) dikemas untuk proses instruksional, sehingga disertai panduan dosen dan panduan mahasiswa untuk menjelaskan cara mempelajarinya. Sedangkan kelemahan paket pembelajaran ini adalah disusun berdasarkan karakteristik mahasiswa program studi pendidikan fisika, sehingga keberadaannya sesuai dengan karakteristik mahasiswa program studi pendidikan fisika FKIP Universitas Kanjuruhan Malang. Bila bahan ajar ingin digunakan secara luas, perlu penyempurnaan atau revisi sesuai dengan karakteristik dan kebutuhan pengguna.

Penerapan media permainan puzzle dalam pembelajaran bahasa Indonesia untuk meningkatkan kemampuan menulis deskripsi siswa SD kelas II di SD Negeri Pohgajih 1 Kec. Selorejo Kab. Blitar / Tisna Kusuma Wardhani

 

Kata kunci : permainan puzzle, menulis deskripsi, peningkatan kemampuan. Menulis adalah salah satu aspek dalam pembelajaran Bahasa Indonesia yang paling kompleks untuk dipelajari. Pada tingkat SD kelas II, materi untuk aspek menulis adalah menulis permulaan dengan mendeskripsikan benda disekitar siswa. Kegiatan tersebut menuntut siswa untuk aktif dalam pembelajaran agar siswa mampu mengembangkan kreatifitas dan ide dalam menulis. Untuk mencapai hal itu, guru harus lebih inovatif dalam menyampaikan pembelajaran agar tercapai tujuan dari pembelajaran tersebut. Salah satu cara adalah dengan menggunakan permainan puzzle sebagai media pembelajaran. Penelitian ini menggunakan racangan penelitian tindakan kelas (PTK) model Kemmis dan McTaggart dengan prosedur pelaksanaan dari tahap perencanaan, pelaksanaan, pengamatan, dan refleksi. Peneliti dalam pelaksanaan tindakan adalah sebagai observer, sedangkan guru kelas adalah sebagai pelaksana tindakan. Subyek penelitian tindakan siswa kelas II SD Pohgajih 1 berjumlah 18 siswa. Hasil penelitian menunjukkan adanya peningkatan kemampuan siswa dalam menulis deskripsi. Hal tersebut dilihat dari hasil evaluasi pada pretes siswa, tidak ada satupun siswa yang mencapai tingkat ketuntasan. Selanjutnya pada siklus I meningkat sebanyak 53% siswa atau sekitar 9 siswa mencapai tingkat ketuntasan. Pada pretes siklus II, sejumlah 10 siswa tuntas engan prosentase 55% dan berikutnya pada postes siklus II 18 siswa mencapai ketuntasan dengan prosentase 100%. Dari hasil penelitian dapat disimpulkan bahwa (1) pembelajaran bahasa Indonesia dengan menggunakan media puzzle di SDN Pohgajih 1 dapat menciptakan pembelajaran yang santai, menarik dan nyaman yang dapat meningkatkan keaktifan siswa, (2) adaya peningkatan kemampuan siswa terbukti dari hasil pretes, postes siklus I, pretes II dan postes pada sikus II. Berdasarkan penelitian tersebut dimemukakan saran bagi: (1) guru hendaknya mererapkan media permainan puzzle dalam pembelajaran terutama pembelajaran menulis deskripsi pada siswa kelas II, (2) kepala sekolah hendaknya memberi kesempatan kepada guru untuk mengujicobakan metode dan media yang inovatif yang berguna bagi peserta didik, (3) bagi peneliti lain hendaknya menindaklanjuti karya ilmiah ini dengan ruang lingkup dan kajian yang lebih luas.

Pertumbuhan populasi Chaetoceros Spp dan Pleurosigma Spp (Bacillariophyceae) sebelum dan sesudah pemupukan di Tambak Udang Windu Paciran Kabupaten Lamongan / oleh Umi Suryati Ningsih

 

Pemanfaatan prasarana internet dalam pembelajaran TIK pada siswa SLTP negeri di Kota Pasuruan / Riski Ardiani

 

Kata Kunci: pemanfaatan, prasarana internet, pembelajaran Pemanfaatan internet dalam pembelajaran dapat ditunjukkan dengan adanya sarana dan prasarana yang menunjang baik di dalam dan di luar sekolah. Adanya laboratorium internet sekolah, fasilitas umum yang menyediakan jasa internet (warnet), serta fasilitas layanan internet yang tersedia di rumah dapat dimanfaatkan dengan baik oleh guru dan siswa. Dengan demikian guru dan siswa memiliki banyak kesempatan untuk memanfaatkan internet sebagai sarana pembelajaran di sekolah yang merupakan fenomena baru dalam memecahkan masalah belajar. Hal ini dapat menjadi solusi yang terjadi selama ini, seperti keterbatasan tenaga, jarak, letak geografis, dan waktu belajar yang terbatas. Penelitian ini bertujuan untuk mendeskripsikan kondisi kelengkapan fasilitas dan kelengkapan ruang akses internet yang ada pada SLTP Negeri di Kota Pasuruan, seberapa jauh pemanfaatan akses internet yang dilakukan oleh guru dan siswa dalam pembelajaran TIK di dalam dan di luar sekolah, serta apa saja kendala yang dirasakan dari pemanfaatan akses internet dengan bantuan SPSS for Windows release 17. Pengambilan sampel dalam penelitian menggunakan teknik proportional random sampling yang terdiri dari 341 orang siswa dan 17 orang guru. Instrumen penelitian terdiri dari angket, lembar observasi, dan dokumentasi. Teknik analisis data menggunakan analisis deskriptif untuk mengetahui kondisi variabel yang akan diteliti dan perbandingan skor tiap variabel.Berdasarkan hasil penelitian ini menunjukkan bahwa (1) kondisi fasilitas akses internet pada SLTP negeri di Kota Pasuruan belum memenuhi kebutuhan pembelajaran TIK (2) kondisi dan kelengkapan ruang akses internet belum sesuai dengan aturan yang ditetapkan, diataranya: kondisi fisik serta ukuran bangunan perlu dilakukan pembenahan atau renovasi, terdapat beberapa sekolah yang daya listrik yang ada belum sesuai dengan kebutuhan, serta ditemukan pula beberapa kelengkapan ruang laboratorium komputer/ruang akses internet seperti: printer dalam kondisi rusak, AC yang belum ada atau tidak dapat digunakan karena daya listriknya kurang, belum tersedia LCD proyektor, scanner, serta peralatan multimedia dan audio. (3) kecenderungan pemanfaatan akses internet di sekolah pada tiap SLTP negeri di Kota Pasuruan oleh siswa tergolong dalam kriteria sedang, sedangkan pemanfaatan internet oleh guru dalam kriteria tinggi. (4) penggunaan internet di luar sekolah lebih sering dilakukan oleh siswa dari pada guru. (5) kendala dalam pemanfaatan internet pada SLTP Negeri di Kota Pasuruan adalah keterbatasan waktu akses internet di sekolah untuk siswa.

Penggunaan media gambar seri untuk meningkatkan kemampuan bercerita anak kelompok B TK Dharma Wanita Persatuan II Parasrejo Kabupaten Pasuruan / Jubaydah

 

Kata Kunci : media gambar seri, kemampuan bercerita. Berdasarkan hasil observasi di TK Dharma Wanita Persatuan II Parasrejo Pasuruan, kemampuan bercerita anak sangat rendah, sehingga anak tidak termotivasi untuk melakukan kegiatan bercerita. Terbukti dari sikap anak yang tidak mau maju ke depan kelas untuk bercerita. Selama ini menggunakan lembar kerja yang tidak berwarna kegiatan untuk bercerita dengan menggunakan alat peraga masih jarang dilakukan oleh guru, khususnya media gambar seri. Tujuan penelitian ini adalah : 1). Mendeskripsikan cara menggunakan media gambar seri untuk meningkatkan kemampuan bercerita dan Mendeskripsikan adanya peningkatan kemampuan bercerita dengan menggunakan media gambar seri pada anak kelompok B TK Dharma Wanita Persatuan II Parasrejo Pasuruan. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) yang dilaksanakan 2 (dua) siklus. Masing – masing siklus terdiri atas 4 tahapan : perencanaan, pelaksanaan, observasi dan refleksi : Subyek penelitian ini adalah anak kelompok B di TK Dharma Wanita Persatuan II Parasrejo Pasuruan sebanyak 16 anak. Teknik pengumpulan data yang digunakan adalah observasi secara langsung terhadap kegiatan anak. Peningkatan kemampuan bercerita anak melalui penggunaan media gambar seri di TK Dharma Wanita Persatuan II Parasrejo Pasuruan, terbukti dari hasil belajar yang diproleh anak sebelum menggunakan media gambar seri yang berukuran besar, siklus I, siklus II yang terus mengalami peningkatan, yaitu pratindakan terdapat 3 anak (19%) telah mencapai ketuntasan individu dan sebanyak 13 anak (81%) belum mencapai ketuntasan individu, Siklus I mengalami peningkatan terdapat 7 anak (44%) mencapai ketuntasan individu, Siklus II semakin meningkat terdapat 11 anak (63%) telah mencapai ketuntasan individu dan 5 anak (31%) belum mencapai ketuntasan individu. Berdasarkan hasil penelitian bahwa kegiatan bercerita menggunakan media seri dapat diterapkan untuk meningkatkan kemampuan bercerita anak. Media gambar yang digunakan hendaknya berukuran besar, berwarna agar menarik bagi anak. Guru harus selalu membimbing dan memberi motivasi kepada anak guru hendaknya sesering mungkin menggadakan kegiatan bercerita, agar anak terbiasa untuk melakukan kegiatan bercerita dan tidak malu lagi untuk bercerita di depan kelas karena sudah terbiasa.

Penerapan model pembelajaran kooperatif Team Game Tournament (TGT) dan fan pick untuk meningkatkan motivasi dan hasil belajar IPS (studi di kelas VIII SMP Negeri 25 Tanjung Jabung Timur Provinsi Jambi) / Frianto

 

ABSTRAK Frianto. 2016. Penerapan Model Pembelajaran Kooperatif Team Game Turnamen (TGT) dan Fan N Pick untuk Meningkatkan Motivasi dan Hasil Belajar IPS. (studi di kelas VIII SMP Negeri 25 Tanjung Jabung Timur Provinsi Jambi). Pembimbing: (1) Prof. Dr. H. Budi Eko Soetjipto, M.Ed, M.Si, (2) Dr. Ach. Amirudin, M.Pd Kata Kunci: Team Game Turnamen, Fan N Pick, Motivasi, Hasil Belajar Berdasarkan hasil observasi yang dilakukan di kelas VIII SMP Negeri 25 Tanjung Jabung Timur Provinsi Jambi diketahui bahwa 1) pada saat proses pembelajaran berlangsung, siswa cenderung pasif dan menganggap mata pelajaran IPS membosankan serta kurang adanya empati terhadap materi pelajaran; 2) cara mengajar yang dilakukan guru secara konvensional dan guru masih cenderung mendominasi kelas sehingga siswa cenderung pasif; 3) masih tingginya sikap ketergantungan siswa terhadap guru, dan 4) hasil belajar siswa pada bidang studi IPS masih kurang optimal yaitu masih banyak siswa yang nilainya di bawah KKM yang ditentukan sekolah yaitu 75. Keempat permasalahan tersebut akan berdampak pada motivasi siswa dalam belajar IPS dan hasil belajarnya. Tujuan penelitian ini adalah 1) untuk mengetahui penerapan model pembelajaran Team Game Turnamen dan Fan N Pick pada siswa kelas VIII SMP Negeri 25 Tanjung Jabung Timur Provinsi Jambi pada mata pelajaran IPS, 2) untuk mengetahui penerapan model pembelajaran Team Game Turnamen dan Fan N Pick dapat meningkatkan motivasi belajar siswa kelas VIII SMP Negeri 25 Tanjung Jabung Timur Provinsi Jambi pada mata pelajaran IPS, dan 3) untuk mengetahui penerapan model pembelajaran Team Game Turnamen dan Fan N Pick dapat meningkatkan hasil belajar siswa kelas VIII SMP Negeri 25 Tanjung Jabung Timur Provinsi Jambi pada mata pelajaran IPS. Temuan penelitian pada sisklis satu menunjukan bahwa masih banyak siswa yang belum paham tentang model pembelajaran kooperatif Team Game Turnamen dan Fan N Pick, dari temuan tersebut peneliti melanjut ke siklus ke dua dengan memberi pembelajaran yang terbimbing tentang model pembelajaran Team Game Turnamen dan Fan N Pick. Penelitian dilakukan dalam dua siklus yang terdiri dari empat tahapan yaitu 1) perencanaan; 2) pelaksanaan; 3) pengamatan; dan 4) refleksi. Hasil penelitiannya menunjukkan penerapan pembelajaran kooperatif Team Game Turnament dengan Fan n Pick berjalan dengan sangat baik. Hal ini dapat ditunjukkan dengan adanya peningkatan motivasi belajar siswa dari sebelum tindakan motivasi belajar siswa mencapai 60,65%, pada akhir siklus I motivasi belajar siswa meningkat menjadi 71,39% dan akhir siklus II meningkat menjadi 81,10%. Dilihat dari nilai rata-rata ulangan harian sebelum tindakan sebesar 69,85, nilai rata-rata tes hasil belajar siklus I mengalami peningkatan menjadi 76,66, dan nilai rata-rata tes hasil belajar siklus II juga mengalami peningkatan menjadi 81,87. Nilai ketuntasan klasikal sebelum tindakan sebesar 58,33%, pada akhir siklus I meningkat menjadi 70,83% dan akhir siklus II meningkat menjadi 87,5%. Dari hasil penelitian dapat ditarik kesimpulan bahwa keunggulan dalam pembelajaran kooperatif adalah (1) saling ketergantungan positif; (2) adanya pengakuan dalam merespon perbedaan individu; (3) siswa dilibatkan dalam perencanaan dan pengelolaan kelas; (4) suasana kelas yang rileks dan tenang; (5) terjadinya hubungan yang hangat dan bersahabat antara siswa dan guru; dan (6) memiliki banyak kesempatan untuk mengekspresikan pengalaman emosi yang menyenangkan. Pada model pembelajaran Team Game Turnament dengan Fan n Pick dapat meningkatkan motivasi dan hasil belajar siswa pada mata pelajaran IPS. Dalam pelaksanaan model pembelajaran Team Game Turnamen dan Fan N Pick disarankan: 1) guru melakukan persiapan yang matang tentang khususnya tentang pengefesiensian waktu permainan; 2) untuk meningkatkan motivasi belajar siswa pada mata pelajaran IPS hendaknya guru menggunakan model pembelajaran yang kreatif dan inovatif yang tidak membosankan bagi siswa; 3) untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS, hendaknya guru harus bisa menciptakan suasana belajar yang menyenangkan sehingga siswa termotivasi untuk belajar yang dapat memacu pada hasil belajar mereka; 4) untuk pihak sekolah hendaknya mendukung dan memfasilitasi guru yang akan melakukan pembelajaran kooperatif yang mana ini akan berguna untuk meningkatkan motivasi dan hasil belajar siswa tentunya yang diharapkan.

Penyelenggaraan program-program pelatihan ditinjau dari prinsip-prinsip pelatihan : studi kasus pada PT. Gandum Malang / oleh Sufyan Sauri

 

Keberlanjutan pengelolaan program pendidikan non formal di PKBM (study kasus di PKBM Widya Kharisma Kecamatan Talun Kabupaten Blitar) / Wisnu Wardhana

 

Tesis, Jurusan Pendidikan Luar Sekolah, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing : (1) Prof. Drs. H. M. Saleh Marzuki, M.Ed, (2) Prof. Dr. Supriyono, M.Pd Kata Kunci : program Pendidikan Non Formal (PNF), keberlanjutan PKBM, pengelolaan PKBM Penelitian ini bertujuan untuk mengetahui makna keberlanjutan pengelolaan program pendidikan non formal di PKBM Widya Kharisma. Untuk itu dilakukan penelitian dengan tradisi studi kasus. Pengumpulan dan penggalian data dilakukan dengan wawancara, observasi, dan studi dokumentasi. Hasil penelitiannya adalah 1. PKBM Widya Kharisma termasuk PKBM yang mempunyai dedikasi tinggi dalam memajukan dunia pendidikan. Selain itu PKBM ini juga memiliki banyak prestasi. 2. upaya penyelenggaraan program di PKBM Widya Kharisma telah memenuhi standar, sedangkan Standar Pengawasan dan Evaluasi masih belum sesuai Standar pengelolaan. 3. adanya kelebihan dan kelemahan dalam aspek perencanaan, pengorganisasian, pembinaan, evaluasi, pelaksanaan, koordinasi 4. konstruksi makna yang menjelaskan fenomena keberlangsungan kehidupan PKBM Widya Kharisma adalah a. PKBM Widya Kharisma didukung dengan fasilitas yang memadai. b. PKBM Widya Kharisma didukung dengan SDM yang professional. c. PKBM Widya Kharisma didukung dengan pengelolaan dan adminitrasi yang baik. d. dukungan pemerintah, tokoh masyarakat dan warga masyarakat sekitar yang sangat besar untuk mendukung dan menyukseskan program yang ada di PKBM. e. kemitraan dengan berbagai kalangan termasuk dunia kerja. f. PKBM Widya Kharisma memiliki sumber dana yang cukup. g. program yang ada di PKBM Widya Kharisma sesuai dengan kebutuhan masyarakat. Berdasarkan proses dan temuan penelitian ini disarankan hal-hal sebagai berikut : a. kekurangan pada pengawasan dan evaluasi dengan cara menyesuaikan pengawasan dan evaluasi dengan standar yang telah ditentukan. b. kekurangan pada aspek pengelolaan di PKBM Widya Kharisma agar segera diperbaiki. c. pengelola PKBM untuk lebih meningkatkan kinerja, sarana dan prasarana dan kualitas program yang ada di PKBM sehingga keberlangsungan PKBM Widya Kharisma tetap terjaga. d. Bagi jurusan PLS, untuk menambah referensi untuk penerapan ilmu-ilmu pendidikan luar sekolah dimasyarakat, guna perkembangan penerapan ilmu-ilmu pendidikan luar sekolah dalam bentuk-bentuk pembelajaran lain yang lebih variatif. e. Bagi peneliti lain, agar penelitian ini dapat menjadi bahan pertimbangan dan referensi dalam pengembangan penelitian lebih lanjut.

Studi kasus menu pembelajaran dan pelaksanaan kelompok bermain negeri bertaraf internasional di Tlogowaru Kota Malang dan kelompok bermain As Sakinah Fajar Harapan di Gondanglegi / Windu Wulandari

 

Kata kunci : Kelompok bermain, Menu Pembelajaran, Pelaksanaan. Kelompok bermain adalah salah satu bentuk layanan pendidikan bagi anak usia 2 - 3 tahun yang berfungsi untuk membantu meletakkan dasar-dasar kea rah perkembangan sikap, pengetahuan dan ketrampilan yang diperlukan bagi anak dini usia dalam menyesuaikan diri dengan lingkungannya dan untuk pertumbuhan serta perkembangan selanjutnya, termasuk siap memasuki pendidikan dasar. Agar prinsip-prinsip dasar mengenai tujuan dan kegiatan pembelajaran dapat dilaksanakan secara optimal, maka perlu adanya menu pembelajaran. Menu pembelajaran merupakan seperangkat rencana dan pengaturan kegiatan pengembangan dan pendidikan yang dirancang sebagai pedoman dalam menyelenggarakan kegiatan pendidikan di kelompok bermain. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui menu pembelajaran dan pelaksanaannya di Kelompok Bermain Negeri Bertaraf Internasional di Tlogowaru Kota Malang dan Kelompok Bermain Assakinah Fajar Harapan di Gondanglegi, serta perbedaan menu pembelajaran dan pelaksanaannya di kedua kelompok bermain tersebut. Pendekatan permasalahan dalam skripsi ini menggunakan pendekatan penelitian kualitatif. Metode yang digunakan dalam pengumpulan data adalah teknik wawancara, observasi, dan dokumentasi. Teknik analisis yang digunakan adalah reduksi data, display data, pengambilan kesimpulan dan verifikasi. Dari hasil penelitian diketahui bahwa menu pembelajaran dan pelaksanaannya di kelompok bermain yang satu dengan kelompok bermain yang lain berbeda. Perbedaan ini sesuai dengan tujuan dan dasar berdirinya kelompok bermain. Selain itu juga karena acuan menu pembelajaran yang didesain oleh Diknas juga tidak bersifat kaku tetapi perlu disesuaikan dengan kebutuhan dan kondisi social budaya anak, sebab pelaksanaan menu pembelajaran berorientasi kepada kebutuhan anak. Perbedaan antara menu pembelajaran Kelompok Bermain Negeri Bertaraf Internasional di Tlogowaru Kota Malang dan Kelompok Bermain Assakinah Fajar Harapan di Gondanglegi terletak pada (a) Tujuan kelompok bermain, (b)bidang pengembangan, (c) materi, (d) unit waktu dan (e) evaluasi. Perbedaan di atas lebih disebabkan karena tujuan dan dasar pembelajaran dimana Kelompok Bermain Negeri Bertaraf Internasional di Tlogowaru Kota Malang bersifat umum dalam arti tidak berdasarkan pada suatu agama tertentu sehingga dapat diikuti oleh semua pemeluk agama. Sedangkan tujuan dan dasar kelompok bermain Assakinah Fajar Harapan di Gondanglegi menggunakan dasar agama Islam sebagai dasar kegiatan pembelajarannya. Perbedaan kedua adalah penggunaan bahasa pengantar Kelompok Bermain Negeri Bertaraf Internasional di Tlogowaru Kota Malang menggunakan bahasa Inggris sedangkan di Kelompok Bermain Assakinah Fajar Harapan di Gondanglegi menggunakan bahasa Indonesia. Persamaan antara menu pembelajaran Kelompok Bermain Negeri Bertaraf Internasional di Tlogowaru Kota Malang dan Kelompok Bermain Assakinah Fajar Harapan di Gondanglegi terletak pada (a) pengorganisasian menu pembelajaran, (b) pengorganisasian kelas, (c) metode dan media yang digunakan dan (d) sistem pelaksanaan evaluasi. Meskipun menu pembelajaran di kedua kelompok bermain ini berbeda, tetapi pelaksanaan di dalam kegiatan sehari-hari hampir sama misalnya nampak pada metode dan media yang digunakan. Perbedaan dapat terlihat pada materi-materi yang diberikan terutama materi-materi tentang kehidupan beragama. Dengan demikian maka pada dasarnya tidak ada perbedaan diantara kedua lembaga, kecuali yang satu berlatar bahasa Inggris sebagai bahasa pengantar dan yang satu berlatar agama Islam. Saran yang dapa diberikan setelah melihat hasil penelitian yaitu jadwal kegiatan pembelajaran harian hendaknya lebih disesuaikan lagi dengan program pembelajaran dan menu pembelajaran yang ada agar pelaksanaan kegiatan sehari-hari tidak terkesan semrawut. Kelompok bermain perlu juga lebih memprioritaskan lagi orientasi program belajar untuk memenuhi kebutuhan warga belajar, srta untuk menhindari kejenuhan penting kiranya agar kelompok bermain lebih luwes lagi dalam menangani waktu, tempat, maupun sumber belajar yang digunakan.

Upaya kepala sekolah dalam meningkatkan citra sekolah (studi multi situs pada SD Muhammadiyah 1 Kota Tegal dan SD Muhammadiyah Kemantran Kabupaten Tegal) / Martha Lararasi

 

ABSTRAK Larasati, Martha. 2016. UpayaKepalaSekolahdalam Meningkatkan Citra Sekolah (Studi Multi Situspada SD Muhammadiyah 1 Kota Tegaldan SD MuhammadiyahKemantran).Tesis. Program StudiManajemenPendidikan, PascasarjanaUniversitasNegeri Malang. Pembimbing: (I) Dr. H.Kusmintardjo, M.Pd.; (II) Dr. H.ImronArifin, M.Pd. Kata Kunci: upaya, kepalasekolah, citrasekolah, Persainganuntukmenarikminatpelanggantidakhanyaterjadi di perusahaan profit.Sekolahsebagaiperusahaanpendidikan yang bersifat non-profit bersainguntukmenarikminatdanmemenuhikeinginanparapelanggandalamhalinisiswa, orang tua, danmasyarakat.Salahsatuupayasekolahuntukmemenangkanpersaingandi duniapendidikanadalahmembanguncitrasekolah di masyarakat.Untukmenarikminatmasyarakat, sekolahharusmemilikicitrapositif.Citra positifdapatdibangunmelaluilayananpendidikanbermutu yang berorientasipadakepuasanpelanggan.Seorangkepalasekolahharusberkomitmendanberanimelakukanperubahankearahlebihbaiksehinggamembentukbudayamutu yang memenuhikebutuhanpelanggandalamhalinisiswa, orang tuasiswa, danmasyarakat.Budayamutu yang terbentukakanberpengaruhpadaresponmasyarakatterhadapsekolahsehinggamampumeningkatkancitrasekolah. Tujuandaripenelitianiniadalahuntuk: (1) mendeskripsikanperankepalasekolah, (2) mendeskripsikanstrategikepalasekolah , (3) mendeskripsikanmasalah yang dihadapidansolusi yang dilakukankepalasekolah, dan (4) mendeskripsikandayadukungsekolahdalammeningkatkancitrasekolah di SD Muhammadiyah 1 Kota Tegaldan SD MuhammadiyahKemantran. Penelitianinimenggunakanpendekatandeskriptifkualitatifdenganrancanganstudimultisitus.Teknikpengumpulan data yang digunakanadalahwawancaramendalam, observasi, danstudidokumentasi.Analisis data dibagidalamduatahapyaknianalisis data individudananalisis data lintassitus.Pengecekankeabsahan data dalampenelitianinimenggunakankredibilitas yang meliputitigakriteriayaknitriangulasi, diskusitemansejawat, menggunakanbahanreferensi, membercheck, ,dandependabilitas. Berdasarkanteknikanalisis data tersebutdiperolehtemuanlintassitussebagaiberikut: (1) Perankepalasekolahmeningkatkancitrasekolahmeliputi; Kepalasekolahsebagaieducator, kepalasekolahsebagaimanager, kepalasekolahsebagaileader, kepalasekolahsebagaipenciptaIklimkerja, kepalasekolahsebagaiwirausahawan. (2) Strategikepalasekolahmeningkatkancitrasekolahmeliputi; Publikasi, Continual Improvement ,melauiperbaikandanpenambahansaranadanprasaranadan program unggulan, revitalisasihumas, danGood communication. (3) Masalahdansolusikepalasekolahdalammeningkatkancitrasekolahyaitu: Masalahpertama, polapikir guru susahdiajakmaju. Solusinyamelalui program teachers’ exchange, melakukanpembiasaanbudayamutu, danreward (piknikdanfresh money).Masalahkedua, dukungandanpolapikir orang tua yang menilaikeberhasilansekolahhanyadarinilaisiswa.Solusinyamerubahpola orang tuamelaluismart parenting, Masalahketiga, pendanaanpengembangansaranaprasarana.Solusinyabiayadidapatmelaluibeberapajalandiantaranya; entrepreneur, sponsorship, danmeningkatkanpelayananpendidikan.Masalahkeempat, kulturmasyarakatmasihberbasisgolongan. Masyarakatsekitarberbasis NU sedangkansekolahberbasisMuhammadiyah.Solusinyamenghadapipersaingansekolahmelaluipromosidanmengadakan program yang menarikmasyarakatsepertilomba-lombasaatperingatanharibesarnasional.Masalahkelima, keinginanantarayayasandenganpihaksekolahkadangtidaksejalan.Solusinyakepalasekolahmengambillangkahtegasdanbijakdalampengambilankeputusandenganmeminimalisirresiko yang dapatmerugikanpihakeksternalsekolah. (4) Dayadukungdalammeningkatkancitrasekolahmeliputi: JPSM (JaringPenggerakSekolahMuhammadiyah), team work yang solid antarakepalasekolahdanseluruh guru dan staff, peranmajelisDikdasmendan PCM sebagaisalahsatustakeholder SD Muhammadiyahdalammemberi support penyelenggaranpendidikan. Saran-saran yang dapatdikemukakanolehpenelitiadalahsebagaiberikut; (1) BagiDinasPendidikan Kota danKabupatenTegal, khususnyaKepalaDinas, Kepala UPPD, danparapengawas SD untukmelibatkanseluruhkepalasekolah di lingkungannyadalamworkshop, danpelatihanuntukmensosialisasikanupayameningkatkancitrasekolah , (2) BagiKepalaSekolah agar menjadisalahsatubahanrujukandanreferensikepalasekolahuntukberupayameningkatkancitrasekolahmelaluiperankepalasekolah yang inovatif, maumengambilresiko, danberkomitmenmelakukanperubahanmutu. Disampingitukepalasekolahharusmelakukanstrategiberupapublikasi, continual improvementsaranaprasaranamaupun program unggulansekolah, revitalisasihumas, danmenjalin good communication antarakepalasekolah,guru, staff, dan orang tuasiswa. Dapatdijadikanreferensijugauntukmengatasimasalah-masalah yang timbulkarenaupaya Meningkatkan citrasekolah, (3) Bagi Orang TuaSiswadanMasyarakat agar menumbuhkankesadaran orang tuasiswadanmasyarakatuntukberpartisipasimendukung program-program kepalasekolahberuparevitalisasihumasmelaluismart parenting, promosi, danparents dayuntukmeningkatancitrasekolah yang akandiikutipeningkatanmutupenyelenggaranpendidikan di sekolahsertakepuasan orang tuasiswadanmasyarakatsebagaipenggunalayananpendidikan, (4) BagiPeneliti Lain dapatmempertimbangkanhasilpenelitianinisebagaibahanreferensi agar dapatmelakukanstudilebihlanjutdalammelakukanpenelitianpadatemapenelitiantentangperandanstrategikepalasekolahdalampeningkatancitrasekolah, dayadukungsekolahdalammeningkatkancitrasekolah, kepemimpinankepalasekolahdalammengatasimasalah-masalah yang muncul di sekolah, ataustrategipemasaransekolah, baikmenggunakanmetodepenelitiankualitatif , kuantitatif, maupunpengembangan.

Sikap mahasiswa Bimbingan Konseling Universitas Negeri Malang terhadap seks pranikah mahasiswa / oleh Titik Hendrawati

 

Penerapan model pembelajaran kooperatif tipe think pair share berbantuan game puzzle untuk meningkatkan motivasi dan hasil belajar IPS siswa kelas VII SMP Negeri 4 Malang / Rani Ramadanis

 

ABSTRAK Ramadanis, Rani. 2016. Penerapan Model PembelajaranKooperatifTipeThink Pair ShareBerbantuanGame PuzzleUntukMeningkatkanMotivasidanHasilBelajar IPS SiswaKelas VII SMP Negeri 4 Malang. Tesis, Program StudiPendidikanDasarKonsentrasi IPS, Program PascasarjanaUniversitasNegeri Malang: (I) Prof. Dr. I Nyoman S Degeng, M.Pd, (II) Prof. Dr. Sudarmiatin, M. Si. Keyword : Think Pair Share, Game Puzzle, Motivasi, HasilBelajar Hasilpengamatanpadawaktupembelajaran IPS di SMP Negeri 4 Malang di kelas VII H diketahuibahwa guru masihmenggunakan model pembelajarankonvensionaldansiswahanyamendengarkanpelajaransecarasatuarah. Guru mengalamibeberapakendala di dalampelaksanaan proses belajarmengajaryaitu: (1) Motivasibelajarsiswa yang masihrendah, (2) Hasilbelajar yang belumtuntasdiketahuidari 32 orang siswadiantaranya17 orang (57%) memperolehnilai di bawah KKM, 7 orang (17%) memperolehnilaisamadengan KKM dan 8 orang (25%) diatas KKM. Makadiperlukansuatuupayauntukmengatasipermasalahantersebutdenganpenerapanmodel pembelajarankooperatiftipethink pair shareberbantuangame puzzleuntukmeningkatkanmotivasidanhasilbelajaripssiswa. Penelitianinimenggunakanpenelitiantindakankelas (PTK) dalamduasiklus yang setiapsiklusterdiridariempatkomponen: perencanaan, tindakan, observasi, danrefleksi. Kedudukanpenelitidalampenelitianinisebagaiperencana, pelaksanatindakan, pengumpul data, penganalisis, penafsir data, danpelaporhasilpenelitian. Subyekpenelitianadalahsiswa SMP N 4 Malang kelas VII H, sebanyak 32 orang siswaterdiridari19 orang perempuandan 13 orang laki-laki. Penelitiandilakukanmelaluiduasiklus. Data dikumpulkandenganteknikobservasi, angket, danpelaksanaantes. Analisa data dilakukanmelaluitigatahapanyaitu: Reduksi data, paparan data, danpenyimpulanhasilanalisis. Temuanpenelitianpadasiklus I yaitupenggunaanalokasiwaktu yang belummaksimalsehingga guru harusbisamenggunakanalokasiwaktudenganbaikdanpadasiklus I belumditambahkangame puzzlepadapelaksanaantahap-tahapThink pair share, sedangkanpadasiklus II guru sudahbisamengalokasikanwaktudenganbaiksertaimplementasipadamatapelajaran IPS lebihefektifketikaditambahkangame puzzlepadatahapthinkdalamsintaksthink pair share. Hasilpenelitianpenerapanmodel pembelajarankooperatiftipethink pair shareberbantuangame puzzleyaitu (1) hasilobservasiketerlaksanaan model pembelajaranoleh guru termasukkategorisangatbaikpadasiklus I diperoleh 74% dansiklus II diperoleh 90,03% mengalamipeningkatan 16,03%. Hasilobservasiketerlaksanaan model pembelajaranolehsiswatermasukkategoribaikdarisiklus I diperoleh 71,23% dansiklus II diperoleh 87,03% mengalamipeningkatan 15,8%. (2) meningkatnyamotivasisiswadarisiklus I diperoleh 82,25% dansiklus II diperoleh 89,90% mengalamipeningkatan 7,65% (3) meningkatnyahasilbelajarsiswadarisiklus I diperoleh 81,25% dansiklus II diperoleh 93,75% mengalamipeningkatan 12,5%. Saran yang diberikanadalah (1) Bagi guru agar dalam proses belajarmengajarlebihbanyakmemberikankesempatankepadasiswauntukberfikirsendiri, melatihkemampuanberpikirdankemampuansosialsertacarabekerjasamasehinggasiswamemperolehkesempatanuntukmengembangkanpotensinya.(2) Bagisekolahhasilpenelitianinidapatdigunakansebagaiacuandalampembinaanpeningkatanmutusekolahdanpeningkatanprofesi guru denganpenerapan model pembelajaran yang efektif. Denganpenelitianinihendaknyasekolahmemberikanfasilitasbelajardanmendukungpara guru sehingga proses pembelajaransemakinmeningkatmutunya.(3) Bagipenelitiselanjutnyadisarankan agar melaksanakanpenelitiandenganmengkolaborasikanberbagai model danpengembangan media dalammeningkatkankualitas guru.

Analisis buku teks bahasa Indonesia kelas IV MI Al-Islamiyah Kecamatan Bangil Kabupaten Pasuruan / Siti Fatimah

 

Kata Kunci: Analisis, Buku Teks, Bahasa Indonesia. As the using of KTSP curriculum at 2006, many new books has been released in market as well as the revision version of an old book that being compatible with KTSP curriculum or new book that already written or released. That case cause a problem where teachers often confused to decide which book is better or suitable to use. Text book is used as a supporting book in learning process. But nowadays there are some book that isn’t suitable enough in a few sides that is the content is relevant to KTSP curriculum or not, the using of accurate language, the readability level, and the compatibility of using illustration. Therefore, to solve that condition, teachers and preserve teacher must have ability to analyze text book. This research has a purpose to describe: (1) relevantly content based on 2006 curriculum, (2) using accurately language, (3) the readability level, (4) illustration compatibility on “Mudah Belajar Bahasa Indonesia Kelas IV SD” authoring by Muh Darisman, dkk, released by Yudhistira. This book is used at MI Al-Islamiyah-Bangil on second semester 2011/2012. These research uses descriptive qualitative for its experimental design and it type is content analyze. Because the research object is a document like text book, the technical analyze that use is descriptive with percentages. Based on the investigation, it can be known about the relevantly content with 2006 curriculum, the using of accurately language, the readability level, and the using of illustration. But, there is a little mistake that need to fix. So it can be conclude that “Mudah Belajar Bahasa Indonesia Kelas IV SD” authoring by Muh Darisman, dkk, released by Yudhistira is already suitable to use on 4th grade. Based on conclusion, the writers give an advice for teachers to carefully analyze a text book to know it is suitable or not. So that some mistake on the text book is not presence in learning process. Then students are not having some misconception after use that text book.

Metode dan rencana anggaran pelaksanaan pekerjaan kolom menggunakan bekisting multiplek dan fiber glass pada proyek tahap 1 gedung administrasi UIN Maulana Malik Ibrahim Malang / Isliarti Purmatami

 

Kata Kunci: metode, rencana anggaran pelaksanaan, kolom. Perkembangan pembangunan ditandai dengan berkembang pesatnya berbagai pembangunan, hal ini dapat dilihat dengan banyaknya pembangunan khususnya pembangunan gedung-gedung bertingkat. Dalam pembangunan gedung, kolom merupakan struktur bangunan yang berperan penting dalam menciptakan bangunan yang kuat dan kokoh. Untuk mendapatkan kolom yang kuat dan kokoh diperlukan acuan dan pengawasan saat pembuatannya mulai saat persiapan sampai dengan perawatanya agar tidak terjadi penyimpangan. Studi lapangan ini bertujuan untuk mengetahui bagaimana metode pelaksanaan pekerjaan kolom dengan menggunakan bekisting multiplek dan fiber glass beserta perbedaan biaya yang terjadi pada Rencana Anggaran Pelaksanaa. Hal tersebut diharapkan dapat menambah ilmu dan wawasan tentang pelaksanaan pekerjaan beton khususnya pekerjaan kolom yang menggunakan bekisting multiplek dan fiber glass. Teknik pengumpulan data pada studi lapangan ini adalah: (1) observasi lapangan, (2) wawancara/interview, (3) dokumentasi, dan (4) analisa rencana anggaran biaya. Setelah semua data terkumpul, kemudian dianalisa dan selanjutnya dideskripsikan. Data tersebut kemudian dibandingkan dengan kajian pustaka sehingga dapat diambil kesimpulan dan saran. Hasil studi menunjukan bahwa terdapat beberapa ketidaksesuaian pelaksanaan pekerjaan kolom menggunakan bekisting multiplek dan fiber glas dari segi pelaksanaan, yaitu (1) panjang kait pengikat yang seharusnya minimal 6d dalam pelaksanaan di lapangan panjang kait hanya 5d, hal ini tidak sesuai SNI (2) tebal selimut beton hanya 25 mm tidak sesuai dengan SK SNI 2002 jarak minimal tebal selimut beton 40 mm, sehingga mempercepat resiko korosi pada tulangan. (3) pada saat penerimaan adonan beton tidak dilaksanakan uji slump, sehingga kekentalan dan homogenitas campuran beton tidak dapat diketahui. (3) tinggi jatuh beton pada pengecoran kolom lebih dari 2 meter hendaknya tidak lebih tinggi dari 1,5 meter, agar tidak menimbulkan pemisahan butiran spesi beton (segregasi).(4) tidak adanya perawatan penyiraman, sehingga terjadi keretakan.pada pekerjaan penulangan, pengecoran dan perwatan beton. (5) terdapat selisih Rp 482.668,43 antara pekerjaan kolom kotak dengan bekisting multiplek dan kolom bulat dengan bekisting fiber glass dikarenakan kebutuhan besi pada kolom bulat lebih besar dibandingkan dengan kolom kotak. Berdasarkan studi dapat disarankan dalam pelaksanaan pekerjaan kolom agar memperhatikan ketentuan dalam kajian teori yang ada, sehingga tidak terjadi kesalahan atau penyimpangan dalam pelaksanaan proyek seharusnya dapat mencapai kualitas kolom yang baik.

Pembuatan busana avantgarde dengan menerapkan hiasan berbentuk jamur Myxomycota / Devy Intan Kumalasari

 

ABSTRAK Kumalasari, Devy Intan. 2016. Pembuatan Busana Avantgarde Dengan Menerapkan Hiasan Berbentuk Jamur Myxomycota. Tugas Akhir, Teknologi Industri, Program Studi Diploma III Tata Busana, Fakultas Teknik, Universitas Negeri Malang. Pembimbing (I) Nurul Hidayati, S.Pd., M.Sn., (II) Agus Sunandar, S.Pd., M.Sn. Kata Kunci: jamur myxomycota, busana avantgarde, penerapan hiasan Trend fashion setiap tahun selalu berbeda-beda. Tahun 2016 trend fashion kali ini mengangkat tema besar Resistance dengan salah satu sub temanya adalah biopop. Busana dengan sub tema biopop ini diberi judul “3D of Myxomycota” yang terinspirasi dari bentuk jamur myxomycota serta jenis busana yang dibuat berupa busana avantgarde. Proses pembuatan busana avantgarde ini meliputi pembuatan desain, persiapan alat dan bahan, pengambilan ukuran model, pembuatan pola dan pecah pola, memotong bahan utama, memotong bahan lining, memotong bahan interlining, menjahit busana avantgarde dan membuat hiasan, menerapkan hiasan berbentuk jamur pada bagian lengan dan bagian bawah coat modifikasi busana avantgarde. Pemasangan hiasan terdapat kesulitan dalam penerapannya dengan cara membentangkan coat modifikasi pada permukaan yang datar sehingga menyebabkan hiasan tampak kurang rapat sebaiknya hiasan dipasang dengan memsangkan coat modifikasi pada mannequin. Penggunaan tulle sebagai lapisan bagian dalam hiasan yang kurang tebal menyebabkan hiasan tampak kurang kokoh sehingga sebaiknya dilapisi 3 lembar tulle. Detail hiasan busana avantgarde ini memiliki ukuran yang berbeda-beda sebaiknya lebih teliti dalam pembuatannya. Busana ini mendapatkan penghargaan sebagai Best Creative Fabric pada pagelaran busana bertemakan Culturesistance yang diperoleh dengan memaksimalkan pembuatannya.

Karakteristik kalimat tanya tulis siswa kelas II SDN IV Sumberpucung berdasarkan Dongeng Burung Bangau dan Ikan / oleh Tutut Umi Yuswanti

 

Kecenderungan perilaku konsumsi mahasiswa Program Studi Pendidikan Ekonomi Fakultas Ekonomi Universitas Negeri Malang / Victry Erlitha Picauly

 

Kata kunci : perilaku konsumsi, pola pikir, pola sikap,tindakan berkonsumsi Dalam usaha mengalokasikan pendapatannya untuk konsumsi , konsumen akan dihadapkan pada proses membuat keputusan terhadap produk atau jasa yang akan dikonsumsi untuk memenuhi kebutuhan hidup sekaligus mencapai kepuasan. Harapan untuk mampu berkonsumsi secara tepat, yang berguna untuk mewujudkan kemakmuran secara individu maupun secara kolektif dengan memanfaatkan sumberdaya yang dimiliki secara efektif dan efisien jika didasari pola pikir atau mindset yang tepat sebagai pertimbangan dalam melakukan hal tersebut. Sikap seseorang merupakan hasil dari suatu proses psikologis, maka hal itu tidak dapat diamati secara langsung tetapi dapat disimpulkan dari apa yang dikatakan atau dilakukannya. Penelitian ini akan mengungkapkan pertimbangan atau alasan yang mendasari mahasiswa dalam mengambil keputusan untuk melakukan tindakan, yang dilihat melalui pola pikir dan pola sikap mahasiswa dalam berkonsumsi sehingga menghasilkan tindakan dalam berkonsumsi. Adapun subjek penelitian ini adalah mahasiswa program studi Pendidikan Ekonomi Fakultas Ekonomi Universitas Negeri Malang. Penelitian ini menggunakan pendekatan kualitatif yaitu fenomenologi dengan paradigma Interpretative. Dalam pengumpulan data, dipergunakan voice recorder, kuisioner, wawancara mendalam dan catatan lapangan. Temuan penelitian menunjukan bahwa pola pikir mahasiswa dalam berkonsumsi mempertimbangkan tiga hal yang paling utama/penting sebelum berkonsumsi yaitu (1) ketersediaan anggaran yang berkaitan dengan sumber, jumlah, pengalokasian anggaran untuk kebutuhan ; (2) prioritas kebutuhan berkaitan dengan preferensi keutamaan; (3) harga barang itu sendiri berkaitan dengan tinggi dan rendah harga barang serta adanya barang subtitusi. Untuk pola sikap mahasiswa mempertimbangkan tiga hal dalam berkonsumsi yaitu (1) penggunaan anggaran berkaitan dengan membuat rencana pengeluaran, pencatatan pengeluaran sebagai bahan evaluasi atau kontrol, (2) cara berkonsumsi berkaitan dengan membayar atau membeli secara tunai dan cicil, dan (3) gaya hidup berkaitan dengan gaya hidup sederhana atau mewah. Sedangkan tindakan berkonsumsi akan optimal dan dikatakan rasional apabila pilihan yang akan dikonsumsi merupakan kebutuhan yang paling dibutuhkan , disesuaikan dengan ketersediaan anggaran yang mampu dilakukan secara konsisten dan bertanggung jawab untuk mencapai kepuasan yang maksimal dalam berkonsumsi. Temuan penelitian menunjukan bahwa selama ini memang terjadi tanpa melihat latar belakang apapun, mahasiswa setiap kali dihadapkan pada pilihan keputusan untuk berkonsumsi pasti mempertimbangkan yang pertama ketersediaan anggaran, prioritas kebutuhan dan harga barang itu sendiri sebagai pola pikir mereka. Sedangkan penggunaan anggaran, cara berkonsumsi dan gaya hidup sebagai pola sikap mereka. Dua hal tersebut menunjukan bahwa tindakan dalam berkonsumsi yang dilakukan mahasiswa dikatakan rasional. Dari hasil ini maka yang dilihat hanya pada perilaku konsumsi mahasiswa perempuan, sehingga akan berbeda orientasinya secara spesifik jika dilihat dari perilaku konsumsi mahasiswa laki-laki yang tidak diteliti.

Pengembangan sumber belajar jarak jauh berbasis WEB pada materi desain website untuk siswa kelas XI Sekolah Menengah Kejuruan / Akhmad Andik Saputra

 

Kata Kunci: Pengembangan sumber belajar, desain website, penmbelajaran jarak jauh, Wordpress. Seiring dengan perkembangan teknologi dan informasi, kebutuhan terhadap desain web meningkat dan memberikan peluang untuk membuka usaha dalam bidang web desainer. Pada Sekolah Menengah Kejuruan, salah satu materi yang diajarkan adalah desain website. Tetapi karena keterbatasan waktu, penyampaian materi tidak dapat disampaikan secara utuh. Untuk mengatasi hal tersebut diperlukan sumber belajar yang bisa diakses tanpa adanya keterbatasan tempat, ruang dan waktu sehingga siswa dapat belajar lebih mandiri dan utuh. Oleh sebab itu diperlukan aplikasi yang mendukung terciptanya sumber belajar tersebut. Moodle adalah salah satu aplikasi yang digunakan untuk pembelajaran berbasis web, sehingga dapat dilakukan pembelajaran mandiri oleh siswa kapan dan dimanapun berada. Dengan adanya sumber belajar berbasis web ini diharapkan pembelajaran pada materi desain website khususnya akan berjalan lebih efektif, efisien dan menarik untuk dipelajari siswa. Model pengembangan yang digunakan dalam penelitian ini adalah model pengembangan Arif Sadiman yang menitikberatkan pada masalah media, produk dari sumber belajar berbasis web ini menggunakan software Moodle. Instrumen pengumpulan data yang digunakan pada pengembangan ini berupa angket yang disebarkan kepada ahli media, ahli materi, dan responden. Sampel uji coba kelompok kecil dan uji coba kelompok besar (uji coba lapangan) diambil dari peserta didik SMK Arrahmah Papar. Hasil uji kelayakan sumber belajar dari ahli media mendapat persentase 82,8%, dari ahli materi mendapat persentase 86,84%, dari responden (siswa kelompok kecil) 89.17% dan dari responden (siswa kelompok besar) 87.67%. Berdasarkan hasil validasi tersebut, sumber belajar pendidikan jarak jauh berbasis web pada materi desain website untuk siswa kelas XI SMK dapat disimpulkan valid dan layak digunakan sebagai sumber belajar jarak jauh.

Kajian semiotik laporan tahunan PT. Bank Rakyat Indonesia, Tbk sebelum dan setelah menjadi pemenang dalan Annual Report Award / Fadllillah Ariza Pradana

 

ABSTRAK Pradana, Fadllillah Afiza. 2016. Kajian Semiotik Laporan Tahunan PT. Bank Rakyat Indonesia, Tbk Sebelum dan Setelah Menjadi Pemenang Dalam Annual Report Award. Skripsi. Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Dr. Sri Pujiningsih, S.E., M.Si., Ak., (2) Dr. Eka Ananta Sidharta, S.E., M.M., Ak., CA Kata Kunci: Kajian Semiotik, Sintaksis, Semantik, Pragmatik. Penelitian ini merupakan penelitian yang mengangkat teori semiotik yang merupakan teori yang berasal dari ilmu sastra. Fokus penelitian ini adalah mengkaji narrative text dan nominal laporan keuangan yang terdapat pada annual report Bank BRI dengan menggunakan ketiga tahap teori semiotik yaitu tahap sintaksis, tahap semantik, dan tahap pragmatik. Data yang digunakan dalam penelitian ini adalah narrative text dan nominal laporan keuangan yang terdapat dalam annual report Bank BRI tahun 2012 untuk digunakan dalam analisis sintaksis dan semantik; dan laporan keuangan dalam annual report Bank BRI tahun 2013 untuk digunakan dalam analisis pragmatik. Data diperoleh dari situs resmi Bank BRI, yaitu www.bri.go.id. Penelitian ini menggunakan metode kualitatif dan menggunakan paradigma interpretif. Metode pengumpulan data yang digunakan dalam penelitian ini adalah content analysis. Analisis data dilakukan dengan cara memaparkan data yang dikaji dengan teori semiotik kemudian dilakukan konfirmasi dengan penelitian terdahulu. Hasil penelitian ini adalah: (1). Secara sintaksis, peneliti menjelaskan kesinambungan antar narrative text yang disampaikan oleh Bank BRI dalam annual report nya yaitu narrative text yang membahas pencapaian-pencapaian yang didapatkan oleh Bank BRI beserta usaha-usaha yang dilakukan oleh Bank BRI untuk mewujudkan pencapaian-pencapaian tersebut. Analisis ini juga menjelaskan hubungan logis antara ketiga komponen laporan keuangan Bank BRI. (2). Secara semantik, peneliti memaknai bahwa Bank BRI berusaha mendesain kata-kata sedemikian rupa dalam setiap narrative text nya dengan tujuan untuk memperoleh legitimasi dari stakeholders nya. Analisis semantik juga menjelaskan bahwa kenaikan nominal laporan keuangan Bank BRI dimaknai sebagai keberhasilan Bank BRI dalam menguasai pangsa pasar (3). Secara pragmatik, analisis ini menunjukkan bahwa informasi narrative text dalam annual report Bank BRI tahun 2012 memiliki dampak positif pada annual report Bank BRI tahun 2013 yaitu naiknya aset dan laba bersih Bank BRI. Naiknya aset dan laba bersih ini menunjukkan bahwa stakeholder Bank BRI menerima dan memanfaatkan informasi yang berasal dari narrative text dalam annual report Bank BRI tahun 2012 baik yang bersifat informasi operasional dan pemasaran Bank BRI maupun informasi yang bersifat retorika. Nominal likuiditas yang mendominasi aset juga mempengaruhi citra Bank BRI yaitu masyarakat terutama nasabah Bank BRI akan menaruh kepercayaan yang besar terhadap Bank BRI karena rasio hutang yang besar menandakan bahwa Bank BRI memiliki dana yang besar untuk segera melunasi hutang-hutangnya.

Penerapan pendekatan kontekstual untuk meningkatkan keterampilan berbicara dan hasil belajar bahasa Indonesia pada siswa kjelas V SDN Jugo 02 tahun pelajaran 2010-2011 / Agus Devid Elfaidin

 

Kata Kunci: Pendekatan Kontekstual, Keterampilan Berbicara, Hasil Belajar Penggunaan metode pembelajaran yang belum tepat dalam pembelajaran bahasa Indonesia menjadi salah satu faktor kurangnya penguasaan keterampilan berbicara dan hasil belajar siswa. Guru hanya menggunakan metode ceramah untuk menjelaskan kepada siswa tentang penggunaan ejaan dan kesesuaian kalimat, selanjutnya siswa diberi tugas untuk membuat daftar pertanyaan wawancara. Setelah pembelajaran ini siswa mengumpulkan hasil kerjanya yang selanjutnya diadakan penilaian oleh guru tanpa mencoba untuk mempraktekkan kegiatan wawancara tersebut. Selama proses pembelajaran keterampilan siswa dalam aspek berbicara yang meliputi keberanian, pemahaman, dan sikap badan dari setiap pertemuan berjalan cukup baik. Dengan diterapkannya pendekatan kontekstual ini, siswa merasa terbantu dan lebih paham bagaimana menyampaikan sesuatu secara lisan dengan menggunakan bahasa yang baik dan sopan. Penerapan pendekatan kontekstual dinyatakan dapat meningkatkan keterampilan berbicara dan hasil belajar pada siswa kelas V SDN Jugo 02. Hal ini dapat dibuktikan dari ketuntasan siswa yang terus meningkat. Metode penelitian yang digunakan adalah Penelitian Tindakan Kelas dengan dua siklus. Setiap siklus dengan dua kali pertemuan yang masing-masing. Sasaran penelitian ini adalah siswa Kelas V SDN Jugo 02 kabupaten Blitar. Data yang diperoleh berupa hasil tes, lembar observasi kegiatan belajar mengajar (aktivitas guru dan siswa dalam pembelajaran), wawancara, dan dokumentasi. Berdasarkan hasil penelitian yang telah dilaksanakan, maka diperoleh peningkatan nilai rata-rata keterampilan berbicara siswa di kelas V dari sebelum siklus 57,33 mengalami peningkatan pada siklus I menjadi 66 (9%), siklus II 77 (12%). Kesimpulan dari penelitian ini berdasarkan paparan data bahwa penerapan pendekatan kontekstual dapat meningkatkan keterampilan berbicara dan hasil belajar siswa. Setelah penerapan pendekatan kontekstual diharapkan guru senantiasa melakukan variasi di dalam menerapkan metode pembelajaran agar siswa tidak bosan dan lebih bersemangat dalam belajar. Siswa diharapkan senantiasa siap untuk menerima pembaharuan dalam setiap metode pembelajaran yang diterapkan oleh guru, dan lebih bersemangat dalam belajar.

Pengembangan e-kamus nama ilmiah tumbuhan obat-obatan berbasis web untuk memfasilitasi akses sumber belajar / Widayati

 

ABSTRAK Widayati. 2016. Pengembangan E-Kamus Nama Ilmiah Tumbuhan Obat-obatan Berbasis Web untuk Memfasilitasi Akses Sumber Belajar.Skripsi, Jurusan Teknologi Pendidikan, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dr. Sulthoni, M.Pd., (II) Dr. Henry Praherdhiono, M.Pd. Kata Kunci: Pengembangan, e-kamus, berbasis web, akses sumber belajar. Di era perkembangan teknologi yang serba elektronik, telah mempengaruhi penyajian cara akses informasi dari media cetak ke media elektronik, salah satunya kamus.Pada saat ini, penggunaan kamus elektronik telah banyak digunakan. Hal ini karena kamus elektronik dirasa lebih praktis dibanding kamus pada umumnya seperti buku. Kamus elektronik merupakan kamus yang didesain dengan pengolahan data secara komputerisasi dalam menyajikan informasi sehingga lebih efektif digunakan dalam pembelajaran karena efisien untuk dibawa kemanapun. Berdasarkan observasi yang telah dilakukan di Jurusan Biologi FMIPA Universitas Negeri Malang, mahasiswa mengeluh menggunakan sumber belajar berupa buku yang tebal.Penggunaan buku nama ilmiah tumbuhan yang tebal dan relatif mahal sebagai sumber belajar mereka, dirasa kurang praktis dan efisien. Oleh karena itu, mahasiswa membutuhkan media berbentuk kamus nama ilmiah tumbuhan yang dirasa cocok karena lebih cepat dan praktis yang disesuaikan dengan kultur dan kebiasaan mahasiswa yang cenderung menggunakan buku dan laptop. Pengembangan e-kamus nama ilmiah tumbuhan obat-obatanberbasis webdirasa cocok untuk mengatasi masalah tersebut. Agar pemanfaatane-kamus yang dikembangkan lebih interaktif, dengan berbasis web sehingga jangkauan aksesnya tidak terbatasdengan di dukung koneksi internet. User tinggal mengetikkan alamat web yang sudah ditentukan pada browser yang dimiliki. Kemudian userdapat mencari denganmemasukkan kata yang diinginkan melalui kolom pencarian sehingga akses pencarian kata tidak lagi ditentukan oleh pengorganisasian kata secara alpabetis. Produk e-kamus nama ilmiah tumbuhan obat-obatan berbasis web yang dikembangkan memiliki kompatibilitas terhadap semua perangkat.Jadi, lebih cepat dan praktis untuk memfasilitasi akses sumber belajar. Tujuan dari pengembangan ini untuk menghasilkan suatu produk e-kamus nama ilmiah tumbuhan obat-obatanberbasis webyang valid atau layak digunakan untuk memfasilitasi akses sumber belajar, serta mampu mendukung kinerja mahasiswa mencari nama ilmiah tumbuhan obatdengan cepat dan praktis. Metode pengembangan yang digunakan adalah model pengembangan Davidson-Shivers & Rasmunssen. Subjek penelitian dalam pengembangan ini adalah mahasiswa yang masih menempuh pendidikan di Jurusan Biologi FMIPA Universitas Negeri Malang. Jenis data yang digunakan adalah data kuantitatif digunakan untuk mengukur prosentase hasil pengumpulan data(instrumen ahli media, ahli materi, dan mahasiswa)dan data kualitatif berupa tanggapan dan saran dari ahli media dan ahli materi yang digunakan sebagai bahan untuk melakukan revisi produk setelah dilakukan pengolahan data. Hasil pengembangan e-kamus berbasis web telah divalidasi oleh seorang ahli media, seorang ahli materi, dan diujicoba implementasikan kepada 20 mahasiswa. Hasil validasi oleh ahli media diperoleh hasil persentase 80% di kategorikan valid, ahli materi diperoleh hasil persentase 85% di kategorikan valid, dan hasil uji coba implementasi pada mahasiswa diperolah hasil persentase 80,25% di kategorikan valid. Dapat disimpulkan bahwa e-kamus nama ilmiah tumbuhan obat-obatan berbasisweb yang dikembangkan termasuk dalam kriteria validdanlayakdigunakansebagai media untuk memfasilitasi akses sumber belajar. Agar produk yang dihasilkan dapat dimanfaatkan secara maksimal dalam kegiatan pembelajaran, saran/rekomendasi yang dapat dirumuskan sebagai berikut; E-kamus berbasis web dapat digunakan untuk memfasilitasi akses sumber belajar dalam mendukung kinerja mahasiswa mencari dan menemukan nama ilmiah tanaman obat secara cepat dan praktis serta saran untuk diseminasi produk ke sasaran yang lebih luas dengan cara menyebarluaskan produk melalui promosi baik di tingkat sekolah maupun universitas, seminar, dan pameran media pembelajaran.

Developing e-writing materials for the second-grade students of MTs Negeri Kota Pasuruan / Khoiriyah

 

Unpublished Thesis, State University of Malang. Graduate Program in English Language Teaching. Advisors: (I) A. Effendi Kadarisman, M.A., Ph. D. (II) Dr. Gunadi Harry Sulistyo, M.A. Key words: developing, e-writing materials, MTs N Kota Pasuruan The present study aims at developing e-writing materials to meet the needs of the students of MTs N Kota Pasuruan. The current study employs a design and development model of Richey and Klein with three main stages: identifying research problem phase realized through needs assessment, model development research, and model validation research for both internal and external validation. Internal validation is a validation phase which involves some experts in FGD forum to judge over the product while external validation is a validation phase which involves students and English teachers to give a response to the product. The research involves the second-grade students of MTs N Kota Pasuruan. In the stage of needs assessment, the instruments used to collect the data are a set of questionnaires addressed to the students and an interview guide addressed to stake holders: school principal, vice school principal of curriculum, ICT teacher, and English teacher. The result of the data is very important as a consideration for developing the materials. The draft of the materials were evaluated by three different experts: three subject matter experts, ICT expert (CALL Practitioner), and instructional technology expert. The validated product is tried out to three different levels of students; upper class, medium class, and lower class. The result of the data from the students shows that the final product can be regarded as an appropriate material for the students; the applicability of the materials reach the score of 3.41 (85.35 %), the usefulness reach the score of 3.32 (83.16 %), the attractiveness reach the score of 3.50 (87 %), motivating reach the score of 3.43 (77.38 %), and the ease of using the materials reach the score of 3.09 (77.38 %). This data are supported by the result of the data obtained from English teachers; this materials reflect constructivism reaches the score of 4.00 (100 %), questioning reaches the score of 3.40 (85 %), inquiry reaches the score of 3.33 (83.53 %), learning community reaches the score of 3.33 (83.53 %), modeling reaches the score of 3.67 (91.75%), reflection reaches the score of 3.00 (75 %), and authentic assessment reaches the score of 3.11 (77.75 %). Therefore, these materials which reflect Contextual Teaching and learning (CTL) are categorized as a very good material and no revision needed.

Penerapan penilaian kurikulum 2013 pada pembelajaran seni budaya kelas VIII di SMP Negeri Kota Malang / Grista Yolanda

 

ABSTRAK Yolanda, Grista. 2015.Penerapan Penilaian Kurikulum 2013 Pada Pembelajaran Seni Budaya Kelas VIII SMP Negeri se-Kota Malang. Skripsi, JurusanSenidanDesain, FakultasSastra, UniversitasNegeri Malang.Pembimbing:(I) Drs. Iriaji, M.Pd, (II) Drs. Muhadjir. Kata Kunci: penilaian kurikulum 2013, seni budaya, SMP Negeri Malang Penilaian kurikulum 2013 merupakan kurikulum yang diimplementasikanpemerintahmelaluiKementrianPendidikandanKebudayaanpadatahun 2013 sebagaipenyempurnaankurikulumsebelumnyayakniKurikulum Tingkat SatuanPendidikan(KTSP).Kurikulum 2013 lebihberfokuspadapemikirankompetensiberbasissikap,keterampilan, danpengetahuan. Senibudayadalamkurikulum 2013 dirumuskanuntukmencakupstudikaryasenibudaya, praktikberkaryasenibudaya, danpembentukansikapapresiasiterhadapsenibudaya.Berlatar belakang pada hal tersebut, maka penelitian ini ditujukan untuk mengetahui bagaimana penerapanperencanaan, pelaksanaan, dan pelaporanpenilaiankurikulum 2013 padapembelajaransenibudayakelas VIII di SMP Negeri Kota Malang. Penelitian ini menggunakan pendekatan kuantitatif. Sedangkan untuk pengumpulan datanya menggunakan kuesioner tertutupdanterbuka. Populasi penelitian ini adalah guru-guru seni budaya yang mengajar kelas VIII SMP Negeri Kota Malang. Teknik pengambilan sampel menggunakan cluster sampling atau sampel wilayah. Subjek penelitian sebanyak 12 guru diambil dari 12 sekolah sebagai sampel dari setiap wilayah kecamatan di kota Malang. Analisis pengumpulan data yang digunakan adalah analisis kuantitatif deskriptif. Hasil penelitian yang diambil dari total 12 responden menunjukkan (1) (72,5%) responden telah melaksanakan perencanaan penilaian kurikulum 2013, (2) (88,9%) responden telah melakukan pelaksanaan penilaian kurikulum 2013, dan (3) (64,9%)responden telah melaksanakan pelaporan penilaian kurikulum 2013. Berdasarkan hasil temuan diatas, bisa disimpulkan bahwa penerapan penilaian kurikulum 2013 belum terlaksana sepenuhnya. Hal ini dikarenakan pendidik mengaku memiliki kendala dalam keterbatasan tenaga dan waktu untuk menerapkan penilaian kurikulum 2013 sepenuhnya. Saran bagi guru seni budaya sesuai hasil temuan penelitian tersebut, agar meningkatkan perencanaan, pelaksanaan, dan pelaporan dalam menerapkan penilaian kurikulum 2013. Bagi sekolah bekerja sama dengan guru dalam menfasilitasi penerapan kurikulum 2013, bagi Dinas Pendidikan Kota Malang penelitian ini dapat menjadi bahan informasi dalam upaya meningkatkan profesionalisme guru dalam menerapkan kurikulum 2013.

Pelaksanaan strategi pelayanan pada divisi Fresh Department Fruti and Vegetable Giant Hypermarket Gajayana Malang / Dwi Widayanti

 

Kata Kunci: strategi pelayanan, Kepuasan Konsumen, Pada saat ini semakin ketatnya persaingan dalam dunia bisnis dan banyak perusahaan dituntut untuk dapat memberikan pelayanan yang terbaik bagi konsumen dan pelanggannya. Pelanggan merupakan hal yang sangat penting untuk kelangsungan sebuah perusahaan, oleh karena itu mempertahankan pelanggan sangatlah perlu dilakukan oleh sebuah perusahaan agar kesuksesan perusahaan tercapai. Berdasarkan hal tersebut pelayanan merupakan landasan dasar yang memperkuat keseluruhan proses pemasaran untuk dapat terus berjalan. Penulisan laporan Tugas Akhir ini menunjukkan: strategi pelayanan apa yang diberikan Departemen Fruit and Vegetable Divisi Fresh Giant Hypermarket Gajayana Malang, strategi pelayanan yang efektif untuk memenuhi kepuasan pelanggan pada Departemen Fruit and Vegetable Giant Hypermarket Gajayana Malang, kendala yang terjadi dalam penerapan strategi pelayanan yang diberikan oleh Departemen Fruit and Vegetable Giant Gajayana Malang. Hasil Praktik Kerja Lapangan yang penulis lakukan untuk (1) kualitas pelayanan Departemen Fruit and Vegetable Divisi Fresh Giant Gajayana Malang mengutamakan kualitas layanan, karena kualitas pelayanan memiliki hubungan yang sangat erat dengan kepuasan pelanggan sehingga tercipta loyalitas pelanggan yang seperti diharapkan, (2) strategi yang paling afektif untuk digunakan pada Departemen Fruit and Vegetable Giant Hypermarket Gajayana Malang adalah: Strategi Relationship Marketing, Strategi Superior Customer Service, Strategi penanganan keluhan yang efektif , Strategi peningkatan kinerja perusahaan, (3) kendala-kendala yang sering terjadi dalam pelaksanaan pelayanan ini adalah sering terjadi kekosongan barang, dan pelayanan karyawan yang kurang memuaskan. Dengan mengetahui kendala-kendala seperti ini diharapkan dapat menjadi bahan masukan untuk lebih meningkatkan kualitas pelayanan. Berdasarkan laporan penelitian ini diharapkan agar Giant harus lebih meningkatkan pelayanannya dan kinerja karyawan juga perlu ditingkatkan lagi, dan juga pihak Giant harus sering mengontrol barang-barangnya jangan sampai terjadi kekosongan barang karena dapat mengecewakan konsumen atau pelanggannya.

Pengaruh pendidikan ekonomi dalam keluarga dan literasi ekonomi terhadap perilaku ekonomi siswa SMAN 10 Malang tahun ajaran 2015/2016 / Galih Hadiirifan Eka Saputro

 

ABSTRAK Saputro, Galih Hadirifan Eka. 2016. Pengaruh Pendidikan Ekonomi dalam Keluarga dan Literasi Ekonomi terhadap Perilaku Ekonomi siswa SMAN 10 Malang Tahun Ajaran 2015/2016.Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Agung Haryono., SE, MP, Ak (II) Ro’ufah Inayati, M.Pd. Kata Kunci : pendidikan ekonomi dalam keluarga, perilaku ekonomi, dan literasi ekonomi Perilaku ekonomi masyarakat diIndonesia mengarah pada tingkat konsumsi yang tinggi diikuti dengan tindakan menabung yang cenderung rendah khususnya bagi siswa SMA (umur 15-24).Tingkat konsumsi yang semakin tinggi tersebut dibuktikan dengan munculnya café, restoran dan mall yang terus tumbuh khususnya di kota Malang. The World Bank mencatat bahwa tingkat kepemilikan akun bank di Indonesia usia 15-24 tahun yaitu sebesar 35,2 % yang tergolong rendah dari rata-rata negara kawasan Asia Timur dan Pasifik. Bukti tersebut mengindikasikan bahwa tingkat menabung di Indonesia cenderung rendah. Beberapa faktor yang mempengaruhi perilaku ekonomi pada siswa yaitu pendidikan ekonomi dalam keluarga dan pengetahuan dasar ekonomi atau disebut literasi ekonomi. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui : (1) pengaruh pendidikan ekonomi dalam keluarga terhadap perilaku ekonomi; (2) pengaruh literasi ekonomi terhadap perilaku ekonomi dan (3) pengaruh pendidikan ekonomi dalam keluarga dan literasi ekonomi terhadap perilaku ekonomi pada siswa SMAN 10 Malang tahun ajaran 2015/2016 Penelitian ini menggunakan rancangan penelitian kuantitatif eksplanasi dengan bantuan program IBM SPSS Statistics 23. Populasi penelitian ini adalah siswa SMAN 10 Malang tahun ajaran 2015/2016 yang berjumlah 584 siswa. Teknik pengambilan sampel menggunakan teknik proportional random sampling. Teknik pengambilan data menggunakanangket dan tes. Berdasarkan hasil analisis data tersebut, diperoleh kesimpulan bahwa (1) pendidikan ekonomi dalam keluarga berpengaruh positif terhadap perilaku ekonomi sebesar 13,18% (2) literasi ekonomi berpengaruh positif terhadap perilaku ekonomi (3) pendidikan ekonomi dalam keluarga dan literasi ekonomi berpengaruh positif secara simultan terhadap perilaku ekonomi siswa sebesar 14,53% Saran dari peneliti bagi peneliti lain untuk mengembangkan variabel penelitian yang berkaitan dengan perilaku ekonomi siswa. Bagi kepala sekolah yaitu memberikan himbauan dan pengarahan kepada orang tua dan guru dalam rangka meningkatkan perilaku ekonomi siswa ke arah yang lebih baik. Penekanan tersebut karena semakin kompleks barang konsumsi yang ditemui oleh siswa

Studi tentang pelaksanaan kegiatan guru pendidikan kesenian SMA Negeri Blitar dalam pembelajaran apresiasi seni / pleh Jiefri Gunawan

 

Studi eksplorasi batik Druju di Kabupaten Malang / Nely Zulfa Nofitasari

 

Kata Kunci: Batik, Batik Druju Batik adalah motif kain yang dibuat dengan menggunakan lilin untuk mencegah pewarnaan sebagian kain. Terdapat ribuan motif batik yang ada di Indonesia. Semua motif itu tersebar diberbagai daerah di Indonesia terutama pulau Jawa dan merambat ke Sumatra. Batik tradisional setiap daerah memiliki keragaman dan ciri khas yang sangat menonjol sehingga dapat dibedakan antara batik dari daerah satu dengan batik dari daerah yang lain. Ciri khas ini meliputi keunikan motif, warna dan teknik pembuatannya. Kabupaten Malang merupakan salah satu daerah penghasil batik dengan salah satu batiknya adalah batik Druju yang terletak di Desa Druju Kecamatan Sumbermanjing Wetan Kabupaten Malang yang memiliki ciri khas tersendiri namun belum diketahui luas oleh masyarakat Malang pada umumnya. Dengan adanya penelitian ini maka akan terungkap cirri khas batik Druju. Pendekatan penelitian yang digunakan untuk mencari dan mengumpulkan data adalah pendekatan kualitatif dengan jenis penelitian deskriptif. Prosedur pengumpulan data dalam penelitian ini menggunakan metode observasi, wawancara dan dokumentasi. Validitas data menggunakan triangulasi sumber, triangulasi teknik, triangulasi waktu dan ketekunan pengamatan. Hasil penelitian menunjukkan:(1) batik Druju muncul pada tahun 1996 di dusun Wonorejo Kabupaten Malang dengan motif Spiral, motif ramuan dan motif Candi Singosari sebagai motif awal; (2) tahapan proses pembuatan batik Druju adalah Persiapan dan pemotongan bahan utama sesuai dengan bahan yang dibutuhkan untuk membuat produk yang diinginkan, Menjahit bahan utama menjadi produk yang diinginkan, Membuat pola motif pada bahan utama, Pemberian lilin dengan cara mencanting, mencap atau perpaduan antara keduanya, Pewarnaan dengan menggunakan zat warna naphtol, Pelorodan, dan Penjemuran; (3) Warna khas dari batik Druju adalah warna hitam dan putih dengan variasi warna dalam satu motif berkisar antara dua hingga empat warna Dalam pemilihan warna tidak tidak ada hubungannya dengan makna perlambang; (4) Motif batik Druju terdiri dari motif organis dan motif geometris. Motif organis dalam batik Druju terdapat tiga jenis yaitu motif floratif, motif fauna, motif benda alam dan motif motif sosial. Selain terilhami oleh alam sekitar desa Druju, ternyata motif batik Druju juga terpengaruh oleh motif batik tradisional dari daerah lain. Hampir semua motif batik Druju tidak memiliki makna perlambang, hanya ada dua motif yang tersirat maknanya yaitu motif Sinar dan motif Seribu Mimpi.

Penerapaqn model pembelajaran two stay two stray untuk meningkatkan kemampuan berdiskusi siswa kelas X.1 MA Ma'arif Batu / Ayu Nur Hasanah

 

ABSTRAK Hasanah, Ayu Nur. 2016. Penerapan Model Pembelajaran Two Stay Two Stray untuk Meningkatkan Kemampuan Berdiskusi Siswa Kelas X.1 MA Ma’arif Batu. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Wahyudi Siswanto, M.Pd, (II) Drs. Dwi Saksomo, M.Si. Kata Kunci: diskusi, berbicara, two stay two stray Diskusi adalah pertemuan dua atau lebih individu yang berinteraksi secara verbal dan tatap muka untuk mencapai suatu tujuan melalui cara tukar-menukar informasi untuk memecahkan masalah yang disertai dengan pendapat-pendapat. Saat melakukan sebuah diskusi semua peserta diharuskan untuk dapat berbicara menyampaikan pendapatnya, namun kenyataan di lapangan, pada saat pembelajaran diskusi siswa cenderung pasif dan kurang berpartisipasi untuk berpendapat. Siswa terlihat malas melakukan pembelajaran dsikusi. Berkaitan dengan masalah tersebut, peneliti melakukan penelitian yang bertujuan untuk meningkatkan kemampuan berdiskusi menggunakan model pembelajaran Two Stay Two Stray. Model pembelajaran ini dapat mendorong siswa untuk aktif dalam kegitan diskusi. Melalui model pembelajaran ini setiap siswa diharuskan untuk berbicara menyampaikan pendapatnya di depan temannya saat proses diskusi berlangsung. Hal tersebut tentu membuat siswa lebih memahami topik diskusi sehingga dapat membuat siswa aktif dan kemampuan berbicara siswa akan meningkat. Penelitian ini bertujuan untuk mengetahui peningkatan proses dan hasil berdiskusi menggunakan model pembelajaran Two Stay Two Stray pada siswa kelas X.1 MA Ma’arif Batu. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) dengan pendekatan deskriptif kualitatif. Subjek penelitiannya adalah siswa kelas X.1 MA Ma’arif Batu yang berjumlah 20 siswa. Teknik pengumpulan data dengan menggunakan wawancara, observasi, tes, dan dokumentasi. Kegiatan analisis data dalam penelitian ini dilakukan setelah pengumpulan data, yaitu dengan cara menjabarkan hasil observasi aktivitas dan proses pembelajaran siswa. Selain itu peneliti juga menganalisis data hasil belajar siswa dengan cara mengumpulkan dan mengolah skor siswa. Berdasarkan hasil analisis data dan kegiatan refleksi, penerapan model pembelajaran Two Stay Two Stray dapat meningkatkan kemampuan berdiskusi siswa terutama dalam hal berbicara. Peningkatan tersebut dapat dilihat dari respon siswa selama pembelajaran berlangsung. Peningkatan respon ditandai dengan meningkatnya respon positif siswa terhadap pembelajaran diskusi. Siswa aktif berdiskusi mendiskusikan permasalahan selama proses pembelajaran. Hasil penilaian aktivitas siswa pada siklus I adalah 72% dengan predikat cukup baik dan pada siklus II meningkat menjadi 87% dengan predikat sangat baik. Penilaian proses siswa juga mengalami peningkatan yaitu 71% pada siklus I dengan predikat baik dan pada siklus II meningkat menjadi 86% dengan predikat sangat baik. Peningkatan penilaian proses mengacu pada proses berdiskusi siswa selama pembelajaran berlangsung. Penilaian hasil siswa dapat dilihat berdasarkan pemenuhan 8 aspek berbicara, yaitu (1) keberanian berbicara, (2) kelancaran berbicara, (3) kenyaringan suara, (4) ketepatan ucapan, (5) pilihan kata, (6) pandangan mata, (7) penguasaan topik, (8) penyampaian persetujuan dan sanggahan. Penilaian hasil berdiskusi siswa meningkatan dibandingkan saat pratindakan. Pada siklus I siswa mulai aktif melakukan kegiatan diskusi, namun masih ada beberapa siswa yang masih terlihat “takut salah” saat akan berpendapat, beberapa siswa masih belum bisa menyertakan alasan dan contoh konkret saat berpendapat, selain itu bahasa daerah masih sering muncul saat siswa berpendapat. Pada siklus II siswa sudah mampu menyampaikan pendapatnya dengan baik, secara keseluruhan siswa sudah berani menyampaikan pendapatnya. Siswa sudah bisa berbicara dengan baik saat berpendapat. Siswa sudah sering untuk berpendapat saaat ada permasalahan yang disertai dengan alasam dan contoh yang konkret. Dengan demikian penerapan model pembelajaran Two Stay Two Stray dalam meningkatkan kemampuan berdiskusi siswa.

Analisis kesesuaian isi LKS Biologi SMU kelas II dengan tuntutan kurikulum 1994 / oleh Anis Riyani

 

Peningkatan kemampuan menerapkan konsep pada pembelajaran IPA melalui model siklus belajar (Learning cycle) 5E di kelas IV SDN Gondanglegi Wetan 03 Kabupaten Malang / Ratih Permanasari

 

Kata Kunci : Kemampuan Menerapkan Konsep, Pembelajaran IPA, Model Siklus Belajar (Learning Cycle) 5E. Penelitian ini dilaksanakan berdasarkan hasil observasi di kelas IV yang menunjukkan bahwa tingkat kemampuan siswa dalam menerapkan konsep pada pembelajaran IPA masih kurang berkembang. Hal ini dikarenakan selama pembelajaran berlangsung, guru kurang mengembangkan adanya pertanyaan-pertanyaan yang berkaitan dengan penerapan konsep Tujuan dari penelitian ini yaitu: (1) untuk mendeskripsikan kemampuan siswa menerapkan konsep pada tahap pratindakan, (2) untuk mendeskripsikan penerapan model siklus belajar (learning cycle) 5E dalam meningkatkan kemampuan siswa menerapkan konsep, dan (3) untuk mendeskripsikan peningkatkan kemampuan siswa dalam menerapkan konsep melalui model siklus belajar (learning cycle) 5E. Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK) Penelitian ini dilaksanakan dalam 2 siklus. Subjek penelitiannya adalah siswa kelas IV yang berjumlah 14 siswa. Teknik pengumpulan data meliputi observasi, tes, dokumentasi, dan catatan lapangan. Teknik analisis data yang digunakan adalah teknik analisis data kualitatif dan kuantitatif. Hasil penelitian menunjukkan bahwa penerapan model siklus belajar (learning cycle) 5E pada pembelajaran pratindakan belum mencapai keberhasilan. Hal ini terlihat dari skor rata-rata hasil tes akhir siswa pada pembelajaran pratindakan hanya sebesar 49 dengan kualifikasi nilai kurang (K). Penerapan model siklus belajar (learning cycle) 5E dilakukan melalui 5 tahap,yaitu (1) tahap engagement, (2) tahap eksplorasi, (3) tahap eksplanasi, (4) tahap elaborasi, dan (5) tahap evaluasi. Penerapan model siklus belajar (learning cycle) 5E dapat meningkatkan kemampuan siswa dalam menerapkan konsep. Hal ini terbukti dari peningkatan skor rata-rata siswa pada setiap tahap. Pada pembelajaran pratindakan skor rata-rata siswa sebesar 49, siklus I sebesar 59, dan siklus II sebesar 75. Melihat keberhasilan penerapan model siklus belajar (learning cycle) 5E tersebut, disarankan bagi guru untuk menerapakan model siklus belajar (learning cycle) 5E pada matapelajaran lain.

Strategi siswa dalam membangun pemahaman pembagian pecahan : kajian terhadap tulisan Marcela D. Perlwitz dalam mathematics teaching in the middle school / oleh Siti Aminah

 

Penerapan model TGT (Team-Games-Tournaments) untuk meningkatkan hasil belajar pada mata pelajaran keamanan, kesehatan, keselamatan kerja dan lingkungan hidup (studi pada kelas X APK SMK Muhammadiyah V Kepanjen) / Anindita Gempita

 

Kata kunci: Team Game Tournament (TGT), dan hasil belajar. Model pemaduan Team Game Tournament (TGT) merupakan salah satu penerapan model pembelajaran yang sesuai dengan Kurikulum saat ini, dimana proses belajar mengajar di kelas terpusat pada siswa ( student oriented). Berdasarkan observasi awal yang dilakukan oleh peneliti di SMK Muhammadiyah V Kepanjen, dapat diketahui bahwa metode pengajaran yang diterapkan oleh guru dalam proses belajar mengajar di kelas adalah metode ceramah dan metode tanya jawab. Metode pengajaran tersebut kurang mengembangkan aktivitas dan hasil belajar siswa. Oleh karena itu, peneliti ingin menerapkan model pembelajran Team Game Tournament (TGT) untuk meningkatkan hasil belajar siswa pada mata pelajaran Keamanan, Kesehatan dan keselamatan Kerja dan Lingkungan Hidup di di SMK Muhammadiyah V Kepanjen. Subyek dan tempat dalam penelitian ini adalah siswa kelas X Apk 2 di SMK Muhammadiyah V Kepanjen yang berjumlah 42 siswa. Penelitian dilakukan pada bulan November 2011. Penelitian ini menggunakan pendekatan kualitatif dengan jenis Penelitian Tindakan Kelas (PTK), yang dilaksanakan dalam 2 siklus. Dalam setiap siklus terdiri dari 2 pertemuan dan melalui 4 tahapan yaitu tahap perencanaan tindakan, tahap pelaksanaan tindakan, tahap pengamatan dan tahap refleksi. Subjek yang diteliti adalah siswa kelas X Program Keahlian Apk 2 di di SMK Muhammadiyah V Kepanjen, Sumber data dalam penelitian ini adalah sumber primer dan sumber sekunder. Teknik pengumpulan data menggunakan tes, angket atau kuesioner, wawancara, observasi, dokumentasi, skenario pembelajaran, dan catatan lapangan. Hasil penelitian ini adalah: (1) dalam siklus I nilai rata-rata pre test dan post test siswa kelas X APK meningkat dari 60,52 menjadi 75,95 dengan persentase kenaikan sebesar 25%. Sedangkan pada siklus II nilai rata-rata pre test dan post test siswa kelas X APK meningkat dari 72,70 menjadi 84,86 dengan persentase kenaikan 16%. (2) Hasil belajar pada aspek aktivitas belajar siswa menunjukkan peningkatan pada tiap siklusnya. Pada siklus I siswa kelas X APK 2 memilki rata-rata total sebesar 55,72 (cukup baik). Sedangkan pada siklus II sebesar 80,08 (sangat baik). (3) Respon siswa kelas X APK 2 di SMK Muhammadiyah V Kepanjen terhadap Model Pembelajaran TGT menunjukkan respon positif dari setiap pernyataan yang diajukan.. Berdasarkan penelitian ini, dapat disimpulkan bahwa: (1) Penerapan Model Pembelajaran Koooeratif TGT untuk Mata Pelajaran K3LH kelas X Apk 2 SMK Muhammadiyah V Kepanjen, menunjukkan bahwa Pembelajaran TGT telah banyak memberikan manfaat pembelajaran yang berbentuk turnamen yang dapat meningkatkan pemahaman siswa; (2) Berdasarkan hasil analisis angket yang berisikan respon siswa terhadap mata pelajaran K3LH dari penerapan model Pembelajran TGT menunjukkan bahwa siswa lebih senang belajar secara berkelompok (kooperatif). Siswa merasa lebih senang ketika belajar K3LH dan cepat memahami materi setelah mengalami proses pembelajaran melalui model Pembelajaran TGT; (3) Hasil belajar siswa dengan adanya penerapan pembelajaran TGT untuk Mata Pelajaran K3LH kelas X Apk 2 SMK Muhammadiyah V Kepanjen menunjukkan hasil yang sangat baik dan mencapai ketuntasan belajar. Prestasi belajar siswa menunjukkan adanya peningkatan dari siklus I ke siklus II. Hal ini terbukti dari hasil analisis prestasi belajar kognitif, dan psikomotorik. Berdasarkan hasil penelitian ini, dapat disarankan bahwa: (1) Bagi guru SMK Muhammadiyah V kepanjen, diharapkan dapat mengimplementasikan strategi pembelajaran yang tepat, dan sesuai dengan masing-masing karakteristik mata pelajaran. Khususnya bagi guru mata pelajaran K3LH agar dapat menerapkan model Pembelajaran Kooperatif TGT sebagai alternatif model pembelajaran yang tepat untuk meningkatkan hasil belajar siswa; (2) Bagi siswa, agar dapat belajar dengan giat, karena pembelajaran tersebut akan melatih siswa berpikir kritis, berani mengungkapkan pendapat, meningkatkan aktivitas belajar, dan dapat meningkatkan hasil belajar siswa.; (3) Bagi peneliti berikutnya, hendaknya dapat melakukan kegiatan penelitian lebih lanjut untuk mengembangkan dan menerapkan model Pembelajaran Kooperatif TGT, bukan hanya pada mata pelajaran K3LH tetapi juga pada mata pelajaran lain yang relevan.

Perbandingan prestasi belajar matematika siswa kelas X SMAN 2 Malang yang mendapatkan pembelajaran dengan problem posing secara kelompok dan problem posing secara individu / oleh Harri Candra Wijaya

 

Pengaruh indeks Dow Jones Industrial Average (DJIA), nilai tukar rupiah/dollars, dan tingkat suku bunga (SBI) terhadap Indeks Harga Saham Gabungan (IHSG) di Bursa Efek Indonesia periode 2008-2011 / Cahyo Hardi Wijayanto

 

Kata Kunci: Indeks Dow Jones Industrial Average (DJIA), Nilai Tukar Rupiah terhadap dollar AS dan Tingkat Suku Bunga SBI Terhadap Indeks Harga Saham Gabungan (IHSG). Kondisi perekonomian suatu Negara yang kuat akan berpengaruh terhadap kondisi perekonomian negara lain (contagion theory). Hal tersebut berdampak terhadap bursa saham suatu negara yang saling berhubungan dengan bursa saham negara lain seperti kondisi DJIA mempengaruhi IHSG. Resiko nilai kurs rupiah mempengaruhi competitiveness perusahaan yang berdampak pada pendapatan perusahaan sehingga mempengaruhi keputusan investasi oleh investor di pasar modal karena investor akan beralih ke pasar uang jika pasar uang lebih menjanjikan keuntungan (teori keynes). Keputusan investasi investor tersebut berpengaruh terhadaphargasaham perusahaan di lantai bursa. Menurut teori tingkat bunga yang menyatakan bahwa kenaikan tingkat suku bunga akan berpengaruh terhadap keputusan investasi investor karena dengan suku bunga tinggi maka investasi pada saham akan berpindah pada investasi dalam bentuk tabungan dan deposito hal tersebut merupakan motif spekulasi yang dilakukan oleh investor untuk memperoleh return yang tinggi dari investasi yang dilakukan dengan tingkat resiko yang rendah (teori keynes). Penelitian ini berusaha menjelaskan pengaruh Dow Jones Indutrial Average (DJIA), Nilai Tukar Rupiah terhadap dollar AS dan Tingkat Suku Bunga SBI Terhadap Indeks Harga Saham Gabungan (IHSG) periode 2008 sampai 2011 serta mengukur pengaruh Dow Jones Indutrial Average (DJIA), Nilai Tukar Rupiah terhadap dollar AS dan Tingkat Suku Bunga SBI Terhadap Indeks Harga Saham Gabungan (IHSG) secara parsial. Penelitian ini termasuk jenis asosiatif kausalitas. Populasi penelitian ini adalah seluruh data Indeks Harga Saham Gabungan (IHSG) yang terdaftar di Bursa Efek Indonesia (BEI) dimulai pada awal periode pertamakali perhitungan IHSG yaitu 10 Agustus 1982 sampai dengan Desember 2011.Teknik pengambilan sampel yang digunakan adalah purposive sampling sehingga diperoleh 48 sampel. Sumber data merupakan sumber data sekunder yang berasal dari dokumentasi. Cara analisis data yang digunakan adalah dengan teknik analisis regresi linear berganda. Hasil penelitian ini menunjukkan bahwa seluruh variabel dalam penelitian ini saling berpengaruh. Dow Jones Indutrial Average (DJIA), Nilai Tukar Rupiah terhadap dollar AS dan Tingkat Suku Bunga SBI berpengaruh signifikan terhadap Indeks Harga Saham Gabungan (IHSG). Untuk penelitian kedepan diharapkan menambahkan variabel makro lain karena variabel lain diduga memiliki hubungan erat terhadap keadaan IHSG.

Menentukan nilai eigen suatu matriks dengan menggunakan matriks Hesseberg
oleh Priyo Suroso

 

Pengaturan rute kereta api pada stasiun berbasis PLC / Moch. Yusnie Azhari

 

Kata Kunci: pengaturan rute, sinyal elektrik, kereta api, wesel, kendali PLC. Perancangan pengaturan rute kereta api pada stasiun ini adalah untuk menjawab salah satu kebutuhan dari PT. KAI yang akan menggalakkan otomatisasi industri dalam segala aspek perjalanan kereta api. Pengaturan rute kereta api ini menggunakan kendali PLC untuk mengendalikan wesel. Dalam rangkaian tersebut terdapat 2 motor utama, dimana motor pertama menggerakkan jalur dari arah masuk, sedangkan pada konveyor kedua motor untuk menggerakkan wesel dari arah keluar. Dalam hal ini akan mengurangi resiko kecelakaan pada stasiun kereta api itu sendiri akibat lalainya dalam mengontrol dan mengatur perpindahan wesel Programmable Logic Controller merupakan bagian yang terpenting dalam system kontrol proses otomasi. Program kendali PLC terdiri atas tiga unsur yaitu: alamat, instruksi, dan operand. Pengaturan rute kereta api pada stasiun pada dasarnya dibuata dengan cara kerja mengatur posisi wesel pemindah jalur pada stasiun kereta api untuk memindahkan ke jalur yang tidak sedang disinggahi oleh kereta api. Apabila kereta api memasuki area stasiun pada jalur pertama, maka secara otomatis kereta api yang akan masuk dari arah selanjutnya akan di masukkan ke dalam jalur kedua atau yang lainnya. Untuk alur kerjanya ketika mesin pengaturan rute sudah dalam keadaan ON, pada motor pertama ketika kereta api memotong jalur sensor photo diode, rangkaian sensor akan langsung memberikan sinyal proximity kepada PLC. Kemudian output dari PLC akan menggerakan wesel menuju jalur yang tidak sedang disinggahi kereta api. Begitupun sebaliknya, pada motor kedua apabila kereta api yang masuk dari jalur yang berlawanan dan memotong jalur sensor photo diode, rangkaian sensor akan memberikan sinyal proximity kepada PLC. Kemudian output dari PLC akan menggerakkan wesel ke jalur yang tidak sedang disinggahi kereta api. Sehingga perpindahan jalur kereta api menjadi lebih efektif. Disarankan sebelum merancang Pengaturan Rute Kereta Api Pada Stasiun Berbasis PLC hendaknya memeriksa lagi seluruh komponen yang akan digunakan sebelum dirakit, sehingga pada saat alat dioperasikan tidak akan terjadi trouble dalam prosesnya. Karena sedikit kesalahan dalam proses ini akan menyebabkan sebuah akibat yang sangat fatal dan terjadi kecelakaan.

Studi keanekaragaman makrobentos sebagai bioindikator kualitas air sungai Bedadung dan pengembangan modul ekologi hewan Universitas Islam Jember / Umi Nurjanah

 

ABSTRAK Umi Nurjanah. 2016. Studi Keanekaragaman Makrobentos Sebagai Bioindikator Kualitas Air Sungai Bedadung dan Pengembangan Modul Ekologi Hewan Universitas Islam Jember. Tesis. Jurusan Pendidikan Biologi, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Ibrohim, M.Si. (2) Dr. Dahlia, M.S. Kata kunci : Keanekaragaman makrobentos, kualitas air Sungai Bedadung, modul ekologi hewan Sungai Bedadung merupakan salah satu sungai terbesar di Jember yang dimanfaatkan masyarakat sekitar. Akibatnya diperkirakan menurunkan kualitas air sungai, maka perlu adanya monitoring. Penelitian ini bertujuan untuk mengetahui 1) komposisi makrobentos; 2) kualitas air berdasarkan bioindikator makrobentos; 3) faktor fisika dan kimia air; 4) hubungan keanekaragaman makrobentos dengan faktor fisika dan kimia air Sungai Bedadung; dan 5) pengembangan hasil penelitian sebagai bahan ajar modul matakuliah Ekologi Hewan. Penelitian ini dilakukan pada bulan Juni sampai Oktober 2015. Sampling dilakukan pada 5 stasiun sepanjang Sungai Bedadung yang dimulai dari hulu sampai ke hilir. Pengambilan sampel pada 4 titik tiap stasiun dengan menggunakan D-Frame Net dan metode kicking. Pengembangan modul Ekologi Hewan dilaksanakan pada matakuliah Ekologi Hewan, Jurusan Biologi, Fakultas Keguruan dan Ilmu Pendidikan, Universitas Islam Jember berdasarkan model pengembangan 4-D. Hasil dari penelitian didapatkan bahwa komposisi makrobentos di Sungai Bedadung terdiri dari 3 filum yaitu Arthropoda, Mollusca dan Annelida. Filum Artropoda diwakili oleh kelas Insecta dan Crustacea, kelas Mollusca oleh Gastropoda dan Bivalvia serta Annelida oleh kelas Clitellata. Kualitas air Sungai Bedadung berdasarkan keanekaragaman makrobentos tidak tercemar tercemar sampai tercemar berat, berdasarkan nilai EPT kualitas air adalah bersih sampai tercemar sedangkan berdasarkan nilai FBI berkualitas sangat baik sampai cukup jelek. Faktor fisika-kimia air Sungai Bedadung yang meliputi pH, suhu, DO, BOD, COD, nitrat dan fosfat menunjukkan kualitas sungai kelas 3 kecuali nilai COD stasiun V yang menunjukkan kualitas air sungai kelas 4. Faktor fisika-kimia air berpengaruh signifikan terhadap keanekaragaman makrobentos. . pH, kekeruhan, DO, fosfat dan nitrat mempunyai hubungan yang positiif terhadap keanekaragaman makrobentos, sedangkan suhu, kedalaman, BOD, COD dan kecepatan arus mempunyai hubungan negatif terhadap keanekaragaman makrobentos. Modul Komunitas Makrobentos sebagai Bioindikator Pencemaran Sungai Bedadung layak digunakan untuk bahan belajar mandiri mata kuliah Ekologi Hewan, Universitas Islam Jember.

Perbedaan prestasi belajar matematika siswa antara siswa yang diajar dengan pembelajaran kooperatif model jigsaw dan siswa yang diajar dengan metode konvensional pokok bahasan sistem persamaan linear dua peubah siswa kelas II SMP Negeri 2 Ngunut Kabupaten

 

Pengaruh implementasi perangkat pembelajaran inkuiri terbuka dipadu NHT dan kemampuan akademik terhadap pemahaman konsep, berpikir tingkat tinggi dan keterampilan proses biologi siswa SMA di Kabupaten Minahasa Utara / Femmy Roosje Kawuwung

 

Program Studi Pendidikan Biologi Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dra. Herawati Susilo, M.Sc., Ph.D., (II) Dr. Hedi Sutomo., S.U., (III) Dr. Hj. Sri Endah Indriwati., M.Pd. Kata kunci: strategi pembelajaran, pemahaman konsep, berpikir tingkat tinggi, keterampilan proses, kemampuan akademik. Pembelajaran yang berkualitas adalah pembelajaran yang berpusat pada aktivitas siswa. Pembelajaran yang berpusat pada siswa adalah siswa mempunyai sumber belajar, siswa mempunyai kesempatan belajar, dan siswa mendapatkan keuntungan dari sumber belajar dan kesempatan. Implementasi pembelajaran yang berpusat pada siswa dapat dilakukan dengan menggunakan strategi pembelajaran yang tepat. Penelitian ini mengimplementasikan pembelajaran Inkuiri dan Numbered Heads Together (NHT), dan Inkuiri Terbuka dipadu NHT dengan melibatkan siswa akademik tinggi dan siswa akademik rendah. Tujuan Penelitian: 1) Penelitian survai adalah: untuk mengetahui bagaimana gambaran umum pelaksanaan pembelajaran biologi SMA di Kabupaten Minahasa Utara. Mengetahui bagaimana pemahaman konsep, berpikir tingkat tinggi, dan keterampilan proses. 2) Penelitian Pengembangan perangkat pembelajaran berbasis Lesson Study (LS) adalah: untuk mengetahui bagaimana mengembangkan perangkat pembelajaran Inkuiri Terbuka, NHT, Inkuiri Terbuka dipadu NHT yang dikembangkan melalui kegiatan LS. 3) Penelitian Eksperimen adalah: a) untuk mengetahui apakah ada perbedaan strategi pembelajaran Inkuiri Terbuka, NHT, Inkuiri Terbuka dipadu NHT terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses, b) untuk mengetahui apakah ada perbedaan kemampuan akademik terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses, c) untuk mengetahui apakah ada pengaruh interaksi strategi pembelajaran dengan kemampuan akademik terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses. Penelitian ini menggunakan rancangan penelitian eksperimen semu atau quasi eksperimental Tes awal dan Tes akhir Non-equivalent Control Group-Design dengan menggunakan rancangan faktorial 4 x 2. Penelitian ini dilaksanakan pada semester gasal tahun pelajaran 2011. Populasi penelitian adalah siswa kelas X/1 SMA di Kabupaten Minahasa Utara dengan jumlah sampel penelitian 241 siswa dari 8 sekolah. Penentuan sampel diawali dengan penentuan sekolah tempat penelitian berdasarkan UN, yaitu; SMA N 1 Airmadidi, SMA N 1 Dimembe, SMA Advent Tanah Putih, SMA St. Xaverius Kema, SMA N 1 Kauditan, SMA N 1 Wori, SMA Katolik Don Bosco Lembean, dan SMA N 1 Likupang. Data penelitian dikumpulkan dengan teknik Tes awal dan Tes akhir menggunakan tes pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses. Pengujian hipotesis menggunakan teknik analisis inferensial parametrik anakova yang dilanjutkan dengan uji beda Least Significant Difference (LSD). Sebelum uji anakova, terlebih dahulu dilakukan uji asumsi matematik atau persyaratan terhadap data hasil penelitian. Analisis data dilakukan dengan analisis deskriptif, analisis statistik anacova, dan anava menggunakan program SPSS versi 17 pada alpha 0,05. Penelitian Survai bulan Nopember 2010 s/d Januari 2011 menunjukkan bahwa guru yang memahami pembelajaran berpusat pada siswa sebanyak 12 (57,14%), guru yang memahami pemahaman konsep sebanyak 2 (9,52%), guru yang memahami kemampuan berpikir tingkat tinggi sebanyak 5 (23,80%), dan guru yang memahami keterampilan proses sebanyak 6 (28,57%). Guru yang memahami Inkuiri Terbuka sebanyak 5 (23,80%) dan guru yang memahami NHT sebanyak 13 (61,90%). Hasil penelitian pengembangan perangkat pembelajaran berbasis Lesson Study menunjukkan bahwa terdapat pengaruh yang sangat signifikan perangkat strategi pembelajaran terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses siswa. Pencapaian rata-rata terkoreksi pemahaman konsep biologi, kemampuan berpikir tingkat tinggi, dan keterampilan proses pada kelompok strategi pembelajaran inkuiri terbuka dipadu NHT (strategi paduan) lebih baik dari pada kelompok NHT, kelompok inkuiri terbuka, apalagi kelompok konvensional. Strategi pembelajaran yang berpengaruh sangat signifikan bagi peningkatan pemahaman konsep, berpikir tingkat tinggi, dan keterampilan proses, secara berurutan dari yang tertinggi, adalah strategi pembelajaran Inkuiri Terbuka dipadu NHT, diikuti oleh strategi pembelajaran NHT, Inkuiri Terbuka, dan pembelajaran Konvensional. Terdapat pengaruh signifikan tingkat kemampuan akademik siswa terhadap keterampilan proses. Tidak terdapat pengaruh interaksi strategi pembelajaran dengan tingkat kemampuan akademik siswa terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses. Hasil Penelitian eksperimen menunjukkan bahwa terdapat pengaruh yang sangat signifikan strategi pembelajaran terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses siswa. Pencapaian rata-rata terkoreksi pemahaman konsep biologi, kemampuan berpikir tingkat tinggi, dan keterampilan proses pada kelompok strategi pembelajaran inkuiri terbuka dipadu NHT (strategi paduan) lebih baik dari pada kelompok inkuiri terbuka, kelompok NHT dan kelompok konvensional. Strategi pembelajaran yang berpengaruh sangat signifikan bagi peningkatan pemahaman konsep, berpikir tingkat tinggi, dan keterampilan proses, secara berurutan dari yang tertinggi, adalah strategi pembelajaran Inkuiri Terbuka dipadu NHT, diikuti oleh strategi pembelajaran Inkuiri Terbuka, strategi pembelajaran NHT, dan pembelajaran Konvensional. Terdapat pengaruh signifikan tingkat kemampuan akademik siswa terhadap pemahaman konsep. Tidak terdapat pengaruh interaksi strategi pembelajaran dengan tingkat kemampuan akademik siswa terhadap pemahaman konsep, kemampuan berpikir tingkat tinggi, dan keterampilan proses. Kesimpulan adalah: pembelajaran biologi SMA Kabupaten Minahasa Utara berdasarkan observasi masih ada yang berpusat pada guru, guru kurang memahami pemahaman konsep, berpikir tingkat tinggi, dan keterampilan proses biologi. Penggunaan perangkat strategi pembelajaran Inkuiri Terbuka dipadu NHT dapat meningkatkan pemahaman konsep, berpikir tingkat tinggi, dan keterampilan proses biologi. Guru untuk dapat menggunakan paradigma baru pembelajaran yang berpusat pada siswa dengan mengimplementasikan pembelajaran Inkuiri Terbuka dipadu NHT. Pembelajaran tersebut terbukti dapat meningkatkan pemahaman konsep, berpikir tingkat tinggi, dan keterampilan proses, diikuti strategi pembelajaran inkuiri terbuka, dan NHT.

Mutu sosis sapi tanpa kemasan di beberapa pasar di Kotamadya Malang ditinjau dari total koloni bakteri dan terdapatnya bakteri Escherichia coli / oleh Leni Aryanti

 

Penerapan metode bermain sirkuit jasmani untuk mengembangkan kemampuan berhitung pada siswa kelompok A2 di TK Tunas Rimba Malang / Eny Dwi Renata

 

Kata Kunci: berhitung, sirkuit jasmani, TK Kemampuan berhitung khususnya membilang/menyebut urutan bilangan1-10, membilang dengan menunjuk benda (mengenal konsep bilangan dengan benda sampai 5), dan menghubungkan/memasangkan lambang bilangan dengan benda 1-5, pada pra penelitian menunjukkan hanya 23,5% dari 17 anak kelompok A2 di TK Tunas Rimba Malang. Kegiatan berhitung pada anak Taman Kanak-kanak kurang menyenangkan karena hanya menggunakan metode ceramah sehingga kegiatan tidak berpusat pada anak, dan media yang digunakan kurang menarik. Penelitian ini bertujuan untuk mendeskripsikan penerapan metode bermain Sirkuit Jasmani untuk meningkatkan kemampuan berhitung pada siswa kelompok A 2 di TK Tunas Rimba Malang dan mendeskripsikan peningkatan kemampuan anak dalam berhitung melalui metode bermain Sirkuit Jasmani. Penelitian ini dilaksanakan dengan desain PTK. Subyek Penelitian 17 anak pada kelompok A2 di TK Tunas Rimba Malang tahun pelajaran 2010/2011. Penelitian dilakukan selama dua siklus, setiap siklus meliputi tahapan: (1) Perencanaan tindakan. (2) Pelaksanaan Tindakan. (3) Pengamatan. (4) Refleksi. Analisis data secara deskriptif kualitatif. Instrumen Pengumpulan data berupa foto, dokumen yang berupa lembar kerja siswa, dan dokumen nilai yang menggambarkan kemampuan berhitung. Hasil penelitian menunjukkan bahwa penerapan pembelajaran melalui metode bermain sirkuit jasmani dapat meningkatkan kemampuan berhitung yaitu (1) membilang/menyebut urutan bilangan 1-10, (2) membilang dengan menunjuk benda (mengenal konsep bilangan dengan benda sampai 5), dan (3) menghubungkan/memasangkan lambang bilangan dengan benda 1-5 pada kelompok A2 di TK Tunas Rimba Malang. Pada proses peningkatan kemampuan berhitung dengan penerapan metode sirkuit jasmani dikatakan meningkat dan berhasil. Pada siklus I rata-rata prosentase kemampuan berhitung siswa sebesar 52,9 %. Dan pada siklus II rata-rata prosentase kemampuan berhitung siswa sebesar 82,3 %. Dari hasil tersebut menunjukkan bahwa terdapat peningkatan kemampuan berhitung siswa. Siklus II lebih baik dari pada siklus I. Kesimpulan penelitian ini adalah peningkatan kemampuan berhitung melalui metode bermain sirkuit jasmani dapat dilaksanakan dengan baik pada kelompok A2 di TK Tunas Rimba Malang. Disarankan pada guru TK maupun bagi peneliti selanjutnya untuk menggunakan pembelajaran melalui metode bermain sirkuit jasmani dengan media yang berbeda sehingga akan menambah rasa senang dalam belajar berhitung.

Hubungan kemampuan membaca pemahaman dan sikap bahasa dengan kemampuan menulis cerita pendek siswa kelas VIIA SMP Negeri 4 Malang / Nila Siti Wardani

 

ABSTRAK SitiWardani, Nila. 2015. HubunganKemampuanMembacaPemahamandanSikapBahasadenganKemampuanMenulisCeritaPendekSiswaKelas VIIA SMP Negeri 4 Malang. Skripsi. JurusanSastra Indonesia, FakultasSastra, UniversitasNegeri Malang. Pembimbing: (I)Dr. Imam AgusBasuki, M.Pd., (II)Musthofa Kamal, S.Pd., M.Sn. Kata kunci:membacapemahaman, sikapbahasa, menulisceritapendek. Membacamerupakansalahsatuaspek di dalampembelajaranbahasa Indonesia. Melaluimembacasiswadapatmemperolehbanyakwawasan. Salah satucarayang dapatdigunakandalammembacaialahmembacapemahaman. Kemampuanmembacapemahamandilakukanuntukmemperolehinformasidariapa yang telahdibaca. Sepertihalnyakemampuanmembacaceritapendek. Kemampuanmembacapemahamanceritapendekdapatdilihatdariseberapabesarseseorangmemperolehwawasanterkaitbacaanyagtelahdibaca. Sikapbahasamerupakanresponatautindakanseseorangterhadapbahasa yang diterima. Sikapsiswaterhadapbahasa Indonesia merupakanresponatautindakansiswaterhadapbahasa Indonesia. Seorangsiswa yang memilikisikappositifterhadapbahasa Indonesia, makasiswaakancenderungmenggunakansertamelestarikanbahasa Indonesia. Sebaliknya, seorangsiswa yang memilikisikapnegatifterhadapbahasa Indonesia, makasiswaakancenderungmengabaikanbahasa Indonesia. Menulismerupakansuatukegiatandengancaramenuangkan ide ataugagasankedalambentuktulisanyang bertujuanuntukmenghasilkansuatukaryatulis. Salah satukaryatulisyang dapatdihasilkanadalahceritapendek. Di dalammenulissebuahceritapendekdiperlukan ide, gagasan, imajinasi, danwawasan yang sangatluas. Sepertikeadaanlingkungan di sekitar (pengalamandirisendiriataupengalaman orang lain) dapatdigunakansebagai ide di dalammenulissebuahceritapendek. Selainmenuangkan ide di dalamcerita, pemilihan kata jugadiperlukan di dalammenulisceritapendek agar cerita yang dihasilkanhidupdanmenarik. Rumusanmasalahpadapenelitianiniadalah(1) bagaimanadeskripsikemampuanmembacapemahaman, sikapbahasa, dankemampuanmenulisceritapendek, (2) adakahhubunganantarakemampuanmembacapemahamandengankemampuanmenulisceritapendeksiswakelas VIIA SMP Negeri 4 Malang, dan(3) adakahhubunganantarasikapbahasadengankemampuanmenulisceritapendeksiswakelas VIIA SMP Negeri 4 Malang. Sebelummengetahuiadaatautidaknyahubunganantarakemampuanmembacapemahamandengankemampuanmenulisceritapendekdanhubungansikapbahasadengankemampuanmenulisceritapendek, terlebihdahuludilakukandeskripsiterhadapkemampuanmembacapemahaman, sikapbahasa, dankemampuanmenulisceritapendek. Penelitianinimenggunakanpendekatanpenelitiankuantitatif. Data dikumpulkandenganmenggunakaninstrumenberupatestulisuntukkemampuanmembacapemahaman, angket/kuesioneruntuksikapbahasa, dantestulisuntukkemampuanmenulisceritapendek. Penelitianinimenggunakansampelsatukelasyaitukelas VIIA SMP Negeri 4 Malang yang terdiriatas 30 siswa. Analisis data yang digunakanyaituanalisisdeskriptifdananalisisujibeda. Analisisdeskriptifdigunakanuntukmendeskripsikankemampuanmembacapemahaman, sikapbahasa, dankemampuanmenulisceritapendek. Analisisujibedadiperolehdenganmenggunakananalisisregresi linier sederhana. Analisisregresi linier sederhanadigunakanuntukmengetahuihubungankemampuanmembacapemahamandengankemampuanmenulisceritapendekdanmengetahuihubungansikapbahasadengankemampuanmenulisceritapendek. Berdasarkanhasilanalisis data, diperolehsimpulan yang menjawabrumusanmasalahpenelitian. Pertama, kemampuanmembacapemahamansiswakelas VIIA SMP Negeri 4 Malang sangattinggi, sikapbahasasiswakelas VIIA SMP Negeri 4 Malang sangattinggi, dankemampuanmenulisceritapendeksiswakelas VIIA SMP Negeri 4 Malang sangattinggi. Kedua, adanyahubungan yang positifdansignifikanantarakemampuanmembacapemahamandengankemampuanmenulisceritapendek. Ketiga, adanyahubungan yang positifdansignifikanantarasikapbahasadengankemampuanmenulisceritapendek Saran yang diberikandalampenelitianinisebagaiberikut. Pertama, disarankansekolahmampumempertahankansikappositifsiswaterhadapbahasa, dengancaramelatihsiswauntukmenggunakanbahasa Indonesia di lingkungansekolahkarenamelihatbesarnyahubunganantarakemampuanmembacapemahamandansikapbahasadengankemampuanmenulisceritapendek. Selainitu, sekolahmampumemfasilitasisumberbelajar yang diperlukansiswauntukmendukung proses pembelajarankhususnyamembacadanmenulis. Pembelajaranmembacadenganmemaksimalkanperpustakaansebagaitempatuntuksiswamemperolehwawasan. Pembelajaranmenulisdenganmemberikanmotivasikepadasiswauntukmenghasilkansuatukaryatulis, seperticeritapendek. Hal tersebutdapatdilakukandenganmemberikanreward (hadiah) kepadasiswa yang menciptakansuatukaryatulis. Kedua, disarankanguru mampumembangunmotivasisiswauntuklebihgiatbelajarkarena guru adalahpengeloladanjugapengarahdalamkegiatanbelajarmengajar. Selainitu, guru mampumemperhatikansikapbahasasiswadanmempertahankansikappositifsiswaterhadapbahasa Indonesia dengancaramenggunakanbahasa Indonesia di dalam proses pembelajaran. Ketiga, disarankansiswalebihmeningkatkansemangatnyauntukbelajarmenulisataumembaca. Jikasiswamemilikikemauanuntukbanyakmembaca, makapengetahuan yang dimilikiakanlebihluasdandapatdijadikan modal dalampenulisansuatukaryatulis. Selainitu, siswamampumempertahankanbahasa Indonesia dengancaramelatihmenggunakanbahasa Indonesia di dalammaupun di luar proses pembelajaran. Keempat, disarankanbagipenelitiselanjutnyahasilpenelitianinidapatdijadikandasaruntukdikembangkanlebihlanjutdenganvariabel yang lebihbervariasi, menggunakanpopulasiatausasaran yang lebihbanyak/luasdandimungkinkanpadajeniskompetensiatautingkatan yang berbeda.

Kerapatan plankton rotifera dan dinoflagellata selama pemupukan di tambak udang pesisir utara Kodya Probolinggo / oleh Asmanik

 

Efektivitas pemberian latihan terpusat dan latihan tersebar terhadap prestasi belajar matematika siswa kelas II SMA Negeri I Ngimbang Lamongan pada pokok bahasan persamaan eksponen dan logaritma / oleh Heni Tri Hidayati

 

Penggunaan gelas, sedotan dan permainan simonan untuk memahamkan penjumlahan dan pengurangan bilangan bulat pada siswa kelas IV SDN Sokaan I Kabupaten Probolinggo / Dyah Ayu Sulistyaning Cipta

 

Tesis. Program Studi Pendidikan Matematika, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Gatot Muhsetyo, M.Sc., (II)Dr. Hery Susanto, M.Si. Kata kunci : penggunaan gelas dan sedotan, permainan simonan, penjumlahan dan pengurangan bilangan bulat Diperlukan suatu usaha tertentu untuk memahamkan konsep penjumlahan dan pengurangan bilangan bulat yang bersifat abstrak agar dapat diterima secara efektif oleh siswa. Gelas dan sedotan merupakan suatu media pembelajaran yang dipilih penulis yang terbukti mampu memahamkan siswa pada penjumlahan dan pengurangan bilangan bulat. Berikutnya, agar siswa lebih handal dalam menggunakan konsep penjumlahan dan pengurangan bilangan bulat, diperlukan suatu latihan dalam menjumlah dan mengurangi bilangan bulat. Namun demikian, karena latihan soal selalu identik dengan kejenuhan siswa, penulis memilih permainan Simonan sebagai pembelajaran untuk melatih siswa dalam menjumlah dan mengurangi bilangan bulat. Tujuan penelitian ini adalah mendeskripsikan desain pembelajaran dengan menggunakan gelas, sedotan, dan permainan Simonan sehingga siswa kelas IV SDN Sokaan I, Kecamatan Krejengan, Kabupaten Probolinggo, pada semester genap tahun pelajaran 2011/2012 benar-benar memahami penjumlahan dan pengurangan bilangan bulat. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) karena dilakukan di suatu kelas dengan menggunakan rencana tindakan bersiklus yang melibatkan inkuiri dalam pengumpulan informasi, analisis, dan refleksi, untuk memahamkan siswa pada penjumlahan dan pengurangan bilangan bulat. Siklus dikatakan berhasil atau dihentikan apabila sudah tidak lagi ditemukan kesalahan konsep penjumlahan dan pengurangan bilangan bulat pada jawaban tes hasil belajar siswa setelah tindakan dengan ketuntasan belajar secara klasikalnya telah mencapai. Hasil penelitian menunjukkan bahwa pada siklus I masih terdapat siswa yang melakukan kesalahan konsep meski ketuntasan klasikal telah mencapai 78% sehingga siklus dilanjutkan pada siklus II. Pada siklus II sudah tidak adalagi siswa melakukan kesalahan konsep dengan ketuntasan klasikal 82% sehingga siklus dihentikan. Desain pembelajaran dengan menggunakan gelas dan sedotan untuk memahamkan penjumlahan dan pengurangan bilangan bulat adalah: 1) membangkitkan kesiapan siswa, yaitu dengan mengingatkan siswa pada penjumlahan dan pengurangan bilangan cacah, menginformasikan materi dan tujuan yang ingin dicapai dalam pembelajaran, mengenalkan media yang akan digunakan, serta meminta siswa untuk duduk bersama kelompok masing-masing; 2) mengarahkan siswa menemukan konsep dengan menuntun siswa untuk menjalani pengalaman menggunakan gelas dan sedotan untuk menemukan konsep penjumlahan dan pengurangan bilangan bulat; 3) latihan untuk siswa dengan memberikan LKS; 4) penguatan materi dengan mengarahkan siswa untuk menarik kesimpulan berupa konsep penjumlahan dan pengurangan bilangan bulat; 5) refleksi dengan memberi kesempatan kepada siswa untuk menanyakan bahan ajar yang belum dipahaminya dan evaluasi untuk memberi kesempatan kepada siswa agar menanyakan bahan ajar yang belum dipahaminya. Permainan Simonan dapat digunakan sebagai siasat guru agar siswa berlatih menjumlah dan mengurangi bilangan. Namun karena pada permainan Simonan yang sesungguhnya bejeng yang digunakan hanya mencantumkan bilangan 1-36, maka pada bejeng yang digunakan dalam pembelajaran dapat dimodifikasi dengan mencantumkan bilangan yang lebih luas. Pada penelitian ini, bilangan yang tertera pada bejeng dalam permainan Simonan adalah -999 hingga 999.

Pengembangan paket bimbingan keterampilan asertif sebagai panduan konselor SMP dalam pemberian layanan bimbingan pribadi-sosial / oleh Sujiati

 

Perkembangan teknologi penangkapan ikan dan dampaknya dalam kehidupan sosial ekonomi masyarakat nelayan pantai Prigi 1980-2010 / Mila Christi Nurjayanti

 

Kata Kunci: Teknologi Penangkapan Ikan, Pelabuhan Perikanan Nusantara Prigi Banyak sekali kajian-kajian yang membahas tentang masyarakat nelayan Pantai Prigi, tetapi dari kajian tersebut belum ada yang membahas tentang teknologi penangkapan ikan yang digunakan oleh nelayan Pantai Prigi. Berawal dari hal tersebut maka penelitian ini memfokuskan pada perkembangan teknologi penangkapan ikan dan dampaknya dalam kehidupan sosial ekonomi masyarakat nelayan Pantai Prigi. Batasan tahun yang digunakan adalah tahun 1980-2010. Alasan 1980 dijadikan batasan awal karena di Pantai Prigi telah dibangun Pelabuhan Perikanan Pantai dan 2010 dijadikan batasan akhir karena nelayan Pantai Prigi banyak yang menggunakan alat tangkap modern seperti purse seine dan pancing tonda. Berdasarkan uaraian tersebut penelitian ini mengambil rumusan masalah sebagai berikut: (1) Bagaimana perkembangan teknologi penangkapan ikan di Pelabuhan Perikanan Nusantara Prigi 1970-2010 (2) Bagaimana dampak perkembangan teknologi penangkapan ikan dalam kehidupan sosial ekonomi masyarakat nelayan di Pelabuhan Perikanan Nusantara Prigi 1970-2010. Pendekatan penelitian ini menggunkan metode penelitian sejarah (historis research). Metode pengumpulan data yang digunakan adalah wawancara, observasi dan studi dokumentasi. Hasil yang diperoleh dari penelitian ini adalah (1) perkembangan teknologi penangkapan ikan di Pantai Prigi dipengaruhi oleh budaya luar (2) dengan perkembangan teknologi yang semakin modern masyarakat Pantai Prigi mulai meninggalkan alat-alat tangkap tradisional dan berubah menjadi nelayan modern (3) alat tangkap yang banyak digunakan oleh nelayan Pantai Prigi adalah pancing ulur dan purse seine (4) penggunaan teknologi yang semakin modern berpengaruh terhadap pendapatan nelayan (5) dengan adanya pendapatan yang semakin meningkat kehidupan nelayan menjadi lebih sejahtera hal ini dapat dilihat dari bangunan tempat tinggal mereka dan juga mampu menyekolahkan anak-anaknya hingga ke perguruan tinggi (6) istri-istri nelayan memegang peranan penting dalam menjaga perekonomian keluarga. Berdasarkan penelitian ini, (1) saran kepada nelayan Pantai Prigi harus siap dengan adanya modenisasi, karena dengan ketidaksiapan akan merugikan nelayan sendiri. Nelayan harus lebih kreatif lagi dalam mengolah ikan hasil tangkapan ketika produksi melimpah (2) bagi Jurusan Sejarah Pelabuhan Perikanan Nusantara Prigi dapat dijadikan sebagai tempat pembelajaran bagi mahasiswa Jurusan Sejarah dengan mengamati aktivitas nelayan di pelabuhan dan alat-alat tangkap apa yang digunakan oleh nelayan (3) bagi penelitian selanjutnya, sebaiknya lebih menekankan pada pemberdayaan masyarakat pesisir dengan adanya modernisasi alat tangkap.

Pengembangan media pembelajaran transformasi geometri pada bidang berbasis komputer grafis untuk siswa SMA kelas XII semester 2 / oleh Ahmad Fauzi

 

Pengembangan E-modul mata pelajaran teknologi informasi dan komunikasi kelas VII semester 2 pokok materi hardware dan software di SMP Negeri 1 Bantur Kabupaten Malang / Widyatama Cahya Cipto

 

Kata Kunci: Pengembangan, E-Modul, Teknologi Informasi dan Komunikasi Pembelajaran TIK di SMP selama ini cenderung menggunakan metode ceramah dalam proses pembelajaran, sehingga siswa merasa jenuh dan kurang termotivasi saat proses pembelajaran. Untuk memvasilitasi gaya belajar siswa yang bervariasi, dan dapat dilakukan oleh guru yang memiliki minat belajar sekalipun bukan guru TIK, perlu di kembangkannya bahan ajar yang dapat mengatsi permasalahan-permasalahan dalam proses pembelajaran. Tujuan pengembangan ini adalah untuk menghasilkan produk bahan ajar berupa e-modul yang layak pakai untuk pembelajaran TIK Kelas VII Semester 2 pokok materi hardware dan software. Model pengembangan e-modul pembelajaran TIK ini memadukan model Borg & Gall dan model ADDIE. Model pengembangan tersebut dimodifikasi, disesuaikan dan diadaptasi sehingga menghasilkan model pengembangan yang mengacu pada kedua model pengembangan tersebut. Prosedur penelitian pengembangan yang penulis gunakan memiliki empat tahapan yaitu analisis, perancangan, pengembangan produk, dan uji coba. Berdasarkan hasil uji coba dapat dikemukakan sebagai berikut: uji coba ahli media di dapat presentase 88,3% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi layak. Uji coba ahli meteri didapat presentase 90% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi layak. Uji coba siswa perorangan didapat presentase 85,8% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi layak. Uji coba siswa kelompok kecil didapat presentase 84% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi layak. Uji coba siswa lapangan didapat presentase 81,9% berdasarkan kriteria kelayakan, e-modul ini termasuk kualifikasi layak. Sedangkan untuk hasil belajar siswa dapat meningkatkan prestasi belajar siswa. Hal ini dapat dilihat dari selisih nilai rata-rata nilai pre-tes dan post-tes yaitu terjadi peningkatan skor hasil belajar pada uji coba siswa perorangan secara keseluruhan sebesar 23.3%, kelompok kecil sebesar 25%, dan uji lapangan sebesar 30.5%. Kesimpulan pengembangan e-modul mata pelajaran TIK kelas VII pokok materi hardware dan software layak pakai dan efektif untuk dimanfaatkan sebagai bahan ajar alternatif untuk Sekolah Menengah Pertama (SMP) kelas VII. Saran dari pengembang sebagai berikut: (1) karena e-modul yang telah dikembangkan ini hanya terfokus pada pokok bahasan hardware dan software, untuk pengembang berikutnya, perlu dikembangkan lagi pokok bahasan yang lain. (2) Diharapkan adanya inovasi secara berkelanjutan agar mutu dari e-modul mempunyai kualitas yang lebih baik sehingga pencapaian hasil belajar siswa lebih maksimal. (3) E-modul yang telah dikembangkan dapat dijadikakan sebagai alternatif pemecahan masalah pembelajaran TIK di SMP.

Using mind mapping technique to improve the ability of eleventh graders of Senior High School 8 Malang in writing report texts / Irwandi

 

Thesis, Graduate Program in English Language Teaching, State University of Malang. Advisors: (1) Prof. H. Ali Saukah, MA., Ph.D (2) Drs. Fachrurrazy, M.A., Ph.D. Keywords: writing, mind mapping, report texts, classroom action research. This study was conducted to solve problems in the teaching and learning of writing report texts. The problems were the students had difficulties to develop and organize their ideas effectively, and they had low motivation. The researcher therefore proposed to use mind mapping as a teaching technique because the previous studies have proven it is an effective solution. To be more practical for the classroom learning, the researcher preferred to use mind mapping software instead of the traditional one, paper-pencil mind mapping. The purpose of this study was to improve the quality of the students’ ability in writing report texts by using mind mapping technique. This study was collaborative classroom action research. The research procedure was repeated cycle for planning, implementing, observing, and reflecting. The subjects of this study were 32 eleventh graders of 1A-5 in science program at SMA 8 Malang in academic year 2011/2012. The research instruments were interview, questionnaire, observation checklists, field notes, and writing test. The mind mapping technique was implemented through process-genre based approach which comprised Building Knowledge of Field (BKoF), Modeling of Text (MoT), Joint Construction of Text (JCoT), and Independent Construction of Text (ICoT). The use of mind mapping was modified by considering the purpose of each stage of the process-genre based approach. In building knowledge of field, mind mapping was used to activate students’ prior knowledge of the topic. Then, in the modeling of text, they identified and arranged the disorderly mind mapping based on its correspondence of report texts, and practiced drawing their mind mapping. In the following meeting, they wrote report texts in groups with mind mapping assistance. To prevent student boredom in the recurring writing activity, the teacher provided a mind mapping game in the next meeting for the sake of keeping them motivated. The last treatment, they wrote report texts independently with complete mind mapping. The result of the treatment during two cycles showed that the use of mind mapping as a teaching strategy could improve the students’ ability in writing report texts. Although the treatment in first cycle showed improvement, not all the criteria of success were achieved yet, especially their writing score. Their scores increased by 15.35 points on average over the preliminary study, while the target was 20 points. Moreover, 16 out of 32 students did not pass the KKM, 76. Therefore, the planning was revised to continue the treatment into second cycle. The revision focused on the classroom management and lesson plan. The teacher made a regulation for those who attended to the class late. Meanwhile, in the lesson plan, practicing mind mapping and playing mind mapping game were the alternative activities. These activities were integrated in the process-genre based approach. Moreover, the selection of topics of report texts was specified to a topic of animals, unlike the first cycle it was too broad. As a result, the treatment in the second cycle could improve their writing score by 28.51 points on average over the preliminary study. 27 out of 32 students passed the KKM. Besides, the average students’ writing score was 88.9 in the second cycle. As the conclusion, mind mapping that is implemented through process-genre based approach is an effective teaching strategy to improve the eleventh graders’ ability in writing because it is a thinking tool that primarily uses imagination and association to develop and organize ideas effectively. Moreover, it has interesting and attractive features, such as images, colors, curve branches, which are able to build positive learning atmosphere for the students. From the conclusion, some suggestions were offered to language teachers and future researchers. For language teachers, they should use this teaching strategy as a solution for their teaching problems in writing. They also have to consider their teaching context, such as the approaches, materials, and media in the implementation of this teaching strategy. In addition, especially the English teacher of SMA 8 Malang, related to the weakness of the study in which five students did the minimum passing level in writing, he should take another action to improve their writing ability. For future researcher, they should use this study as a reference in conducting their research related the use of mind mapping technique, not only in writing skill, but also in other skills, such as in speaking skill. They were also suggested to use the teaching strategy as a learning strategy, which is applied in factorial design that focuses on the short-term effect.

Kajian serangan jamur penyebab penyakit antraknose pada pasca panen 4 kultivar buah apel (Malus domestika Borkh) / oleh Avia Riza Dwi Kurnia

 

Kata kunci: Media, Gulungan Situasi, Peningkatan Kemampuan berbicara merupakan kemampuan yang kompleks, yang menuntut sejumlah pengetahuan dan keterampilan. Dalam latihan berbicara yang sederhana secara teknis tidak dituntut harus selalu benar, tetapi latihan berbicara dalam pembelajaran wajib dituntut untuk berani dan tidak takut salah. Berdasarkan beberapa penelitian, strategi pembelajaran dengan menggunakan permainan dapat meningkatkan motivasi, semangat, dan hasil belajar siswa. Berdasarkan hasil observasi/ studi pendahuluan yang dilakukan oleh peneliti, salah satu faktor yang menyebabkan kurangnya latihan berbicara siswa dikarenakan metode yang digunakan oleh guru bahasa Arab adalah monoton, dengan membaca terus menerus dan pembelajaran cenderung berpusat pada guru. Tujuan dilaksanakan penelitian ini adalah untuk meningkatkan kemahiran berbicara bahasa Arab siswa dengan menggunakan media gulungan situasi. Pendekatan yang digunakan dalam penelitian ini adalah Penelitian Tindakan Kelas (PTK), dengan dua siklus. Setiap siklus terdiri atas dua kali pertemuan dengan pertemuan pertama digunakan untuk menyampaikan materi dan melakukan drill kosa kata serta pemberian tes yang sesuai tema dengan menggunakan berbicara bahasa Arab, yaitu dengan teks khiwar sesuai dengan buku LKS. Sedangkan pertemuan kedua digunakan untuk mereview materi pembelajaran pada pertemuan pertama, yaitu kosa kata dan dilanjutkan dengan melakukan praktek berbicara bahasa Arab dengan menggunakan media gulungan situasi. Hasil penelitian menunjukkan bahwa penerapan metode permainan, khususnya permainan dengan menggunakan media gulungan situasi dapat meningkatkan kemahiran berbicara bahasa Arab siswa kelas VIII.E MTs. Negeri Kepanjen. Indikator meningkatnya berbicara bahasa Arab siswa adalah meningkatnya nilai rata-rata siswa dan prosentase keberhasilan siswa dari satu siklus ke siklus berikutnya, yakni pada siklus I:kurang dengan nilai 72, dan siklus II:cukup baik dengan nilai 84. Saran yang diberikan oleh peneliti untuk para guru yang akan menerapkan metode permainan adalah agar mempertimbangkan temuan penelitian ini, yang antara lain berupa langkah-langkah pembelajaran dengan metode permainan, yakni dengan bermain peran. Bagi peneliti lain yang ingin melakukan penelitian sejenis dianjurkan untuk menggunakan strategi-strategi permainan yang lain agar memperkaya penerapan pembelajaran bahasa Arab.

Penerapan metode pemisahan variabel dan deret fourier untuk menyelesaikan persamaan potensial listrik / oleh Nur Augustyno Eko Nugroho

 

Rancangan pembelajaran matematika dengan pendekatan open-ended pokok bahasan himpunan bagi siswa SMP kelas VII semester 2 / oleh Sri Lestari

 

Kemampuan gramatikal bahasa arab mahasiswa dalam interaksi belajar mengajar muxaadatsah / oleh Moh. Khasairi

 

Penentuan lintasan terpendek (shorter path) dengan algoritma dijkstra, algoritma floyd-warshall dan algoritma bellman-ford / oleh Dwi Erna Novianti

 

Tindak tutur dalam rubrik "Apa Kabar Bo?" majalah Bobo / oleh Bislita Aprillia Kartini

 

Penerapan pendekatan inkuiri terpimpin dalam pembelajaran untuk meningkatkan prestasi belajar pokok bahasan reproduksi pada siswa kelas II-2 SMA Negeri I Tumpang / oleh Fitri Wahyu Ichwani

 

Penyelenggaraan program SD-SMP Satu Atap pada daerah terpencil dalam latar budaya Rumah Betang Kalimantan Tengah (Studi multikasus pada SMPN satu Atap 2 Kurun, dan SMPN Satu Atap 3 Tewah di Kabupaten Gunung Mas) / Rudi Hasan

 

Kata Kunci: SD-SMP satu atap, struktur birokrasi, sumber daya pendidikan, komunikasi, daerah terpencil, budaya rumah betang Tujuan penelitian ini adalah mendeskripsikan penyelengaaraan program SD-SMP Satu Atap sebagai alternatif pemerataan pendidikan dasar sembilan tahun pada daerah terpencil dalam latar budaya rumah betang Kalimantan Tengah yang dikaitkan dengan (1) struktur birokrasi, meliputi aspek: a) standar operasional prosedur, b) koordinasi, dan c) efisiensi pemberdayaan sumber daya manusia; (2) ketersediaan sumber daya, yang meliputi aspek: a) sumber daya manusia, b) sumber daya fisik/ prasarana dan sarana, c) sumber daya pembiayaan/ pendanaan; dan (3) komunikasi, meliputi aspek komunikasi a) intern SMP Satu Atap, b) SMP Satu Atap dengan SD penyangga, c) SMP Satu Atap dengan UPTD/ Dinas Pendidikan terkait, d) SMP Satu Atap dengan masyarakat sekitar. Hasil penelitian ini menemukan, bahwa: (1) struktur birokrasi yang didasari nilai-nilai budaya rumah betang, meliputi (a) standar operasional kerja yaitu penyelenggaraan program sekolah melibatkan seluruh komponen sekolah, pembagian tugas secara cermat dengan uraian tugas jelas, memberi kepercayaan kepada guru dengan pendekatan kekeluargaan untuk meningkatkan kesadaran guru dalam penyelenggaraan program sekolah, (b) koordinasi dilakukan setiap waktu, dengan pihak Dinas Pendidikan dan pengurus komite secara rutin, intensif, dan proaktif, (c) pemberdayaan sumber daya manusia didasarkan kemampuan dan komitmen dengan rasa tanggung jawab, pembagian tugas secara merata berkeadilan; (2) ketersediaan sumber daya, meliputi (a) sumber daya manusia, yaitu secara kuantitas jumlah guru dan pegawai masih kurang secara kualitas sebagian besar guru mengajar tidak sesuai bidangnya, solusi dengan GTT dan sikap kreatif dan inovatif, (b) sumber daya fisik/ prasarana dan sarana masih kurang dan bahkan belum ada, (c) sumber daya pembiayaan/pendanaan sangat minim, mengandalkan dana anggaran pemerintah pusat dan daerah; (3) komunikasi SMP Satu Atap didasari nilai-nilai budaya rumah betang, meliputi (a) komunikasi intern SMP Satu Atap terjadi secara intensif antara kepala sekolah, guru. dan siswa dengan penuh kekeluargaan, (b) dengan SD penyangga terjadi secara intensif baik alih jenjang SD ke SMP maupun kegiatan bersama secara kekeluargaan, (c) komunikasi dengan dinas terkait terjadi secara aktif dan proaktif dengan lancar, loyalitas tinggi, dan suasana akrab, serta kekeluargaan karena secara struktural SMP Satu Atap di bawah Dinas Pendidikan, (d) komunikasi dengan masyarakat sekitar terjadi komunikasi positif dengan bentuk kegiatan yang melibatkan masyarakat sekitar sekolah dengan penuh rasa kekeluargaan dan keakraban.

Pengaruh penambahan 2,3-D dan NAA dalam medium MS +2,2 uM BAP terhadap perkembangan eksplan daun nilam (Pogosteman cablin Benth) / oleh Ika Su'udia

 

Peningkatan keaktifan siswa pada ranah afektif dalam pembelajaran tolak peluru melalui metode bermain pada siswa kelas VI SDN Cukurgondang I Kecamatan Grati Kabupaten Pasuruan / Khaidar Robbi

 

Kata kunci : metode bermain, siswa aktif, pembelajaran Tolak Peluru Tolak Peluru merupakan salah satu cabang atletik yang diajarkan di sekolah dasar. Berdasarkan hasil data observasi awal yang dilakukan, diperoleh data bahwa masih banyak siswa yang tidak aktif dalam pembelajaran. Pembelajaran Tolak Peluru di SD Negeri Cukurgondang I Kecamatan Grati Kabupaten Pasuruan masih sering menggunakan metode ceramah dan demonstrasi untuk menyampaikan materi serta memberikan contoh kepada siswa. Dengan metode ceramah dan demonstrasi banyak siswa yang tidak serius dalam mengikuti pelajaran. Mereka kebanyakan asyik bermain sendiri tanpa memperhatikan guru yang sedang berceramah di depan kelas. Untuk itu, dalam penelitian ini diterapkan pembelajaran dengan menggunakan metode bermain. Pembelajaran dengan metode ini mempunyai ciri yaitu siswa merasa senang, bersemangat dan tekun dalam mengikuti pembelajaran. Dengan metode ini diharapkan semua siswa dapat lebih aktif dalam mengikuti pembelajaran Tolak Peluru. Tujuan penelitian ini adalah untuk meningkatkan keaktifan siswa pada ranah afektif dalam mengikuti pembelajaran Tolak Peluru di kelas VI SD Negeri Cukurgondang I. Dan diharapkan pula pembelajaran ini akan lebih menarik dan dapat berhasil dilaksanakan oleh peneliti. Penelitian ini merupakan Penelitian Tindakan Kelas (Classroom Action Research). Pelaksanaan tindakan kelas ini dilakukan melalui dua siklus dimana tiap siklus terdiri dari satu pertemuan dengan 4 tahap yaitu: (1) perencanaan, (2) pelaksanaan, (3) observasi, (4) refleksi. Subyek dalam penelitian ini adalah siswa kelas VI SD Negeri Cukurgondang I. Teknik pengumpulan data dalam penelitian ini menggunakan observasi, dokumentasi, dan catatan lapangan. Hasil observasi awal pada penelitian ini menunjukkan ketidak tuntasan pada pembelajaran Tolak Peluru yang ditunjukkan dengan indikator senang 69,33%, semangat 20% dan tekun hanya 20%. Namun setelah pertemuan I dan II dapat diketahui peningkatan keaktifan yang sangat berarti bagi guru pendidikan jasmani yaitu indikator senang dari 69,33% menjadi 82,66%, semangat 70,66% menjadi 80%, tekun dan 72,66% menjadi 84%. Berdasarkan hasil penelitian ini, peneliti menyarankan bagi guru Pendidikan Jasmani di SD bahwa metode bermain dapat dijadikan alternatif dalam pembelajaran Tolak Peluru dan dapat disimpulkan bahwa dengan metode bermain dan penerapan bentuk-bentuk permainan dapat meningkatkan keaktifan siswa pada ranah afektif kelas VI di SD Negeri Cukurgondang I Kecamatan Grati Kabupaten Pasuruan.

Pengembangan media pembelajaran sistem periodik unsur-unsur dengan bahasa pemrograman Visual Basic 6.0 / oleh Afiat Meiristian

 

Penerapan pembelajaran kooperatif model Team Assited Individualization (TAI) untuk meningkatkan hasail belajar siswa (Studi pada siswa kelas X APK SMK Cendika Bangsa Kepanjen) / Yuda Adrian Hadi Subrata

 

Kata Kunci: Pembelajaran Kooperatif Model TAI (Team Assisted individualization), Hasil Belajar Penelitian ini menggunakan pendekatan kualitatif karena penelitian ini bersifat alamiah dan data yang diperoleh dinyatakan dalam bentuk verbal. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK). Subyek penelitian adalah siswa kelas X APK SMK Cendika Bangsa Kepanjen. Teknik pengambilan dan pengumpulan data dilakukan dengan menggunakan lembar observasi, pedoman wawancara, tes, catatan lapangan, dan dokumentasi. Analisis data yang digunakan adalah analisis data secara induktif. Tindakan yang dilakukan dalam penerapan pembelajaran kooperatif model TAI pada mata pelajaran Mengelola Peralatan Kantor adalah: 1. Peneliti menjelaskan secara rinci kepada siswa tentang metode pembelajaran kooperatif model TAI, 2. Peneliti memulai kegiatan pembelajaran kooperatif model TAI dengan memberikan pretest, kemudian siswa dibagi menjadi 6 kelompok heterogen berdasarkan segi akademik dan siswa duduk dalam kelompok yang sudah dibentuk, peneliti melakukan penyajian kelas tentang materi Macam-macam Mesin Kantor, siswa melaksanakan kerja kelompok untuk mendiskusikan Lembar soal yang diberikan oleh peneliti dan mempresentasikan hasil diskusinya di depan kelas, serta guru memberikan strategi pemecahan masalah. Setelah itu pemberian penghargaan terhadap kelompok yang mendapat nilai tertinggi, dan kegiatan akhir ditutup dengan memberikan soal postest, 3. Hasil belajar siswa dapat dilihat dari ketuntasan belajarnya yang diperoleh dari nilai pretest dan posttest. Hasil belajar siswa mengalami peningkatan setelah diterapkan metode pembelajaran kooperatif model TAI dilihat dari tercapainya kriteria ketuntasan belajar yang ditetapkan. Data hasil belajar siswa pada siklus I nilai rata-rata siswa adalah 66,8, dan pada siklus II nilai rata-rata siswa meningkat menjadi 89,8. Presentase siswa yang tuntas belajar pada siklus I sebanyak 35,7% mengalami peningkatan 64,3%, yaitu sebanyak 96,7% pada siklus II. Saran yang dapat peneliti berikan yaitu dapat menerapkan model Team Assisted Individualization sebagai salah satu alternatif pilihan model pembelajaran yang dapat digunakan dalam kegiatan pembelajaran, khususnya pada mata pelajaran Mengelola Peralatan Kantor serta mata pelajaran yang lainnya. Sehingga tercipta pembelajaran yang variatif dan menyenangkan yang berujung pada peningkatan hasil belajar siswa.

Senyawa-senyawa hasil metilasi asam risinoleat (asam 12-hidroksi-oktadekenoat) dengan dimetilsulfat dan larutan nitrium hidroksida (Na OHaq) / oleh Evi Sufiyani

 

Penerapan pembelajaran berbasis masalah (problem based learning) pada pembelajaran minyak bumi di SMA Negeri 1 Jombang / oleh Ailila Yuniati

 

Perbedaan prestasi belajar IPS antara siswa yang belajar menggunakan LKS dengan siswa yang belajar menggunakan bahan ajar modul siswa kelas V SDN Ketawanggede 1 Kota Malang / Handri Farisi

 

Kata Kunci: Prestasi Belajar, IPS, LKS, Bahan Ajar Modul . Guru memiliki segudang tugas dan kewajiban yang sangat menyita waktunya, mulai dari mempersiapkan pembelajaran, mengajar di kelas, mengevaluasi dan mengoreksi, sampai pada tugas administrasi yang masih dibebankan kepadanya. Hal inilah yang sering menjadi alasan ketidak berdayaan guru untuk mengembangkan diri dalam hal menyusun dan mengembangkan bahan ajar, sehingga proses pembelajaran berlangsung dengan menggunakan LKS dari penerbit. Padahal LKS yang ada di sekolah atau LKS dari penerbit hanya LKS yang memindah sebuah jawaban dari materi yang terurai pada awal halaman. Modul adalah suatu kesatuan yang bulat dan lengkap yang terdiri dari serangkaian kegiatan belajar yang secara empiris telah memberi hasil belajar yang efektif untuk mencapai tujuan yang dirumuskan secara jelas dan spesifik. Lembar Kegitan Siswa ( LKS) bisa diartikan lembaran-lembaran yang digunakan siswa sebagai pedoman dalam pembelajaran, serta berisi tugas yang dikerjakan oleh siswa baik berupa soal maupun kegiatan yang akan dilakukan peserta didik. Rancangan penelitian yang digunakan dalam penelitian ini yaitu peneltian kuantitatif dengan pendekatan rancangan eksperimen semu (quasi experimental). Pada rancangan penelitian ini, peneliti menggunakan tes awal (pre test) yaitu test yang diberikan sebelum perlakuan dan tes akhir (post test) yaitu tes yang diberikan setelah perlakuan. Subyek penelitian ini adalah siswa kelas VA dan VB SDN Ketawanggede 1 Kota Malang. Instrumen yang digunakan untuk mengumpulkan data dalam penelitian ini adalah soal tes untuk tes awal dan tes akhir, sedangkan analisis data yang digunakan adalah analisis deskriptif kuantitatif. Hasil penelitian menunjukkan bahwa ada perbedaan signifikan antar siswa yang belajar menggunakan LKS dengan siswa yang belajar menggunakan bahan ajar modul siswa kelas V SDN Ketawanggede 1. Hal ini dilihat dari hasil penghitungan uji hipotesis dengan menggunakan t-test Pooled Varian harga thitung lebih besar dari ttabel dengan taraf signifikansi 5% yaitu 7.061 > 2.68. Berdasarkan analisis data dan pembahasan secara keseluruhan disimpulkan bahwa nilai rata-rata siswa yang belajar menggunakan LKS sebesar 6.90, dengan ketuntasan belajar sebesar 94,25%. Sedangkan siswa yang belajar menggunakan bahan ajar modul sebesar 27.59 dengan ketuntasan belajar sebesar 97,58%. Hasil pengujian hipotesis berdasarkan kriteria ketentuannya, apabila thitung > ttabel yaitu 7.061 > 2.68 maka ada perbedaan prestasi belajar antara siswa yang belajar menggunakan LKS dengan siswa yang belajar menggunakan bahan ajar modul siswa kelas V di SDN Ketawanggede 1 Kota Malang. Disarankan untuk guru mata pelajaran khusunya mata pelajaran IPS dalam menggunakan LKS, sebaiknya guru menyusun sendiri LKS yang akan dipakai. Karena LKS dari penerbit yang sekarang ini banyak beredar, penyusunannya kurang sesuai dengan syarat-syarat penyusunan LKS yang sebenarnya.  

Upaya meningkatkan kemampuan berpikir kreatif dan prestasi belajar fisika siswa kelas II-E SMP Laboratorium UM melalui pembelajaran dengan pendekatan CTL (Contextual Teaching and Learning) model inkuiri / oleh Dwi Septarani HP.

 

Efektifitas komik sebagai media informasi bahaya merokok untuk mengurangi perilaku merokok siswa SMP / Shofiyatul Fikriyah

 

Kata Kunci: komik, media informasi, perilaku merokok. Perilaku merokok pada kalangan siswa SMP semakin bertambah seiring dengan semakin berkembangnya media informasi dan komunikasi. Hal tersebut mendapat perhatian dari Sri Wahyuni (205111483647) mahasiswa program studi Bimbingan Konseling Universitas Negeri Malang. Sri Wahyuni melakukan penelitian dengan judul “Pengembangan Komik Sebagai Media Informasi Bahaya Merokok Bagi Siswa SMP”. Dari penelitian yang dilakukan oleh Sri Wahyuni dihasilkan sebuah komik sebagai media pemberian infomasi mengenai bahaya merokok dengan judul “Asap Putih yang Membunuh, Sebuah Kisah Persahabatan dengan Si Asap Racun”. Komik tersebut menarik minat peneliti untuk diangkat dalam suatu penelitian eksperimen. Pada akhirnya, peneliti meminta izin dari peneliti sebelumnya untuk menggunakan produk penelitiannya dalam suatu penelitian eksperimen. Penelitian ini bertujuan untuk mengetahui efektifitas komik “Asap Putih yang Membunuh, Sebuah Kisah Persahabatan dengan Si Asap Racun” sebagai media informasi bahaya merokok untuk mengurangi perilaku merokok pada siswa SMP. Desain penelitian yang digunakan adalah pre-experimental dengan one group pretest-posttest design dengan teknik pengambilan sampel berdasarkan tujuan (purposive sampling). Menggunakan instrumen self report berupa angket untuk mendapatkan siswa perokok. Analisis data menggunakan uji Wilcoxon. Hasil penelitian menunjukkan bahwa pada kelompok eksperimen terdapat perbedaan antara nilai pretest dan posttest (nilai Z= (-2,193 Asymp. Sig. (2-tailed) nilai signifikansi untuk uji dua sisi adalah 0,028. Karena signifikansi 0,028 < 0,05 maka dapat diambil keputusan untuk menerima H1 dan menolak H0. Hasil tersebut menunjukkan bahwa treatment menggunakan komik “Asap Putih yang Membunuh, Sebuah Kisah Persahabatan dengan Si Asap Racun” teruji efektif untuk mengurangi perilaku merokok pada siswa SMP. Berdasarkan hasil disarankan kepada: (1) konselor, komik dengan judul “Asap Putih yang Membunuh, Sebuah Kisah Persahabatan dengan Si Asap Racun” karya Sri Wahyuni (205111483647) dapat dijadikan alternatif media bimbingan yang efektif untuk memberikan pemahaman pada siswa tentang bahaya dan kerugian yang diakibatkan oleh rokok, sehingga dapat mendorong siswa untuk mengurangi bahkan berhenti merokok, (2) Sekolah sebagai lembaga penyelenggara pendidikan formal yang memfasilitasi siswa dalam mencapai tugas perkembangannya diharapkan menyediakan sarana maupun prasarana pendidikan yang mendukung proses pembelajaran pada siswa khususnya dalam bimbingan konseling. Media/alat bimbingan harus terus menerus diperbaharui mengingat perkembangan IPTEK terus berlanjut. Hal tersebut bisa dilakukan dengan memberikan anggaran yang cukup bagi penyelenggaraan bimbingan konseling di sekolah sehingga penyelenggara bimbingan konseling di sekolah data melakukan inovasi dalam mengoptimalkan bimbingan di sekolah., (3) peneliti selanjutnya, penelitian ini terbatas oleh waktu sehingga diharapkan untuk peneliti selanjutnya bisa memperhitungkan dan mempertimbangkan waktu serta adanya kelompok kontrol dalam penelitian akan memberikan pengaruh pada hasil treatment yang dilakukan.

Pertumbuhan kemampuan bertanya sebagai dampak pembelajaran berbasis observasi gejala fisis pada perkuliahan fisika dasar 1 bagi mahasiswa program studi Pendidikan Fisika angkatan 2004 / oleh M. Taufiqullah

 

Pengembangan bahan ajar mata kuliah perpajakan dengan model Dick, Carey & Carey p[ada program studi Pendidikan Ekonomi FKIP Universitas Jember / Hety Mustika Ani

 

Tesis, Jurusan Pendidikan Ekonomi, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Agung Haryono, S.E., M.P. Ak., (II) Dr. Sugeng Hadi Utomo, M.Ec. Kata kunci: pengembangan, bahan ajar, perpajakan, model Dick, Carey & Carey. Rumusan masalah penelitian ini adalah apakah bahan ajar mata kuliah perpajakan yang dikembangkan dengan model Dick, Carey & Carey dapat meningkatkan kualitas proses, kualitas hasil pembelajaran, motivasi mahasiswa serta pemahaman perpajakan bagi mahasiswa Pendidikan Ekonomi FKIP Universitas Jember, sejalan dengan pertanyaan penelitian tersebut, maka penelitian ini bertujuan untuk menghasilkan bahan ajar mata kuliah perpajakan dengan model Dick, Carey & Carey yang dapat meningkatkan kualitas proses, kualitas hasil pembelajaran, motivasi mahasiswa serta pemahaman perpajakan mahasiswa Pendidikan Ekonomi FKIP Universitas Jember. Model yang digunakan dalam pengembangan bahan ajar ini adalah Model Dick, Carey & Carey terdiri atas sepuluh langkah, yaitu: (1) Mengidentifikasi tujuan pembelajaran, (2) Melakukan analisis pembelajaran, (3) Mengidentifikasi perilaku awal dan karakteristik pebelajar, (4) menulis tujuan pembelajaran khusus, (5) mengembangkan butir-butir tes acuan patokan, (6) mengembangkan strategi pembelajaran, (7) mengembangkan dan memilih materi pembelajaran, (8) mendesain dan melakukan evaluasi formatif, dan (9) merevisi pembelajaran, dan (10) mendesain dan menyusun evaluasi sumatif. Namun dalam pengembangan ini hanya dilakukan delapan langkah, pengembang tidak mengembangkan strategi pembelajaran dan tidak melakukan evaluasi sumatif. Hasil pengembangan berupa draft bahan ajar, panduan dosen dan panduan mahasiswa diujicobakan. Ujicoba yang telah dilakukan meliputi uji coba ahli isi mata kuliah perpajakan, uji coba ahli media pembelajaran, uji coba perorangan, uji coba kelompok kecil dan uji coba lapangan. Hasil penilaian/tanggapan dari masing-masing tahap digunakan sebagai masukan proses penyempurnaan produk pengembangan. Hasil uji coba ahli untuk bahan ajar, panduan dosen dan panduan mahasiswa berada dalam kategori baik dan sangat baik. Dari hasil uji coba perorangan pengembang banyak mendapat saran dan masukan. Berdasarkan uji kelompok kecil, bahan ajar termasuk kategori kategori sangat tepat. Dengan rerata persentase ketepatan 89,04%, kejelasan 88,66% dan kemenarikan 80,83%. Panduan mahasiswa juga termasuk kategori sangat baik, dengan rerata persentase 93,33%. Untuk uji lapangan bahan ajar termasuk kategori sangat tepat, dengan rerata persentase ketepatan 89%, kejelasan 80%, dan kemenarikan 89%. Penilaian/tanggapan dosen pembina mata kuliah terhadap bahan ajar termasuk kategori sangat baik dengan persentase ketepatan 86%, kejelasan 88% dan kemenarikan 80%. Panduan mahasiswa berada dalam kategori baik (83%), panduan dosen berada dalam kategori sangat baik (86%). Peningkatan hasil belajar mahasiswa sangat signifikan, terbukti dengan adanya perbedaan nilai pretes dan nilai postes sebesar 36,5. Artinya bahan ajar sangat efektif untuk meningkatkan hasil belajar. Kekuatan bahan ajar yang telah disusun adalah (1) bahan ajar disusun secara sistematis untuk digunakan dosen dan mahasiswa dalam kegiatan pembelajaran, sehingga dosen dan mahasiswa mudah untuk menggunakannya, (2) bahan ajar dapat menimbulkan minat baca, (3) bahan ajar ditulis untuk kepentingan mahasiswa sehingga strukturnya disesuaikan dengan karakteristik mahasiswa, (4) bahan ajar mencantumkan dan menjelaskan tujuan pembelajaran sehingga dalam memandu mahasiswa dalam melakukan aktivitas belajar, (5) bahan ajar disusun dengan dilengkapi latihan didalamnya sehingga memberi kesempatan pada mahasiswa untuk berlatih mengerjakan latihan soal secara mandiri; (6) bahan ajar mengakomodasi kesulitan mahasiswa, (7) bahan ajar memberikan rangkuman, sehingga mempermudah proses belajar siswa, (8) dilengkapi dengan panduan dosen dan panduan mahasiswa. Sedangkan kelemahan perangkat pembelajaran ini adalah bahan ajar disusun berdasarkan hanya pada karakteristik mahasiswa Pendidikan Ekonomi FKIP Universitas Jember, sehingga bila bahan ajar ini digunakan secara luas, perlu penyempurnaan atau revisi yang sesuai dengan karakteristik dan kebutuhan pengguna yang lain.

Penerapan metode penemuan terbimbing melalui pemberian bantuan (scaffolding) untuk meningkatkan pemahaman siswa kelas V SD dalam mata pelajaran matematika / Ika Rahmawati

 

Program Studi Pendidikan Dasar – Matematika SD, Program Pasca Sarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Sri Mulyati, M.Pd., (II) Dr. Abdul Qohar, MT. Kata Kunci: penemuan terbimbing, scaffolding, sifat-sifat bangun datar. Pelaksanaan penelitian ini dilatarbelakangi oleh adanya masalah yang dihadapi oleh siswa kelas V SD Negeri Sukun 2 Malang. Mereka merasa kesulitan dalam memahami materi matematika khususnya materi bangun datar, karena mereka menganggap bahwa proses pembelajaran yang kurang begitu menarik bagi mereka. Beberapa siswa pun menyampaikan keluhan bahwa siswa yang kurang mampu dalam proses pemahaman materi tidak memperoleh kesempatan untuk mendapatkan bantuan dari teman yang memiliki kemampuan lebih. Hal ini dikarenakan kebiasaan siswa yang berkemampuan tinggi sering berkumpul dengan sesama siswa yang berkemampuan tinggi pula. Akibatnya beberapa siswa yang merasa kesulitan akan tetap mendapatkan kesulitan karena mereka tidak berkesempatan mendapatkan bantuan baik dari guru maupun teman mereka sendiri. Oleh karena itu diperlukan usaha yang serius dalam membangun pemahaman siswa terhadap materi sifat-sifat bangun datar. Usaha yang dapat dilakukan guru untuk menyelesaikan permasalahan ini adalah dengan menggunakan LKS dan bahan manipulatif dengan metode penemuan terbimbing melalui pemberian bantuan. Penelitian ini penelitian tindakan kelas dan bertujuan mendeskripsikan penerapan metode penemuan terbimbing melalui pemberian bantuan yang dapat meningkatkan pemahaman siswa terhadap materi sifat-sifat bangun datar dan dilaksanakan di SD Negeri Sukun 2 Malang dengan subjek penelitian adalah siswa kelas VA SD Negeri Sukun 2 Malang. Dari hasil penelitian diperoleh bahwa pembelajaran dengan metode penemuan terbimbing melalui pemberian bantuan dapat membangun pemahaman materi sifat-sifat bangun datar siswa kelas VA SD Negeri Sukun 2 Malang dan memiliki beberapa langkah sebagai berikut: (1) scaffolding 1 yang meliputi pengamatan fenomena dunia nyata dan presentasi interaktif; (2) scaffolding 2 yang meliputi aktivitas memproses pembelajaran, pengalaman dunia nyata yang kontekstual, pelatihan menemukan (sendiri, berkelompok) dengan menggunakan LKS, aktivitas dukungan kawan, pelatihan hasil pembelajaran dan aktivitas pemecahan masalah; serta (3) scaffolding 3 yang meliputi aktivitas penguatan, umpan balik dan pelatihan terus menerus. Penelitian ini terdiri dari 2 siklus. Berdasarkan hasil tes belajar 1 pada siklus 1, diperoleh 13 dari 42 siswa masih memperoleh nilai kurang dari 65. Berdasarkan hasil tes belajar 2 pada siklus 2, diperoleh 10 dari 42 siswa yang memperoleh nilai kurang dari 65. Namun, pada tes hasil belajar 3, diperoleh 2 dari 42 siswa memperoleh nilai kurang dari 65, dan 1 siswa memperoleh nilai 69.

Meningkatkan hasil belajar geografi dengan menerapkan model teams games tournament (TGT) pada kompetensi mendeskripsikan pelestarian lingkungan hidup dalam kaitannya dengan pembangunan berkelanjutan siswa kelas XI IPS-3 SMA Negeri 1 Paiton Kabupaten Probolinggo / Susria

 

Kata kunci: Cooperative learning, model Teams Games Tournament (TGT), hasil belajar. Pembelajaran adalah suatu kegiatan dengan maksud agar proses belajar seseorang atau sekelompok orang dapat berlangsung. Untuk proses belajar geografi diperlukan strategi, bermacam pendekatan, metode, media, agar siswa lebih aktif belajar dan berbuat untuk memahami konsep, prinsip-prinsip geografi sehingga diharapkan hasil belajar siswa lebih baik. Berdasarkan observasi awal diketahui bahwa pembelajaran Geografi yang dilakukan di SMA Negeri 1 Paiton memiliki Kriteria Ketuntasan Minimum (KKM) lebih besar atau sama dengan 70. Berdasarkan hasil wawancara dengan guru Geografi dan observasi diketahui bahwa daya serap klasikal mata pelajaran Geografi di kelas XI IPS-3 belum mencapai kriteria ketuntasan minimum (KKM). Dari kriteria ketuntasan minimum (KKM) yang telah ditetapkan, 13 siswa mampu mencapai nilai ketuntasan siswa ≥ 75 dan 23 siswa belum mampu mencapai nilai ketuntasan siswa ≥ 75 pada ulangan harian pertama. Dengan demikian tidak ada siswa XI IPS-3 yang tuntas. Rata-rata nilai yang diperoleh siswa kelas XI IPS-3 adalah 68,72. Penelitian ini bertujuan meningkatkan hasil belajar siswa. Upaya untuk mencapai tujuan tersebut, maka penelitian ini dirancang dengan model penelitian tindakan kelas yang dilaksanakan pada bulan April–Mei 2011. Subjek penelitian yaitu siswa kelas XI IPS-3 yang berjumlah 36 siswa. Penelitian ini dilakukan dalam 2 siklus, teknik pengumpulan data melalui tes. Tindakan yang dilakukan yaitu pembelajaran kooperatif model teams games tournament (TGT). Hasil penelitian menunjukkan bahwa hasil belajar siswa mengalami peningkatan mulai dari pra tindakan ke siklus 1 dan siklus 1 ke siklus 2. Rata-rata hasil belajar siswa pada pra tindakan sebesar 68,72 pada siklus 1 meningkat menjadi 74,88 dan pada siklus 2 meningkat menjadi 81,80. Ketuntasan belajar juga mengalami peningkatan, pada proses pembelajaran pra tindakan sebesar 36%, siklus 1 sebesar 68,57%, dan pada siklus 2 menjadi 91,43%. Berdasarkan hasil tersebut, disarankan: (1) Bagi guru geografi agar menggunakan model teams games tournament untuk meningkatkan hasil belajar siswa. (2) Bagi peneliti selanjutnya diharapkan dapat melakukan penelitian sejenis dalam rangka memperbaiki kualitas pembelajaran kooperatif model temas games tournament dengan subjek penelitian yang berbeda.

Penerapan siklus belajar (learning cycle) pada pembelajaran fisika pokok bahasan listrik statis untuk meningkatkan motivasi dan hasil belajar siswa kelas II C SMPN 17 Malang tahun pelajaran 2004/2005 / oleh Rini Purwatiningsih

 

Pemanfaatan Koperasi Sekolah SMA Negeri di Kota Malang sebagai tempat belajar berkoperasai / Husnul; Khotimah

 

Pengaruh pendidikan karakter dan motivasi belajar terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Bangil pada mata pelajaran ekonomi / Wahyu Anjasmoro

 

ABSTRAK Anjasmoro, Wahyu. 2016. Pengaruh Pendidikan Karakter dan Motivasi Belajar Terhadap Prestasi Belajar Siswa Kelas XI IPS SMA Negeri 1 Bangil Pada Mata Pelajaran Ekonomi. Skripsi, Jurusan Ekonomi Pembangunan, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. Prih Hardinto, M.si, (II) Drs. H. Sapir, S.Sos, M.si. Kata Kunci: pendidikan karakter, motivasi belajar, prestasi belajar Pendidikan saat ini hanya menekankan pada aspek kognitifnya saja, sehingga pada faktanya di lapangan masih banyak ditemui krisis moral yang nyata dan mengkhawatirkan dikalangan pelajar dan motivasi belajar siswa kelas XI IPS SMA Negeri 1 Bangil masih relatif rendah. Hal itu ditunjukkan dari antusias siswa dalam mengikuti kegiatan pembelajaran mata pelajaran ekonomi masih rendah.. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui apakah ada pengaruh pendidikan karakter terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Bangil pada mata pelajaran ekonomi?, apakah ada pengaruh motivasi belajar terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Bangil pada mata pelajaran ekonomi?, apakah ada pengaruh pendidikan karakter dan motivasi belajar terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Bangil pada mata pelajaran ekonomi? Penelitian ini menggunakan pendekatan deskriptif kuantitatif. Data penelitian ini untuk menjelaskan pengaruh pendidikan karakter dan motivasi belajar terhadap prestasi belajar siswa kelas XI IPS SMA Negeri 1 Bangil. Pengumpulan data dilakukan dengan menggunakan Angket dan dokumentasi. Analisis data menggunakan analisis statistik deskriptif dan analisis regresi linier berganda. Populasidalam penelitian ini berjumlah 113 siswa dan sampel sebanyak 88 siswa. Teknik sampling yang digunakan adalah teknik proportional random sampling. Berdasarkan hasil analisis deskriptif, diperoleh hasil penelitian sebagai berikut. Pertama, pada variabel pendidikan karaker terdapat 42 siswa (47,7%) termasuk dalam sangat baik, 44 siswa (50%) termasuk dalam kategori baik, dan 2 siswa (2,3%) termasuk kategori kurang. Kedua, pada variabel motivasi belajar terdapat 34 siswa (38,6%) termasuk kategori sangat baik, 50 siswa (56,8%) termasuk kategori baik, 4 siswa (4,5%) termasuk kategori kurang. Hasil penelitian menunjukkan bahwa pendidikan karakter dan motivasi belajar dalam mata pelajaran ekonomi secara simultan mempunyai pengaruh sebesar (32%) terhadap prestasi belajar ekonomi. Pendidikan karakter berpengaruh sebesar (5,7%) terhadap prestasi belajar ekonomi. Motivasi belajar berpengaruh sebesar (17,9%) terhadap prestasi belajar. Berdasarkan hasil penelitian di atas, dapat diambil kesimpulan bahwa pendidikan karakter dan motivasi belajar berpengaruh terhadap prestasi belajar siswa pada mata pelajaran ekonomi kelas XI IPS SMA Negeri 1 Bangil. Dimana semakin meningkat pendidikan karakter dan motivasi belajar prestasi belajar juga mengalami peningkatan.

Meningkatkan prestasi belajar matematika siswa kelas II semester II Madrasah Aliyah Negeri Pasuruan menggunakan pembelajaran kooperatif model jigsaw / oleh Asri Kanti Wilujeng

 

Pengembangan bahan ajar geografi pada kompetensi dasar memahami atmosfer dan dampaknya terhadap kehidupan di muka bumi kelas X SMA/MA semester II dengan menggunakan pendekatan keruangan / Yulian Widya Saputra

 

Kata kunci: pengembangan, bahan ajar geografi, model Dick dan Carey, pendekatan keruangan Bahan ajar geografi kelas X SMA/MA semester II pada kompetensi dasar memahami atmosfer dan dampaknya terhadap kehidupan di muka bumi di lapangan masih banyak ditemui permasalahan ditinjau dari aspek data/fakta, konsep, kebenaran penyajian gambar, generalisasi, tanda baca, keterbacaan materi, keterhubungan objek formal dan material, dan penggunaan pendekatan keruangan. Oleh karena itu, diperlukan pengembangan bahan ajar sesuai keilmuan geografi dengan desain pengembangan Model Dick and Carey. Mengacu pada temuan dari analisis materi maka diperlukan pengembangan bahan ajar sesuai kaidah keilmuan geografi. Selain itu produk yang disusun nanti menggunakan pendekatan keruangan agar tercipta bahan ajar yang baik dan berkualitas serta ideal. Penelitian ini dirancang dengan menggunakan model pengembangan Dick and Carey. Model ini dimodifikasi dari sepuluh langkah menjadi lima langkah. Beberapa penyerdehanaan model Dick and Carey dilakukan sebab ada tahapan yang tidak sesuai untuk pengembangan bahan ajar, yakni langkahnya sebagai berikut: (1) identifikasi standar kompetensi, kompetensi dasar, dan indikator, (2) analisis materi, (3) penulisan bahan ajar, (4) validasi ahli dan uji coba, dan (5) revisi bahan ajar. Penyerdehanaan metode atau langkah pengembangan model ini disebabkan adanya penyesuaian dengan Model Dick and Carey yang sebelumnya untuk rancangan pendidikan digunakan sebagai pengembangan bahan ajar Bahan ajar ini sebelum uji coba divalidasi oleh dosen yang ahli dibidangya. Validator materi menilai dari segi kesesuaian materi atmosfer dengan pendekatan keruangan. Selain ahli materi penilaian ahli desain pembelajaran geografi juga dilakukan untuk menilai desain produk teks ajar geografi agar lebih bermutu. Pelaksanaan validasi ahli materi atmosfer berlangsung tiga kali tahapan validasi sedangkan ahli desain pembelajaran geografi berlangsung lima kali tahapan validasi. Uji coba teks bahan ajar ini dilakukan di MAN Malang I yang beralamatkan di Jalan Baiduri Bulan No. 40 Kecamatan Lowokwaru Kota Malang. Kelas yang digunakan uji coba adalah X.G yang memiliki siswa sejumlah 36. Namun pada semester satu ada siswa yang meninggal jadi tinggal 35 siswa di kelas X. G. Dasar pemilihan kelas ini adalah kelas yang dipilih bukan kelas unggulan atau kelas yang dikhususkan. Jenis data yang dikumpulkan selama uji coba adalah deskripsi mengenai hasil pengerjaan siswa pada soal tes pemahaman bahan ajar teks atmosfer. Soal tes pemahaman model IRI (Informal Reading Inventory) selanjutnya dipersentase dan dicocokkan dengan kunci jawaban. Tes pemahaman siswa model IRI ini dilakukan tiga kali pertemuan pembelajaran. Berdasarkan hasil pengerjaan tes pemahaman model IRI dapat dideskripsikan bahwa hasil tes pemahaman model IRI pertama hasil keseluruhan sebesar 84,5%, hasil tes pemahaman model IRI kedua hasil keseluruhan sebesar 85,3%, dan hasil tes pemahaman model IRI ketiga hasil keseluruhan sebesar 91,6%. Hasil tes pemahaman model IRI yang diperoleh ini disebabkan siswa mampu memahami isi bacaan atau teks bahan ajar atmosfer. Oleh karena teks bahan ajar yang dikembangkan dapat dikatakan membantu proses pembelajaran di kelas. Teks bahan ajar atmosfer ini boleh dikatakan ’’sangat layak” digunakan dalam pembelajaran geografi khususnya pada kompetensi dasar memahami atmosfer dan dampaknya terhadap kehidupan. Pelaksanaan diseminasi dalam bentuk seminar, penyebarluasan dalam wadah lokal seperti MGMP Geografi, dan pemuatan bahan ajar dalam bentuk e-book merupakan suatu upaya pengembangan secara luas ke berbagai pihak. Penyebarluasan bertujuan untuk memperoleh tanggapan meluas dari masyarakat luas khususnya pengguna bahan ajar dan pemerintah sebagai penentu kebijakan khusus tentang kurikulum. Saran dalam pengembangan lebih lanjut perlu dilakukan usaha sebagai berikut: (1) untuk menghasilkan buku teks yang utuh sebaiknya dikembangkan pada semua kompetensi dasar selama dua semester, (2) uji coba produk hendaknya dilakukan pada beberapa sekolah untuk mendapatkan data dan masukan untuk memperkaya produk agar berkualitas, (3) untuk memperoleh hasil yang lebih berkualitas pada pengembangan buku ini sebaiknya dilakukan penelitian eksperimen untuk menguji pengaruh produk pada prestasi belajar siswa, dan (4) untuk menghasilkan pengembangan secara lebih berkualitas dan komprehensif dibutuhkan waktu penelitian dan pengembangan yang relatif lama (multiply years).

Pendugaan sigma pada sistem pengendali individual untuk data pencilan melalui AMR dan MMR : studi kasus pada data BRIX (BX) FST di PT. Coca-Cola Bottling Indonesia Jawa Timur / oleh Umma Ilma Muadhom

 

Pengaruh strategi pembelajaran kooperatif STAD, TGT, dan integrasi STAD+TGT terhadap keterampilan metakognisi, berpikir kritis, dan hasil belajar kognitif IPA-Biologi SD kelas V di Kota Ternate / Said Hasan

 

Kata kunci: STAD, TGT, STAD+TGT, keterampilan metakognisi, keterampilan berpikir kritis, hasil belajar kognitif Keterampilan berpikir, khususnya berpikir tingkat tinggi (termasuk keterampilan metakognisi dan berpikir kritis), memegang peranan penting terhadap keberhasilan proses pembelajaran. Peserta didik yang memiliki keterampilan metakognisi dan berpikir kritis diyakini dapat menjadi pebelajar mandiri (self-regulated learner), yaitu pebelajar yang bertanggung jawab terhadap kemajuan belajarnya sendiri dan mengadaptasi strategi belajarnya untuk mencapai tuntutan tugas. Keterampilan berpikir tinggi yang dimiliki peserta didik dapat dibentuk melalui proses pemberdayaan yang dilakukan secara sengaja, salah satunya yaitu dengan menerapkan strategi pembelajaran kooperatif. Berdasarkan hasil survai yang dilakukan pada beberapa kepala sekolah dan guru SD di Kota Ternate, diketahui bahwa: 1) proses pembelajaran masih didominasi dengan penerapan strategi pembelajaran konvensional, 2) sebagian besar guru belum pernah mendengar dan bahkan menerapkan strategi pembelajaran kooperatif; 3) rata-rata capaian hasil belajar kognitif siswa masih rendah. Berdasarkan hasil survai, diyakini bahwa proses pembelajaran di SD Kota Ternate belum secara sengaja ditujukan untuk memberdayakan keterampilan berpikir tinggi siswa. Terkait pentingnya keterampilan berpikir tingkat tinggi dalam proses pembelajaran, dan bertolak dari fakta-fakta proses pembelajaran di SD Kota Ternate; maka penerapan strategi pembelajaran kooperatif perlu segera dilakukan. Tujuan penelitian secara rinci adalah untuk mengetahui pengaruh strategi pembelajaran STAD, TGT, dan STAD + TGT terhadap (1) keterampilan metakognisi, (2) berpikir kritis, dan (3) hasil belajar kognitif siswa SD kelas V di Kota Ternate, (4) korelasi antara keterampilan metakognisi dan berpikir kritis, (5) korelasi antara keterampilan metakognisi dan berpikir kritis terhadap hasil belajar kognitif. Penelitian dilakukan pada semester ganjil tahun ajaran 2011/2012 (1 semester) pada tingkat SD di Kota Ternate, yaitu di SDN Sulamadaha, SDN Tabam, MIS Kulaba, dan SD Inpres Tarau. Penelitian ini tergolong quasi experiment. Variabel bebas pada penelitian ini adalah strategi pembelajaran yang terdiri dari tiga level, yaitu STAD, TGT, dan STAD + TGT; jadi penelitian eksperimen ini tergolong non-faktorial yang terdiri dari tiga level. Penerapan ketiga strategi pembelajaran tersebut pada empat sekolah yang telah ditetapkan adalah sebagai berikut: SDN Sulamadaha: konvensional, SDN Tabam: STAD+TGT, MIS Kulaba: TGT, dan SD Inpres Tarau: STAD. Variabel tergantung meliputi keterampilan metakognisi, keterampilan berpikir kritis, dan hasil belajar kognitif. Keterampilan metakognisi diukur dengan menggunakan rubrik metakognisi yang mengacu kepada Corebima (2009); sementara keterampilan berpikir kritis dan hasil belajar kognitif diukur dengan menggunakan rubrik terkait yang mengacu kepada Hart (1994). Penelitian eksperimen dilakukan melalui tiga tahapan utama, yaitu survai, pengembangan perangkat pembelajaran, dan pelaksanaan penelitian eksperimen. Analisis data terkait pengaruh strategi pembelajaran kooperatif terhadap keterampilan metakognisi, berpikir kritis, dan hasil belajar kognitif dilakukan melalui anacova; korelasi antara keterampilan metakognisi dan berpikir kritis dianalisis melalui analisis regresi sederhana; sementara analisis untuk mengetahui sumbangan efektif keterampilan metakognisi dan keterampilan berpikir kritis terhadap hasil belajar kognitif dianalisis melalui analisis regresi ganda. Keseluruhan analisis data dilakukan melalui program SPSS 16.0. Atas dasar hasil analisis data, diperoleh hasil-hasil sebagai berikut: ada pengaruh strategi pembelajaran terhadap (1) keterampilan metakognisi, (2) berpikir kritis, dan (3) hasil belajar kognitif. Strategi pembelajaran STAD + TGT menunjukkan potensi tertinggi dalam memberdayakan ketiga parameter yang diukur. Strategi STAD dan TGT menunjukkan potensi yang tidak berbeda nyata dalam memberdayakan ketiga parameter yang diukur; sementara itu strategi pembelajaran konvensional menunjukkan potensi terendah dalam memberda-yakan ketiga parameter yang diukur, (4) keterampilan metakognisi dan berpikir kritis memiliki korelasi positif, (5) keterampilan metakognisi dan berpikir kritis berpengaruh terhadap capaian hasil belajar kognitif. Kesimpulan yang diperoleh dari hasil penelitian ini yaitu ada pengaruh penerapan strategi pembelajaran kooperatif STAD, TGT, dan STAD + TGT terhadap (1) keterampilan metakognisi, (2) berpikir kritis, dan (3) hasil belajar kognitif; (4) terdapat korelasi positif antara keterampilan metakognisi dan berpikir kritis; dan (5) terdapat korelasi positif antara keterampilan metakognisi dan keterampilan berpikir kritis terhadap hasil belajar kognitif. Beberapa saran yang direkomendasikan yaitu (1) guru hendaknya meninggalkan pembelajaran konvensional, dan mulai menerapkan strategi pembelajaran kooperatif; (2) guru hendaknya lebih banyak menerapkan strategi STAD dan TGT dalam proses pembelajaran, sekalipun tidak tertutup peluang bagi para guru untuk menerapkan strategi pembelajaran kooperatif lainnya; (3) perlu dilakukan penelitian lebih lanjut untuk menemukan strategi yang dapat memberdayakan keterampilan metakognisi siswa pada tingkat SD secara optimal; (4) perlu dilakukan penelitian untuk mengungkap faktor-faktor non-akademik yang dapat mempengaruhi capaian hasil belajar siswa. Hal tersebut penting untuk dilakukan, karena dengan mengetahui faktor akademik maupun non-akademik yang mempengaruhi capaian hasil belajar, maka diharapkan upaya pencapaian keberhasilan pendidikan akan lebih mudah dilakukan; (5) peneliti hendaknya melakukan pelatihan yang optimal guna mempersiapkan guru mitra pelaksana penelitian, khususnya guru yang masih awam tentang perlakuan yang akan diterapkan. Kesiapan guru mitra sangat perlu diperhatikan karena diyakini bahwa hal tersebut berpengaruh terhadap parameter-parameter yang diukur dalam penelitian.

Perbandingan indeks kemampuan proses pada distribusi non formal antara pendekatan dengan distribusi Weilbull dan transformasi Box-Cox : studi kasus pada data Brix (BX) produk Fanta Strawberry (FST) di PT. Coca-Cola Bottling Indonesia, Jawa Timur / oleh Pu

 

Pelakasanaan model sistem guru kunjung di daerah terpencil kawasan daratan (Studi multisitus di Kecamatan Tanah Siang, Kecamatan Sumber Barito, dan Kecamatan Permata Intan Kabupate3n Murung Raya Provinsi Kalimantan Tengah) / Reddy Siram

 

Kata kunci: guru kunjung, sekolah terpencil, wajib belajar. Penelitian ini bertujuan untuk mendeskripsikan: (1) proses perencanaan model sistem guru kunjung, (2) proses sosialisaisi model sistem guru kunjung , (3) proses pelaksanaan model sistem guru kunjung, dan (4) peran stakeholders dalam pelaksanaan model sistem guru kunjung.Temuan penelitian pada tiga SD Kunjung menunjukkan bahwa: (1) kegiatan dalam perencanaan pendirian SD Kunjung sesuai dengan persyaratan terpencil, terisolir, terpencar dan hambatan geografis sosial-ekonomi berdasarkan kebutuhan masyarakat dalam perencanaan melibatkan berbagai pihak. (2) sosialisasi dilakukan oleh masyarakat, perusahaan, perangkat desa, kepala SD Induk-Basis, guru dan komite di acara adat dayak, memotivasi masyarakat dalam pendidikan untuk penguatan kualitas hidup dan kebutuhan masyarakat. (3) pelaksanaan SD kunjung dikepalai oleh seorang Kepala SD Induk berasal dari SD terdekat, pelaksanaan tugas dibantu oleh guru, tutor dan tenaga terampil, penggunaan kios belajar atau bangsal, guru kunjung sebagai motivator dalam pendidikan, perlibatan guru kunjung dan karyawan perusahaan untuk meningkatkan pemahaman terhadap tugas dan penghargaan diri, pelaksanaan SD Kunjung dengan pemerintah desa, perusahaan, tokoh adat dan masyarakat melaksanakan pembangunan kios belajar atau bangsal melibatkan berbagai pihak, dan (4) peranan stakeholders dalam pengelolaan dan penyelenggaraan pendidikan terpencil sesuai dengan kewenangan dan kemampuan masing-masing.

Pengaruh penggunaan lembar kerja siswa terhadap prestasi belajar kelas II SMU 2 Blitar pada konsep susunan tata surya dan bola langit tahun pelajaran 1996/1997 / oleh Sri Wahyuni

 

Implementasi grafik pengendali I-IMR pada data non normal menggunakan transformasi Box-Cox: studi kasus pada data Brix (BX) produk Fanta Strawberry (FST) di PT. Coca-Cola Bottling Indonesia, Jawa Timur / oleh Leny Isnalita Agustin

 

Pengaruh pembelajaran inkuiri terbimbing berbasis laboratorium terhadap prestasi belajar fisika ditinjau dari kinerja laboratorium siswa kelas X SMAN 1 Malang / Zakariah

 

Kata Kunci: inkuiri terbimbing, kinerja laboratorium, prestasi belajar Telah diketahui bahwa pembelajaran inkuiri terbimbing berbasis laboratorium pada pembelajaran fisika mampu memberikan dampak yang sangat baik terhadap prestasi belajar fisika. Oleh karena itu, melalui pembelajaran inkuiri terbimbing yang berpusat pada kegiatan laboratorium, siswa lebih mudah memahami dan mengingat konsep-konsep fisika yang telah dipelajari, serta siswa ikut terlibat aktif dalam penemuan konsep tentang permasalahan yang dihadapi. Pembelajaran konvensional belum mampu memberikan pemahaman fisika siswa yang cukup. Hal ini disebabkan konsep-konsep yang diperoleh tidak melalui observasi dan praktikum yang dilakukan secara langsung. Penelitian ini bertujuan untuk: (1) mengetahui perbedaan prestasi belajar fisika antara siswa yang belajar secara inkuiri terbimbing berbasis laboratorium dan siswa yang belajar secara konvensional, (2) mengetahui interaksi antara kinerja laboratorium dan strategi pembelajaran terhadap prestasi belajar fisika siswa, (3) mengetahui perbedaan prestasi belajar fisika siswa yang memiliki kinerja laboratorium kategori tinggi yang belajar dengan inkuiri terbimbing berbasis laboratorium dan siswa yang belajar secara konvensional, dan (4) mengetahui perbedaan prestasi belajar fisika siswa yang memiliki kinerja laboratorium kategori rendah yang belajar dengan inkuiri terbimbing berbasis laboratorium dan siswa yang belajar secara konvensional. Rancangan penelitian yang digunakan adalah faktorial 2x2 dengan sampel purposive sampling. Populasi penelitian ini adalah siswa kelas X SMA Negeri 1 Malang semester 2 tahun pelajaran 2011/2012. Instrumen yang digunakan dalam penelitian adalah perlakuan: rencana pelaksanaan pembelajaran dan lembar kerja siswa, dan pengukuran: rubrik penilaian kinerja laboratorium dan naskah soal. Teknik pengumpulan data adalah pengamatan dan tes. Teknik analisis data yang digunakan adalah analisis variansi dua jalan dan uji Tukey. Hasil penelitian ini menunjukkan bahwa: (1) prestasi belajar fisika siswa yang belajar dengan inkuiri terbimbing berbasis laboratorium lebih tinggi daripada siswa yang belajar secara konvensional, (2) ada interaksi antara kinerja laboratorium dan strategi pembelajaran terhadap prestasi belajar fisika siswa, (3) prestasi belajar fisika siswa yang memiliki kinerja laboratorium kategori tinggi yang belajar dengan inkuiri terbimbing berbasis laboratorium lebih tinggi daripada siswa yang belajar secara konvensional, dan (4) prestasi belajar fisika siswa yang memiliki kinerja laboratorium kategori rendah yang belajar dengan inkuiri terbimbing berbasis laboratorium lebih tinggi daripada siswa yang belajar secara konvensional.

Implementasi pembelajaran kooperatif metode problem solving untuk meningkatkan hasil belajar (Studi pada siswa penjualan kelas X SMK Muhammadiyah pada mata diklat kewirausahaan tahun ajaran 2009/2010) / Retno Wahyuning Tyastutik

 

Kata kunci: Pembelajaran kooperatif metode problem solving, hasil belajar Guru memiliki peranan yang besar dalam upaya meningkatkan hasil belajar peserta didik di sekolah. Berangkat dari fakta yang diperoleh peneliti selama observasi di SMK Muhammadiyah 2 Malang khususnya pada mata diklat kewirausahaan siswa kelas X masih disampaikan dengan metode ceramah. Dari sini peneliti mencoba menggunakan metode problem solving untuk mengetahui apakah hasil belajar siswa akan meningkat dengan dikembangkannya metode ini dalam proses pembelajaran khususnya pada mata diklat kewirausahaan. Tujuan penelitian ini adalah untuk mengetahui apakah hasil belajar siswa akan meningkat setelah diterapkan metode problem solving. Jenis penelitian ini adalah penelitian tindakan kelas yang dilaksanakan dalam dua siklus, dimana setiap siklus terdiri dari empat tahapan yaitu: (1) perencanaan; (2) tindakan; (3) pengamatan; dan (4) refleksi. Subyek penelitian ini adalah siswa kelas X Penjualan SMK Muhammadiyah 2 Malang pada semester genap tahun ajaran 2009/ 2010, yang berjumlah 28 orang siswa. Instrumen yang digunakan dalam penelitian ini adalah lembar observasi, tes, pedoman wawancara, catatan lapangan lembar penilaian ranah psikomotorik, lembar penilaian ranah afektif dan dokumentasi. Hasil penelitian yang dilakukan diperoleh adanya hasil belajar siswa dimana rata-rata hasil belajar siswa pada siklus I adalah 79,82 dan pada siklus II rata-rata hasil belajar siswa adalah 77,5. Ketuntasan klasikal ranah Psikomotorik mengalami peningkatan. Pada siklus I sebesar 42,85% dan siklus II 89,28%. Pada aspek afektif dapat dilaksanakan dengan baik. Pada siklus I dan siklus II dengan ketuntasan 100% Berdasarkan hasil penelitian ini dapat disimpulkan bahwa pengembangan metode problem solving dalam proses kegiatan belajar mengajar dapat meningkatkan hasil belajar siswa kelas X Penjualan SMK Muhammadiyah 2 Malang. Keberhasilan penelitian meningkat seiring dengan diterapkannya probelm solving sebagai alternatif pembelajaran dalam rangka meningkatkan hasil belajar siswa. Tetapi masih ada beberapa yang perlu dibenahi lagi yaitu alokasi waktu yang harus diperhatikan dalam setiap tahapan dalam problem solving dan adanya tindak lanjut dari peneliti berikutnya diharapkan usahanya untuk mengembangkan metode problem solving dalam mata diklat yang berbeda.

Iktisaba tholibati al madrasah ats tsanawiyyah ad diniyyah al hukumiyyah Malang lil 'anashir an nahwiyyah wash shorofiyyah fi al muhadatsah / biqolam Mohammad Alfan

 

Penerapan strategi pembelajaran kontekstual REACT untuk meningkatkan hasil belajar geografi siswa kelas VII-B di SMP Mualimin Kabupaten Blitar / Siti Masfiah

 

Kata Kunci: strategi pembelajaran kontekstual REACT, hasil belajar geografi Proses perbaikan mutu pendidikan yang dilakukan di sekolah masih banyak mengalami hambatan, salah satunya indikasinya pada hasil belajar siswa yang masih rendah. Hasil observasi yang telah dilakukan di kelas VII-B SMP Mualimin didapatkan nilai rata-rata hasil belajar siswa 37,63. Hanya satu siswa (5,26%) yang dapat mencapai tujuan pembelajaran yang telah ditetapkan oleh guru dan selebihnya (94,74%) mendapat nilai dibawah KKM. Rendahnya hasil belajar ini dipengaruhi oleh strategi belajar pembelajaran yang dipakai guru kurang tepat dengan materi yang diajarkannya, guru banyak mengalami kesulitan memahami materi geografi karena guru bukan lulusan pendidikan geografi, sehingga tidak tahu mana materi yang benar dalam ilmu geografi karena penjelasan dalam buku teks berbeda-beda. Selain itu, cara mengajar guru yang sama persis dengan buku yang dimiliki siswa membuat siswa beranggapan pelajaran geografi adalah pelajaran hafalan, guru menggunakan metode ceramah, mencatat, tanyajawab dan penugasan dikarenakan terbatasnya sumber belajar dan media yang ada disekolah. Metode-metode yang digunakan tersebut kurang mengajak siswa berfikir kritis, sehingga pemahaman materi yang dimiliki siswa kurang dan berdampak pada hasil belajar yang rendah. Berkaitan dengan hal tersebut, alternatif yang dapat digunakan untuk mengatasi masalah hasil belajar yang rendah adalah dengan menerapkan strategi pembelajaran kontekstual REACT. Penelitian ini menggunakan pendekatan Penelitian Tindakan Kelas (PTK) yang bertujuan untuk memecahkan masalah di kelas dan untuk meningkatkan hasil belajar siswa. Subyek penelitian ini adalah siswa kelas VII-B dengan jumlah siswa 19 orang, pada semester genap tahun ajaran 20011/2012 di SMP Mualimin Kabupaten Blitar. Penelitian ini dilaksanakan dalam dua siklus, setiap siklus terdiri dari dua kali pertemuan, pertemuan pertama untuk tindakan pembelajaran dan pertemuan kedua dilakukan untuk tes hasil belajar siswa. Pengumpulan data dilakukan dengan menggunakan lembar catatan lapangan dan observasi saat pelaksanaan tindakan, serta tes tulis di setiap akhir siklus. Analisis data diperoleh dari pengurangan skor nilai rata-rata hasil belajar siklus I dan siklus II, kemudian di buat persentase peningkatan hasil belajar dalam bentuk tabel dan grafik. Hasil penelitian menunjukkan bahwa penerapan strategi pembelajaran kontekstual REACT dapat meningkatkan hasil belajar geografi siswa pada materi gejala-gejala yang ada di atmosfer dan hidrosfer serta dampaknya terhadap kehidupan di kelas VII-B SMP Mualimin. Strategi REACT terdiri dari kegiatan Relating (mengaitkan materi pembelajaran dengan pengalaman yang tidak asing lagi dalam kehidupan sehari-hari siswa), Experiencing (mengalami: menggali, menemukan dan menciptakan konsep secara mandiri melalui pengalaman pembelajaran secara langsung), Applying (menerapkan materi ke konteks yang bermanfaat bagi kehidupan), Cooperating (bekerja sama untuk berfikir dan bertukar pendapat dalam pemecahan masalah) dan Transfering (memindahkan dan meratakan pengetahuan dari siswa satu ke siswa lain). Perolehan pengetahuan yang dimiliki siswa dalam menerapkan strategi REACT membutikan bahwa adanya peningkatan skor hasil belajar dari tindakan ke siklus I meningkat 64,34%, dan dari siklus I ke siklus II sebesar 27,23%.

Penggunaan media al-khwarizmi untuk meningkatkan pemahaman siswa pada materi persamaan kuadrat melalui model pembelajaran kooperatif Numbered Keads Together (NHT) kelas VIII SMP Negeri 1 Singosari / Elita Mega Selvia Wijaya

 

ABSTRAK Wijaya, Elita Mega Selvia. 2015. Penggunaan Media Al-Khwarizmi untuk Meningkatkan Pemahaman Siswa pada Materi Persamaan Kuadrat Melalui Model Pembelajaran Kooperaif Tipe Numbered Heads Together (NHT) Kelas VIII SMP Negeri 1 Singosari. Tesis. Program Studi Pendidikan Matematika, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Drs. Gatot Muhsetyo, M.Sc, dan (II) Dr. Swasono Rahardjo, S.Pd, M.Si. Kata Kunci : Media Al-Khwarizmi, pemahaman, model pembelajaran kooperatif tipe Numbered Heads Together (NHT). Penelitian ini bertujuan untuk mendeskripsikan langkah-langkah menggunakan media Al-Khwarizmi di kelas VIII SMP Negeri 1 Singosari dengan model pembelajaran kooperatif Numbered Heads Together (NHT) yang dapat meningkatkan pemahaman siswa pada materi persamaan kuadrat. Jenis penelitian ini adalah penelitian tindakan kelas (PTK). Penelitian ini terdiri dari dua siklus dan setiap siklus terdiri dari empat tindakan. Subjek penelitian ini adalah seluruh siswa kelas VIII-F SMP Negeri 1 Singosari yang mengikuti kegiatan pembelajaran. Subjek dipilih berdasarkan wawancara dengan guru kelas VIII pada tanggal 5 april 2014 di SMP Negeri 1 Singosari, hasil belajar materi persamaan kuadrat masih di bawah standar ketuntasan minimal sekolah yaitu 80. Hal ini ditunjukkan dari hasil obervasi yaitu dari 32 siswa hanya 12 siswa yang dapat menjawab soal dengan benar. Sehingga, dapat disimpulkan bahwa siswa tidak memahami konsep, karena tidak dapat membedakan persamaan kuadat dan bukan persamaan kuadrat serta tidak dapat menentukan a, b, dan c jika diketahui bentuk umum ax2 + bx + c = 0. Data yang dikumpulkan antara lain berasal dari: a) hasil pekerjaan siswa secara tertulis, b) hasil wawancara, c) hasil observasi, dan d) hasil catatan lapangan. Peningkatan pemahaman siswa ditunjukkan dari kesalahan yang dilakukan siswa. Pada siklus I siswa masih melakukan kesalahan konsep dan prosedural yang berdampak pada hasil belajar siswa yaitu terdapat 24 siswa dari 32 siswa (75%) yang memenuhi SKM dan pada siklus II mayoritas siswa sudah tidak melakukan kesalahan konsep dan prosedural yang berdampak pada hasil belajar siswa yaitu terdapat 27 siswa dari 32 siswa (84,4%) yang memenuhi SKM. Dengan demikian, pemahaman siswa mengalami peningkatan yaitu dari kategori cukup ke kategori baik. Selain itu, hasil observasi aktivitas guru pada siklus I dan siklus II adalah 3,51 dan 3,79 yang termasuk kategori baik dan hasil observasi aktivitas siswa adalah 3,49 dan 3,75 berada pada kategori baik. Saran yang dapat dikemukakan untuk pembelajaran berikutnya antara lain: a) media Al-Khwarizmi bentuk umum persamaan kuadrat ax2 + bx + c = 0 dibatasi hanya untuk a, b, c dan x bilangan rasional, sehingga sebagai masukan untuk pembelajaran berikutnya sebaiknya media Al-Khwarizmi yang digunakan untuk a, b, c dan x bilangan real, dan sebaiknya menggunakan bahan yang lebih tebal, tahan lama, serta mempunyai ukuran yang sesuai sehingga tidak kesulitan dan tepat dalam menyusunnya, b) pembelajaran persamaan kuadrat dengan menggunakan media Al-Khwarizmi berupa potongan kertas bufalo membutuhkan waktu yang cukup lama, sehingga sebagai masukan untuk pembelajaran berikutnya sebaiknya guru dapat mengatur waktu dengan baik, dan c) pada saat siswa melakukan diskusi kelompok, guru dapat menyusun tempat duduk di kelas dengan bentuk yang bervariasi, misalnya bangku disusun membentuk lingkaran kecil. Hal ini dilakukan untuk memudahkan proses diskusi siswa dan memudahkan guru untuk melakukan bimbingan.

A Study of Charles Dickens's journalism and fiction with a special reference to sketches by boz and aliver twist / by Gaston Soehadi

 

Efektivitas iklan televisi terhadap ekuitas merek ice cream Wall's Magnum (Stdu kasus pada mahasiswi angkatan 2011/2012 Jurusan Manajeman FE UM) / Tantri Wulanputih

 

Kata Kunci: Iklan Televisi, Isi Pesan, Struktur Pesan, Format Pesan, Sumber Pesan, Ekuitas Merek. Komunikasi pemasaran menggunakan iklan dengan media televisi masih dianggap sebagai cara paling efektif untuk mempresentasikan unsur-unsur bauran pemasaran karena pola masyarakatnya dapat dikatakan brand minded, dimana merek yang pernah muncul di iklan televisi lebih direspon positif daripada yang tidak diiklankan di televisi. Oleh karena itu, perusahaan harus memiliki cara kreatif dalam beriklan agar dapat menarik perhatian konsumen dan menciptakan preferensi nilai terhadap merek. Nilai terhadap merek dapat timbul dari citra merek maupun kesadaran merek. Penelitian ini termasuk dalam jenis penelitian asosiatif yang bertujuan untuk mengetahui: (1) deskripsi persepsi iklan televisi (isi pesan, struktur pesan, format pesan, dan sumber pesan) terhadap ekuitas merek ice cream Wall`s Magnum pada mahasiswi angkatan 2011/2012 Jurusan Manajemen FE UM, (2) efektivitas iklan televisi (isi pesan, struktur pesan, format pesan, dan sumber pesan) terhadap pembentukan ekuitas merek ice cream Wall`s Magnum pada mahasiswi angkatan 2011/2012 Jurusan Manajemen FE UM. Populasi pada penelitian ini adalah mahasiswi angkatan 2011/2012 Jurusan Manajemen FE UM yang pernah menonton tayangan iklan ini, yaitu sebanyak 195 mahasiswi. Sampel dalam penelitian ini sebanyak 100 responden. Penentuan sampel menggunakan teknik multy stage sampling yang terdiri atas cluster sampling, proportional sampling, dan random sampling untuk menyebarkan kuisioner yang dilaksanakan pada bulan Februari-Maret 2012. Kuisioner dalam penelitian ini termasuk dalam kuisioner tertutup menggunakan skala Likert (Sangat Setuju, Setuju, Cukup Setuju, Tidak Setuju, dan Sangat Tidak Setuju). Analisis data menggunakan regresi linier berganda. Hasil analisis deskriptif menunjukkan bahwa: (1) responden yang menyatakan cukup setuju terhadap pengaruh isi pesan menduduki peringkat tertinggi yaitu sebanyak 43% responden, (2) responden yang menyatakan setuju terhadap pengaruh struktur pesan menduduki peringkat tertinggi yaitu sebanyak 36% responden, (3) responden yang menyatakan cukup setuju terhadap pengaruh format pesan menduduki peringkat tertinggi yaitu sebanyak 47% responden, (3) responden yang menyatakan cukup setuju terhadap pengaruh sumber pesan menduduki peringkat tertinggi yaitu sebanyak 43% responden. Hasil analisis inferensial menunjukkan bahwa: (1) terdapat pengaruh positif yang signifikan antara isi pesan, struktur pesan, dan format pesan secara parsial terhadap ekuitas merek pada ice cream Wall`s Magnum, sedangkan sumber pesan tidak berpengaruh, (2) terdapat pengaruh positif yang signifikan iklan televisi secara simultan terhadap ekuitas merek pada ice cream Wall`s Magnum,, (3) Sub variabel format pesan memiliki nilai Sumbangan Efektif (SE) paling besar yaitu 28,5%. Iklan televisi mempengaruhi ekuitas merek sebesar 52,2% sedangkan sisanya dipengaruhi oleh faktor-faktor lain di luar penelitian. Kesimpulan dari penelitian ini adalah: (1) Isi pesan, struktur pesan, format pesan, dan sumber pesan pada iklan televisi ice cream Wall`s Magnum telah berhasil menciptakan ekuitas merek yang baik, (2) iklan televisi yang terdiri dari isi pesan, struktur pesan, format pesan, dan sumber pesan secara simultan efektif pengaruhnya dalam pembentukan ekuitas merek ice cream Wall`s Magnum dan konsumen mempunyai persepsi yang baik mengenai ekuitas merek Wall`s Magnum tersebut, (3) isi pesan, struktur pesan, maupun format pesan yang dirancang sedemikian rupa oleh produsen dalam iklan televisi Wall`s Magnum efektif pengaruhnya dalam pembentukan ekuitas merek Wall`s Magnum. Sedangkan sumber pesan yang membawakan iklan tersebut justru tidak efektif pengaruhnya dalam pembentukan ekuitas merek produk tersebut, (4) jika dibandingkan dengan isi pesan, struktur pesan, dan sumber pesan, variabel format pesan memiliki pengaruh paling dominan terhadap ekuitas merek Wall`s Magnum pada mahasiswa jurusan Manajemen FE UM. Saran yang dapat ditujukan pada produsen ice cream Wall`s Magnum berdasarkan dari hasil dari penelitian ini, yaitu: (1) Iklan televisi dalam penyajiannya perlu dipertimbangkan untuk merancang iklan versi Indonesia dengan membawa brand ambassador-nya yaitu Marissa Nasution. Dengan begitu calon konsumen akan lebih tertarik dengan penayangan iklan televisi sehingga komunikasi pemasaran dapat tersampaikan dengan baik. (2) Perlu diperhatikan dalam keefektivan iklan yang dirancang karena selain menarik, konsumen akan lebih memperhatikan suatu iklan yang singkat, padat, serta jelas isi dan maksudnya dibandingkan dengan iklan yang terlalu panjang. Sehingga konsep iklan baik dari isi pesan, struktur pesan, maupun format pesan harus dirancang seefektif mungkin agar komunikasi pemasaran dapat tersampaikan dengan baik pula. (3) Untuk pembentukan ekuitas merek yang lebih baik, produsen perlu memperhatikan faktor lain selain iklan televisi word of mouth. Karena issu tentang kandungan lemak babi yang menjadi perbincangan sempat menurunkan brand image Wall`s Magnum. (4) Selain melalui periklanan, mempublikasikan merek kepada khalayak melalui acara-acara sponsorship juga perlu diperhatikan agar memberikan dedikasi terhadap pembentukan ekuitas merek dan lebih mendekatkan diri pada calon konsumen.

Kelas sosial, pandangan hidup, dan sikap hidup masyarakat Jawa dalam kumpulan cerpen Bulan Bugil Bulat karya Yanusa Nugroho / oleh Musthofa Kamal

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 |