Persepsi siswa SMA Negeri 2 Malang tentang penataan ruang bimbingan dan konseling / oleh Nur Aini

 

Pengembangan Instrumen tes pilihan ganda bermakna sebagai pengidentifikasi miskonsepsi siswa SMA pokok bahasan optik geometri

 

Kata Kunci : butir tes pilihan ganda bermakna, miskonsepsi, optik geometri Salah satu penyebab kesulitan belajar yang dialami siswa adalah salah konsepsi atau miskonsepsi. Kondisi ini disebabkan karena proses pembelajaran yang kurang memperhatikan prakonsepsi siswa. Selain itu, belum tersedianya alat tes yang digunakan untuk mengidentifikasi miskonsepsi siswa. Padahal, miskonsepsi yang terjadi pada siswa sulit dihilangkan dan cenderung bersifat permanen. Berdasarkan permasalahan tersebut, dikembangkan butir soal pilihan ganda bermakna. Tujuan dilaksanakan penelitian ini adalah mengembangkan alat identifikasi miskonsepsi materi optik geometri yang efektif dan efisien. Selain itu, bertujuan untuk mendeskripsikan karakteristik produk yang dihasilkan dan mengetahui kelayakan produk yang dikembangkan. Model penelitian yang digunakan adalah penelitian dan pengembangan Borg dan Gall meliputi tahap pendahuluan, tahap perencanaan, tahap pengembangan produk awal, tahap uji lapangan awal dan tahap revisi produk akhir. Sedangkan teknik analisis data yaitu analisis validasi isi, analisis program AAFF (Analisis Assessmen Formatif Fisika) dan analisis program anates versi 4.0. Jenis data penelitian meliputi data kuantitatif berupa penilaian validator berdasarkan skala Likert dan data kualitatif berupa tanggapan dan saran yang diberikan oleh validator. Pengumpulan data menggunakan angket yang disertai rubrik penilaian, soal uraian dan soal pilihan ganda bermakna sebagai produk yang dikembangkan. Hasil analisis data menunjukkan bahwa produk yang dihasilkan sudah memenuhi kriteria layak, namun perlu melakukan revisi dari segi bahasa. Proses identifikasi berdasarkan kekonsistenan jawaban siswa. Soal pilihan ganda bermakna mempunyai empat alternatif deskripsi jawaban yang berbeda. Deskripsi jawaban pilihan ganda bermakna berasal dari pemikiran siswa yaitu jawaban siswa pada soal uraian yang telah diujikan sebelumnya. Penyusunan deskripsi jawaban berdasarkan persentase tertinggi konsepsi siswa yang salah dari soal uraian dan kesesuaian konsepsi siswa dengan pertanyaan pada soal pilihan ganda bermakna. Produk ini mampu mengidentifikasi siswa yang mengalami miskonsepsi dengan siswa yang tidak mengalami miskonsepsi. Selain itu, produk ini mampu mengelompokkan siswa berdasarkan bentuk miskonsepsi yang dialami.

Uji pembedaan sifat fisik dan organoleptik tortilla sorgum dengan tortilla jagung / oleh Fella Septa Wanda

 

Pengembangan instrumen asesmen autentik menulis teks cerpen dan teks fabel untuk siswa SMP/ MTs yang mengimplementasikan kurikulum 2013 / Kukuh Fadliyatis S.

 

ABSTRAK Shollikhah, KukuhFadliyatis. 2016. Pengembangan Instrumen Asesmen Autentik Menulis Teks Cerpen dan Teks Fabel untuk Siswa SMP/MTs yang Mengimplementasikan Kurikulum 2013.Tesis, Progam Studi Pendidikan Bahasa Indonesia, Pascasarjana UniversitasNegeri Malang. Pembimbing: (I) Dr. Titik Harsiati,(II) Dr. Muakibatul Hasanah, M.Pd Kata Kunci: instrumen asesmen autentik, teks cerpen, teks fabel Penelitian pengembangan ini dilatarbelakangi oleh asesmen kompetensi menulis teks cerpen dan teks fabel di jenjang SMP/MTs memiliki kekurangan. Kekurangan tersebut terdiri atas empat hal, yakni (1) instrumen asesmen yang digunakan untuk mengukur kompetensi menulis yaitu tes objektif; (2) tugas menulis yang diberikan belum terstruktur; (3) instrumen asesmen yang digunakan belum memenuhi syarat validitas, keterbacaan, dan reliabilitas; dan (4) guru kesulitan menyusun instrumen asesmen menulis yang memuat petunjuk yang jelas. Secara umum, penelitian ini menghasilkan dua produk, yakni tugas autentik menulis dan panduan penggunaan instrumen asesmen. Tugas autentik menulis yang disajikan ada dua jenis yaitu (1) tugas menulis berdasarkan konflik atau masalah dan (2) tugas menulis sinopsis cerpen dan fabel. Tugas menulis yang disajikan juga menggunakan stimulan berupa gambar berseri, komik, foto peristiwa, masalah, dan video sebagai bantuan siswa mencari ide. Penelitian ini bertujuan (1) mengembangkan produkberupainstrumenasesmenketerampilanmenulistekscerpendanteksfabel dan panduan guru menulis teks cerpen serta teks fabel; dan (2) mendeskripsikanhasilujivaliditas, keterbacaan, dan reliabilitas instrumenasesmentekscerpendanteks fabel. Produk yang dikembangkan memperhatikan syarat instrumen asesmen yakni validitas, reliabilitas, dan keterbacaan. Penelitian ini termasuk ke dalam jenis penelitian pengembangan dengan model pengembangan instrumen bahasa O’Malley dan Pierce (1996). Tahapan adaptasi model pengembangan tersebut, yaitu (1) menentukan tujuan pengembangan, (2) menyusun spesifikasi produk, (3) melakukan pengembangan, (4) menguji coba, dan (5) merevisi. Jenis data dalampenelitianiniyaitu (1) data verbal dan (2) data numerik.Data verbal berupakritik, komentar, dan saran perbaikanterhadapinstrumenasesmenmenulistekscerpendanteksfabel yang diperolehdariujivalidasiahlievaluasi, ahlipembelajaran, guru, dansiswa.Data numerikberupaskor-skor yang terdapatpadaangketpenilaian yang diperolehdariahli dan subjek ujiterhadapinstrumenasesmen yang menggambarkanhasil uji validitas, reliabilitas, danketerbacaaninstrumenasesmen. Prosedur pengumpulan data dilakukan peneliti dengan teknik wawancara tidak terstruktur dan survei terbatas. Wawancaratidakterstrukturdilakukanpenelitikepada guru berkaitandenganinstrumenasesmen yang digunakan.Surveiterbatasdilakukanpenelitidengancaramemberikanangketkepadaahli. Teknik analisis data dalam penelitian ini yaitu teknik analisis data kualitatif dan kuantitatif. Teknik analisis data kuantitatif digunakan untuk menganalisis data numerik yang diperoleh dari angket yang disebarkan kepada validator. Hasil skor dari angket ahli kemudian dipersentasekan untuk menentukan produk layak diimplementasikan. Selain data numerik dari angket, data numerik lainnya diperoleh dari uji reliabilitas. Uji reliabilitas dilakukan dengan cara uji korelasi Pearson Product Moment. Sebelum melakukan uji korelasi, dilakukan uji normalitas dan uji homogenitas pada data sebagai prasyarat untuk melakukan uji korelasi Pearson Product Moment. Berdasarkan uji normalitas dan uji homogenitas, data numerik normal dan memiliki varian yang hampir sama. Berdasarkan uji validitas produk Tugas Menulis Autentik Teks Cerpen diperoleh persentase sebesar 86%.Hasil uji validitas produk Tugas Menulis Autentik Teks Fabel diperoleh persentase sebesar 87 %. Hasil uji keterbacaan produk Tugas Menulis Autentik Teks Cerpen diperoleh persentase sebesar 86%. Hasil uji keterbacaan produk Tugas Menulis Autentik Teks Fabel diperoleh persentase sebesar 85 %. Berdasarkan uji reliabilitas interrater yang dilakukan terhadap produk instrumen asesmen menulis teks cerpen dan teks fabel diperoleh nilai korelasi 0, 829 untuk teks cerpen dan nilai 0, 761 untuk teks fabel. Dengan demikian nilai korelasi > 0,05, maka dapat disimpulkan produk instrumen asesmen yang dikembangkan memiliki nilai reliabilitas yang tinggi. Berdasarkan uji empiris, produk Tugas Menulis Autentik Teks Cerpen diperoleh persentase sebesar 78% (SMPN 7 Malang) dan 77% (SMPN 24 Malang). Hasil uji empiris produk Tugas Menulis Autentik Teks Fabel diperoleh persentase sebesar 82% (SMPN 7 Malang) dan 80% (SMPN 24 Malang). Persentase yang diperoleh > 75% sehingga produk layak dan dapat diimplementasikan dengan revisi kecil. Berdasarkan uji validitas produk Panduan Penggunaan Instrumen Menulis Autentik Teks Cerpen diperoleh persentase sebesar 85%. Hasil uji validitas produk Panduan Penggunaan Tugas Menulis Autentik Teks Fabel diperoleh persentase sebesar 85 %. Hasil uji keterbacaan produk Panduan Penggunaan Tugas Menulis Autentik Teks Cerpen diperoleh persentase sebesar 85%. Hasil uji keterbacaan produk Panduan Penggunaan Tugas Menulis Autentik Teks Fabel diperoleh persentase sebesar 83%. Tugas menulis autentik dan panduan penggunaan instrumen asesmen teks cerpen dan teks fabel ini dapat menjadi salah satu alternatif untuk melakukan penilaian menulis khususnya menulis teks sastra. Sebagai langkah pemanfaatan produk hasil pengembangan, guru disarankan untuk menggunakan instrumen asesmen ini dengan lebih inovatif dan kreatif. Produk ini dapat dijadikan dasar atau pijakan untuk pengembangan produk instrumen asesmen selanjutnya. Produk ini dapat disebarluaskan melalui forum MGMP (Musyawarah Guru Mata Pelajaran) Bahasa Indonesia, jurnal penelitian, blog, dan sosial media.

Manajemen sarana dan prasarana dalam penyelenggaraan pendidikan (Studi kasus di MIN Malang 1) / Aldi Yunizar

 

Kata kunci: manajemen, sarana dan prasarana, kualitas pendidikan Sarana dan prasarana di sekolah merupakan hal yang sangat penting dalam kelancaran pendidikan di sekolah, hal ini karena sarana dan prasarana dapat mendukung kelancaran di dalam pengajaran maupun yang lainnya. Maka dari itu sarana dan prasarana sebisa mungkin dilengkapi dan digunakan semaksimal mungkin guna mendukung kelancaran pendidikan di sekolah. Manajemen sarana dan prasarana sekolah ditujukan untuk memperlancar proses yang dibutuhkan dalam hal sarana dan prasarana. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui bagaimana proses manajemen sarana dan prasarana, kendala-kendala dan strategi pemecahan masalah dalam manajemen sarana dan prasarana, dan mengetahui faktor pendukung dan strategi pemberdayaan dalam manajemen sarana dan prasarana di MIN Malang 1. Penelitian ini menggunakan rancangan penelitian kualitatif studi kasus tunggal. Data penelitian berupa paparan proses manajemen sarana dan prasarana, kendala-kendala dan strategi pemecahan masalah dalam manajemen sarana dan prasarana, dan faktor pendukung dan strategi pemberdayaan dalam manajemen sarana dan prasarana di MIN Malang 1 yang diperoleh dari hasil wawancara dan observasi. Pengumpulan data dilakukan dengan menggunakan teknik wawancara, observasi, dan dokumentasi. Instrumen yang digunakan untuk mengumpulkan data yaitu berupa instrumen kunci yaitu peneliti sendiri. Untuk menjaga keabsahan data, dilakukan dengan triangulasi data. Kegiatan analisis data dimulai dari mereduksi data, display data, dan verifikasi data. Berdasarkan hasil analisis data tersebut, diperoleh lima kesimpulan hasil penelitian sebagai berikut: manajemen sarana dan prasarana sekolah mempunyai peran yang secara langsung membantu kelancaran sekolah, proses manajemen sarana dan prasarana meliputi: perencanaan pengadaan sarana dan prasarana, dalam setiap mengadakan sarana dan prasarana selalu mengadakan perencanaan untuk mengetahui barang apa saja yang dibutuhkan; pelaksanaan pengadaan sarana dan prasarana, pengadaan sarana dan prasarana bisa dilakukan oleh pihak sekolah sendiri atau menggunakan pihak ketiga sebagai pelakunya; inventarisasi, pencatatan sarana dan prasarana yang dibeli kedalam buku induk dan dipilah berdasarkan barang milik negara dan barang milik komite; pendistribusian, membagikan sarana dan prasarana ke unit-unit yang memerlukan; pemeliharaan, pemeliharaan dilakukan ada yang setiap hari dan ada juga yang dilakukan beberapa bulan sekali seperti perawatan gedung; serta penghapusan, penghapusan dilakukan karena barang-barang tersebut sudah tidak layak pakai atau barang tersebut sudah ketinggalan jaman. Kedala-kendala yang dihadapi yaitu sulitnya pencairan dana dari negara, kebutuhan madrasah yang mendadak, serta kendala pada pihak ketiga. Untuk mengatasi kendala tersebut madrasah mengupayakan komunikasi dengan pihak ketiga apabila permasalahannya dengan pihak ketiga, serta untuk kebutuhan madrasah yang mendadak pihak madrasah mengkomunikasikan kembali dengan komite madrasah sebagai pemegang dana terbesar. Faktor pendukung lebih kepada orang tua murid yang sering membantu madrasah dengan menyumbangkan dana yang akan ditampung oleh komite madrasah, selain itu juga peran komite madrasah yang sangat aktif dalam hal membantu mengumpulkan dana untuk madrasah, dan adanya kebebasan kepala madrasah dalam hal merencanakan dan mengembangkan manajemen sarana dan prasarana yang sebelumnya sudah dibicarakan terlebih dahulu dengan pihak komite madrasah. Faktor pemberdayaan sarana dan prasarana dilakukan dengan cara melakukan pelatihan-pelatihan serta lomba untuk guru dalam hal IT, agar mereka selalu menggunakan peralatan tersebut di dalam lingkungan madrasah sesuai kebutuhan yang diperlukan, misalnya untuk pengajaran kelas dengan menggunakan LCD proyektor dan laptop yang disediakan madrasah. Berdasarkan hasil penelitian ini, disarankan kepada kepala madrasah, panitia pengadaan dan penerimaan sarana dan prasarana, serta guru untuk meningkatkan partisipasi dalam mengembangkan sekolah dengan sarana dan prasarana yang sudah disediakan madrasah.

Pelaksanaan audit manajemen fungsi sumber daya manusia pada PT. Pabrik Kertas Tjiwi Mojokerto oleh Bety Nur Achadiyah

 

Kegiatanm anajenaal dalahk eseluruhana ktivitasy angd ilaksanakaonl eh manajedra lamp elaksanaaonp erasionapl erusahaans,a lahs atunyaa dalahp engelolaan sumbedra yam anusia.M anajemens umberd ayam anusiaa dalahb agiany ang paling vitald alamt iap-tiap perusahaanka renam empunyaip erans trategikd alam pengelolabains nis. untuk mewujudkanp elaksanaasnu mberd ayam anusiaa gard imainkano leh nerekay angm emperolehtu gasd ant anggungja wab untukm engelolas umberd aya manusdiae nganti ngkate fektifitasy angt inggi adalahd enganm elaluia udit.M elalui audiat kand iketahuik eberhasilapne laksanaapne ngelolaansu mberd ayam anusia. PT.P abrikk ertasT jiwi Kimia merupakanp erusahaamn anufaklurc, iri utamanyaad alahm engolahb ahanm entahm enjadib arangja di. Perusahaain i didirikanta ngga2l Oktober1 972.P erante nagak erja di PT. Pabrikk eraasT iiwi Kimiac ukupb esarm engingaPt T. Pabrikk ertasT iiwi Kimia merupakans alahs atu perusahaaenks portiry angh arusm enghasilkanp rodukb erkualitasin temasional. Untukm enghasilkapnr oduky angb erkualitasin temasionadl iperlukanp arap ekerla yangte rampild anp rofesionalP. eranm anajemensu mberd ayam anusiate ntus angat diperlukaunn tukm encetakp ekerja-pekerjyaa ngt erampil,p rofesionasl erta berdedikastiin ggi kepadap erusahaan. Masalahy angd ikaji dalamp enelitianin i adalah(: l ) Apakahp elaksanaan auditm anajemefnu ngsis umberd ayam anusiap adad ivisi paperP T. PabrikK ertas ljiwi Kimia telahb erjaland engane fektif?( 2) Apakahp engelolaansu mberd aya manusiap adad ivisi paperP T. PabrikK ertasT iiwi Kimia telahb erjaland engan efehifl Penelitiani ni menggunakanp endekatand eskriptif kualitatif yangb ertujuan untuk( 1) Menganalisisti ngkate fektifitasp elaksanaaanu ditm anajemensu mberd aya manusiap adad ivisi paperP T. PabrikK ertas'liiwi Kimia, (2) Menganalisisti ngkat efeldfitasp engelolaasnu mberd ayam anusiap adad ivisi paperP T. PabrikK ertas 1-iwKi imia. Pelaksanaapne nelitianin i terdiri dari aktivitasa nalisisp elaksanaan audit sumber daya manusia dan aktivitas konfirmatif Untuk aktivitas pertama, instrumeny ang digunakanu ntuk mengumpulkand ata adalahc heklist dan pedoman wawancarate, knik analisisd atad ilaksanakadne nganm embandingkaann tarar ealisasi pelaksanaaanu ditd engans tandar-standyaar ngd itetapkanS. edangkaunn tuka ktivitas konfirmatif,jn strumeny angd igunakanu ntukm engumpulkand ataa dalaha ngket, teknika nalisisd atad ilaksanakadne nganm embandingkaann tarar ealisasi pengelolaasnu mberd ayam anusiad engans tandar-standyaar ngd itetapkanA' ngket disebarkakne padam asing-masindge partemenp adad ivisi paperk emudiand ihitung

UPS berbasis mikrokontroler untuk lampu emergency / oleh Faishol Mubarrok dan Hadi Wibisono

 

Evaluasi kondisi sarana dan prasarana laboratorium pendidikan teknik bangunan jurusan teknik sipil Universitas Negeri Malang terhadap standar minimal laboratorium, workshop, dan studio pendidikan teknologi dan kejuruan jenjang S1 / Etty Kurniawati

 

Kata kunci: sarana dan prasarana, laboratorium; workshop, dan studio, pendidikan teknik bangunan Sarana dan prasarana adalah unsur penunjang dalam pelaksanaan Tri Dharma Perguruan Tinggi, yang mencakup bangunan, perabotan, peralatan (perangkat keras dan lunak). Sesuai dengan visi, misi atau mandatnya maka suatu perguruan tinggi membutuhkan pengembangan suatu sistem pengelolaan yang mencakup perencanaan, pengadaan, pendataan, pemanfaatan, pemeliharaan, penghapusan, serta pemutahiran semua sarana dan prasarana. Penelitian ini bertujuan untuk mendeskripsikan beberapa hal, yang mencakup sarana dan prasarana laboratorium, workshop dan studio yang ada pada program studi Pendidikan Teknik Bangunan yang kemudian dibandingkan dengan standar. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Pengumpulan data dilakukan dengan menggunakan teknik observasi dan dokumentasi. Instrumen yang digunakan untuk mengumpulkan data adalah tabel yang mengacu pada standar. Berdasarkan hasil analisis data, diperoleh kesimpulan hasil penelitian sebagai berikut. Pertama, sebagian besar kondisi kondisi sarana menunjukan, dari 9 laboratorium, workshop, dan studio, 5 laboratorium dalam kondisi Sangat Layak, 2 laboratorium dalam kondisi Cukup Layak, 1 laboratorium dalam kondisi Kurang Layak, dan 1 laboratorium dalam kondisi Sangat Tidak Layak. Kedua, kondisi prasarana menunjukkan, dari 9 laboratorium, workshop, dan studio, 7 laboratorium dalam kondisi Cukup Layak, 1 laboratorium dalam kondisi Kurang Layak, dan 1 laboratorium dalam kondisi Sangat Tidak Layak. Ketiga, kesesuaian sarana dan prasarana program studi Pendidikan Teknik Bangunan terhadap Standar Minimal Laboratorium, Workshop, dan Studio Pendidikan Teknologi dan Kejuruan Jenjang S1, Peraturan Menteri Pendidikan Nasional RI No. 40 Tahun 2004, dan Instrumen Verifikasi dari Badan Standar Nasional Pendidikan No. 1023-P2-10/11 menunjukkan 1 dari 9 indikator mencapai kriteria pencapaian sarana Kurang Sesuai, sedangkan kriteria pencapaian prasarana menunjukkan 5 dari 6 indikator mencapai Kurang Sesuai. Pihak jurusan sebaiknya lebih memperhatikan masalah pencahayaan, seperti menambah titik lampu dan memperbaiki lampu yang rusak, karena semua laboratorium dan workshop tidak ada yang memenuhi standar intensitas cahaya.

Otomatisasi kran dan pemanas air pada dispenser berbasis mikrokontroler / oleh Moh. Saidir Yanto dan Rahmad Verdianto

 

Peningkatan keterampilan menulis narasi melalui model picture and picture pada siswa kelas V SDN Turi 01 Kota Blitar / Yohana Ngair

 

Penerapan model pembelajaran peta konseo untuk meningkatkan hasil belajar siswa pada mata diklat Kewirausahaan (Studi pada kelas X Bisnis dan Managemen SMK Arjuna 1 Malang) / Fadli Achsani Akbar

 

Kata Kunci : Model PembelajaranPetaKonsep, HasilBelajar. Penelitianinibertujuanuntukmenerapkan Model PembelajaranPetaKonseppadatingkat SMK, siswadiharapkanmampuberkembangdanmenemukan sendiricarabelajar yang tepat. Dan tidakhanya mengingat seperangkat fakta-fakta.Tetapibelajarharuslahmampumemotivasisiswauntukkreatif, aktifdanmemperpanjang proses ingatan. Penelitianinibersifatkualitatifdeskriptif, sumber data daripenelitianiniadalah primer yang diperolehlangsungdaripengumpulan data dilakukanolehpenelitidibantuolehtigapengamat, hasilcatatanlapangan, observasiaktivitas guru dansiswa di SMK Ardjuna 1 Malang., yang kemudiandianalisismelaluireduksi data, danpenyajian.Penelitiandilakukanpadatanggal 28 februarisampai 20 maret, terdapatduatahapyaitusiklus I dansiklus II. Hasilpenelitianmenunjukkanadanyapeningkatanaktivitassiswasiklus I kesiklus II yang dapatdiukurdarihasilobservasiaktivitassiswasiklus I sebesar 84,79% dansiklus II sebesar 97,43%, terjadipeningkatansebesar 12,64%. Padaaspekafektifjugaterjadipeningkatan, darisiklus I sebesar 79,41% kesiklus II sebesar 92,94%, terjadi rata-rata presentasepeningkatansebesar 13,53%. Hasilpenelitianjugamenunjukkanadanyapeningkatanhasilbelajarpadaaspekkognitif (pre-test danpost-test) yaitupadasiklus I setelahdilakukantindakan rata-rata presentasekelulusanbelajar 64,71%, padasiklus II setelahdilakukantindakan rata-rata presentasekelulusanbelajar 88,24%. Dari hasilpenelitianinidapatdisimpulkanbahwa Model pembalajaraninibisadijadikanalternatifpilihan Model Pembelajaran di kelaswalauterdapatkesulitandalampenerapan model pembelajaranPetaKonseptetapipenelitianinimampumeningkatkanhasilbelajarSiswa Kelas X BisnisdanManajemen SMK Ardjuna 1 Malang.

Otomatisasi penstabil arus pada mesin las 1 fasa / oleh Agus Indra Achmadi

 

Pengaruh tingkat pengganguran, TPAK wanita dan laju GDP perkapita terhadap distribusi pendapatan di Indonesia (Tahun 2006-2010) / Moch.Saiful Azianto

 

Kata Kunci :Tingkat Pengangguran, Tingkat Partisipasi Angkatan Kerja Wanita, dan Laju GDP per Kapita Selama ini,fokus utama negara yang melakukan pembangunan ekonomi adalah pertumbuhan ekonomi dan hasil dari pertumbuhan didistribusikan baik secara ekonomis atas pendapatan dan aset maupun nonekonomis seperti pertumbuhan penduduk, pengangguran, dan masalah pendidikan.Hal inilah yang melatar belakangi kenapa penelitian ini ingin melihat seberapa besar pengaruh variable sosial-ekonomi terhadap distribusi pendapatan. Penelitian ini bertujuan untuk:(1) Apakah tingkat pengangguran, tingkat partisipasi tenaga kerja wanita dan laju GDP per kapita terhadap distribusi pendapatan di Indonesia.(2)Apakah krisis ekonomi yang dimulai pada pertengahan 2008 terhadap distribusi pendapatan di Indonesia. .Hipotesa yang menyebutkan bahwa variabel tingkat pengangguran, tingkat partisipasi tenaga kerja wanita, laju GDP per kapita dan berpengaruh terhadap distribusi pendapatan di Indonesia terbukti dalam penelitian ini..Bahwa krisis ekonomi yang dimulai pada pertengahan 1997 berpengaruh pada distribusi pendapatan di Indonesia tidak terbukti dalam penelitian ini. Tidak berpengaruhnya krisis ekonomi ini dapat dilihat dari hasil uji t yang tidak signifikan terhadap variabel rasio gini. Hasil penelitian menunjukkan bahwa tingkat pengangguran, tingkat partisipasi tenaga kerja wanita, dan laju GDP per kapita berpengaruh terhadap besarnya distribusi pendapatan di Indonesia meskipun pengaruh masing-masing variabel tidak begitu besar. Sedangkan krisis ekonomi yang dimulai pada pertengahan 1997 tidak memiliki pengaruh secara signifikan terhadap besarnya distribusi pendapatan di Indonesia. Kenaikan tingkat pengangguran menyebabkan distribusi pendapatan semakin merata. Sedangkan kenaikan tingkat partisipasi tenaga kerja wanita dan laju GDP per kapita menyebabkan distribusi pendapatan semakin timpang.Hal ini berbeda dengan hasil penelitian-penelitian terdahulu khususnya hasil penelitian Biewen menyebutkan bahwa peningkatan partisipasi angkatan kerja wanita, penurunan pengangguran dan meningkatnya pendapatan per kapita menurunkan ketimpangan distribusi pendapatan.Karena keterbatasan data, perhitungan rasio gini menggunakan data pengeluaran penduduk desa dan kota tahunan. Untuk penelitian selanjutnya, sebaiknya menggunakan data pengeluaran penduduk desa dan kota bulanan atau kuartal supaya penelitiannya semakin mendekati keadaan sesungguhnya.Untuk penelitian selanjutnya, sebaiknya menggunakan metode penelitian yang digunakan oleh penulis asli jurnal yang menjadi acuan untuk mendapatkan hasil yang lebih teliti dan mendekati keadaan yang sebenarnya. Selain itu, sebaiknya menggunakan pendekatan variabel-variabel bebas yang lebih konkret pengaruhnya terhadap distribusi pendapatan seperti kemiskinan, pendidikan, dan upah atau gaji.

Studi pelaksanaan pekerjaan kolom pada proyek pembangunan gedung perkuliahan Fakultas Ekonomi UM / oleh Maziyatun Solicha

 

Pengembangan Lembar Kerja Siswa (LKS) dengan menggunakan masalah kontekstual untuk siswa SMA kelas X materi logika / Dia Rini Pristyanti

 

Kata Kunci: Lembar Kerja Siswa (LKS), Masalah Kontekstual, Logika. Berdasarkan hasil observasi yang dilakukan di kelas X SMAN 9 Malang mengenai materi Logika, ternyata siswa belum memahami konsep-konsep Logika. LKS yang digunakan siswa kurang menarik dan cenderung langsung memberikan permasalahan-permasalahan formal tanpa mengawali dengan kehidupan di sekitar siswa. Pengintegrasian konteks ke dalam LKS akan sangat membantu siswa dalam mengkonstruk pemahaman terhadap konsep matematika. Materi Logika merupakan materi yang baru bagi siswa SMA kelas X, sehingga akan lebih baik jika guru memulai penjelasan tentang materi ini dengan masalah kontekstual yang ada dalam kehidupan sehari-hari. Oleh karena itu, tujuan dari pengembangan ini adalah tersusunnya LKS menggunakan masalah kontekstual pada materi Logika untuk SMA kelas X. Pengembangan lembar kerja siswa ini merujuk pada prosedur pengembangan yang meliputi (1) analisis situasi awal, (2) pengembangan rancangan LKS, (3) penyusunan LKS, dan (4) penilaian LKS. LKS hasil pengembangan divalidasi oleh 3 validator yang terdiri dari 1 dosen matematika dan 2 guru matematika SMA. Setelah itu, LKS diujicobakan kepada 6 siswa kelas X SMA. Berdasarkan hasil validasi ahli, diperoleh persentase aspek kontekstual 80% dan aspek praktis 88%. Selain itu, berdasarkan hasil uji coba kelompok kecil, siswa dapat mengerjakan cek pemahaman yang diberikan dengan perolehan nilai yang telah memenuhi SKM yang ditentukan, yaitu 75. Dengan demikian, LKS yang dikembangkan dapat dinyatakan valid, karena telah memenuhi aspek kontektual, praktis, dan telah disusun sesuai dengan kemampuan siswa. Saran untuk pengembangan LKS selanjutnya diharapkan mengembangkan LKS kontekstual pada materi lainnya. Selain itu diharapkan LKS hasil pengembangan ini diterapkan pada proses belajar mengajar siswa kelas X SMA.

Perencanaan campuran aspal beton menggunakan gradasi agregat No. 3 SNI No. 1737-1989-F untuk lalu lintas sedang / oleh Eki Achmad Baihaqi

 

Perkuatan lentur balok kayu sengon dengan menggunakan bambu ori pada bagian tarik / oleh Ferry Kusuma Wiyadi

 

Pengaruh medium asam klorida terhadap laju korosi tembaga berlapis nikel / Bakhtiar Rifa'i

 

Kata kunci: korosi, tembaga, nikel, medium Logam–logam yang digunakan sehari-hari tidak lepas dari masalah korosi. Korosi merupakan penurunan mutu logam akibat reaksi kimia dengan lingkungan. Oleh karena itu, perlu dilakukan suatu perlakuan untuk mendapatkan sifat yang lebih baik dari permukaan logam, misalkan electroplating. Electroplating atau pelapisan logam digunakan untuk melindungi logam dari korosi dan memperbaiki sifat dekoratif dari permukaan logam. Logam tembaga dengan bentuk permukaan yang tidak mengkilap dan berwarna kecoklatan, dilapisi dengan nikel untuk memperbaiki sifat permukaan tembaga. Nikel memiliki warna abu-abu yang mengkilap, sehingga dapat memperbaiki permukaan tembaga. Tembaga berlapis nikel juga tidak terlepas dari masalah korosi. Oleh karena itu, perlu dilakukan uji laju korosi terhadap tembaga berlapis nikel. Tujuan dari penelitian adalah untuk mengetahui laju korosi tembaga berlapis nikel. Penelitian ini juga bertujuan untuk mengetahui pengaruh medium HCl dan lama pencelupan terhadap laju korosi tembaga berlapis nikel. Penelitian menggunakan rancangan penelitian eksperimen. Variabel penelitian adalah perbedaan atau variasi konsentrasi medium HCl sebagai medium pengkorosi dan variasi waktu pencelupan tembaga berlapis nikel dalam medium HCl. Penentuan laju korosi tembaga berlapis nikel menggunakan metode kehilangan berat. Tembaga berlapis nikel yang telah diketahui massanya dicelupkan dalam medium HCl dengan konsentrasi 0,01 M, 0,05 M, dan 0,1 M. Tembaga berlapis nikel ini direndam selama 3, 6, 10, 15, dan 20 hari untuk masing-masing konsentrasi untuk selanjutnya ditimbang kembali dan dihitung selisih berat masing-masing sampel, kemudian dihitung laju korosinya. Hasil penelitian yang diperoleh yaitu untuk konsentrasi medium HCl 0,01 M, laju korosi selama 3, 6, 10, 15, dan 20 hari berturut-turut 0,1107 mm/tahun, 0,0402 mm/tahun, 0,0317 mm/tahun, 0,0212 mm/tahun, dan 0,0183 mm/tahun. Untuk konsentrasi medium HCl 0,05 M, laju korosi saat 3, 6, 10, 15, dan 20 hari berturut-turut 0,2469 mm/tahun, 0,2716 mm/tahun, 0,1715 mm/tahun, 0,1144 mm/tahun, dan 0,0955 mm/tahun. Sedangkan untuk konsentrasi medium HCl 0,1 M, laju korosi saat 3, 6, 10, 15, dan 20 hari berturut-turut 0,4572 mm/tahun, 0,5978 mm/tahun, 0,3562 mm/tahun, 0,2468 mm/tahun, dan 0,205 mm/tahun. Dari data yang telah diperoleh dapat disimpulkan, sejalan dengan naiknya konsentrasi larutan HCl sebagai medium pengkorosi, laju korosi tembaga berlapis nikel akan semakin besar dan semakin lama perendaman tembaga berlapis nikel, semakin kecil laju korosinya.

Studi teknologi pemasangan ubin lantai dari bahan kayu / oleh M. Agus Khoirul Fuad

 

Pengembangan bahan ajar kimia berbasis CORE (Connect, Organize, Reflect, and Extend) untuk rintisan sekolah bertaraf internasional pada materi alkana, alkena, alkuna / Aang Saptadri Yahya

 

Kata Kunci: alkana, alkena, alkuna, bahan ajar, CORE, RSBI Pendidikan adalah hal mendasar yang sangat dibutuhkan oleh manusia dalam menjalankan kehidupannya. Atas dasar tersebut, pemerintah berusaha meningkatkan kualitas pendidikan nasional agar bisa bersaing secara global. Salah satu usaha yang dilakukan pemerintah adalah dengan penerapan standar kurikulum internasional yang melahirkan RSBI. Salah satu kendala yang dihadapi guru RSBI adalah penyediaan bahan ajar dengan standar kurikulum internasional. Untuk itu peneliti mengembangkan bahan ajar Kimia RSBI pada materi Alkana, Alkena, Alkuna. Penelitian ini menggunakan rancangan penelitian pengembangan. Model pengembangan bahan ajar yang diacu adalah Model 4D, meliputi empat tahap utama yaitu define, design, develop, dan disseminate. Namun, karena keterbatasan waktu dan pendukung lain model yang digunakan terbatas pada define, design dan develop. Validasi isi dilakukan dengan memberikan angket penilaian terhadap bahan ajar yang dikembangkan kepada validator yaitu satu orang dosen Kimia dan dua orang guru Kimia RSBI. Angket penilaian ini mengadaptasi butir instrumen penilaian bahan ajar yang dikeluarkan oleh BSNP. Jenis data yang diperoleh dari hasil validasi pengembangan bahan ajar ada dua, yaitu data kuantitatif yang diperoleh dari perhitungan nilai rata-rata untuk mengetahui besarnya kelayakan/kevalidan bahan ajar tersebut dan data kualitatif berupa tanggapan/saran dari validator. Setelah dilakukan validasi isi bahan ajar kemudian dilakukan uji terbatas kepada enam siswa RSBI. Revisi paket hasil pengembangan dilakukan setelah diperoleh data validasi. Produk dari pengembangan adalah paket bahan ajar Kimia RSBI kelas X pada materi alkana, alkena, dan alkuna yang digunakan untuk siswa dan guru. Buku teks yang dihasilkan ditulis dengan menggunakan format CORE (Connect, Organize, Reflect, and Extend) dan berbahasa Inggris. Bahan ajar setebal 60 halaman ini terdiri dari tiga bagian yaitu bagian awal, bagian isi, dan bagian akhir. Masing-masing bagian mempunyai beberapa komponen. Bagian awal (pembuka) terdiri dari cover, preface, study guide, student tips, table of contents, dan learning goals. Bagian isi (materi) terdiri dari connect, organize, reflect, dan extend. Bagian akhir (penutup) terdiri dari chemistry life inside, summary, glossary, review questions, UCLES, solutions manual, dan bibliography. Dari hasil validasi bahan ajar diperoleh nilai rata-rata 3,61 dengan kriteria valid/baik/layak. Berdasarkan hasil uji terbatas, diperoleh nilai nilai rata-rata 3,47 dengan kriteria valid/baik/layak untuk bahan ajar. Oleh karena itu, dapat disimpulkan bahwa bahan ajar Kimia RSBI pada materi alkana, alkena, alkuna sudah layak dan dapat dilakukan evaluasi sumatif di lapangan.

Ogan transformations and some syntactical problems in the teaching of English to speakers of Ogan / Mohammad Rasjid Mulkan

 

Rekayasa tempurung kelapa sebagai mozaik ubin kayu / oleh Toni Murtono

 

Analisis pengaruh Retur On Asset (ROA), Price Earning Ratio (PEB), Book value per share, total Aset dan Debt To Equity Ratio (DER) terhadap Investment Opportunity Set ( IOS) / Muh Arif Setia Budi

 

Kata Kunci: Return On Asset (ROA), Price Earning Ratio (PER), Book Value Per Share (BV), Total Asset, Debt to Equity ratio (DER), dan Investment opportunity Set (IOS). Adanya pilihan investasi yang dapat menghasilkan keuntungan dimasa depan merupakan kesempatan bertumbuh bagi perusahaan yang akan menaikkan nilai perusahaan. Pilihan investasi di masa yang akan datang ini kemudian di kenal dengan istilah Investment opportunity Set (IOS). Dalam penelitian ini IOS diproksikan dengan market value to book value of assets (MBVA). Tujuan penelitian ini adalah untuk mengetahui apakah variabel independen Return On Asset (ROA), Price Earning Ratio (PER), Book Value (BV), Size, dan Leverage berpengaruh terhadap variabel dependen investment opportunity set (IOS). Sampel yang digunakan adalah perusahaan food and beverages yang listing di BEI periode 2008-2011, yang telah diseleksi menggunakan metode purposive sampling. Metode pengumpulan data dengan cara dokumentasi data sekunder yang diperoleh dari Indonesian Capital Market Directory (ICMD). Teknik analisis data yang digunakan dalam penelitian ini adalah regresi linier berganda dengan menggunakan SPSS (Statistical Package for Social Sciences) versi 19.0 for Windows. Untuk menguji secara simultan variabel independen (X) terhadap variabel dependen (Y) digunakan uji F, sedangkan untuk menguji secara parsial digunakan uji t. Hasil penelitian Secara parsial ROA, PER, dan Size berpengaruh positif terhadap IOS msing-masing sebesar 73,3%, 66,4%, 30,2%. Untuk variabel Book Value dan Leverage secara parsial tidak berpengaruh. Return On Asset (ROA), Price Earning Ratio (PER), Book Value (BV), Size, dan Leverage secara simultan berpengaruh terhadap IOS sebesar 58,8%. Sedangkan sisanya 41,2% dipengaruhi variabel lain yang tidak diteliti. Saran yang dapat diberikan penulis dalam penelitian ini adalah (1) penelitian berikutnya dapat menggunakan proksi pendekatan pengukuran komposit (composite measurements), untuk mengurangi measurement error yang ada pada proksi dengan rasio individual. (2) memperluas objek penelitian, tidak hanya perusahaan food and baverages tetapi juga pada perusahaan manufaktur serta non manufaktur.

Kualitas batu pualam marmer bahan penutup lantai bangunan gedung dari daerah Tulungagung / oleh Fenti Andriana

 

Pengaruh struktur modal terhadap harga saham pada perusahaan perbankan yang linting di Bursa Efek Indonesia periode 2009-2010 / Bangkit Adi Nugroho

 

Kata kunci : Stuktur modal, Debt to asset ratio, equity to asset ratio, debt to equity ratio, harga saham, bank, pecking order theory. Struktur modal adalah bagian yang penting dalam perusahaan karena dikaitkan dengan sumber dana perusahaan untuk menjalankan operasionalnya, struktur modal sendiri terbagi atas modal internal yang berupa modal sendiri atau saham, dan modal eksterna yang terdiri dari hutang jangka pendek, hutang jangka panjang atau pun obligasi. Menurut teori pecking order adalah susunan struktur modal yang baik adalah dengan mengutamakan sumber dana dari internal dahulu dan di susul oleh sumber dana dari eksrternal, hal ini bertolakan dengan struktur modal bank yang mempunyai karakter struktur modal dengan memiliki sumber modal eksternal yang lebih besar, struktur modal yang baik akan mempengaruhi harga saham. Tujuan penelitian ini adalah menguji sejauh mana harga saham dipengaruhi oleh struktur modal (Debt to asset ratio, equity to asset ratio, debt to equity ratio) Penelitian ini merupakan jenis penelitian eksplanasi karena disesuaikan dengan rumusan hipotesis yang menduga bahwa strukur modal (Debt to asset ratio, equity to asset ratio, debt to equity ratio) berpengaruh terhadap harga saham. Data yang digunakan dalam penelitian ini adalah data kuantitatif yang didapat dari data sekunder berupa jumlah ketersediaan total aktiva, total hutang, total modal sendiri, dan harga saham suatu perusahaan. Subjek dalam penelitian ini adalah seluruh perusahaan Perbankan konvensonal yang listing di Bursa Efek Indonesia pada tahun 2008-2010. Penelitian ini menggunakan analisis regresi linier berganda dengan pengujian hipotesis secara parsial dan simultan. Hasil penelitian ini menunjukkan bahwa tidak terdapat pengaruh variabel Debt to asset ratio, equity to asset ratio, debt to equity ratio terhadap harga saham, baik secara parsial maupun simultan. Perubahan Debt to asset ratio, equity to asset ratio, debt to equity ratio sebagai struktul modal dalam suatu perusahaan tidak akan menyebabkan harga saham suatu perusahaan berubah. Berdasarkan hasil penelitian yang diperoleh maka saran yang diberikan adalah (1) Menggunakan data terbaru yaitu tahun 2011 dan tahun-tahun berikutnya. (2) Menggunakan varibel lain yang berasal dari eksternal perusahaan yang dapat berpengaruh terhadap harga saham. (3) tidak hanya melibatkan perusahaan perbankan, tetapi juga lembaga keuangan yang lain

Pengaruh prestasi belajar mata pelajaran kewirausahaan dan lingkungan keluarga terhadap minat berwirausaha siswa kelas XI SMK Negeri 1 Banyuwangi / Martha Magdalena

 

ABSTRAK Magdalena, M. 2015. Pengaruh Prestasi Belajar Mata Pelajaran Kewirausahaan dan Lingkungan Keluarga Terhadap Minat Berwirausaha Siswa Kelas XI SMK Negeri 1 Banyuwangi. Skripsi, Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Drs. H. Gatot Isnani, M.Si., (II) Dr. Aniek Indrawati, S.Si, M.M. Kata kunci: prestasi belajar, lingkungan keluarga, minat berwirausaha Minat siswa untuk menjadi seorang wirausaha dipengaruhi oleh faktor intern maupun faktor ekstern, diantaranya adalah prestasi belajar dan lingkungan keluarga. Keseriusan siswa untuk menjadi wirausaha dapat terlihat dari prestasi belajar mata pelajaran kewirausahaan. Prestasi belajar kewirausahaan adalah bukti keberhasilan siswa dalam penguasaan materi mata pelajaran kewirausahaan, dan lingkungan keluarga juga merupakan faktor pendorong bagi siswa untuk menumbuhkan minat berwirausaha. Penelitian ini bertujuan untuk mengetahui: (1) Deskripsi prestasi belajar mata pelajaran kewirausahaan dan lingkungan keluarga; (2) deskripsi minat berwirausaha siswa; (3) pengaruh pretasi belajar mata pelajaran kewirausahaan dan lingkungan keluarga secara parsial terhadap minat berwirasuaha siswa kelas XI SMK Negeri 1 Banyuwangi. Penelitian ini merupakan penelitian kuantitatif dengan menggunakan analisis deskriptif dan analisis regresi berganda. Variabel bebas dalam penelitian ini adalah prestasi belajar mata pelajaran kewirausahaan (X1), dan lingkungan keluarga (X2) dengan variabel terikat minat berwirausaha (Y). Populasi dalam penelitian ini adalah seluruh siswa kelas XI SMK Negeri 1 Banyuwangi berjumlah 492 siswa dan jumlah sampel dalam penelitian ini sebesar 202 responden yang dihitung dengan rumus Isaac dan Michael, sedangkan untuk menentukan sampel menggunakan proportional random sampling. Skala yang digunakan adalah skala Likert dengan lima opsi jawaban sangat setuju, setuju, cukup setuju, tidak setuju, sangat tidak setuju. Jenis datanya adalah data ordinal yang diperlakukan sebagai data interval. Untuk sumber data berasal dari data primer dan data sekunder yang dimana data primer berasal dari responden sedangkan data sekunder berasal dari nilai rapor 3 semester yang diperoleh dari guru. Teknik pengumpulan data menggunakan metode kuesioner dan metode dokumentasi. Untuk uji kelayakan instrumen digunakan uji validitas dan reliabilitas. Penelitian ini menggunakan model uji asumsi klasik, yaitu: (1) Uji normalitas; (2) uji heteroskedastisitas; (3) uji multikolinieritas. Penelitian ini menggunakan bantuan SPSS 16 for Windows. Hasil uji asumsi klasik menunjukkan bahwa: (1) Model regresi memenuhi asumsi normalitas terlihat dari titik-titik menyebar di sekitar garis diagonal pada gambar P-P Plot of Regression Standardized Residual; (2) model regresi tidak terjadi heteroskedastisitas dilihat pada gambar scatterplot tidak membentuk suatu pola tertentu dan menyebar acak di atas dan di bawah angka 0 pada sumbu Y; (3) model regresi tidak terjadi multikolinieritas. Jadi, model regresi layak untuk digunakan. Hasil analisis deskriptif menunjukkan bahwa: (1) Prestasi belajar mata pelajaran kewirausahaan adalah baik; (2) lingkungan keluarga dapat diklasifikasikan baik; (3) minat berwirausaha dapat diklasifikasi- kan baik. Berdasarkan hasil uji hipotesis menunjukkan bahwa: (1) Ada pengaruh positif dan signifikan antara prestasi belajar mata pelajaran kewirausahaan terhadap minat berwirausaha; (2) ada pengaruh positif dan signifikan antara lingkungan keluarga terhadap minat berwirausaha. Berdasarkan hasil penelitian ini, peneliti menyarankan: (1) Bagi guru SMK Negeri 1 Banyuwangi diharapkan lebih menambah materi dan praktik lagi kepada siswa, agar siswa terus bersemangat dalam mengikuti pelajaran kewirausahaan dan semakin tumbuh minat berwirausaha; (2) bagi siswa diharapkan supaya lebih memahami tentang materi atau praktik kewirausahaan yang telah diajarkan oleh guru dan memanfaatkan dengan sebaik mungkin untuk menjadi bekal dalam berwirausaha; (3) bagi orang tua hendaknya dapat memberikan dukungan, bimbingan, arahan, dan dorongan dalam kegiatan belajar serta menemani anak pada waktu belajar; (4) bagi peneliti yang tertarik untuk melanjutkan penelitian ini, sebaiknya perlu dilakukan penelitian lebih lanjut tentang faktor-faktor lain yang dapat mempengaruhi minat berwirausaha misalnya lingkungan masyarakat, kepercayaan diri, dan motivasi.

Studi kasus produksi dan mutu genteng pada industri kecil di desa Kaloran, Kec. Nggrogot Nganjuk / oleh Lisa Listiana

 

Penetapan Kadar Tembaga (Cu) dalam daging ikan Sapu-Sapu (Hyposarcus pardalis) menggunakan Digestasi-HNO / Nur Uswatun Khasanah

 

Kata kunci: Tembaga, Digestasi, Daging Ikan Sapu-sapu (Hyposarcus pardalis). Sungai memiliki peran yang sangat penting sebagai sumber daya air vital bagi masyarakat Surabaya dan sekitarnya. Kualitas air sungai Surabaya sering dinyatakan terjadi pencemaran, terutama berasal dari limbah industri. Logam tembaga (Cu) adalah salah satu logam berat yang dapat ditemukan dalam perairan yang tercemar oleh limbah industri, namun penetapan rutin sulit membuktikan. Ikan sebagai salah satu biota air pada ekosistem sungai yang penuh oleh pencemaran air, ikan sapu-sapu (Hyposarcus pardalis) salah satu yang mudah ditemukan sehingga dapat digunakan sebagai indikator pencemar air. Tujuan penelitian ini adalah penetapan data kadar Cu yang terdapat dalam daging ikan sapu-sapu (Hyposarcus pardalis) melalui metode digestasi-HNO3. Analisis hasil dilakukan secara analisis grafis. Penelitian ini merupakan penelitian eksperimen laboratoris untuk penetapan kadar Cu dalam sampel daging ikan sapu-sapu (Hyposarcus pardalis) yang diambil dari perairan sungai Surabaya. Metode yang digunakan adalah digestasi berbasis HNO3 dengan melakukan variasi konsentrasi HNO3 serta suhu digestasi. Pengukuran kadar Cu hasil digestasi menggunakan instrumen Spektroskopi Serapan Atom (SSA) pada panjang gelombang () 324,8 nm. Hasil penelitian yang telah dilakukan diketahui bahwa sampel daging ikan sapu-sapu (Hyposarcus pardalis) di perairan Surabaya mengandung logam tembaga (Cu) pada digestasi-HNO3 masing-masing konsentrasi HNO3 6 M sebesar 0,69 ppm, HNO3 8 M sebesar 0,74 ppm, HNO3 10 M sebesar 0,77 ppm dan HNO3 12 M sebesar 0,85 ppm, sedangkan pada digestasi HNO3 dengan variasi suhu 110°C, 120°C dan 130°C diperoleh kadar Cu sebesar 0,85 ppm pada suhu 110°C, 0,72 ppm pada suhu 120°C dan 0,74 ppm pada suhu 130°C.

Studi proses produksi ubin batu marmer (dolomit) di Tulungagung / oleh Nita Mawar Sari

 

Pengembangan media pembelajaran alat ukur mekanik presisi berbasis komputer interaktif dijurusan teknik Pemesinan Sekolah Menengah Kejuruan (SMK) / Sutrisno

 

Kata Kunci: Media Pembelajaran, Interaktif, Alat Ukur Mekanik Presisi, Alat ukur mekanik presisi merupakan salah satu standar kompetensi yang ada di Jurusan Teknik Pemesinan Sekolah Menengah Kejuruan (SMK). Standar kompetensi ini merupakan salah satu standar kompetensi wajib yang harus dipelajari oleh siswa Jurusan Teknik Pemesinan Sekolah Menengah Kejuruan (SMK). Keterbatasan alat peraga dan banyaknya alat peraga yang rusak menyebabkan terhambatnya kegiatan proses belajar mengajar pada standar kompetensi ini. Metode pembelajaran di Jurusan Teknik Pemesinan Sekolah Menengah Kejuruan (SMK) saat ini, lebih banyak dilakukan dengan metode ceramah dan tanya jawab dikarenakan kurangnya fasilitas dalam pembelajaran. Metode ini cukup efektif, tetapi belum cukup apabila menginginkan pembelajaran yang menuntut siswa untuk lebih aktif dan mandiri. Penggunaan media CD pembelajaran interaktif sebagai salah satu solusi media pembelajaran yang sangat tepat dalam mengurangi keterbatasan fasilitas tersebut dan meningkatkan kualitas pembelajaran. Penelitian ini bertujuan; (1) merancang, membuat, dan melakukan uji coba media pembelajaran alat ukur mekanik presisi berbasis komputer interaktif di jurusan teknik pemesian sekolah menengah kejuruan (SMK). (2) mengetahui hasil validasi media pembelajaran alat ukur mekanik presisi berbasis komputer interaktif di jurusan teknik pemesian sekolah menengah kejuruan (SMK). Dalam merancang media pembelajaran harus sesuai dengan prosedur pemilihan media pembelajaran yaitu dimulai dengan menganalisis kebutuhan (need assessment). Analisis kebutuhan ini didasarkan pada faktor-faktor yang menjadi dasar pemilihan media, yaitu meliputi telaah terhadap karakteristik peserta didik, kompetensi yang diharapkan, dan karakteristik materi ajar. Di samping itu, ketersediaan media, keterbatasan sumber daya, fasilitas sekolah, biaya, waktu dan lain-lain juga perlu dipertimbangkan. Pengkajian tentang kondisi Sekolah juga dimaksudkan untuk mengsingkronkan jenis dan bentuk media yang akan dipilih. Dalam pembuatan media pembelajaran ini menggunakan program adobe flash CS5 professional yang memungkinkan untuk membuat animasi dan menampilkan media pembelajaran berbasis komputer yang menarik. Adobe Flash Professional CS5 merupakan salah satu software animasi. Software ini mempunyai banyak keunggulan diantaranya adalah program yang berorientasi objek (OOP), mampu mendesain gambar berbasis vector , dapat dipergunakan sebagai software pembuat satus WEB, dan banyak keunggulan lainnya. Pengembangan media pembelajaran berbasis komputer interaktif ini menggunakan model pengembangan menurut Sadiman, dkk. perancangan media pembelajaran melalui 10 tahap kegiatan, yaitu: (1) menganalisis kebutuhan; (2) merumuskan tujuan pembelajaran; (3) merumuskan butir-butir materi; (4) menyusun instrumen evaluasi; (5) menulis naskah media; (6) produksi produk media pembelajaran; (7) validasi ahli; (8) uji coba produk; (9) revisi; 10) hasil produk. Validasi media pembelajaran dilakukan kepada 1 orang ahli media yaitu dosen ahli perancangan pembelajaran di Jurusan Teknik Mesin Fakultas Teknik Universitas Negeri Malang dan 2 orang ahli materi yaitu 1 orang dosen ahli materi alat ukur mekanik presisi di Jurusan Teknik Mesin Fakultas Teknik Universitas Negeri Malang dan 1 orang ahli materi adalah guru mata diklat pengukuran di SMK Pekerjaan Umum Malang. Subjek uji coba dalam pengembangan media pembelajaran komputer interaktif ini adalah siswa kelas X TPM SMK Pekerjaan Umum Malang, tahun ajaran 2011-2012 dengan jumlah siswa 30 dengan usia rata-rata16 tahun. Subyek ini diambil karena kelas ini sedang melakukan kegiatan pembelajaran pada standart kompetensi Alat ukur Mekanik Presisi. Berdasarkan hasil validasi ahli materi I, diperoleh skor 3.31 dan dari validasi ahli materi II diperoleh skor 3.77, selanjutnya validasi ahli media diperoleh skor 2.38. Sehingga dapat disimpulkan bahwa media pembelajaran berbasis komputer interaktif yang dikembangkan masuk pada kriteria valid/ baik dan dapat digunakan dalam pembelajaran. Selaian itu, terdapat hasil uji coba kelompok kecil, diperoleh skor 3.20, dan uji coba lapangan, diperoleh skor 3.40. kesimpulan bahwa media pembelajaran alat ukur mekanik presisi berbasis komputer interaktif ini menarik dan mudah digunakan baik dari segi materi ataupun pengoperasian program. Media yang telah divalidasi dan direvisi, selanjutnya disimpan dalam bentuk CD dikemas dalam box CD beserta sampul identitas. Di dalam aplikasi software ini berisi 7 materi pembelajaran antara lain: (1) Jangka sorong 0,1mm, (2) Jangka sorong 0,02mm, (3) ) jangka sorong 0,05mm, (4) ) jangka sorong 1/1000inchi, (5) Micrometer 0,01mm, (6) Bevel Protractor, (7) Dial Indicator 0,01mm.

Cerminan budaya Indonesia dalam wacana jurnalistik berita berbahasa Indonesia / oleh Nur Fajar Aried

 

Pengaruh tayangan iklan mie Indomie ditelevisi terhadap citra merk (Studi pada masyarakat Tegal Gondo Asri di desa Tegal Gondo Kabupaten Malang) / Gerry Dimas Mahesa Surya

 

Kata kunci : Iklan, Citra Merek Tujuan dari penelitian ini adalah untuk mengetahui pengaruh tayangan iklan Mie Indomie terhadap citra merek, baik secara parsial maupun simultan. Dalam penelitian ini terdapat dua variabel yaitu periklanan (X) yang terdiri dari isi pesan, struktur pesan, format pesan, sumber pesan, dan citra merek (Y). populasi dalam penelitian ini adalah warga perumahan tegalgondo asri yang merupakan konsumen mie indomie dan berdomisili di kelurahan tegalgondo. Pengambilan populasi dengan menggunakan jumlah Kepala Keluarga (KK) dengan tujuan keefektifan dan efisien penelitian. Penelitian ini bersifat deskriptif korelasional yaitu pengaruh penayangan iklan Mie Indomie terhadap citra merek. Populasi yang diambil adalah 348 Kepala Keluarga (KK) yang ada di Perumahan Tegalgondo Asri di Desa Tegalgondo Kabupaten Malang. Teknik pengambilan data menggunakan teknik area proportioned purposive sampling. Data diperoleh melalui responden menggunakan kuesioner/angket tertutup dan diukur menggunakan skala Likert 1-5. Sedangkan analisis data menggunakan regresi linier berganda untuk mengetahui pengaruh periklanan yang meliputi isi pesan, struktur pesan, format pesan, dan sumber pesan terhadap citra merek baik secara parsial maupun simultan, analisis deskriptif, uji asumsi klasik. Proses pengolahan data menggunakan program SPSS 16 for Windows. Hasil penelitian ini adalah sebagai berikut: (1) Terdapat pengaruh signifikan periklanan yang terdiri dari isi pesan, struktur pesan, sumber pesan secara parsial terhadap citra merek Mie Indomie. (2) Tidak terdapat pengaruh signifikan variabel format pesan secara parsial terhadap terhadap citra merek Mie Indomie. (3) Terdapat pengaruh positif dan signifikan periklanan yang terdiri dari isi pesan, struktur pesan, format pesan, sumber pesan secara simultan terhadap terhadap citra merek Mie Indomie Selanjutnya saran-saran yang dapat peneliti berikan adalah: (1) PT. Indofood CBP Sukses Makmur diharapkan perusahaan tetap mempertahankan dan lebih mengembangkan inovasi-inovasi atas kegiatan iklan yang dilakukan selama ini sehingga mampu secara maksimal untuk mengenalkan produk. (2) Peneliti menyarankan dalam penelitian selanjutnya agar objek penelitian yang diambil lebih baik dan menambah jumlah variabel.

Ragam varian pendidikan lifeskill pondok pesantren : studi kasus pendidikan multi terampil POndok Pesantren Al-Amien Prenduan Sumenep / oleh Mashuri Toha

 

Hubungan minat terhadap game bertema kekerasan dan perilaku agresif remaja di SMPN 1 Pujon / Rizky Ika Pradibta

 

Kata kunci: Minat terhadap game, Prilaku agresi, Remaja Prilaku agresi adalah prilaku yang di lakukan dengan sengaja dengantujuan untuk menyakiti objek agresi, sedangkan minat terhadapgame bertema kekerasan adalah kecendrungan untuk memberikan perhatian lebih tehadap game bertema kekerasan serta menganggap gamebertema kekerasan memiliki arti penting, Tujuan dari penelitian ini adalah :1) Mengetahui deskripsi minat remaja terhadap game bertema kekerasan, 2)Mengetahui deskripsi agresivitas remaja3) Mengetahui hubungan antara minat terhadap game bertema kekerasan dengan perilaku agresi remajaPenelitian ini menggunakan analisis deskriptif dan korelasional pengambilan sampel di lakukan dengan metode snowball sampling, trerhadap 48 siswa SMPN 1 PujonPengambilan data dalam penelitian ini menggunakan skala minat game dan kuesioner prilaku agresi . Dari pengujian reliabilitas di peroleh r sebesar 0,89 untuk kuesioner agresi dan 0,86 untuk skala minat game Hasil penelitian menunjukkan bahwa mayoritas responden memiliki minat yang tinggi terhadap game bertema kekerasan sedangkan prilaku agresi yang di miliki subjek mayoritas dalam klasifikasi sedang, Uji hipotesis dilakukan dengan menggunakan teknik korelasi product moment dengan taraf signifikasi 0,05. Berdasarkan hasil perhitungan dengan menggunakan bantuan program SPSS 17.00 for Windows diperoleh r hitung = 0,683 dengan taraf signifikansi 0,000 < 0,05. Dengan demikian Ho dalam penelitian ini yang menyatakan bahwa tidak ada hubungan antara minat terhadap game bertema kekerasan dan Perilaku agresi Remaja remaja SMPN 1 Pujon ditolak, sebaliknya H1 yang menyatakan ada hubungan antara minat terhadap game bertema kekerasan dan perilaku agresi pada remaja diterima. Hal ini berarti bahwa ada hubungan antara minat terhadap game bertema kekerasan dan perilaku agresi pada remaja .

Penerapan pembelajaran kooperatif tipe TGP ( Tame Game Tournament ) pada pokok bahasan segi empat di kelas VII SMP NEGRI 20 Malang / imam Supandi

 

Kata Kunci: TGT( Team Game Tournament ), Segi Empat, Hasil Belajar Berdasarkan pengamatan yang dilakukan peneliti di SMPN 20 Malang selama menjalani Praktek Pengalaman Lapangan (PPL) diketahui bahwa kegiatan belajar di kelas masih berpusat pada guru, serta kurang adanya variasi metode pembelajaran. Lebih lanjut, hasil wawancara peneliti dengan guru kelas VII di SMPN 20 Malang menyebutkan bahwa dalam menyampaikan materi segi empat beliau hanya menjelaskan bahwa kegiatan pembelajaran yang diterapkan seperti pembelajaran biasanya yaitu menggunakan metode ceramah, tanya jawab dan penugasan. Hal itu mengakibatkan siswa kurang mandiri dan semangat dalam belajar matematika.oleh karena itu perlu kiranya dilakukan perubahan dalam pelaksanaan pembelajaran sehingga siswa lebih mandiri dan bersemangat. Salah satu model pembelajaran yang memenuhi hal tersebut adalah TGT (Teams Games Tournament). Dalam TGT pembelajaran berpusat pada siswa dan membantu sesama temannya bekerja sama dengan baik sehingga siswa akan lebih bersemangat dengan pemainan dan reward. Tujuan penelitian ini yang dilakukan adalah menghasilkan suatu rancangan pembelajaran pokok bahasan segi empat dengan pembelajaran kooperatif tipe TGT dan mendeskripsikan hasil belajar siswa kelas VII SMP Negeri 20 Malang. Penelitian dilaksanakan pada bulan Maret-April 2011 dengan subjek penelitian adalah siswa VII SMP Negeri 20 Malang. Pembelajaran TGT dalam penelitian ini terdiri dari kegiatan utama yaitu: (1) kegiatan awal, meliputi guru menyampaikan tujuan pembelajaran materi segiempat, guru memberikan apersepsi mengenai materi sebelumnya yang berkaitan dengan materi yang akan dipelajari, dan guru memberikan motivasi kepada siswa tentang pentingnya materi segiempat melalui pemberian masalah sehari-hari yang sesuai dengan materi (mengajar), (2) kegiatan inti, meliputi kelas dibagi menjadi kelompok-kelompok yang heterogen, guru membagikan lembar kerja siswa (LKS) yang berisi masalah sehari-hari yang berkaitan dengan materi segiempat, guru mengarahkan siswa mengenai kegiatan yang akan dilaksanakan, siswa mempersiapkan peralatan yang dibutuhkan untuk menyelesaikan masalah, siswa berdiskusi menyelesaikan permasalahan yang ada di LKS dengan anggota kelompoknya masing-masing, guru membimbing dan memberikan bantuan kepada siswa atau kelompok yang menemui kesulitan, beberapa kelompok mempresentasikan hasil kerja kelompoknya, dan kelompok lain memberi tanggapan dan membandingkan jawaban kelompoknya dengan jawaban kelompok penyaji(Belajar Kelompok), guru melaksanakan permainan (game) yang diturnamenkan (3) kegiatan akhir, meliputi memberikan penghargaan (reward), evaluasi terhadap jawaban siswa dan berdiskusi dengan siswa dan mengarahkan siswa untuk membuat kesimpulan terhadap kegiatan yang telah dilakukan Hasil penelitian menunjukkan bahwa rata-rata nilai tes dari 38 siswa (mengikuti tes) kelas VII-I yaitu 86 (berada pada taraf penguasaan materi baik), dengan banyaknya siswa yang lulus KKM adalah 34 siswa. Berdasarkan hasil penelitian ini, TGT layak dipertimbangkan sebagai alternative pembelajaran matematika pada pokok bahasan segi empat.

Translation as a skill and its place in The English Department of IKIP / Murdibjono

 

Pengaruh penggunaan strategi pembelajaran yang berbeda dan gaya belajar siswa terhadap peningkatan kemampuan mengingat kosakata Bahasa Inggris siswa kelas IV SDN Semayap 1 Kotabaru Kalimantan Selatan / oleh Ahmad Saini

 

Pengembangan metode tutor sebaya terbimbing pada layanan pembelajaran remidial (Remedial Teaching pada mata pelajaran Biologi siswa kelas XI IPA 1 SMA Negeri 1 Sutojayan, Blitar, Jawa Timur) / Nike Nuriansari

 

Kata Kunci: Pembelajaran Tutor Sebaya Terbimbing, Pembelajaran Remedial (Remedial Teaching) Remedial Teaching adalah suatu usaha untuk membetulkan dan menyembuhkan anak-anak yang mengalami kegagalan atau kesulitan belajar. Tujuan utama remedial teaching adalah pembetulan atau penyembuhan anak-anak yang menderita kesulitan-kesulitan belajar. Kelebihan penggunaan metode tutor sebaya adalah tidak ada persaingan antar siswa atau kelompok, karena mereka bekerjasama untuk menyelesaikan masalah dalam mengatasi cara berpikir yang berbeda. Alasan lain perlu diterapkannya metode ini karena dalam pelaksanaannya mampu menciptakan ruang psikologis yang nyaman bagi setiap anggota yang ada di dalamnya. Pada materi sistem pencernaan manusia terdapat 51% siswa yang mengalami remidi, sedangkan pada materi sistem pernapasan manusia terdapat 58% siswa yang mengalami remidi. Oleh karena itu, pengembang melakukan penelitian pengembangan metode pembelajaran tutor sebaya terbimbing pada layanan pembelajaran remedial (remedial teaching). Pengembangan metode yang dilakukan mengikuti model konseptual yang direkomendasikan oleh Thiagarajan yang disebut model 4D dengan langkahlangkah (1) Define (pendefinisian), (2) Design (perancangan), (3) Develop (Pengembangan), dan (4) Disseminate (Penyebaran). Pada pelaksanaan penelitian pengembangan ini hanya dilakukan 3 tahap saja yaitu Define, Design dan Develop Tahap Disseminate tidak dilakukan karena keterbatasan waktu, tenaga dan biaya. Produk akhir dari penelitian pengembangan ini adalah panduan pelaksanaan pembelajaran remedial (remedial teaching) dengan tutor sebaya. Pengukuran metode dilakukan melalui tahap validasi. Validasi tersebut meliputi validasi isi oleh para ahli dan validasi empirik di lapangan yakni guru, siswa dan observer. Berdasarkan hasil uji coba yang dilakukan, metode pembelajaran yang diproduksi dikategorikan valid (efektif dan efisien) untuk digunakan di sekolah, serta dapat meningkatkan motivasi belajar siswa. Kevalidan metode ini mencapai 82,32% dari ahli metode, 87,5% dari ahli materi, 79,17% dari guru, 81,94% dari siswa pada materi sistem pencernaan manusia dan 89,51% dari siswa pada materi sistem pernapasan manusia. Pada materi sistem pencernaan manusia masih terdapat 1 siswa yang belum mencapai KKM, sedangkan pada materi sistem pernapasan manusia masih terdapat 3 siswa yang belum mencapai KKM. Berdasarkan hasil yang diperoleh setelah pelaksanaan pembelajaran remedial (remedial teaching) dengan menggunakan metode tutor sebaya terbimbing dapat membuktikan bahwa metode pembelajaran yang diproduksi mampu memberikan hasil yang nyata terhadap peningkatan skor hasil belajar siswa.

Perancangan software piston mobil dan komponen lainnya menggunakan visual basic sebagai media pembelajaran / oleh Novia Riza

 

Mutu organoleptik produk surimi ikan lele dumbo dengan penambahan flavour udang / oleh Agnes Istiyaningsih

 

Pengaruh implementasi kurikulum tingkat satuan pendidikan (KTSP) dengan sistem kredit semester (SKS) dan kebiasaan belajar siswa terhadap prestasi belajar siswa kelas XI jurusan IPS di SMA 2 Negeri Malang / Giyanti Novita Sari

 

Kata Kunci: Implementasi KTSP dengan SKS, Kebiasaan Belajar, dan Prestasi. Pendidikan merupakan pilar atau pondasi utama untuk membangun manusia berkualitas dan merupakan salah satu aspek penting dalam kehidupan di negara kita. Pendidikan merupakan salah satu sarana untuk mencapai tujuan nasional, sehingga peningkatan mutu pendidikan perlu dilakukan agar tujuan nasional tersebut dapat diwujudkan. Upaya yang dilakukan pemerintah dalam meningkatkan mutu pendidikan salah satunya melalui peningkatan prestasi belajar siswa. Prestasi belajar dipengaruhi oleh beberapa faktor, diantaranya adalah implementasi KTSP dengan SKS dan kebiasaan belajar. Kurikulum berperan penting dalam meningkatkan prestasi siswa. KTSP disusun dan dilaksanakan oleh masing-masing satuan pendidikan yang didalamnya memuat pengaturan beban belajar dengan Sistem Kredit Semester (SKS). Sejauh mana efektifitas KTSP dengan SKS tersebut diterapkan di sekolah sehingga mampu menunjang siswa untuk berprestasi. Selain itu prestasi belajar siswa dipengaruhi oleh kebiasaan belajarnya. Agar dapat memperoleh prestasi yang baik, maka dalam kegiatan belajarnya siswa harus mempunyai sikap dan cara belajar yang baik. Penelitian ini bertujuan mengetahui pengaruh secara parsial implementasi KTSP dengan SKS terhadap prestasi belajar siswa akan meningkat jika implementasi KTSP dengan SKS benar-benar efektif dan kebiasaan belajar yang baik, oleh karena itu siswa diharapkan mampu tasi dan kebiasaan belajar terhadap prestasi, juga pengaruh dominan implementasi KTSP dengan SKS dan kebiasaan belajar terhadap prestasi siswa kelas XI jurusan IPS di SMA Negeri 2 Malang. Populasi dalam penelitian ini adalah seluruh siswa kelas XI jurusan IPS yang berjumlah 104 siswa. Sampel yang digunakan dalam penelitian ini berjumlah 59 siswa. Jenis penelitian yang digunakan adalah penelitian deskriptif korelasional, teknik pengumpulan data menggunakan kuesioner dan dokumentasi. Teknik analisis data menggunakan regresi linier berganda. Hasil penelitian menunjukkan bahwa secara parsial implementasi KTSP dengan SKS dan kebiasaan belajar mempunyai pengaruh positif terhadap prestasi siswa kelas XI jurusan IPS di SMA Negeri 2 Malang, hal tersebut dapat di lihat dari nilai masing-masing thitung 4,382 dan 3,520. Diketahui secara simultan motivasi dan kebiasaan belajar juga berpengaruh positif terhadap prestasi siswa kelas XI jurusan IPS ddi SMA Negeri 2 Malang dengan diperoleh nilai Fhitung sebesar 24,187. Hasil penelitian ini juga menunjukkan bahwa variabel yang berpengaruh dominan adalah variabel implementasi KTSP dengan SKS (X1). Saran yang dapat diberikan yaitu: (1) Bagi pihak sekolah, agar fasilitas belajar di sekolah dilengkapi sehingga siswa dapat melaksanakan kegiatan belajar dengan lebih baik, (2) Guru senantiasa memberikan dorongan agar siswa memperbaiki kebiasaan belajar mereka dengan cara menciptakan kondisi belajar yang menyenangkan (3) Siswa diharapkan mampu mengikuti kegiatan belajar mengajar dengan baik dengan adanya implementasi KTSP dengan SKS.

Pengembangan motivasi belajar siswa berprestasi anak Tenaga kerja Indonesia (studi kasus pada siswa sekolah dasar di Kabupaten Blitar) / Dian Fitri Nur Aini

 

ABSTRAK NurAini, Dian Fitri. 2016. PengembanganMotivasiBelajarSiswaBerprestasiAnakTenagaKerja Indonesia (StudiKasuspadaSiswaSekolahDasar di KabupatenBlitar). Tesis. Program StudiPendidikanDasar, PascaSarjana, UniversitasNegeri Malang. Pembimbing (I) Prof. Dr. Fattah Hanurawan, M.Si. M.Ed., (II) Prof. Dr. Hariyono, M.Pd. Kata Kunci: motivasibelajar, siswaberprestasi, SekolahDasar, tenagakerja Indonesia. BerdasarkanstudipendahuluanditemukanfaktabahwasiswaSekolahDasar di KabupatenBlitar yang merupakananakdaritenagakerja Indonesia memilikiprestasibelajar yang baikmeskipuntanpapendampingan orang tua yang lengkap. Setelahdilakukanstudipendahuluanlebihdalam, ketercapaianprestasibelajarsiswasalahsatunyadipengaruhiolehmotivasibelajar. Penelitianinibertujuanuntukmendeskripsikanpengembanganmotivasibelajarsiswaberprestasi yang merupakananakdaritenagakerja Indonesia padaSekolahDasar di KabupatenBlitar. Deskripsipengembanganmotivasidikaitkandenganbeberapapemenuhankebutuhanbelajarsiswa, yaitu: kebutuhanfisiologis, kebutuhan rasa aman, kebutuhan rasa cinta, kebutuhanpenghargaandirisertakebutuhanaktualisasidiri. Penelitianinimenggunakanpendekatankualitatifdenganrancanganstudikasus. Dalampenelitianini, penelitibertindaksebagaiinstrumenkunci. Data yang digunakandalampenelitianiniberupakata-kata dantindakan. Sumber data dalampenelitianinisatusiswakelas IV, satusiswakelas V, dansatusiswakelas VI. Penelitianinimenggunakantigateknikpengumpulan data, yaitu: observasi, wawancaradantelaahdokumen. Tahapananalisis data dalampenelitianiniyaitu: pertama, manajemen data untukmemahamikeseluruhan. Kedua, membacadanmembuat memo untukmemahamiunit bermaknadari data. Ketiga, mendeskripsikan, mengklasifikasikandanmenafsirkan data menjadikodedantema. Keempat, menyajikandanmemvisualisasi data. Penelitianinimenggunakanpengecekankeabsahan data dengantriangulasi data. Berdasarkanpaparanhasilanalisis data dantemuanpenelitiansertapembahasandisimpulkanbahwapengembanganmotivasibelajarsiswaberprestasi yang merupakananaktenagakerja Indonesia dapattercapaidenganpemenuhanbeberapakebutuhanbelajarsiswa di rumahdan di sekolah. Pertama, kebutuhanfisiologis yang terkaitdengankebutuhandasardanpokoksiswa yang dapatmenunjangkeberlangsungan proses belajarnya. Kedua, kebutuhan rasa aman yang berkaitandengankeamananfisikdankeamanan yang bersifatpsikologis. Ketiga, kebutuhan rasa cinta yang berkaitandenganinteraksisiswadenganindividu di lingkungannya. Keempat, kebutuhanpenghargaandiri yang berkaitandenganreinforcementdanumpanbalikkepadasiswa. Kelima, kebutuhanaktualisasidiri yang berkaitandenganpengembanganpotensisecarasistematik. Pemenuhanberbagaikebutuhanbelajarsiswatersebutmenunjukkanketerkaitannyadenganpeningkatanmotivasibelajarnya. Pertama, kebutuhanfisiologisbelajarsiswa di rumahdihayatiberdasarkanpemenuhannutrisimakanansiswa; pakaianseragam yang dikenakan; kebutuhanfinansialterkaituangsakudankeikutsertaan les; danwaktuistirahatsiswa. Sedangkankebutuhanfisiologis di sekolahdihayatidengankeberadaankantinsekolah yang memadai, ruangkelas yang memadai, danwaktuistirahat yang cukupbagisiswa. Kedua, kebutuhan rasa aman di rumhdihayatidenganpendampinganbelajaroleh orang tuadanpenataantempatbelajar yang nyaman. Sedangkankebutuhan rasa aman di sekolahdihayatidenganpengendaliansikapsiswa di kelassertasikap guru dalampembelajaran. Ketiga, kebutuhan rasa cinta di rumahdihayatidenganperhatian orang tuadankomunikasi yang terjalinantara orang tuadananak. sedangkanpadalingkungansekolah, kebutuhan rasa cintadihayatidenganterjalinnyahubunganbaikantara guru dansiswasertasiswadengantemannya. Keempat, kebutuhanpenghargaandiri di rumahdihayatidenganpemberian reinforcement positif, kepercayaan orang tuadanpemberiaanhadiah. Sedangkankebutuhanpenghargaandiri di sekolahdihayatidenganpenilaiandanumpanbalik yang diresponoleh guru. Kelima, kebutuhanaktualisasidiri di rumahdihayatidengandukunganpengembanganhobidancita-citasiswa. Sedangkan di lingkungansekolah, kebutuhanaktualisasidiridihayatidenganpanduanbelajar, sikaphumanistik guru sertadukunganterhadapminatsiswa. Berdasarkanhasilpenelitiandisarankanbagi: pertama, orang tua. Hasilpenelitianinimemberikanpengetahuankepadaorangtuatentangpengembanganmotivasibelajarsehinggadapatdijadikansebagairujukanuntukkebutuhanpendampinganterhadappendidikananakpadausiasekolahdasar.Kedua, guru. Hasilpenelitininidapatdigunakansebagaibahanpertimbanganbagi guru untukmemberikankonselingterhadapanaktenagakerja Indonesiadalammemberikanmotivasiagar dapatmeningkatkanpembelajaransiswasertabahanpengetahuanbagi guru tentangkarakteristikanakdidiknyasehinggadapatmemahamikebutuhansiswadalambelajar.Ketiga, peneliti. Hasilpenelitianinimemberikandeskripsikajiantentangpengembanganmotivasibelajarsiswaberprestasianaktenagakerja Indonesia sehinggadapatdijadikansebagairujukanuntukkeperluanpenelitianselanjutnya. Keempat, praktisipendidikan. Hasilpenelitianinimemberikandeskripsikajiantentangmotivasibelajarsiswaberprestasianaktenagakerja Indonesia sehinggadapatdijadikanrujukanuntukmembuatkebijakanberkenaandenganpeningkatankualitaspembelajaran.

Pengaruh kualitas produk terhadap keputusan pembelian konsumen : studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang pengguna kartu seluler simpati / oleh Eka Wijayanti

 

Pengaruh minat pada profesi guru dan motivasi belajar terhadap prestasi belajar mahasiswa program studi pendidikan ekonomi angkatan 2009-2010 fakultas ekonomi Universitas Negeri Malang / Putri Anita Wulandari

 

Kata kunci: kepentingan pengajaran profesi, motivasi belajar, belajar prestasi Universitas Negeri Malang, karena banyak universitas di Indonesia, adalah dituntut untuk mempersiapkan siswa untuk menjadi warga sipil besar yang memiliki akademik kemampuan dan menerapkannya. Berdasarkan pada masalah itu, didirikan Program Studi beberapa dari berbagai disiplin ilmu, seperti Program Pendidikan Ekonomi. Dalam Program ini, siswa tidak hanya mendapatkan ekonomi, tetapi juga program pendidikan. Pada kenyataannya, banyak siswa tahun 2009-2010 tidak memiliki antusias untuk menjadi guru dan tertinggi motivasi dalam studi. Dalam rangka untuk menciptakan penelitian yang relevan, 187 mahasiswa tahun 2009-2010 yang digunakan sebagai populasi, dari populasi yang kita pilih 127 sampel menggunakan proporsional random sampling. Data prestasi belajar telah diambil dari Biro Administrasi Akademik Kemahasiswaan Dan INFORMASI (biro AAKPSI) dan kuesioner yang diberikan kepada siswa adalah tentang mengajar minat profesi dan motivasi belajar. Setelah data telah sebaran, peneliti membuat validitas, reliabilitas, normalitas, uji multikolinieritas, uji heteroskedastisitas, dan uji regresi. Itu Hasilnya adalah, signifikan X1 adalah 0,004, signifikan dari X2 adalah sekitar 0,003 dan signifikan X3 adalah 0,245. Hasil korelasi antusiasme guru 0,482, motivasi intrinsik adalah 0,494 dan motivasi ekstrinsik adalah 0.335. Skor signifikan F 0,000 <0,05. Berdasarkan hasil penelitian, menunjukkan bahwa sebagian kepentingan dalam profesi guru berpengaruh signifikan terhadap prestasi belajar, pengaruh motivasi belajar berpengaruh secara signifikan terhadap prestasi belajar, kecuali ekstrinsik motivasi. Sekaligus efek bunga dalam pengajaran profesi dan motivasi belajar berpengaruh secara signifikan terhadap prestasi belajar. Akhirnya, diharapkan dosen untuk memotivasi mahasiswa ekonomi sebagai calon guru, dengan memberikan gambaran bahwa profesi guru adalah menyenangkan, sehingga dapat meningkatkan minat siswa untuk menjadi guru. Serta diharapkan untuk dosen untuk memperketat skor untuk siswa khususnya Program Pendidikan Ekonomi.

Studi korelasi prestasi belajar dengan prestasi Pendidikan Sistem Ganda (PSG) pada siswa kelas II Program Keahlian Sekretaris SMK Negeri 1 Malang tahun pelajaran 2004-2005 / oleh Gita Andriani

 

Studi tentang proses pembuatan pakaian jadi batik tulis di "Andis Batik Druju" / Anggrek Puspitasari S

 

Kata Kunci: Proses, Pakaian Batik Tulis Batik merupakan kebudayaan asli Indonesia yang memiliki nilai seni dan budaya yang tinggi. Sehingga batik mudah diterima oleh masyarakat domestik dan mancanegara. Perkembangan batik saat ini mengalami banyak perubahan dan berkembang dengan cepat. Banyak pengrajin batik di berbagai daerah yang berlomba-lomba menciptakan motif dan teknik yang semakin kreatif dan inovatif. Desa Druju merupakan suatu tempat terciptanya motif-motif dan teknik membatik yang inovatif, yang dihasilkan oleh bapak Eddi Subagio dan ibu Antik Subagio sebagai pengusaha batik. Teknik pembuatan batik Druju berbeda dengan pembuatan batik pada umumnya. Media yang digunakan oleh Andis Batik Druju adalah pakaian bukan selembar kain, sehingga motif yang dihasilkan dapat menyambung pada semua bagian yaitu bagian sisi badan, sisi lengan, kerung lengan, bahu, tengah muka, dan tengah belakang. Selain teknik pembuatan yag berbeda, Andis Batik Druju juga menghasilkan warna hitam yang berbeda yaitu warna hitam yang benar-penar hitam pekat. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Prosedur pengumpulan data menggunakan metode observasi, wawancara, dan dokumentasi. Analisis data menggunakan tiga tahapan yaitu mereduksi data, menyajikan data, dan menarik kesimpulan. Pengecekan keabsahan data menggunakan triangulasi sumber data dan ketekunan pengamatan. Berdasarkan temuan peneliti dilapangan maka: (1) Andis Batik Druju ada sejak tahun 1996, setelah bapak Eddi Subagio merantau keberbagai daerah penghasil batik dan beliau memberanikan diri untuk menciptakan batik dengan motif dan karakteristik yang berbeda; (2) Motif yang dihasilkan Andis Batik Druju menyambung pada semua bagian karena media yang digunakan untuk membatik adalah pakaian (seperti: kemeja, blus, dan gaun; (3) Tahapan dalam Proses pembuatan pakaian batik tulis di Andis Batik Druju antara lain: membuat desain (busana dan motif batik), produksi pakaian, membuat pola motif batik pada pakaian, dan proses membatik; (4) Warna hitam yang dihasilkan oleh Andis Batik Druju merupakan warna hitam yang benar-benar hitam pekat. Saran yang dikemukakan dalam penelitian ini adalah: (1) Produk yang dihasilkan Andis Batik Druju lebih bervariasi; (2) Pada saat mencuci pakaian batik, jangan digosok karena secara otomatis warna akan larut sehingga warna terlihat kusam. Pakaian batik dijemur ditempat yang teduh, jangan manjemur pakaian batik di bawah sinar matahari.

Pengaruh harga, merek, dan kualitas produk terhadap minat pembelian konsumen produk sepeda motor merek Yamaha (studi pada kepala keluarga di Dusun Bendungan Desa Landungsari) / Wanda Meilia Citraningrum

 

Kata Kunci :harga, merek, kualitas produk, minat pembelian Harga yang ditawarkan sebuah produk tentu akan sangat berbeda-beda. Konsumen dalam menyikapi varian harga yang ditawarkan tersebut pasti akan menyesuaikan dengan kemampuan daya beli disamping mempertimbangkan tentang kebutuhan akan produk tersebut. Selain harga, merek juga merupakan hal yang mempengaruhi konsumen dalam memilih sebuah produk. Sebuah produk dikatakan memiliki merek yang unggul apabila merek mudah diingat, mudah dikenali, dipertimbangkan sebagai alternatif pilihan, dan masih mengingat ketika menggunakan produk lain. Selain harga dan merek, kualitas juga merupakan hal yang sangat dipertimbangkan. Dengan adanya kualitas yang baik maka kebutuhan serta kepuasan konsumen akan terpenuhi dengan baik. Tujuan dari penelitian ini adalah untuk mengetahui variabel-variabel yang mempengaruhi minat pembelian konsumen. Penelitian ini mempuyai 4 variabel, yaitu 3 variabel bebas diantaranya harga (X1), merek (X2), dan kualitas produk (X3) dan variabel terikat (Y) adalah minat pembelian. Penelitian ini merupakan penelitian asosiatif kausalitas. Populasi dalam penelitian ini adalah kepala keluarga di Dusun Bendungan Desa Landungsari yang biasanya sebagai pembuat keputusan dalam memilih sebuah produk. Sedangkan sampel dalam penelitian ini adalah 100 responden. Sampel diambil dengan menggunakan teknik Accidental sampling. Pengambilan jumlah sampel tersebut karena keterbatasan peneliti dalam hal tenaga, biaya dan waktu. Hasil penelitian ini menyimpulkan bahwa: (1) terdapat pengaruh harga secara parsial terhadap minat pembelian sepeda motor merek Yamaha di Dusun Bendungan Desa Landungsari dengan nilai B=0,230; thitung=2,059; dan Signifikansi t=0,042; (2) terdapat pengaruh merek secara parsial terhadap minat sepeda motor merek Yamaha di Dusun Bendungan Desa Landungsari dengan nilai B=0,476; thitung=6,103; dan Signifikansi t=0,000; (3) tidak terdapat pengaruh kualitas produk secara parsial terhadap minat pembelian sepeda motor merek Yamaha di Dusun Bendungan Desa Landungsari dengan nilai B=-0,095; thitung=-0,667; dan Signifikansi t=0,506; dan (5) terdapat pengaruh variabel bebas secara simultan terhadap minat pembelian sepeda motor merek Yamaha di Dusun Bendungan Desa Landungsari dengan nilai Fhitung=14,350; dan Signifikansi F=0,000; R=0,556; R square =0,310; dan Adjusted R Square=0,288. Saran yang dapat diberikan berkaitan dengan temuan yang diperoleh selama pelaksanaan penelitian ini adalah: (1) Sepeda motor merek Yamaha telah memiliki harga yang sesuai dengan kemampuan konsumen, merek yang unggul, dan kualitas produk yang baik, oleh karena harus tetap dijaga dan dipertahankan dengan cara menciptakan produk yang mengutamakan standar mutu dan kualitas yang bagus ketika barang hendak dipasarkan. Dengan harga, merek dan kualitas produk yang baik dan dapat diterima oleh konsumen maka dapat menjaga loyalitas konsumen sehingga tetap menggunakan sepeda motor merek Yamaha. (2) Ketatnya persaingan di pasar sepeda motor, maka produsen sepeda motor merek Yamaha harus tetap menjaga konsistensi harga yang sesuai dengan kemampuan konsumen, merek yang unggul dan kualitas produk yang baik serta mengikuti perubahan yang terjadi dengan tetap menjaga keunggulan produk. Perusahaan harus secara inovatif memperbaiki dan meningkatkan mutu produk sesuai dengan perkembangan yang disesuaikan dengan permintaan pasar. Karena mempertahankan pelanggan sangatlah penting bagi keberlangsungan perusahaan. (3) Peneliti menyarankan dalam penelitian selanjutnya agar objek penelitian yang diambil lebih baik, yaitu masyarakat umum dari berbagai golongan baik usia, jenis kelamin, dan tempat penelitian yang lebih luas supaya data penelitian yang diperoleh lebih valid dan ruang lingkupnya lebih luas. (4) Bagi peneliti selanjutnya disarankan dalam mengukur minat pembelian yang belum diketahui secara pasti tidak menggunakan rumus Slovin, akan tetapi menggunakan rumus infinitive population dari Daniel dan Terrel. (5) Bagi peneliti selanjutnya disarankan untuk menambah jumlah variabel selain harga, merek, dan kualitas produk. Selain itu menyempurnakan kekurangan-kekurangan dalam penelitian ini dan dapat dijadikan dasar pertimbangan ilmiah bagi kesempurnaan yang ada. Perlu perhatian lebih mengenai permasalahan mengapa kualitas produk tidak berpengaruh terhadap minat pembelian sepeda motor merek Yamaha dalam penelitian ini. (6) Bagi peneliti selanjutnya juga disarankan untuk mencari solusi terkait permasalahan mengapa kualitas produk tidak berpengaruh terhadap minat pembelian, mengingat kualitas produk merupakan variabel yang seringkali dipertimbangkan sebelum memilih sebuah produk.

Studi model dan jenis pelatihan di Balai Latihan Kerja Industri (BLKI) Kecamatan Singosari Kabupaten Malang / oleh Moh. Aria Herma P.

 

Keefektifan program penyelenggaraan masa orientasi siswa di sekolah lanjutan tingkat atas se-kecamatan Patianrowo Kabupaten Nganjuk / Ulfa Diyah Rizkiani

 

Kata Kunci: Keefektifan, Masa Orientasi Sekolah, Sekolah Lanjutan Tingkat Atas Setiap tahun pelajaran baru, pada setiap jenjang pendidikan selalu melaksanakan beberapa kegiatan, terutama dalam menyambut hadirnya peserta didik baru. Suatu kegiatan rutin yang dilaksanakan oleh sekolah adalah dengan melaksanakan orientasi bagi peserta didik baru. Hal ini dilakukan untuk mengenalkan lingkungan fisik dan lingkungan sosial kepada peserta didik baru, agar mereka dapat beradaptasi dan berprestasi di sekolah. Dengan demikian, dalam kegiatan Masa Orientasi Siswa (MOS) diperlukan kegiatan yang dapat mengubah pola pikir peserta didik, sehingga dapat lebih dewasa dalam bertindak. Tujuan penelitian ini adalah: (1) untuk mengetahui materi yang diberikan pihak sekolah pada MOS, (2) untuk mendeskripsikan keefektifan pelaksanaan MOS, (3) untuk mengemukakan tingkat adaptasi peserta didik terhadap sekolahnya pasca kegiatan MOS di Sekolah Lanjutan Tingkat Atas se–Kecamatan Patianrowo, Kabupaten Nganjuk. Penelitian ini merupakan penelitian deskriptif yang menggunakan pendekatan kuantitatif, dengan metode survai. Populasi dalam penelitian ini adalah siswa Sekolah Lanjutan Tingkat Atas se–Kecamatan Patianrowo yang berjumlah 957 siswa. Sampel yang digunakan sebanyak 137 siswa diambil dengan teknik Purposive Sampling dan Proportional Random Sampling dari teknik pertama. Metode pengumpulan data yang digunakan adalah angket dan analisis dengan teknik prosentase. Hasil penelitian ini menunjukkan: materi kegiatan MOS secara garis besar sudah sesuai yang mencakup materi wajib dan materi pilihan. Materi wajib meliputi materi tata krama dan tata tertib, pengetahuan mengenai materi tambahan, materi mengenai visi misi sekolah, materi Wawasan Wiyata Mandala, materi pengenalan kurikulum, dan cara belajar siswa. Sedangkan materi pilihan sesuai dengan keadaan dan keinginan sekolah. Kesan peserta didik terhadap materi MOS cukup beragam, sesuai dengan tingkat pemahaman, cara menilai keadaan, dan kepribadian peserta didik itu sendiri. Penyampaian materi sudah sesuai dengan ketentuan, yaitu materi wajib dan materi pilihan. Sebanyak 98% responden menyatakan waktu pelaksanaan kegiatan sudah sesuai dengan aturan yang berlaku yakni pada Bulan Juli. Pengelolaan kegiatan atau kegiatan kepanitiaan, sebagian besar responden (63% responden) merasa panitia sudah bekerja secara optimal. Rata-rata metode yang digunakan dalam kegiatan MOS adalah metode ceramah dengan berbagai kombinasi (simulasi, diskusi, ii penugasan). Sebanyak 75% responden menganggap kegiatan MOS sudah optimal. Tingkat kebermanfaatan kegiatan MOS dinilai bermanfaat oleh 96% responden. Dalam kemampuan adaptasi, secara keseluruhan dari 137 responden cenderung menyatakan mampu beradaptasi dengan jenjang barunya melalui kegiatan MOS, yang meliputi lingkungan sekolah 42% responden, teman sebaya 21% responden, cara berfikir dan belajar 12% responden, sedangkan 25% responden memilih kombinasi dari ketiganya. Berdasarkan kesimpulan penelitian, maka saran ditujukan kepada: (1) pembina OSIS, harus mampu untuk menciptakan dan menggerakkan baik panitia maupun peserta kegiatan MOS untuk melaksanakan kegiatan MOS, sehingga dapat mewujudkan kegiatan MOS yang tepat sasaran dan lebih memberikan nilai pembelajaran diri bagi peserta didik yang mengikuti kegiatan MOS; (2) Wakil kepala sekolah bidang kesiswaan diharapkan dapat menimbang dan mengembangkan kegiatan MOS serta dapat lebih meningkatkan pengawasan pelaksanaan kegiatan MOS; (3) Kepala sekolah diharapkan dapat memantau kegiatan MOS baik sebelum maupun sesudah pelaksanaan kegiatan MOS, sehingga dapat berjalan sesuai dengan tujuan yang ditetapkan dan tidak terjadi hal-hal yang tidak diinginkan; (4) peserta didik, harus mampu memahami dan melaksanakan tujuan pelaksanaan MOS sehingga peserta didik mampu beradaptasi dan berprestasi dalam pendidikan barunya; dan (5) peneliti lain, diharapkan dapat digunakan sebagai masukan dan bahan referensi untuk melaksanakan penelitian selanjutnya serta menyempurnakan penelitian ini.

Pengaruh kualitas pelayanan terhadap kepuasan konsumen pada swalayan fatur Madiun / oleh Irmalia Soesi Anggrahini

 

Implementasi pembelajaran kooperatif model make a match untuk meningkatkan belajar siswa kepada mata diklat kewirausahaan / Agha Vananda Yoel

 

Kata Kunci : Model Pembelajaran Make a Match, Hasil Belajar. Hasil Penelitian ini bertujuan untuk menerapkan Model Pembelajaran Make a Match pada mata pelajaran kewirausahaan dan sebagai upaya untuk meningkatkan hasil belajar siswa. Subyek penelitian ini adalah siswa kelas XI Administrasi Perkantoran SMK Ardjuna 1 Malang tahun ajaran 2011/2012 yang berjumlah 27 siswa. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) dengan menggunakan pendekatam yang bersifat kualitatif deskriptif, sumber data dari penelitian ini adalah primer yang diperoleh langsung dari pengumpulan data dilakukan oleh peneliti dibantu oleh tiga pengamat. Hasil catatan lapangan, observasi aktivitas guru dan siswa di SMK Ardjuna 1 Malang dianalisis melalui 3 tahap, yaitu: reduksi data, paparan data dan kemudian penarikan kesimpulan. Penelitian ini dilakukan pada tanggal 2 April sampai 30 April 2012, terdapat dua tahap yaitu siklus I dan siklus II. Hasil penelitian menunjukkan adanya peningkatan aktivitas siswa siklus I ke siklus II yang dapat diukur dari hasil observasi aktivitas siswa siklus I sebesar 84,79% dan siklus II sebesar 97,43%, terjadi peningkatan sebesar 12,64%. Pada aspek afektif juga terjadi peningkatan, dari siklus I sebesar 71,1% ke siklus II sebesar 84,4%, terjadi rata-rata presentase peningkatan sebesar 13,3%. Hasil penelitian juga menunjukkan adanya peningkatan hasil belajar pada aspek kognitif (pre-test dan post-test) yaitu pada siklus I setelah dilakukan tindakan rata-rata presentase kelulusan belajar 79%, pada siklus II setelah dilakukan tindakan rata-rata presentase kelulusan belajar 81,5%. Dari hasil penelitian ini dapat disimpulkan bahwa Model pembalajaran ini bisa dijadikan alternatif pilihan Model Pembelajaran di kelas walau terdapat kesulitan dalam penerapan model pembelajaran Make a Match tetapi penelitian ini mampu meningkatkan hasil belajar Siswa Kelas XI Administrasi Perkantoran SMK Ardjuna 1 Malang.

Simulasi evolusi vorteks menuju keseimbangan energi bebas GL pada superkonduktor mesoskopik berdasarkan model Ginzburg-Landau / Siti Alfiah Ilmiawati

 

Kata Kunci: Kurva magnetisasi, Jumlah vorteks, Medan magnet luar, Temperatur, TDGL Persamaan TDGL banyak digunakan untuk mengkaji karakteristik dan dinamika vorteks pada bahan superkonduktor, terutama superkonduktor tipe II karena aplikasinya yang sangat luas. Selain TDGL, ada beberapa model yang membahas tentag dinamika vorteks, salah satunya adalah Model Quantum Makroskopik (MQM). Salah satu kelebihan model GL dibanding MQM adalah dapat dengan sukses mendiskripsikan fenomena superkonduktivitas yang merupakan integrasi dari perilaku elektrodinamika, mekanika kuantum, dan termodinamika Dinamika vorteks ini sangat bergantung pada geometri bahan, seperti bentuk bahan dan ukurannya. Selain itu temperatur kritis juga mempengaruhi dinamika vorteks dari suatu bahan. Dengan adanya dinamika bahan ini, maka dapat dijadikan sebagai acuan untuk lebih mendalami aplikasi lain dari bahan superkonduktor. Penelitian ini bertujuan untuk mengetahui simulasi vorteks menuju keseimbangan energi bebas GL dengan menggunakan model TDGL (Time Dependent Ginzburg-Landau). Dengan mengkondisikan bahan mesoskopik (berorde nano) dan dibuat simulasi dinamika vorteks bagi bahan berukuran , 3 , dan 4 dengan variasi temperatur untuk masing-masing bahan T = 0 Tc, T = 0,125 Tc, dan T = 0,25 Tc. Program ditulis dan dijalankan dengan Fortran 90 dengan sistem linux IBM X3400 M2. Hasil penilitian menunjukkan bahwa: (1) karakteristik kurva magnetisasi sebagai fungsi medan magnet luar M - He dipengaruhi oleh temperatur (2) karakteristik kurva jumlah vorteks sebagai fungsi medan magnet luar M – Nv dipengaruhi oleh temperatur (3) Evolusi dinamika vorteks menuju keseimbangan bergantung pada ukuran bahan dan temperatur. Dengan variasi temperatur, pada bahan berukuran tidak terdapat vorteks, untuk bahan berukuran hanya terdapat satu vorteks, dan untuk bahan berukuran terdapat tiga vorteks pada temperatur T = 0 Tc dan T = 0,125 Tc yang membentuk sebuah giant vorteks. Sedangkan pada T = 0,25 Tc hanya terdapat dua vorteks.

Pengaruh struktur modal terhadap rentabilitas pada perusahaan manufaktur yang listing di BEJ (Bursa Efek Jakarta) / oleh Isna Noor Jana

 

Faktor-faktor penunjang minat berwirausaha pada mahasiswa S1 pendidikan teknik bangunan (PTB) fakultas teknik universitas Negeri Malang / Devia Rahmasari M.

 

Kata kunci: faktor penunjang, minat berwirausaha. Tujuan dari penelitian ini adalah untuk mengetahui variabel-variabel faktor penunjang yang mempengaruhi minat berwirausaha. Penelitian ini mempunyai dua variabel, yaitu variabel bebas (X) dan variabel terikat (Y). Variabel bebas (X) terdiri dari pola pikir (X1), keterampilan (X2), sikap mental (X3), instuisi (X4), lingkungan keluarga (X5), lingkungan pendidikan (X6) sedangkan variabel terikatnya (Y) adalah minat berwirausaha. Penelitian ini merupakan penelitian deskriptif. Penelitian ini berusaha untuk menjelaskan kondisi dan pengaruh faktor-faktor penunjang secara parsial maupun secara simultan terhadap minat berwirausaha pada mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang. Populasi dalam penelitian ini adalah para mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang yang registrasi tahun 2010/2011 Sedangkan sampel dalam penelitian ini adalah 87 responden. Sampel diambil dengan menggunakan teknik Random sampling. Kondisi faktor-faktor penunjang (pola pikir, keterampilan, sikap mental, instuisi, lingkungan keluarga, dan lingkungan pendidikan) dan minat berwirausaha pada mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang yang registrasi tahun 2010/2011 sudah baik. Hasil penelitian ini adalah: (1) terdapat pengaruh pola pikir secara parsial minat berwirausaha pada mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang, tidak terdapat pengaruh keterampilan secara parsial minat berwirausaha pada mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang, tidak terdapat pengaruh sikap mental secara parsial minat berwirausaha pada mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang, terdapat pengaruh instuisi secara parsial minat berwirausaha pada mahasiswa S1 PTB Fakultas Teknik Universitas Negeri Malang; (2) variabel yang dominan mempengaruhi minat berwirausaha adalah pola pikir. Hal ini dikarenakan pola pikir memiliki Sumbangan Efektif (SE) terbesar yaitu 22,5%. Dan nilai koefisien determinasi (R2) secara simultan yang ditunjukkan dengan adjusted R square bernilai 0.270.

Rancang bangun alat pengukur kadar air dan suhu gabah untuk menunjukkan perkiraan masa simpan dengan aplikasi mikrokontroler AT89C51 / oleh Ihda Shofia Rahmatunnisa

 

Pengaruh financial leverage dan net profit margin terhadap perataan laba pada perusahaan property dan real estate yang terdaftar di bursa efek Indonesia / Hesti Apriliatul Fitri

 

Kata Kunci: Perataan Laba, Financial Leverage, dan Net Profit Margin Perataan Laba (Income Smoothing) adalah cara yang digunakan manajemen untuk mengurangi fluktuasi laba yang dilaporkan agar sesuai dengan target yang diinginkan baik secara artifisial (melalui metode akuntansi) maupun secara riil (melalui transaksi) serta meningkatkan kemampuan investor untuk meramalkan kas dimasa yang akan datang. Tindakan perataan laba dianggap sebagai tindakan yang umum dilakukan oleh manajemen untuk mencapai maksudmaksud tertentu. Namun demikian praktik ini telah dikritik oleh banyak pihak karena dapat menyebabkan disclosure dalam laporan keuangan menjadi tidak memadai. Akibat selanjutnya, laporan keuangan tidak lagi mencerminkan keadaan sebenarnya mengenai hal-hal yang terjadi di perusahaan yang seharusnya perlu diketahui oleh pemakai laporan keuangan. Penelitian ini bertujuan untuk menguji pengaruh financial leverage dan net profit margin terhadap perataan laba. Pemisahan antara perusahaan yang melakukan perataan laba dan yang tidak melakukan dengan menggunakan Index Eckel terhadap laba operasi. Sampel penelitian ini yaitu perusahaan property dan real estate yang terdaftar di Bursa Efek Indonesia dengan teknik pengambilan sampel purposive sampling atau berdasarkan kriteria yang telah ditentukan sehingga diperoleh sampel sebanyak 32 perusahaan dengan sub sampel sebanyak 96 laporan keuangan. Pengamatan dilakukan selama tiga tahun, yaitu 2009, 2010, 2011. Teknik analisis dilakukan dengan menggunakan metode analisis regresi linier berganda yang disesuaikan dengan metode penelitian ini. Berdasarkan hasil penelitian menunjukkan bahwa financial leverage tidak berpengaruh signifikan terhadap tindakan perataan laba, sedangkan net profit margin berpengaruh signifikan positif terhadap tindakan perataan laba. Saran yang dapat diberikan dalam penelitian ini yaitu, bagi investor sebaiknya sebelum menanamkan modal kedalam perusahaan harus mempertimbangkan dengan baik, artinya tidak hanya terpaku pada informasi laba saja. Bagi perusahaan dapat digunakan sebagai bahan pertimbangan dalam menentukan kebijakan-kebijakan yang akan dilakukan oleh perusahaan. Bagi peneliti selanjutnya sebaiknya menggunakan sampel yang lebih banyak, rentang waktu yang lebih lama, serta memasukkan variabel lain yang diperkirakan dapat mempengaruhi tindakan perataan laba. Bagi pemerintah diharapkan memiliki peraturan hukum yang tegas dan cukup mengikat serta lebih meningkatkan pengawasan (monitoring) terhadap perusahaan.

Analisis pengaruh rasio keuangan Camel terhadap profitabilitas pada 3 bank BUMN yang listing di BEJ tahun 2003-2008 (studi kasus pada bank BRI, BNI, Mandiri) / Diastining Utami Putri

 

Kata Kunci : Capital Adequacy Ratio (CAR), Loan to Deposit Ratio (LDR), Return on Equity (ROE), BOPO dan Return On Asset (ROA) Pengelolaan perbankan nasional yang baik serta pengawasan perbankan nasional yang diperketat sangat menunjang keberhasilan kinerja perbankan itu sendiri. Dalam pengelolaan dalam perbankan sendiri harus dilakukan secara professional, sehingga dapat memperoleh keuntungan, seperti tujuan utama lainnya bank didirikan yaitu selain sebagai lembaga intermediasi dan penghimpun dana, bank memiliki tujuan untuk memperoleh laba secara berkelanjutan. Penelitian ini bertujuan untuk menganalisis pengaruh Capital Adequacy Ratio (CAR), Loan to Deposit Ratio (LDR),Return on Equity (ROE), dan BOPO terhadap profitabilitas diukur dengan Return On Asset (ROA) serta melihat variabel rasio CAMEL mana yang paling dominan mempengaruhi ROA pada tiga perusahaan bank BUMN (BRI, BNI, Mandiri) yang terdaftar di Bursa Efek Indonesia periode 2003-2008. Data diperoleh dari Laporan Keuangan Publikasi yang diterbitkan oleh Bank Indonesia dengan periode waktu tahun 2003 hingga 2008. Teknik analisa yang akan dipakai dalam penelitian ini adalah regresi linier untuk memperoleh gambaran yang menyeluruh mengenai hubungan antara variabel satu dengan variabel yang lain. Program yang digunakan adalah program EViews 3.1 dengan model estimasi Fixed Effect Hasil penelitian menunjukkan bahwa variabel Capital Adequacy Ratio (CAR), Loan to Deposit Ratio (LDR) berpengaruh positif dan tidak signifikan dan Return on Equity (ROE) berpengaruh positif dan signifikan terhadap Return On Asset (ROA), selain itu BOPO berpengaruh negatif dan tidak signifikan terhadap Return On Asset (ROA) pada perusahaan perbankan. Hasil penelitian ini diharapkan bahwa variabel Capital Adequacy Ratio (CAR), Loan to Deposit Ratio (LDR), Return on Equity (ROE) dan BOPO, dapat dijadikan pedoman, baik oleh pihak manajemen perusahaan dalam pengelolaan perusahaan, maupun oleh para investor dalam menentukan strategi investasi.

Analisis faktor-faktor yang melatarbelakangi pengambilan keputusan memilih SMPN I Kecamatan Tanjunganom Kabupaten Nganjuk / Erfin Rusdiansyah

 

Kata kunci: pengambilan keputusan Masyarakat merupakan obyek pendidikan yang harus diperhatikan dalam perencanaan pendidikan. Hal tersebut dikarenakan masyarakat adalah tujuan dari adanya pelaksanaan pendidikan, yaitu sebagaimana tercantum dalam Undang-Undang Dasar bahwa tujuan pendidikan adalah mencerdaskan kehidupan bangsa. Dengan demikian perencanaan harus mempertimbangkan faktor-faktor masyarakat sebagai konsumen pelayanan jasa pendidikan. Penelitian ini memiliki tujuan untuk: (1) Memperoleh deskripsi objektif mengenai faktor-faktor apa saja yang secara signifikan melatarbelakangi pengambilan keputusan memilih SMPN 1 Tanjunganom. (2) Mengetahui seberapa besar sumbangan faktor-faktor hasil analisis faktor terhadap keputusan memilih SMPN 1 Tanjunganom. Penelitian ini mengunakan rancangan analisis faktor eksploratori yang bermaksud meringkas atribut-atribut yang melatarbelakangi pengambilan keputusan memilih SMPN 1 Tanjunganom menjadi faktor yang lebih sederhana. Kesimpulan penelitian ini adalah (1) atribut-atribut yang melatarbelakangi keputusan memilih SMPN 1 Tanjunganom, yaitu: fasilitas pembelajaran yang lengkap, program pendidikan sekolah yang bagus, masa depan yang baik untuk melanjutkan sekolah, tenaga pendidik yang berkualitas, prestasi sekolah yang terkenal, murahnya biaya pendidikan, biaya transportasi yang murah untuk menuju sekolah, kemampuan yang dimiliki siswa untuk sekolah, bakat yang dimiliki siswa, kondisi sosial ekonomi keluarga, jumlah peminat yang banyak pada program pendidikan, daya tampung program pendidikan yang besar, adanya penghargaan terhadap prestasi yang dicapai siswa, adanya kegiatan ekstrakurikuler yang menarik, adanya informasi program pendidikan dari brosur ataupun pamflet, adanya informasi program pendidikan dari media elektronik, adanya informasi program pendidikan dari alumni, adanya saran dari orang tua, keluarga atau saudara, adanya ajakan teman, lokasi sekolah dekat dengan tempat tinggal, lokasi sekolah terjangkau angkutan umum, dan lingkungan sekolah yang aman, dapat direduksi atau diringkas menjadi 5 faktor yang lebih sederhana; (2) faktor 1: faktor pengembangan bakat memberikan sumbangan sebesar 18,335%, faktor 2: faktor lingkungan teman sebaya memberikan sumbangan sebesar 14,314%, faktor 3: faktor harapan terhadap masa depan siswa memberikan sumbangan sebesar 10,626%, faktor 4: faktor persepsi terhadap mutu sekolah memberikan sumbangan sebesar 9,052%, faktor 5: faktor keluarga memberikan sumbangan sebesar 6,640%. Berdasarkan hasil penelitian tersebut, maka disarankan:1) kepada kepala sekolah agar dapat memanfaatkan hasil penelitian ini sebagai dasar pengambilan keputusan dalam menentukan arah orientasi pengembangan sekolah, khusunya dalam menerapkan strategi pemasaran dan pelayanan kepada para pemangku kepentingan (siswa dan orang tua siswa), 2) kepada para pengelola Jurusan Administrasi Pendidikan agar mengkaji dan mewacanakan perkembangan kajian ilmu manajemen pendidikan, khusunya manajemen peserta didik dan ekonomi pendidikan yang berhubungan dengan pengambilan keputusan memilih sekolah karena hal tersbut sangat bermanfaat bagi masyarakat yang berkepentingan untuk memilih sekolah, 3) kepada para kepada para guru untuk mempertahankan profesionalitas dalam menjalankan tugas pendidikan karena hal tersebut selalu menjadi sorotan para murid dan wali murid yang menjadi salah satu latar belakang memilih sekolah, 4) kepada peneliti selanjutnya yang tertarik mendalami hasil penelitian ini disarankan agar melakukan penelitian secara lebih komprehensif. Hal ini bisa dilakukan dengan menggunakan rancangan penelitian yang lain (misalnya deskriptif kualitatif, deksriptif komparatif ataupun deskriptif korelasioanal) dan menambah variabel-variabel lainnya.

Penerapan metode inkuiri terbimbing untk meningkatkan keterampilan proses sains dan hasil belajar siswa kelas VII MTs Almaarif 01 Singosari / Maratusy Syahadatud Dinnurriya

 

Kata Kunci: metode inkuiri terbimbing, keterampilan proses sains, dan hasil belajar. Dalam proses belajar siswa diharapkan dapat aktif melakukan proses belajar agar dapat membangun konsepnya sendiri sesuai dengan tuntutan pada Permendiknas No. 22 dan 23 tahun 2006. Namun berdasarkan fakta yang ditemukan dari hasil observasi dan wawancara yang dilakukan di MTs Almaarif 01 Singosari pada tanggal 7 Desember 2012 sampai 24 Desember 2012 terdapat kesenjangan antara fakta dan harapan. Fakta di lapangan menunjukkan bahwa kegiatan praktikum jarang dilaksanakan karena keterbatasan sarana dan prasarana laboratorium, pada umumnya siswa masih kurang aktif dalam mengikuti pembelajaran, KKM klasikal siswa belum tercapai dan metode yang digunakan adalah ceramah yang didominasi oleh guru. Untuk mengatasi kesenjangan antara fakta dan harapan maka dilakukan penelitian yang memiliki tujuan yaitu: (1) mendeskripsikan cara penerapan metode inkuiri terbimbing yang dapat meningkatkan keterampilan proses sains siswa kelas VII MTs Almaarif 01 Singosari dengan penerapan metode inkuiri terbimbing; (2) mendeskripsikan dampak penerapan metode inkuiri terbimbing terhadap meningkatan hasil belajar siswa kelas VII MTs Almaarif 01 Singosari. Metode yang digunakan dalam penelitian ini adalah metode inkuiri terbimbing yang merupakan suatu metode yang dapat membuat siswa aktif dalam kegiatan pembelajaran karena siswa dilatih untuk membangun pengetahuannya sendiri dengan mengalami proses pencarian secara langsung. Dengan demikian diharapkan dapat membuat siswa lebih memahami segala sesuatu yang dipelajarinya dan dapat membekas lebih dalam. Pendekatan yang digunakan pada penelitian ini adalah kualitatif. Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas yang dilakukan selama tiga siklus. Tahapan Penelitian Tindakan Kelas yang dilakukan meliputi perencanaan, pelaksanaan dan observasi, serta refleksi. Subyek dan kancah penelitian ini adalah siswa kelas VII B MTs Almaarif 01 Singosari yang terletak di Jalan Masjid No.33 Singosari Malang. Penelitian ini dilakukan untuk meningkatkan keterampilan proses sains dan hasil belajar siswa melalui penerapan metode inkuiri yang dilakukan secara berkelanjutan dengan memperhatikan kekurangan dan kelebihan yang didapatkan dari hasil refleksi setiap siklus, sehingga dapat diambil tindakan alternatif sebagai perbaikan pada siklus selanjutnya. Hasil penelitian ini menunjukkan bahwa terjadi peningkatan keterampilan proses dan hasil belajar mulai dari siklus I hingga siklus III seperti berikut. 1. Keterampilan proses sains pada siklus I hanya sebesar 36,76%, kemudian pada siklus II menjadi sebesar 68,91% dan pada siklus III meningkat sebesar 85,71%. 2. Hasil belajar kognitif siswa sebelum diberi tindakan ketuntasan belajar siswa dalam ranah kognitif hanya sebesar 33%. Setelah diberi tindakan diperoleh jumlah siswa yang tuntas secara klasikal pada siklus I sebesar 67,65%, pada siklus sebesar 69,70%, dan pada siklus III sebesar 81,82%. 3. Hasil belajar afektif diperoleh adanya peningkatan pada siklus I sebesar 91,18%, pada siklus II sebesar 100%, dan siklus III sebesar 100%. 4. Hasil belajar psikomotor siswa diperoleh hasil ketuntasan belajar siswa sebesar 2,94%, pada siklus II sebesar 91,18%, sedangkan pada siklus III sebesar 100%. Berdasarkan paparan data di atas dapat disimpulkan bahwa penerapan metode inkuiri terbimbing yang dilakukan dalam tiga siklus mampu meningkatkan keterampilan proses sains dan hasil belajar siswa. Saran dari penelitian ini adalah pemberian bimbingan pada setiap tahapnya dan pengawasan siswa sangat dibutuhkan terutama jika metode inkuiri ini baru pertama kali dilakukan. Siswa dapat dibimbing secara bersama-sama dalam melakukan tahapan inkuiri. Hal tersebut berguna agar tahapan inkuiri dapat terlaksana seluruhnya dan kegiatan berlangsung lancar.

Mobilitas wanita pedagang dan kontribusinya terhadap pendapatan keluarga di Pasar Umum Babat Kecamatan Babat Kabupaten Lamongan / oleh Elya Rosyidah

 

Pengaruh penguasaan matakuliah pengantar akuntansi 1, bahasa inggris dan computer anxiety terhadap keterampilan mengoprasikan komputer akuntansi (myob accounting).(studi terhadap mahasiswa akuntansi semester genap 2011/2012 di jurusan akuntansi fakultas ekonomi univers

 

Kata Kunci : Pengantar Akuntansi I, Bahasa Inggris, Computer Anxiety, Komputer Akuntansi (MYOB Accounting). MYOB Accounting adalah salah satu software akuntansi untuk membantu mengolah data. Untuk dapat mengoperasikan Komputer Akuntansi (MYOB Accounting) terlebih dahulu sebaiknya mahasiswa menguasai matakuliah Pengantar Akuntansi I karena konsep dasar akuntansi adalah Pengantar Akuntansi I, menguasai matakuliah Bahasa Inggris karena dalam MYOB Accounting di default dalam Bahasa Inggris, serta Computer Anxiety yaitu sikap menghadapi komputer yang berupa kecemasan. Jenis penelitian ini adalah penelitian eksplanasi pendekatan kuantitatif. Variabel bebas dalam penelitian ini adalah penguasaan matakuliah Pengantar Akuntansi I (X1), penguasaan matakuliah Bahasa Inggris (X2), dan Computer Anxiety (X3), variabel terikat adalah keterampilan mengoperasikan Komputer Akuntansi (MYOB Accounting) (Y). Subyek penelitian ini adalah mahasiswa jurusan akuntansi Universitas Negeri Malang dan Universitas Islam Balitar yang sedang menempuh matakuliah Komputer Akuntansi (MYOB Accounting) yang berjumlah 85 orang. Sumber data berasal dari jawaban atas angket yang telah disebarkan, daftar nilai dari dosen, prestasi belajar mahasiswa yang tercermin dalam KHS yang diperoleh dari BAAKPSI bagian Pendidikan dan Evaluasi. Teknik pengumpulan data adalah angket dan dokumentasi. Analisis data menggunakan analisis uji regresi berganda yang didahului dengan uji asumsi klasik yang terdiri dari uji normalitas, uji multikolinearitas, dan uji heteroskedastisitas. Pengujian hipotesis dilakukan dengan menggunakan uji t. Berdasarkan penelitian yang telah dilakukan menunjukkan bahwa variabel independen, penguasaan matakuliah Pengantar Akuntansi I dan penguasaan matakuliah Bahasa Inggris berpengaruh positif terhadap keterampilan mengoperasikan Komputer Akuntansi (MYOB Accounting), sedangkan variabel Computer Anxiety berpengaruh negatif terhadap keterampilan mengoperasikan Komputer Akuntansi (MYOB Accounting). Nilai Adjusted R Square sebesar 0,302 menunjukkan bahwa variabel keterampilan mengoperasikan Komputer Akuntansi (MYOB Accounting) dapat dijelaskan oleh variabel independen hanya sebesar 30,2% sedangkan sisanya sebesar 69,8% dijelaskan oleh variabel lain yang tidak dimasukkan dalam model. Berdasarkan hasil penelitian disarankan agar penelitian selanjutnya memperluas sampel penelitian serta menambah variabel independen lain seperti kecerdasan, psikologi, dan jenis kelamin.

Profil pelaku mobiliotas ulang-alik pedagang wanita di Pasar Kalangbret Kecamatan Kauman Kabupaten Tulungagung : acuan pada sosial ekonomi, aktivitas, remiten dan faktor-faktor yang mempengaruhi pendapatan / oleh Rismi Wiyani

 

Penerapan pembelajaran berbasis masalah untuk meningkatkan pemahaman konsep trigonometri siswa kelas x-5 SMA Negeri 4 Malang

 

Kata Kunci: pembelajaran berbasis masalah, pemahaman konsep, trigonometri Berdasarkan observasi yang telah dilakukan peneliti di SMA Negeri 4 Malang, dalam kegiatan pembelajaran matematika, guru sering menggunakan metode ceramah kemudian dilanjutkan dengan pemberian tugas kepada siswa. Hal ini membuat siswa cenderung pasif. Berdasarkan hasil tes siswa pada materi sebelumnya hanya 36,84% dari 38 siswa yang dapat mencapai nilai SKBM yang telah ditetapkan sekolah yaitu 78. Kebanyakan siswa hanya menghafalkan rumus-rumus yang diberikan tanpa memahami konsep-konsep dalam matematika. Berdasarkan kenyataan tersebut peneliti menerapkan pembelajaran berbasis masalah. Diharapkan dengan penerapan pembelajaran berbasis masalah dapat meningkatkan pemahaman konsep siswa pada materi trigonometri. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan pembelajaran berbasis masalah yang dapat meningkatkan pemahaman konsep trigonometri siswa. Penelitian ini merupakan penelitian tindakan kelas yang terdiri dari dua siklus yaitu siklus I dan siklus II dengan menggunakan pendekatan kualitatif dan kuantitatif. Subjek dalam penelitian ini adalah siswa kelas X-5 SMA Negeri 4 Malang. Pokok bahasan dalam penelitian ini adalah aturan sinus dan cosinus. Data yang dikumpulkan meliputi : 1) hasil observasi selama proses pembelajaran yang berpedoman pada lembar observasi, 2) hasil catatan lapangan, 3) hasil tes, 4) serta hasil wawancara untuk mengetahui respon siswa terhadap penerapan pembelajaran berbasis masalah. Model pembelajaran berbasis masalah yang dapat meningkatkan pemahaman konsep trigonometri siswa dilakukan dengan menerapkan kelima tahapan Nurhadi dan Senduk, yaitu (1) orientasi siswa pada masalah, (2) mengorganisasi siswa untuk belajar, (3) membantu penyelidikan individu maupun kelompok, (4) mengembangkan dan menyajikan hasil karya, dan (5) menganalisis dan mengevaluasi proses pemecahan masalah. Hasil penelitian menunjukkan bahwa pemahaman konsep siswa mengalami peningkatan. Hal ini dapat dilihat dari peningkatan persentase siswa yang lulus SKBM (Standar Ketuntasan Belajar Minimal) yang ditetapkan sekolah pada siklus II yakni 78,95% siswa kelas X-5 memperoleh nilai lebih dari atau sama dengan 78 dan hasil observasi aktivitas guru maupun siswa yang masuk dalam kategori “sangat baik”. Berdasarkan wawancara yang dilakukan siswa memberikan respon sangat baik terhadap penerapan pembelajaran berbasis masalah sangat senang. Berdasarkan hasil penelitian tersebut, maka peneliti menyarankan kepada guru untuk menerapkan model pembelajaran berbasis masalah untuk meningkatkan pemahaman konsep trigonometri siswa.

Hubungan antara perilaku pacaran dengan prestasi belajar siswa kelas 2 MA. Al-Ittihad Poncokumuso Kabupaten Malang / oleh Anik Shofiyatuz Zuhro

 

Perbedaan pengetahuan dan perilaku pacaran siswa kelas II laki-laki dan perempuan SMAN Kabupaten Pacitan / oleh Evi Fajarwati

 

Studi pengembangan variasi resep masakan ayam bakar khas lumajang dengan bumbu daun sebagai penambahan rasa dan aroma / I'is Afrianti

 

Kata kunci : Pengembangan, Ayam Bakar, Bumbu Daun Ayam Bakar adalah Masakan yang dibuat dari bahan utama ayam yang dimasak bersamaan dengan kaldu ayam dan rempah-rempah seperti: jahe, serai, dan lengkuas . Ayam Bakar memiliki aroma sangat gurih dan rasa pedas dan gurih yang sangat khas. Tujuan penelitian ini adalah menemukan apakah dengan penambahan bumbu daun pada Ayam bakar khas Lumajang akan meningkatkan aroma dan rasa, komposisi bahan dan bumbu daun dalam ayam bakar Khas Lumajang yang disukai masyarakat sebagai penambah rasa dan aroma. Pengujian terhadap aroma, rasa, warna, dan kesukaan dengan menggunakan format penilaian terhadap subjek uji coba, kemudian hasil uji coba dianalisis menggunakan persentase dan dijabarkan secara deskriptif. Hasil penelitian menunjukkan adanya peningkatan aroma dan rasa pada ayam bakar. Penilaian aroma bumbu daun tertinggi adalah produk C sangat beraroma sebesar 56%, penilaian rasa bumbu daun tertinggi dengan pernyataan sangat berasa pada produk C sebesar 66%, penilaian warna merah coklat tertinggi pada produk B sebesar 34%, sedangkan penilaian terhadap kesukaan tertinggi pada produk C sebesar 86% responden menyatakan sangat suka. Komposisi bumbu daun yang banyak untuk penambahan bahan baku ayam bakar tidak menjamin disukai oleh konsumen. Diantara 2 jenis bumbu daun yang digunakan pada penelitian, daun kemangi adalah yang paling disukai sebagai penambah rasa dan aroma. Berdasarkan hasil tersebut dapat disimpulkan bahwa dengan penambahan bumbu daun pada Ayam bakar khas Lumajang meningkatkan aroma dan rasa pada produk variasi C. Komposisi bumbu daun dalam ayam bakar yang disukai masyarakat adalah dengan penambahan 5 gr daun kemangi. Jenis bumbu daun yang paling disukai masyarakat pada ayam bakar khas Lumajang sebagai penambah rasa dan aroma adalah daun kemangi. Pemerintah kota Lumajang dan masyarakat wirausaha dapat menjadikan variasi ayam bakar sebagai prospek untuk peluang usaha makanan yang bergerak dibidang boga sebagai penambah penghasilan. Peneliti selanjutnya yang tertarik untuk melakukan pengembangan produk ayam bakar khas Lumajang dapat menambahkan kajian untuk mengembangkan bauran pemasaran.

Pengaruh ketidakpuasa siswa dengan situasi lingkungan keluarga dan lingkungan sekolah yang ada terhadap kenakalan siswa di SMP Negeri VI Surabaya / Syafiie Nafsichin

 

Kuat tekan pasangan dinding batako dengan variasi tepal spesi / Angger Arum Sagita

 

ABSTRAK Sagita, Angger, Arum. 2016. Kuat Tekan Pasangan Dinding Batako dengan Variasi Tebal spesi. Skripsi, Program Studi S1 Teknik Sipil, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Dr. Nindyawati, S.T., M.T., (II) Ir. Edi Santoso, M.T. Kata Kunci: Dinding Batako, Kuat Tekan, Mortar Dinding merupakan pembatas antar ruangan, penahan beban, dan peredam bunyi. Dinding dibedakan menjadi dua yaitu, dinding partisi dan dinding pengisi. Dinding partisi umumnya terbuat dari gypsum dan kayu, sedangkan dinding pengisi umumnya terbuat dari pasangan batu bata merah, batako, atau bata ringan (hebel). Batako sebagai dinding pengisi memberikan kekuatan struktur utama bangunan sehingga dapat memberikan pengaruh terhadap perilaku struktur bangunan secara keseluruhan. Batako merupakan salah satu material dinding yang mudah untuk mendapatkannya. Pemasangan dinding dengan menggunakan batako lebih cepat daripada pasangan dinding batu bata merah. Pada pasangan dinding batako terdapat mortar yang berfungsi sebagai bahan pengikat antara batako yang satu dengan yang lain. Tebal mortar atau spesi pada umumnya yaitu 1 cm sampai 2 cm. Namun pada tempat tertentu tebal spesi dapat meningkat menjadi hampir 3 cm sampai 4 cm. Maka dari itu penelitian bertujuan untuk mengetahui pengaruh tebal spesi terhadap kuat tekan pasangan dinding batako. Variabel yang digunakan dalam penelitian ini yaitu, variabel bebas adalah variasi tebal spesi dan variabel terikat adalah kuat tekan pasangan dinding batako. Benda uji dalam penelitian ini digunakan 3 variasi yaitu, DB-A, DB-B, dan DB-C dengan masing-masing variasi sebanyak 5 benda uji. Analisis dalam penelitian ini menggunakan anova satu jalur. Hasil dari penelitian ini : (1) Hasil rata-rata pada pengujian kuat tekan pasangan dinding batako benda uji DB-A, DB-B, dan DB-C berturut-turut adalah 2,16 N/mm2; 2,25 N/mm2; dan 2,09 N/mm2. (2) Hasil rata-rata pada perhitungan regangan pasangan dinding batako benda uji DB-A, DB-B, dan DB-C berturut-turut adalah 0,008; 0,007; dan 0,007. (3) Variasi tebal spesi tidak begitu berpengaruh terhadap hasil regangan pada pasangan dinding batako dan intensitas pola retakan. Dalam pengujian ini, pasangan dinding batako dengan tebal spesi 2 cm mempunyai nilai kuat tekan yang paling tinggi, maka dari itu disarankan untuk menggunakan tebal spesi 2 cm.

Kedaulatan rakyat dilakukan sepenuhnya oleh Majelis Permusyawaratan Rakyat / I Made Sekadharna

 

Peningkatan kemampuan mengenal huruf melalui media kartu nama di Kelompok Beramain Anak Saleh Malang / Lina Vidianti

 

ABSTRAK Vidianti Lina, 2016. Peningkatan Kemampuan Mengenal Huruf Melalui Media Kartu Nama Di Kelompok Bermain Anak Saleh Malang. Skripsi, Jurusan Kependidikan Sekolah Dasar dan Pra Sekolah, FIP Universitas Negeri Malang. Pembimbing I Drs. Kentar Budhojo, M.Pd., pembimbing II Wuri Astuti, S.Pd. Kata kunci: Mengenal Huruf, Kartu Nama Hasil observasi yang dilakukan oleh peneliti sejak bulan Maret 2016 di kelompok bermain KB-B1 diperoleh data persentase kemampuan mengenal huruf anak sebesar 57,40% yaitu dari 18 anak kelompok KB-B1 hanya 7 anak yang kemampuan mengenal huruf awalnya sudah baik. Sedangkan sisanya sebanyak 11 anak kemampuan mengenal huruf awalnya masih kurang. Berdasarkan paparan data diatas maka diperlukan tindakan penelitian untuk menyelesaikan permasalahan dalam kegiatan pembelajaran mengenal huruf pada anak. Adapun rumusan masalah dalam penelitian ini: 1) Bagaimana pelaksanaan pengenalan huruf melalui media kartu nama untuk anak kelompok bermain Anak Saleh Malang?, dan 2) Apakah media kartu nama dapat meningkatkan kemampuan mengenal huruf pada anak kelompok bermain Anak Saleh Malang?. Penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK) yang terdiri dari 2 siklus. Instrument yang digunakan observasi, dokumen. Analisis data secara kualitatif dan deskriptif kuantitatif. Berdasarkan olahan data hasil peningkatan kemampuan mengenal huruf atau abjad anak KB-B1 Anak Saleh Malang yang berjumlah 18 orang didapatkan dari pra-tindakan dengan rata-rata hasil kemampuan mengenal huruf atau abjad sebesar 57,40% mengalami peningkatan kemampuan pada siklus I sebesar 71,59%, dan di siklus II menjadi 90,11%. Berdasarkan pengalaman peneliti ketika melakukan kegiatan penelitian berupa (PTK), peningkatan kemampuan mengenal huruf atau abjad melalui media kartu nama dengan bernyanyi pada anak KB-B1 Anak Saleh Malang tahun ajaran 2015/2016 ini, maka peneliti menyarankan kepada semua pihak khususnya sekolah untuk lebih aktif dalam melakukan inovasi terhadap media pembelajaran sebagai alat dalam meningkatkan kemampuan anak mengenal huruf atau abjad.

Pemetaan sebaran keruangan keluarga miskin di Kecamatan Batumarmar Kabupaten Pamekasan tahun 2011 / Achmad Hidayat

 

Kata Kunci: Pemetaan, Sebaran Keruangan Keluarga Miskin Kemiskinan adalah sebuah fenomena multidimensional. Hidup miskin bukan hanya berarti hidup didalam kekurangan kondisi sandang, pangan, dan papan. Hidup dalam kemiskinan seringkali juga berarti akses yang rendah terhadap berbagai ragam sumberdaya dan aset produktif yang sangat diperlukan untuk memperoleh sarana pemenuhan kebutuhan-kebutuhan hidup yang paling dasar tersebut, antara lain: informasi, ilmu pengetahuan, teknologi, dan modal. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui karakteristik, penyebab, dan sebaran keruangan keluarga miskin di Kecamatan Batumarmar Kabupaten Pamekasan Tahun 2011 berdasarkan tingkat kemiskinan. Penelitian ini bersifat deskriptif. Populasi keluarga miskin di Kecamatan Batumarmar sebanyak 10.050 KK dan diambil sampel sebanyak 100 KK. Instrumen penelitian berupa angket yang digunakan untuk melakukan wawancara. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, angket, dan dokumentasi. Analisis data menggunakan analisis tabulasi tunggal an silang. Sedangkan penyajian data dalam peta menggunakan metode Choroplethic. Berdasarkan hasil analisis data tersebut,diperoleh hasil penelitian sebagai berikut. Karakteristik dan penyebab keluarga miskin di Kecamatan Batumarmar meliputi bentuk lahan dataran karst, dataran tektonik bergelombang, plateau karst, dan punggung perbukitan tektonik. Karena batuan yang terdapat di masingmasing lahan beragam, maka jenis tanah yang terbentuk juga beragam antara lain: tanah mollisol, entisol, alfisol, ultisol, dan inceptisol yang tingkat kesuburannya rendah sampai tinggi. Sedangkan ketersediaan air tanahnya asin, langka/terbatas setempat, dan kritis air. Berdasarkan karakteristik sosialnya, keluarga miskin di Kecamatan Batumarmar disebabkan oleh latar belakang pendidikan keluarga miskin yang sebagian besar tidak pernah sekolah atau hanya tamatan SD, sehingga mereka lebih memilih bekerja sebagai petani. Karena menurut mereka hanya pekerjaan ini yang bisa mereka tekuni sesuai pengalaman yang mereka dapatkan dari orang tua mereka, sehingga pendapatan yang mereka dapat rendah yaitu rata-rata Rp. 300.000/bulan. Akibatnya kebutuhan sehari-hari mereka tidak terpenuhi terutama kebutuhan pendidikan untuk anaknya dan untuk membangun rumah mereka. Hal ini didukung temuan di lapangan, dimana kondisi rumah keluarga miskin yang sebagian besar hanya seluas kurang dari 8 m2 per orang dengan lantai dari tanah dan dinding yang terbuat dari seng, serta jumlah beban tanggungan keluarga mereka sebanyak 1-4 orang. Keluarga miskin di Kecamatan Batumarmar berdasarkan tingkat kemiskinan yaitu dari 100 keluarga miskin di Kecamatan Batumarmar 48 keluarga miskin termasuk dalam kategori miskin sekali, 32 keluarga miskin termasuk dalam kategori melarat/paling miskin, dan 20 keluarga miskin termasuk dalam kategori ii miskin. Sedangkan sebaran keruangan keluarga miskin berdasarkan tingkat kemiskinan sebagai berikut.  Bentuk lahan dataran karst dengan ketersediaan air tanah asin, langka/terbatas setempat. Lahan ini sebagian besar meliputi Desa Tamberu, Kapong, Lesong Daja, Lesong Laok, Bangsereh, Ponjanan Barat, Blaban, Batubintang, dan Ponjanan Timur. Sedangkan jenis tanah yang terbentuk di lahan ini yaitu mollisol, entisol, dan alfisol. Dimana desa yang paling miskin yaitu Desa Ponjanan Timur, sedangkan desa yang miskin sekali dan miskin yaitu Desa Batubintang.  Bentuk lahan punggung perbukitan tektonik dengan ketersediaan air langka/terbatas setempat. Lahan ini sebagian besar meliputi Desa Ponjanan Barat, Bangsereh, Ponjanan Timur, Lesong Laok, Batubintang, Pangereman, Bujur Barat, Bujur Tengah, dan Bujur Timur. Sedangkan jenis tanah yang terbentuk di lahan ini ultisol, alfisol, dan inceptisol. Dimana desa yang paling miskin dan miskin sekali yaitu Desa Bujur Timur, sedangkan desa yang miskin yaitu Desa Bujur Tengah.  Bentuk lahan dataran tektonik bergelombang dengan ketersediaan air langka/terbatas setempat. Lahan ini sebagian besar meliputi Desa Lesong Laok, Pangereman, Bujur Barat, Bujur Tengah, dan Bujur Timur. Sedangkan jenis tanah yang terbentuk di lahan ini alfisol dan inceptisol. Dimana desa yang paling miskin dan miskin sekali yaitu Desa Bujur Timur, sedangkan desa yang miskin yaitu Desa Bujur Tengah.  Bentuk lahan plateau karst dengan ketersediaan air langka/terbatas setempat. Lahan ini sebagian besar meliputi Desa Bujur Tengah dan Bujur Timur. Sedangkan jenis tanah yang terbentuk di lahan ini mollisol, alfisol, dan entisol. Dimana desa yang paling miskin dan miskin sekali yaitu Desa Bujur Timur, sedangkan desa yang miskin yaitu Desa Bujur Tengah.

Pengukuran magnitudo mutlak planet mars pada saat terjadi jarak minimum antara mars dan bumi dengan menggunakan software iris / oleh Nur Afifah

 

Pengaruh radiasi sinar gamma terhadap vitamin C (Asam askorbat) dan vitamin E (Alphatokoferol) berdasarkan spektrum UV-VIS / oleh Ririn Nur Rahayu

 

Penerapan model pembelajaran kooperatif tipe role playing dalam mata pelajaran ekonomi untuk meningkatkan aktivitas dan hasil belajar siswa kelas XI SMA Laboratorium Universitas Negeri Malang / Putra Hilmy Prayitno

 

Kata Kunci: model pembelajaran role playing, aktivitas belajar siswa, hasil belajar Berdasarkan observasi awal dan wawancara informal yang dilakukan pada tanggal 5 Agustus 2010 dengan guru Ekonomi kelas XI IPS 1 SMA Negeri Laboratorium Universitas Negeri Malang diketahui bahwa sebagian besar proses pembelajaran masih didominasi guru dan siswa masih pasif. Selain itu kondisi kelas yang sesak karena diisi oleh hampir 50 siswa menyebabkan banyak siswa yang ramai sendiri, bergurau dan kurang memperhatikan penjelasan guru di dalam kelas. Sebagian siswa kelas XI IPS-1 juga masih beranggapan bahwa mata pelajaran Ekonomi merupakan mata pelajaran yang sulit dan membosankan karena terlalu banyak teori dan pengertian-pengertian yang dihafalkan. Untuk mengatasi hal tersebut diperlukan model pembelajaran yang dapat meningkatkan aktivitas dan hasil belajar siswa yaitu dengan menggunakan model pembelajaran kooperatif tipe role playing. Penelitian ini dilaksanakan di SMA Negeri Laboratorium Universitas Negeri Malang, dengan subjek siswa kelas XI IPS 1 yang berjumlah 45 siswa. Penelitian ini termasuk penelitian tindakan kelas yang terdiri dari dua siklus, masing-masing siklus terdiri dari dua pertemuan. Teknik pengumpulan data aktivitas belajar siswa menggunakan lembar observasi aktivitas belajar siswa dan untuk hasil belajar peneliti melihat peningkatan hasil nilai tes siklus I dan siklus II. Tujuan penelitian ini adalah 1) Untuk mendeskripsikan dan menganalisis penerapan pembelajaran kooperatif tipe Role Playing untuk meningkatkan aktivitas dan hasil belajar siswa kelas XI SMA Laboratorium Universitas Negeri Malang dalam mata pelajaran ekonomi; dan 2) mengetahui aktivitas dan hasil belajar siswa kelas XI SMA Laboratorium Universitas Negeri Malang dalam mata pelajaran ekonomi setelah diterapkan pembelajaran kooperatif tipe Role Playing Pada penelitian ini, aktivitas belajar siswa meningkat dari siklus I yang hanya mencapai 46,67% menjadi 73,33% pada siklus II, sedangkan untuk hasil belajar pada siklus I mencapai 73,3% menjadi 77,8 % pada siklus II. Dengan demikian dapat disimpulkan bahwa model pembelajaran kooperatif tipe role playing dapat meningkatkan aktivitas dan hasil belajar siswa kelas XI IPS 1 SMA Laboratorium Universitas Negeri Malang.

"Pengaruh kualitas produk terhadap minat beli produk minuman Coca-Cola" (studi pada mahasiswa Fakultas Ekonomi Jurusan Manajemen 2014/2015 Universitas Negeri Malang) / Aditya Sutrisna Putra

 

ABSTRAK Sutrisna, Aditya. 2014. “Pengaruh Kualitas Produk Terhadap Minat Beli Produk Minuman Coca-Cola”. (Studi Pada Mahasiswa Fakultas Ekonomi Jurusan Manajemen 2014/2015 Universitas Negeri Malang). Pembimbing: (I) Afwan Hariri Agus P, SE, M.M (II) Handri Dian Wahyudi, SPd, M.Sc Kata Kunci: Kualitas Produk, Minat Beli, Coca Cola. Persaingan dalam dunia usaha dewasa ini sangatlah ketat dimana persaingan sudah tidak bisa diprediksi lagi dalam hal menarik perhatian konsumen. Pelaku industri kian menghadapi tantangan untuk mendapatkan pangsa pasar yang mereka inginkan. Dilain pihak, konsumen cenderung semakin sensitif terhadap penilaian suatu produk. Dalam kondisi pasar yang kompetitif, kualitas produk dan minat beli konsumen adalah kunci sukses perusahaan dalam memperoleh keunggulan kompetitif. Penelitian ini dilaksanakan dengan tujuan untuk memberikan gambaran jelas mengenai pengaruh kualitas produk terhadap minat beli konsumen dengan obyek penelitian produk minuman coca cola pada mahasiswa universitas negeri malang Penelitian ini menggunakan rancangan penelitian deskriptif kausalitas.Dalam penelitian ini menggunakan sumber data primer. Dimana sumber data primer berasal dari sampel yang diambil dari mahasiwa universitas negeri malang. Uji validitas instrumen penelitian dilakukan pada 30 mahasiswa dan hasilnya 23 item pernyataan dinyatakan valid. Uji reliabilitas instrumen penelitian menghasilkan nilai cronbach alpha 0,722 untuk variabel Bentuk X1, 0,712 untuk variabel Kualitas Kinerja X2, 0,813 untuk variabel Ketahanan X3, 0,706 untuk Kehandalan X4 , 0,718 untuk Desain X5 serta 0,901 untuk variabel Minat Beli Y yang berarti dinyatakan reliabel karena semua instrument α > 0,7. Pengumpulan data dalam penelitian ini dilakukan dengan menggunakan kuesioner yang dibagikan secara langsung kepada mahasiswa baru 2014/2015. Uji asumsi klasik yang digunakan dalam penelitian ini meliputi uji normalitas, uji heteroskedastisitas dan uji multikolinieritas. Dalam penelitian ini peneliti menggunakan analisis regresi berganda. Teknis ini digunakan karena untuk menguji pengaruh 2 atau lebih variabel bebas terhadap variabel terikat. Berdasarkan hasil analisis data regresi berganda, menyimpulkan bahwa terdapat pengaruh secara simultan & parsial variabel kualitas produk (bentuk, kualitas kinerja, ketahanan, kehandalan, desain) terhadap minat beli konsumen yang dinyatakan dengan Konstanta variabel kualitas produk sebesar -12,776 Dengan kata lain konsumen tidak akan berminat membeli produk tersebut jika indikator kualitas produk tidak baik. . Bagi peneliti selanjutnya, diharapkan untuk menguji variabel lain yang belum dibahas dalam penelitian ini. Seperti keunggulan produk atau variabel rasa secara mendalam agar penelitian ini lebih berkembang kearah yang lebih baik lagi kedepannya. Bagi PT Coca Cola Amatil Indonesia (CCAI), agar lebih meningkatkan faktor-faktor yang dapat mempengaruhi minat beli konsumen dalam membeli produk coca cola, terutama dalam hal rasa dan bentuk kemasan produk.

Meningkatkan prestasi belajar matematika siswa kelas 2 IPA 1 SMAN 1 Talun melalui penerapan pembelajaran kooperatif model TGT pada pokok bahasan peluang / oleh Ronnie Arwan D.

 

Potensi Sanggar Kegiatan Belajar (SKB) Kota Malang untuk melaksanakan program wajib belajar pendidikan dasar 9 tahun / oleh Chus Yudi Rusmawan

 

Hubungan antara tingkat kecemasan ibu hamil dengan usia kehamilan / oleh Jihanita Mandasari

 

Nilai-nilai moral dalam serat Wedhatama / oleh Erlin Slamet

 

Dampak wisata religi (Makam Sunan Giri) terhadap kehidupan masyrakat sekitar di Kecamatan Kebomas Kabupaten Gresik / oleh Imroaton Khasanah

 

ABSTRAK Khasanah, Imroatun. 2006. Dampak Wisata Religi (Makam Sunan Giri) terhadap Kehidupan Masyarakat Sekitar di Kecamatan Kebomas Kabupaten Gresik. Skripsi, Jurusan Pendidikan Geografi FMIPA UM. Pembimbing (1) Drs. I Komang Astina, M. S., (II) Drs. M. Yusuf Idris. Kata Kunci: dampak wisata, kehidupan masyarakat Pembangunan sektor pariwisata merupakan salah satu program andalan pemerintah Indonesia yang memiliki prospek dan peranan penting dalam pembangunan. Pembangunan ini membawa banyak manfaat sehingga dalam upaya pengembangan diharapkan dapat meningkatan kesejahteraan masyarakat seperti terbukanya lapangan pekerjaan, kesempatan berusaha, meningkatkan pendapatan baik masyarakat setempat maupun negara. Kegiatan pariwisata juga menimbulkan dampak sosial-budaya baik positif maupun negatif. Pariwisata bukan hanya suatu fenomena ekonomi tetapi mencakup juga aspek sosial-budaya, dan lingkungan fisik. Penelitian ini bertujuan untuk mendeskripsikan dampak wisata religi (makam Sunan Giri) dilihat dari aspek ekonomi, sosial-budaya dan lingkungan masyarakat sekitar di Kecamatan Kebomas Kabupaten Gresik. Dalam penelitian ini menggunakan rancangan deskriptif kualitatif dengan persentase. Populasi dalam penelitian ini adalah masyarakat sekitar objek wisata makam Sunan Giri yang terdiri dari 2 desa yaitu Desa Giri dan Klangonan yang berjumlah 131 KK, selanjutnya diambil 40% dari jumlah populasi sebesar 52 KK sebagai sampel dengan menggunakan Teknik Random Sampling dengan cara undian. Instrumen yang digunakan untuk pengumpulan data adalah wawancara dan angket terstruktur. Adapun untuk menganalisis data yang telah dikumpulkan digunakan teknik analisis deskriptif persentase. Hasil penelitian ini menunjukkan bahwa dampak tentang aspek ekonomi adalah memperluas lapangan kerja dan kesempatan berusaha seperti masyarakat membuka stand souvenir dan toko minyak wangi sebanyak 55 orang, kedai makanan dan minuman sebanyak 10 orang, dan pengojek sebanyak 450 orang, sehingga terserap tenaga kerja dari berbagai jenis pekerjaan sebanyak 515 orang dan masyarakat dapat menambah pendapatan mereka pada hari-hari tertentu sebesar 100.000 – 1.500.000 selama 3 hari. Dampak sosial-budaya adalah kurangnya keterlibatan masyarakat sekitar terhadap organisasi sosial, 33 responden/ masyarakat (63,5%) menyatakan bahwa keberadaan pengemis menganggu kegiatan wisata, dan 50 responden (96,2%) menyatakan tidak setuju dengan peningkatan jumlah pengemis. Kesenian tradisional hadra dapat berkembang sebagai kesenian khas daerah wisata. Kegiatan keagamaan seperti tahlilan dan pengajian diikutsertakan dalam kegiatan wisata. Dampak lingkungan yang terjadi di objek wisata makam Sunan Giri adalah terjadinya pencemaran limbah padat yang berupa sampah, seperti sampah kertas, plastik bekas makanan dan minuman serta kaleng. Didukung dengan cara wisatawan yang membuang sampah secara sembarangan. Menurut 28 responden/masyarakat (53,8%) menyatakan bahwa kebersihan di sekitar objek wisata adalah cukup bersih, 32 responden (61,5%) menyatakan bahwa keamanan di sekitar objek wisata adalah cukup aman, tetapi masih ada tindak kriminalitas terutama di masjid Jami’ makam Sunan Giri adalah pencurian, kemacetan lalu lintas terjadi pada malam Jum’at dan minggu serta terjadi kepadatan orang pada saat hari-hari tertentu seperti acara haul Sunan Giri dan Malam Selawe.

Hubungan antara kecerdasan emosional dan kelola diri di bidang sosial mahasiswa Jurusan Bimbingan Konseling dan Psikologi Universitas Negeri Malang / oleh Rosi Wijayanti

 

Pengembangan bahan ajar mata kuliah Reading Comprehension dengan menggunakan C_ID model R2D2 / Yudi Hari Rayanto

 

ABSTRAK Rayanto, YudiHari, 2016. PengembangaanBahanAjar Mata Kuliah Reading Comprehension denganmenggunakan, C-ID Model R2D2. Disertasi. Program Studi TeknologiPembelajaran, Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Nyoman S Degeng., (II) Prof. Dra.UtamiWidiati, M.A, Ph.D., (III) Prof. Dr. PunajiSetyosari,M.Ed, M.Pd Kata Kunci: pembelajaran,, r2d2, prosedur Pembelajaranmerupakansuatu proses interaksiantarapembelajardanpebelajar. Proses inimenitikberatkanpadaupayamembelajarkanparapebelajardalammengaitkanunsur-unsurkognitif yang telahmerekamilikisebagai prior knowledgenya, Degeng (2013). Untukinipengembanganbahan ajar sangatpentinguntukdilakukanuntukmendukungpembelajaran yang akandiimplementasikan. Bahan ajar merupakansaranabelajar yang berfungsimembantumembelajarkanpebelajarsecarasistematis, terarahsesuaidengantujuan yang telah di tetapkan.Bahan ajar merupakanmateri yang terusberkembangsecaradinamisseiringdengankemajuandantuntutanperkembanganmasayarakat. OlehKarenaitu, bahan ajar yang dipergunakanharusmampumeresponsetiapperubahanataumengantisipasisetiapperkembangan yang akanterjadi di masadepan. Ketersediaanbahan ajar yang di desaindengankonsepdanteori yang tepatdapatmendorongpebelajaruntukmampumencernadanmemahamiisibahan ajar secaramaksimal. Pembelajaranmatakuliah Reading Comprehensionpada Program StudiBahasaInggris STKIP PGRI Pasuruanmasihdirasabelumoptimal.Halinidikarenakanbelumadanyabahan ajar yang dikembangkansendiriolehpembelajaryang memperhatikankarakteristikpebelajar.Selainitu, pembelajaranmatakuliahmembacamasihterpusatpadapembelajardanbelummelakukanpendekatan yang komunikatif. Untukmemecahkanpermasalahantersebut diatas, makaperludikembangkanbahan ajar yang bisamemenuhikebutuhanpengguna, yaituuntukpembelajardanpebelajar. Model R2D2 merupakansuatuprosedurrancanganpembelajarankonstruktifistik yang menekankankekreatifitasanpada proses pembelajaranitusendiri. Dalamhalini, R2D2 yang akandikembangkanmerupakanprosedur yang beradadalam R2D2 itusendiriuntukmendesaindanmengembangkanbahan ajar dengan yang akandiimplementasikandalampembelajaran dikelas. Hal inidikarenakan, Masalah-masalah yang samamungkindibahasberkali-kali melaluisuatu proses. Selainitu, prosedurrancanganpembelajaran model R2D2 inidipandangsebagaisuatupembelajaran yangmengarahpadaperbaikan-perbaikandidalammateripembelajarandalampengembangannya. Prosedurpengembanganbahan ajar initerdiridari 5 tahap.Pertama, tahapidentifikasi yang terdiridari (1) pengkajiateoritismelaluistudipustaka,(2) pengkajianempirismelaluiobservasi di kelas. Kedua, tahap define, yaitumembentuksuatutim( terdiridariperwakilanpembelajarmatakuliahitusendiri, pebelajar, danpengembang). Ketiga, tahapdesaindanpengembangan, yaitu (1) mendesaintempatataulingkunganpengembangan,(2) pemilihan media danformatnya, (3) prosedurevaluasi, dan (4) produkdesaindanpengembangan (silabus, RPP, isimateri, test danpenilaian). Keempat, tahapujicoba yang terdiridariujiahli, kelompokdanlapangan.Kelima, tahapdiseminasi. Data yang diperolehdariparaahli, ujikelompokdanlapangandianalisisdenganmenggunakanteknikanalisisdiskriptifkuantitatifdankualitatifuntukmengetahuikevalidan, kepraktisandankeefektifandaribuku ajar yang dihasilkan. Secara kuantitatif, (1)kevalidandaribuku ajar yang dikembangkanmemenuhikriteria valid, yaitu 3,9. Nilaiiniberadapada interval3 ≤(V_k ) ̅≤ 4, (2) Kepraktisanberdasarkan data aktivitaspembelajardalampembelajaranmenunjukkankriteriapraktis, yaitudengan nilai 3,9padauji kelompok dan 4,0 padauji lapangan. Nilai tersebut berada pada interval 3≤(P_k ) ̅≤4, sedangkanuntuk (3) keefektifandaribuku ajar pada: (a) aktivitas pebelajar mendapat nilai 3,97 diuji kelompok dan 4,0 diuji lapangan. Nilai tersebut dapat dikategorikan aktivitas tinggikarena berada pada interval 3 ≤(a_k ) ̅≤4,(b) prosentase pebelajar yang merespon positif secara keseluruhan adalah 100% di uji kelompok dan 93,5% di uji lapangan, dan dapat dikatakan bahwa pebelajartelahmemberikan respon positifterhadappembelajaran yang telahdilakukan,(c) prosentase pebelajaryang sudah menguasai adalah 100% di uji kelompok dan 93,5% di uji lapangan dan secarakualitatif, berdasarkan saran, masukandankomentar yang diberikan, produkbuku ajar yang dikembangkanperludilakukanrevisi. Revisi yang dilakukanolehpengembangberdasarkandariparaahliterkaitpada cover, perpaduanwarna, istilah, penulisan chapter, judulperluditambahi, danpenulisan style dalamreferensi.Sedangkandaripara observer padaujikelompoklangsungdilakukanrevisi di pertemuanselanjutnya, yaituterkaitpadapengaturantataletakkursi, danpebelajardiberikesempatanuntukbertanya. Sehinggapadaujilapangan, para observer sudahtidakmemberikan saran, masukanmaupunkomentarlagi. Berdasarkanproduk yang dihasilkan, pengembangmemberikan saran agar produk buku ajar Reading Comprehension sebaiknyajangandigunakanpadapebelajar di semesterawal, namundiberikankepadapebelajar di semester II.Hal inidikarenakanpebelajardi semester awalmerupakanpebelajartransisi yang masihbutuhadaptasi.Selaindaripadaini, sebelumdibelajarkan, baikpebelajarmaupunpembelajar, disarankan agar membacaterlebihdahulucaramenggunakanbuku ajar Reading Comprehension yang telahtertulis didalambuku ajar.

Pengaruh free cash flow, kepemilikan manajerial, dan kepemilikan institusional terhadap kebijakan hutang pada perusahaan manufaktur yang listing di Bursa Efek Indonesia tahun 2007-2008 / Rizaldhi Pamuditra

 

Pamuditra, Rizaldhi. 2010. Pengaruh Free Cash Flow dan Kepemilikan Manajerial, Kepemilikan Institusional terhadap Kebijakan Hutang pada Perusahaan Manufaktur yang listing di Bursa Efek Indonesia Tahun 2007-2008. Skripsi, Jurusan Manajemen, Program Studi S1 Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Dr. Dyah Aju Wardhani, S.E., M.Si., Ak. (II) Ibu Sri Puji Ningsih, S.E., M.Si., Ak. Kata Kunci: Free Cash Flow, Kepemilikan Manajerial, Kepemilikan Institusional, Kebijakan Hutang Tujuan utama perusahaan adalah untuk meningkatkan nilai perusahaan melalui peningkatan kemakmuran pemilik perusahaan atau pemegang saham. Pemegang saham sebagai pemilik perusahaan mempercayakan pengelolaan kepada pihak manajemen untuk membuat keputusan sesuai kepentingan pemilik. Pemilik perusahaan dengan manajemen memiliki kepentingan masing-masing di dalam perusahaan. Perbedaan kepentingan tersebut disebut dengan agency problem. Hubungan antara pemilik perusahaan dengan manajemen tersebut juga menyangkut dengan adanya free cash flow di dalam perusahaan. Dan pada akhirnya bermuara pada kebijakan pendanaan perusahaan yang dalam hal ini merupakan kebijakan hutang perusahaan. Tujuan penelitian ini adalah untuk mengetahui pengaruh free cash flow terhadap kebijakan hutang, pengaruh kepemilikan manajerial terhadap kebijakan hutang, kepemilikan institusional terhadap kebijakan hutang, dan pengaruh free cash flow dan kepemilikan manajerial, kepemilikan institusional terhadap kebijakan hutang. Variabel dalam penelitian ini adalah free cash flow, kepemilikan manajerial, dan kepemilikan inastitusional. Populasi dalam penelitian meliputi seluruh perusahaan manufaktur yang listing di Bursa Efek Indonesia tahun 2007-2008. Pengambilan sampel dalam penelititn ini menggunakan teknik purposive sampling. Sampel penelitian adalah 44 perusahaan manufaktur dengan kriteria tertentu. Periode pengamatan dalam penelititan yaitu selama dua tahun yaitu mulai tahun 2007-2008. data penelitian ini menggunakan data sekunder yang diperoleh dari laporan keuangan tahunan. Teknik pengumpulan data dalam penelitian ini menggunakan teknik dokumentasi yang diperoleh dari Pusat Data Bisnis (PDB) Universitas Negeri Malang. Teknik analisis data yang digunakan adalah regresi linier berganda. Hasil penelitian ini menunjukkan bahwa free cash flow mempunyai pengaruh positif dan signifikan terhadap kebijakn hutang, kepemilikan manajerial mempunyai pengaruh positif dan signifikan terhadap kebijakan hutang, kepemilikan institusional tidak memiliki pengaruh terhadap kebijakan hutang dan tidak signifikan. Dan free cash flow dan kepemilikan manajerial, kepemilikan institusional memiliki pengaruh yang signifikan antara terhadap kebijakan hutang. Saran untuk penelititan terkait selanjutnya adalah untuk menambah variabel baru seperti faktor eksternal perusahaan, menggunakan satu set rasio dalam sebuah proksi dan menambahkan variabel proksi yang lainnya seperti proksi berdasarkan harga, investasi dan ukuran variansi.

Analisis stimulus dan fungsi gambar dalam buku teks IPS dan IPA sekolah dasar di SIntang / oleh Azwar

 

Wanita dan Sukarno : suatu kajian sejarah wanita / oleh Riani

 

Makna preposisi fii dalam Al-Qur'an serta padanannya dalam Bahasa Indonesia / oleh Lu'luatul Azizah

 

Perbedaan ekonomi tenaga kerja Indonesia desa Sukorejo Kulon, Kecamatan Kalidawir, Kabupaten Tulungagung, sebelum dan sesudah pemulangan dari Malaysia / oleh Evi Yulianti

 

Peranan penilaian kinerja sumber daya manusia untuk perumusan program pelatihan dan pengembangan karyawan : studi kasus di Rumah Sakit Budi Rahayu Blitar / oleh Lesna Maria Magdalena

 

Analisa pengaruh aspek-aspek pelatihan kerja terhadap prestasi kerja karyawan pada Hotel Pelangi Malang / oleh M. Rizki Firdaus N.

 

Pengaruh efikasi diri siswa terhadap prestasi belajar berdasarkan tipe tes pada mata pelajaran akuntansi kelas XI IPS di SMA Negeri 9 Malang / Elsmeyti Indra Serani

 

Kata Kunci: Efikasi Diri Siswa, Tipe Tes, Prestasi Belajar. Proses belajar mengajar yang dilakukan oleh guru dan siswa diharapkan tercermin dalam prestasi belajar. Banyak faktor yang mempengaruhi prestasi belajar siswa baik itu internal maupun eksternal. Salah satu faktor internal adalah efikasi diri yang dimiliki oleh siswa. Selain itu, untuk melihat perubahan tingkah laku siswa mengenai pemahaman dan penguasaan terhadap mata pelajaran tertentu maka diperlukan evaluasi yang merupakan tahap terakhir dari kegiatan belajar mengajar. Mengingat umumnya bentuk evaluasi, maka dalam penelitian ini peneliti menggunakan bentuk evaluasi berupa tes untuk melihat tingkat pencapaian siswa terhadap pelajaran akuntansi. Tes yang digunakan adalah tes pilihan ganda dan esai. Penelitian ini bertujuan untuk mengetahui pengaruh efikasi diri siswa terhadap prestasi belajar, pengaruh tipe tes terhadap prestasi belajar siswa, dan pengaruh efikasi diri siswa dan tipe tes terhadap prestasi belajar. Efikasi diri siswa merupakan keyakinan yang dimiliki oleh siswa terhadap kemampuan yang mereka miliki. Sedangkan tipe tes merupakan tes yang digunakan untuk mengukur tingkat pencapaian siswa, bentuk tes yang digunakan dalam penelitian ini adalah tes pilihan ganda dan esai. Prestasi belajar yang digunakan adalah hasil ulangan tengah semester mata pelajaran akuntansi. Penelitian ini merupakan jenis penelitian eksplanasi (Eksplanatory Research). Penelitian yang digunakan adalah penelitian asosiatif yang dilaksanakan di SMA Negeri 9 Malang. Populasi pada penelitian meliputi seluruh siswa kelas XI IPS di SMA Negeri 9 Malang. Teknik pengambilan sampel menggunakan purposive sample. Sampel yang diteliti berjumlah 62 orang. Pengujian hipotesis menggunakan Analisis Regresi berganda dengan menggunakan SPSS 17 for windows. Berdasarkan hasil penelitian diperoleh (1) efikasi diri siswa berpengaruh terhadap prestasi belajar, (2) tipe tes berpengaruh terhadap prestasi belajar, (3) efikasi diri siswa dan tipe tes berpengaruh secara simultan terhadap prestasi belajar. Saran dari penelitian ini yaitu bagi guru sebaiknya mengetahui efikasi diri siswanya sebelum melakukan atau memberikan tes. Selain itu cara dan upaya yang dilakukan oleh guru sangat diperlukan agar siswa mampu memiliki pemahaman secara menyeluruh. Bagi peneliti lain sebaiknya menambahkan variabel lain yang mempengaruhi prestasi belajar siswa dan menggunakan sampel yang lebih banyak.

Perbedaan hasil belajar siswa yang berasal dari keluarga utuh dengan siswa yang berasal dari keluarga broken home pada siswa SMP Negeri I Kromengan Kabupaten Malang / oleh Sugiana

 

Penerapan pembelajaran kooperatif model Think Pair Share untuk meningkatkan motivasi dan hasil belajar siswa kelas VII-A SMP Negeri 1 Tosari Pasuruan / Nike Yuanita

 

Kata kunci: pembelajaran kooperatif, think pair share, motivasi belajar, hasil belajar. Pencapaian tujuan pendidikan berdasarkan (KTSP) yang sedang dilaksanakan, perlu adanya suatu strategi pembelajaran yang sesuai. Think pair share (TPS) merupakan model pembelajaran yang sesuai dengan tuntutan kurikulum. Tujuan penelitian ini adalah untuk mengetahui bagaimana penerapan Pembelajaran Kooperatif Model Think Pair Share untuk meningkatkan motivasi dan hasil belajar siswa kelas VII-A SMP Negeri Tosari Pasuruan. Jenis penelitian ini merupakan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam dua siklus. Setiap akhir siklus dilakukan penilaian untuk mengetahui ada tidaknya peningkatan motivasi belajar siswa. Tindakan yang diberikan berupa penerapan model Think Pair Share sebagai upaya memperbaiki hasil belajar dan meningkatkan motivasi. Motivasi belajar dianalisis secara deskriptif berdasarkan taraf keberhasilan tindakan, sedangkan hasil belajar dianalisis berdasarkan tingkat pemahaman kognitifnya. Hasil kognitif ditentukan dari skor perolehan dari hasil ters pada akhir siklus. Hasil penelitian menunjukkan bahwa penerapan model think pair share dapat digunakan untuk meningkatkan motivasi dan hasil belajar siswa mata pelajaran Biologi kompetensi dasar Klasifikasi Makhluk Hidup. Hal ini ditunjukkan dengan meningkatnya aktivitas siswa yang menjadi indikator motivasi yaitu perhatian, waktu belajar, usaha, irama perasaan, dan penampilan. Demikian halnya dengan hasil belajar siswa yang diukur berdasarkan ketuntasan klasikal maupun individu yang semakin meningkat dari siklus ke siklus. Kondisi tersebut menunjukkan bahwa penerapan pembelajaran kooperatif model think pair share dapat digunakan untuk meningkatkan motivasi dan hasil belajar siswa pada mata pelajaran Biologi pada kompetensi dasar Klasifikasi Makhluk Hidup pada siswa kelas VII-A SMP Negeri Tosari Pasuruan. Oleh karena itu disarankan bagi guru yang memiliki masalah dalam pembelajaran yang sama sebaiknya menerapkan pembelajaran kooperatif model TPS karena telah terbukti dapat meningkatkan motivasi dan hasil belajar siswa. Peneliti berikutnya sebaiknya menerapkan pembelajaran kooperatif model TPS yang lebih menarik bagi siswasehingga dapat meningkatkan motivasi siswa menjadi lebih optimal.

Profil penyelenggaraan pelatihan keterampilan untuk pembinaan anak didik di Lembaga Pemasyarakatan Anak (LPA) Blitar / oleh Novi Catur Muspita

 

Karakteristik narasi tulis siswa Sekolah Dasar Negeri Jember Lor 3 Kabupaten Jember / oleh Arju Muti'ah

 

Pengembangan media interaktif animasi praktikum biologi pada proses perolehan nutrisi dan transformasi energi pada tumbuhan hijau untuk siswa kelas VIKII SMP / Fina Akhwatul Janah

 

Kata Kunci : media interaktif, animasi praktikum, biologi. Ciri dari belajar biologi adalah adanya kegiatan praktikum. Kegiatan praktikum ini dilaksanakan karena pembelajaran biologi tidak hanya mementingkan produk melainkan juga proses. Dalam pencapaian kompetensi mendeskripsikan proses perolehan nutrisi dan transformasi energi pada tumbuhan hijau selama ini, pengalaman belajar siswa hanya dilakukan secara teori tanpa adanya kegiatan praktikum. Jika dilakukan praktikum, praktikum hanya membuktikan teori saja dan tidak dilakukan secara scientific inquiry. Akibatnya, siswa tidak bisa mengembangkan rasa keingintahuan dan kemampuan berpikirnya. Maka dari itu, pengembangan media interaktif animasi praktikum ini ditujukan untuk mengatasi kendala penguasaan kemampuan dasar yang hanya diperoleh secara teori tersebut. Dengan dikembangkannya media berbantuan komputer yang memiliki karakteristik adanya visualisasi pengamatan praktikum dalam bentuk animasi ini, maka siswa dapat melakukan pengamatan praktikum secara scientific inquiry. Pengembangan media pembelajaran pada penelitian ini menggunakan model pengembangan media pembelajaran oleh Sadiman. Tahap-tahap penelitian dan pengembangan adalah sebagai berikut: (1) menganalisis kebutuhan dan karakteristik siswa, (2) merumuskan tujuan instruksional, (3) merumuskan butirbutir materi secara terperinci yang mendukung tercapainya tujuan, (4) mengembangkan alat pengukur keberhasilan, (5) menulis naskah dan produksi media, dan (6) mengadakan tes dan revisi media. Validasi terhadap produk melibatkan dua orang dosen jurusan Biologi FMIPA UM, seorang guru SMPN 1 Batu dan dua siswa kelas VIII SMPN 1 Batu (evaluasi satu lawan satu). Hasil validasi yang diperoleh digunakan untuk melakukan revisi terhadap media yang dikembangkan. Selanjutnya dilakukan uji coba media pada 37 orang siswa kelas VIII SMPN 1 Batu. Hasil analisis data menunjukkan bahwa: (1) didapatkan persentase hasil validasi oleh ahli media sebesar 90,54%, (2) ahli materi sebesar 83,1%, (3) evaluasi satu lawan satu sebesar 91,19%, dan (4) hasil uji coba lapangan sebesar 91,68%. Rata-rata persentase validitas sebesar 89,12%. Berdasarkan analisis gain score pada uji coba lapangan, diperoleh nilai gain score sebesar 0,67 yang menunjukkan bahwa keefektifan pembelajaran dengan menggunakan media yang dikembankan termasuk dalam kategori sedang. ii Dengan hasil tersebut, maka dapat ditarik beberapa kesimpulan dari penelitian ini, yaitu (1) media interaktif animasi praktikum yang dikembangkan memiliki kriteria layak sebagai media pembelajaran interaktif dengan rata-rata persentase validitas sebesar 90,54%; (2) materi pada media interaktif animasi praktikum yang dikembangkan memiliki kriteria valid untuk memenuhi kompetensi dasar proses perolehan nutrisi dan transformasi energi pada tumbuhan hijau dengan rata-rata persentase validitas sebesar 83,1%; (3) media interaktif animasi praktikum telah dikembangkan memiliki kriteria layak dengan rata-rata persentase validitas sebesar 89,12%; (4) keefektifan pembelajaran dengan menggunakan media yang dikembangkan termasuk dalam kategori sedang dengan nilai gain score sebesar 0,67, sehingga media yang dikembangkan layak digunakan.

The Impact of the teaching of English at the elementary schools on the students' achievement of English at the first year of lower secondary schools / by Sri Rachmajanti

 

Peranan Perpustakaan Umum Kota Malang dalam proses pembelajaran apresiasi seni budaya bagi siswa sekolah menengah / Indra Bayu Anindika Waspodo

 

Kata kunci: Peranan Perpustakaan, Pembelajaran Apresiasi, Seni Budaya, Siswa, Malang. Penelitian ini mencoba untuk meneliti kegiatan apresiasi siswa sekolah menengah yang berada di Perpustakaan Umum Kota Malang. Fokus masalah yang diteliti yaitu (1) Fasilitas dan layanan Perpustakaan Umum terkait proses apresiasi Seni Budaya bagi siswa sekolah menengah di Kota Malang (2) Peranan Perpustakaan Umum dalam proses pembelajaran apresiasi pada Mata Pelajaran Seni Budaya bagi siswa Sekolah Menengah di Kota Malang (3) Faktor pendukung dan penghambat siswa sekolah menengah dalam melakukan kegiatan apresiasi di Perpustakaan Umum Kota Malang. Subyek yang diteliti meliputi siswa sekolah menengah di kota malang, pegawai perpustakaan dan guru sekolah. Metode yang digunakan pada penelitian ini adalah deskriptif menggunakan pendekatan kualitatif sedangkan untuk pengumpulan datanya dengan angket, wawancara, observasi dan dokumentasi. Proses analisis data penelitian ini dibagi menjadi dua, yaitu proses analisis data untuk data yang diperoleh dari guru dan pegawai perpustakaan serta proses analisis data untuk data yang diperoleh dari siswa. Proses analisis data untuk data yang diperoleh dari guru menggunakan pengolahan data menurut kategorinya, kemudian data dianalisis langsung dan dikaitkan dengan data sejenis pada kelompok kategori yang sama. dalam hal ini data ditrianggulasi secara teknik atau sumber. Untuk data yang diperoleh dari siswa dianalisis dengan rumus prosentase. Hasil dari penelitian yaitu Perpustakaan Umum Kota Malang merupakan salah satu tempat untuk melakukan kegiatan pembelajaran apresiasi bagi para siswa di kota Malang di luar lingkungan sekolahnya. Fasilitas yang dapat digunakan terkait pembelajaran apresiasi adalah koleksi bahan pustaka Seni Budaya di ruang koleksi, Pameran karya seni di ruangan Anjungan Ken Arok dan pemutaran video seni budaya di ruang audio visual atau Hall utama Perpustakaan Umum Kota Malang. Peranan Perpustakaan Umum dalam pembelajaran apresiasi dapat meningkatkan tingkat apresiasi siswa dalam pembelajaran seni budaya. Untuk mendukung data yang diperoleh, ditambahkan data statistik yang diperoleh dari angket yang diberikan kepada siswa.

Pembelajaran kemampuan berbahasa Indonesia berbasis cerita fiksi kontemporer anak-anak untuk siswa kelas 5 sekolah dasar / oleh Muakibatul Hasanah

 

Pengaruh konflik peran terhadap kepuasan kerja melalui stres kerja (studi pada karyawan Bagian Administrasi Keuangan dan Umum PG Meritjan Kediri) / Muhammad Lutfi

 

Kata Kunci : Konflik Peran, Stres Kerja, Kepuasan Kerja Perkembangan industrialisasi yang semakin pesat membuat perusahaan mengerahkan segenap kemampuan dan sumberdaya yang dimiliki untuk mempertahankan eksistensinya. Karyawan dituntut untuk bekerja serba cepat dan tepat demi target yang telah diberikan, banyaknya perintah dan tuntutan membuat karyawan bimbang, perintah mana yang lebih diutamakan. Hal inilah salah satu penyebab konflik di dalam diri karyawan (konflik peran). Jika pihak manajemen tidak serius dalam menyikapi permasalahan ini, karyawan akan mengalami stres di dalam pekerjaanya dan jika stres kerja dibiarkan berlarut-larut maka akan berdampak pada kepuasan kerja karyawan dan secara langsung maupun atau tidak langsung perusahaan juga akan mengalami kerugian. Pada PG Meritjan sumberdaya manusia merupakan aset yang paling berharga, mereka memberikan kontribusi yang besar bagi perusahaan dan sebaliknya perusahaan juga sangat memperhatikan kesejahteraan karyawan. Penelitian ini bertujuan untuk mengetahui: 1) deskripsi konflik peran, stres kerja, dan kepuasan kerja karyawan, 2) pengaruh konflik peran terhadap stres kerja, 3) pengaruh konflik peran terhadap kepuasan kerja, 4) pengaruh stres kerja terhadap kepuasan kerja, dan 5) pengaruh konflik peran terhadap kepuasan kerja melalui stres kerja. Jenis penelitian yang digunakan adalah penelitian Explanatory research. Penelitian dilaksanakan pada bulan November sampai dengan bulan Desember 2011 di PG Meritjan Kediri. Populasi yang dipilih adalah karyawan bagian Administrasi, Keuangan dan Umum yang berjumlah 78 orang dan teknik pengambilan sampel menggunakan simple random sampling sebanyak 65 orang. Analisis data yang dipakai adalah analisis jalur (path analysis). Dalam penelitian ini variabel bebas yaitu konflik peran (X), variabel intervening yaitu stres kerja (Z) dan variabel terikat yaitu kepuasan kerja (Y). Pengujian hipotesis dilakukan dengan menggunakan SPSS 16.0 for Windows. Hasil penelitian menunjukkan bahwa : 1) Konflik Peran pada karyawan bagian administrasi keuangan dan umum PG Meritjan tergolong rendah, Stres Kerja pada karyawan bagian administrasi keuangan dan umum PG Meritjan tergolong rendah, dan Karyawan bagian administrasi keuangan dan umum PG Meritjan merasakan puas dengan kondisi pekerjaanya saat ini, 2) Terdapat pengaruh positif secara langsung yang signifikan konflik peran terhadap stres kerja karyawan bagian administrasi keuangan dan umum PG Meritjan, 3) Terdapat pengaruh negatif secara langsung yang signifikan konflik peran terhadap kepuasan kerja karyawan bagian administrasi keuangan dan umum PG Meritjan, 4) Terdapat pengaruh negatif secara langsung yang signifikan stres kerja terhadap kepuasan kerja karyawan bagian administrasi keuangan dan umum PG Meritjan, 5) Terdapat pengaruh negatif secara tidak langsung yang signifikan konflik peran terhadap kepuasan kerja melalui stres kerja. Dari hasil analisis tersebut peneliti memberikan saran sebagai berikut: 1) Untuk menjaga agar konflik peran tetap rendah pihak manajemen perusahaan selalu memperhatikan kewajiban dan hak dari karyawan itu sendiri. Dan kebijakan yang selama ini dilakukan hendaknya tetap dipertahankan karena sudah cukup baik. 2) Untuk mengantisipasi karyawan yang merasa frustasi dengan rutinitas sehari-hari mereka, pihak manajemen bisa mencoba untuk mengadakan suatu kegiatan yang diluar pekerjaan yaang bersifat kekeluargaan, menyenangkan, dan menghibur serta paling tidak dilakukan setiap periode tertentu agar karyawan tidak merasa bosan dan frustasi. 3) Untuk mengantisipasi karyawan yang merasa kurang puas terhadap pengakuan kerja mereka, maka pihak manajemen mempersiapkan suatu kebijakan untuk membuat karyawan merasa termotivasi untuk bekerja lebih baik yaitu dengan memberikan bonus bagi karyawan yang memiliki kinerja bagus dan bisa menjadi contoh bagi karyawan yang lain.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |