Perilaku pemilih dan partisipasi politik masyarakat dalam pilkada Kabupaten Malang 2010 / Eko Wahyudi

 

Kata Kunci: perilaku pemilih, partisipasi politik, pilkada Perilaku pemilih merupakan bagian dari partisipasi politik karena dalam perilaku pemilih menunjukkan sikap, tingkah laku, tindakan dan keputusan politik dari seseorang. Sikap, tingkah laku, tindakan, dan keputusan politik diwujudkan dalam berbagai aktivitas mulai dari masa sebelum pemilihan (pre-election period) seperti keterlibatan dalam kampanye, partisanship, keterlibatan dalam mengawal jalannya pemilu, sampai pada proses pemilu, masa ketika pemilihan (in-election period) yaitu partisipasi dalam pemilihan (voter-turnout), perilaku memilih (voting), dan aktivitas tidak memilih (non-voting) yang di Indonesia, meskipun sesungguhnya penggunaan istilah itu sangat tidak tepat, populer dengan istilah golput. Tujuan dari penelitian ini antara lain: (1) untuk menjelaskan perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010, (2) untuk menjelaskan partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010, (3) untuk mengidentifikasi faktor yang mempengaruhi perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010, (4) untuk mengidentifikasi faktor yang mempengaruhi partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010. Penelitian ini menggunakan rancangan penelitian kualitatif dengan jenis penelitian studi kasus. Lokasi penelitian di Kabupaten Malang. Sumber data dalam penelitian ini adalah manusia dan dokumen. Teknik pengumpulan data yang digunakan adalah wawancara (interview) dan studi dokumentasi. Analisis data yang digunakan adalah model interaktif melalui tiga tahap yaitu: (1) reduksi data, (2) penyajian data, dan (3) penarikan kesimpulan. Temuan penelitian dalam penelitian ini antara lain: (1) perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010 diantaranya: (a) mendirikan kelompok pendukung pasangan calon, ikut memasang baliho calon, serta membangun posko pemenangan, (b) menggunakan pernak-pernik pasangan calon, (c) memakai kaos yang bergambarkan pasangan calon, (d) ikut mengarak calon dari kediamaannya menuju tempat digelarnya acara, (e) menempelkan beberapa stiker di mobil dan sepeda motor mereka, (f) menerima bantuan berupa sembako dan uang, (g) melakukan perusakan alat peraga, (h) mengikuti kampanye dan menghadiri acara debat calon yang disiarkan oleh stasiun televisi lokal dan swasta, (i) mengikuti penghitungan suara, (j) bertepuk tangan ketika ketika calon yang dijagokannya mendapatkan suara, (k) mengikuti suara petugas TPS dengan mengucapkan kata-kata “sah”, (l) berkumpul di posko pemenangan pasangan calon, (m) sujud syukur bersama-sama, (n) pemilih memangkas rambutnya dan melakukan syukuran dengan memotong tumpeng, (2) partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah (Pilkada) Kabupaten Malang 2010 antara lain: (a) mengikuti sosialisasi Pilkada oleh KPUD Kabupaten Malang, (b) mengikuti perkembangan pelaksanaan Pemilihan Kepala Daerah (Pilkada) 2010 melalui media massa, (c) menjadi anggota aktif dari partai politik atau kelompok kepentingan, (d) menghadiri acara diskusi politik, (e) mengikuti kegiatan kampanye, (f) memberikan suara dengan memilih Bupati dan Wakil Bupati, dan (g) masyarakat yang menggunakan hak pilihnya sebanyak 1.112.187 orang dari jumlah Daftar Pemilih Tetap (DPT) sebanyak 1.882.452 orang atau sekitar 59,56 %, (3) faktor yang mempengaruhi perilaku pemilih dalam pelaksanaan Pemilihan Kepala Daerah Kabupaten Malang 2010 antara lain: (a) loyalitas pemilih terhadap partai politik, (b) figur pasangan calon, (c) pertimbangan untung rugi atau imbalan, dan (d) keberadaan tokoh masyarakat, dan (4) faktor yang mempengaruhi partisipasi politik masyarakat dalam pelaksanaan Pemilihan Kepala Daerah Kabupaten Malang 2010 diantaranya: (a) kesadaran politik dari masyarakat, (b) tingkat pendidikan, (c) keberadaan tokoh masyarakat, dan (d) rendahnya pendidikan politik masyarakat. Berdasakan hasil penelitian saran yang diajukan adalah: (1) sebaiknya sosialisasi yang dilakukan KPUD Kabupaten Malang mencakup semua golongan masyarakat, (2) sebaiknya ada kerjasama antara lembaga penyelenggara Pemilihan Kepala Daerah yaitu KPUD Kabupaten Malang, partai politik serta organisasi kemasyarakatan untuk meningkatkan pendidikan politik bagi masyarakat Kabupaten Malang, (3) perlu adanya kerjasama antara KPUD Kabupaten Malang, Panwaslu, organisasi kemasyarakatan, LSM yang bertindak sebagai pemantau pelaksanaan Pilkada untuk mengawasi pelaksanaan Pilkada, (4) sebaiknya masyarakat memanfaatkan pelaksanaan Pilkada sebagai salah satu sarana menyampaikan aspirasi dan hak politiknya serta menggunakan hati nuraninya dalam menyalurkan aspirasi untuk mewujudkan proses demokrasi di Kabupaten Malang, dan (5) sebaiknya KPUD Kabupaten Malang perlu mengadakan evaluasi mengenai pelaksanaan Pilkada Kabupaten Malang 2010 sehingga pelaksanaan Pilkada berikutnya dapat berjalan lebih baik lagi.

Kolaborasi model pembelajaran STAD (Student Teams Achievement Divisions) dengan Group Investigation (GI) untuk meningkatkan aktivitas dan hasil belajar siswa (studi pada siswa kelas XI Program Keahlian Pemasaran, mata pelajaran menata produk di SMK Negeri 1 Malang) / Da

 

Kata Kunci: Kolaborasi Model Pembelajaran STAD dengan Group Investigation (GI), Aktivitas & Hasil Belajar Siswa Kolaborasi Model Pembelajaran STAD dengan Group Investigation dilakukan untuk meningkatkan aktivitas dan hasil belajar siswa, menjadikan siswa lebih aktif dalam proses pembelajaran. Kolaborasi model pembelajaran STAD dengan Group Investigation merupakan variasi dalam pembelajaran agar pembelajaran tidak monoton dengan hanya menggunakan metode ceramah sehingga siswa tidak merasa bosan dan lebih termotivasi dalam belajar. Penelitian dilakukan untuk mengetahui perbandingan aktivitas dan hasil belajar sebelum dan setelah diimplementasikan kolaborasi model pembelajaran STAD dengan Group Investigation pada pokok bahasan memonitor penataan atau display produk pada siklus I dengan model pembelajaran STAD dan materi menjaga display agar sesuai dengan standar perusahaan dan perencanaan pada siklus II dengan model pembelajaran Group Investigation. Tujuan penelitian ini adalah: (1) untuk mengetahui bagaimanakah penerapan kolaborasi model pembelajaran STAD dengan Group Investigation; (2) Untuk mengetahui aktivitas dan hasil belajar siswa kelas XI sebelum dan setelah diimplementasikan model pembelajaran STAD dengan Group Investigation; (3) Untuk mengetahui hambatan beserta solusi dalam penerapan kolaborasi model pembelajaran STAD dengan Group Investigation. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang dilakukan dalam dua siklus. Setiap siklus terdiri dari beberapa tahap yaitu perencanaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian adalah kelas XI PM SMK Negeri 1 Malang. Pengumpulan data dilakukan dengan menggunakan tes, panduan observasi, format penilaian, wawancara dan angket untuk mengetahui respon siswa terhadap kolaborasi model pembelajaran STAD dengan Group Investigation. Hasil penelitian menunjukkan bahwa penerapan kolaborasi model pembelajaran STAD dengan Group pada mata pelajaran Menata Produk berjalan dengan lancar, walaupun pada saat pelaksanaan masih terdapat beberapa kekurangan. Selain itu, hasil belajar siswa juga terjadi peningkatan cara belajar. Peningkatan cara belajar siswa tersebut dapat dilihat dari antusiasme dan kerjasama siswa dalam belajar kelompok. Di samping itu, siswa tampak aktif, dalam belajar. Kemampuan siswa dalam aspek afektif pada mata pelajaran Menata Produk juga mengalami peningkatan. Dari 40 orang siswa yang menjadi subyek penelitian, sebanyak 27,5% (29 orang) sudah tuntas belajar. Sebelumnya, siswa yang tuntas di siklus I hanya 14 siswa (35%). Nilai rata-rata kelas pada aspek kognitif mengalami kenaikan, yaitu dari 65,74 di siklus I menjadi 70,41 di siklus II. Hal ini berarti terjadi kenaikan sebesar 4,67 yang berarti terjadi peningkatan meskipun hanya sedikit. Sedangkan nilai rata-rata kelas pada aspek afektif juga mengalami kenaikan. Terjadi kenaikan persentase hasil belajar aspek afektif dari siklus I ke siklus II. Di siklus I rata-rata kelas sebesar 71,34 sedangkan di siklus II sebesar 81,50. Berarti terjadi kenaikan sebesar 10,16. Adapun saran yang dapat diberikan peneliti dari penelitian yang telah dilakukan ini adalah agar pihak SMK Negeri 1 Malang tidak hanya memakai metode konvensional dalam pembelajaran sehari-hari, tetapi juga memakai metode kooperatif agar siswa lebih aktif. Berdasarkan kecenderungan peningkatan yang terjadi pada setiap siklus meskipun hanya sedikit, apabila siswa diberikan kesempatan untuk mengembangkan kompetensinya secara rutin, maka dapat diyakini kemampuannya akan bisa lebih ditingkatkan. Karena itu, untuk meningkatkan aktivitas, kreativitas, dan produktivitas berpikir siswa, pemecahan masalah dalam mata pelajaran Menata Produk perlu diberikan secara rutin dalam pembelajaran.

Perbedaan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama dan perkawinan campuran (Jawa-Madura) / Rian Hidrya W.

 

Kata Kunci: Jawa-Madura, Perkawinan Antarbudaya, Depresi Istri Perkawinan antarbudaya merupakan perkawinan yang kompleks, sejalan dengan hal tersebut dalam perkawinan antarbudaya akan terdapat dua karakteristik budaya yang berbeda dan memungkinkan untuk terjadi konflik. Dalam menghadapi suatu masalah memiliki kecenderungan depresi yang terdiri dari gejala emosional, kognitif, motivasional dan fisik. Tujuan penelitian ini (1) menggambarkan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama; (2) menggambarkan depresi istri bersuku Jawa pada perkawinan berlatar belakang perkawinan campuran (Jawa-Madura); (3) mengetahui perbedaan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama dan perkawinan campuran (Jawa-Madura). Penelitian ini menggunakan metode kuantitatif dengan desain deskriptif dan komparatif. Subjek penelitian terdiri dari 30 istri bersuku Jawa pada perkawinan sama suku dan 30 istri bersuku Jawa pada perkawinan campuran (Jawa-Madura) di Malang dan Situbondo dengan menggunakan teknik aksidental. Penelitian ini menggunakan instrumen Beck Depression Inventory (BDI) dengan reliabilitas 0,93. Hasil penelitian menunjukkan (1) Skor mean depresi istri bersuku Jawa pada perkawinan sama suku sebesar 4,97. Depresi istri bersuku Jawa pada perkawinan sama suku yang teridentifikasi depresi minimal sebanyak 26 orang (86,67%), depresi ringan sebanyak 3 orang (10%), dan depresi sedang sebanyak 1 orang (3,33%). (2) Skor mean depresi istri bersuku Jawa pada perkawinan campuran (Jawa-madura) sebesar 13,50 dan depresi istri bersuku Jawa pada perkawinan campuran (Jawa-Madura) yang teridentifikasi depresi kategori minimal sebanyak 18 orang (60%), depresi ringan sebanyak 4 orang (13,33%), depresi sedang sebanyak 6 orang (20%), dan depresi berat sebanyak 2 orang (6,67%). (3) Berdasarkan analisis komparatif diperoleh hasil skor U = 197,500 Sig 0,000 < 0,05 hal ini berarti terdapat perbedaan depresi istri bersuku Jawa pada perkawinan berlatar belakang suku yang sama dan perkawinan campuran (Jawa- Madura). Disarankan (1) untuk pasangan yang melakukan perkawinan campuran sebaiknya memahami kebiasaan dan mengetahui budaya pasangannya dengan cara membaca berbagai buku mengenai budaya pasangannya, selain itu bisa juga melakukan konsultasi perkawinan, agar masalah dapat terselesaikan dengan tepat. (2) Untuk penelitian selanjutnya diharapkan menggunakan metode kualitatif agar dapat mendeskripsikan aspek-aspek dengan lebih jelas. Jika menggunakan metode kuantitatif, diharapkan memperluas subjek penelitian agar hasil penelitian yang diperoleh menjadi lebih variatif dan lebih akurat.

Studi daerah rawan kecelakaan lalu lintas jalur Karanglo-Purwosari / Yudha Sucianto

 

Kata kunci: rawan kecelakaan, lalu lintas. Jalan raya jalur Karanglo (Malang)-Purwosari (Pasuruan) sebagai jalan arteri primer harus sebanding dengan jumlah kendaraan yang lewat, sehingga beban lalu-lintas tidak menjadi menumpuk dari bermacam-macam tipe kendaraan dan berujung pada keselamatan lalu lintas. Lokasi rawan kecelakaan adalah suatu lokasi dimana angka kecelakaan tinggi dengan kejadian kecelakaan berulang dalam suatu ruang dan rentang waktu yang relatif sama yang diakibatkan oleh suatu penyebab tertentu. Penelitian ini merupakan penelitian deskriptif kuantitatif, yang akan menggali data mengenai kecelakaan lalu lintas disepanjang jalur Karanglo-Purwosari dengan mengutip data kepolisian dan survei lalu lintas di jalan raya. Selain itu tujuan yang ingin dicapai yaitu untuk mengetahui gambaran kondisi dan lokasi rawan kecelakaan, serta nantinya diharapkan dapat digunakan untuk kebijakan instansi terkait. Hasil penelitian ini menunjukkan bahwa pada kurun waktu tahun 2008 sampai dengan 2010, terdapat 326 kali kecelakaan yang mengakibatkan 432 luka ringan, 16 luka berat, dan 122 meninggal dunia pada usia terbanyak 31-40 tahun (24,39%). Kecenderungan kecelakaan terjadi pada hari Sabtu (17,48%), bulan April (11,87%), antara jam 06.00-12.00 (36,8%). Tabrakan samping- samping berpeluang (38,96%) sebagai kecelakaan ganda (64,11%) dengan melibatkan kendaraan terbanyak yaitu sepeda motor (57%) pada cuaca yang cerah (74,54%). Disamping itu kerugian material yang ditimbulkan mencapai Rp. 440.445.000,-. Selain itu berdasarkan hasil perhitungan angka Upper Control Limmit (UCL) = 45,529 dapat ditentukan posisi blackspot dan blacksite berada pada STA 14 + 000 s/d 15 + 000 (KM 67-66) AR/FR = 60,62/47,38, STA 16 + 000 s/d 17 + 000 (KM 65- 64) AR/FR = 128,82/124,55, dan STA 18 + 000 s/d 19 + 000 (KM 63-62) AR/FR = 70,09/48,31. Dimana penentuan patok KM adalah arah menuju kota Surabaya dari titik awal stationing pada KM 81 SBY (pertigaan Karanglo). Berdasarkan hasil penelitian ini, dapat disarankan agar dilakukan penambahan pos jaga pada titik rawan. Terlebih lagi pemberian jalur khusus sepeda motor serta pembinaan cara berkendara yang baik. Selain itu penyempurnaan sistem identifikasi dan rekam kecelakaan juga perlu dilakukan, agar tercipta dan terjaga keselamatan lalu lintas.

Pengembangan kartu kuartet sebagai media pembelajaran kemahiran berbicara bahasa Arab bagi siswa kelas XI Madrasah Aliyah / Jumiati

 

Kata Kunci: kartu kuartet, pembelajaran kemahiran berbicara, MA Bahasa Arab merupakan mata pelajaran wajib di madrasah, mulai tingkat dasar sampai tingkat menengah. Untuk menjadikan siswa menyerap, memahami, serta menguasai materi bahasa Arab diperlukan usaha yang terencana dan sistematik. Salah satu upaya yang dapat dilakukan adalah dengan mengembangkan media pembelajaran untuk menarik minat siswa agar lebih menyukai pelajaran bahasa Arab. Media Kartu Kuartet sebagai media pembelajaran kemahiran berbicara dirancang dengan tehnik permainan, dan dapat memberikan suasana belajar yang menyenangkan serta meningkatkan semangat siswa. Cara menggunakannya sangat mudah, sehingga membuat siswa senang bermain sambil memikirkan jawaban dari berbagai pertanyaan dalam permainan edukatif ini. Karena pada saat siswa melakukan aktivitas permainan kartu kuartet siswa akan aktif bertanya jawab dan tanpa mereka sadari bahasa Arab yang mereka gunakan berangsur-angsur menjadi lebih familiar. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal yang mancakup pembuatan media kartu kuartet, tampilan produk media kartu kuartet, dan cara penggunaan media kartu kuartet. Data yang telah dikumpulkan yaitu berupa data validasi dari hasil uji ahli media dan uji materi, serta hasil validasi dari uji lapangan yaitu dari guru dan siswa kelas XI MA Nurul Ulum Malang. Data tersebut diperoleh melalui angket dan hasil dari pengisian angket tersebut dirangkum dalam bentuk tabel validasi/ tinjauan hasil penelitian. Berdasarkan hasil analisis data, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, pembuatan media kartu kuartet telah dilaksanakan melalui beberapa tahap dalam proses pengembangannya, yaitu (1) analisis kebutuhan, (2) memilih materi, (3) mengembangkan produk, (4) tahap produksi, (5) tahap validasi, (6) tahap revisi, (7) uji lapangan. Kedua, tampilan produk media kartu kuartet memiliki empat komponen yaitu tema, tema/judul, pertanyaan, 1 gambar inti yang dimaksudkan didalam pertanyaan, tiga gambar yang ukurannya lebih kecil terletak dibagian paling bawah kartu untuk menerangkan materi-materi dalam satu tema. Untuk mempermudah pengelompokan pengembang memberikan warna yang berbeda pada setiap kelompok tema. Kartu kuartet yang telah dikembangkan memiliki 8 tema dengan 4 pasang gambar pada setiap kartu. Ketiga, cara penggunaan media kartu kuartet yaitu kegiatan pendahuluan, kegiatan inti, dan kegiatan penutup. Dalam setiap tahap pembelajaran tersebut siswa tidak hanya diajarkan berbicara menggunakan bahasa Arab akan tetapi dari media kartu kuartet ini perbendaharaan kosakata yang didapatkan siswa menjadi bertambah. Berdasarkan hasil penelitian ini disarankan kepada guru mata pelajaran bahasa Arab untuk menggunakan permainan kartu kuartet sebagai sarana untuk meningkatkan motivasi belajar siswa, dan disarankan kepada pengembang selanjutnya untuk mengembangkan kartu kuartet dengan variasi, teknis permainan, dan penggunaan kemahiran berbahasa yang berbeda.

Analisis faktor yang menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi Universitas Negeri Malang / Devi Wulan Febriarto

 

Kata kunci: Kepuasan Mahasiswa, Pelayanan Salah satu usaha yang paling penting dalam menciptakan kepuasan pelanggan adalah melalui pemberian pelayanan yang baik. Kualitas pelayanan yang diberikan oleh perusahaan dapat menciptakan suatu persepsi positif dari pelanggan terhadap perusahaan dan menghasilkan suatu keputusan serta loyalitas pelanggan. Ada lima dimensi yang berperan besar dalam kualitas pelayanan, yaitu aspek bukti langsung (bukti fisik), keandalan, daya tanggap, jaminan, serta empati. Tujuan dari penelitian ini yaitu untuk mengetahui: (1) apa saja pelayanan yang diberikan oleh Fakultas Ekonomi dalam memenuhi kebutuhan mahasiswa, (2) faktor apa saja yang menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan Fakultas Ekonomi, (3) faktor mana yang dominan menjadi pertimbangan dalam menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi. Variabel dalam penelitian ini adalah kualitas pelayanan, dimana dibagi dalam lima subvariabel yaitu bukti fisik, keandalan, daya tanggap, jaminan, dan empati. Populasi yang digunakan adalah seluruh mahasiswa Fakultas Ekonomi yang melakukan registrasi semester gasal 2010/2011. Sampel yang diambil menggunakan teknik proportional sampling, pengambilan sampel dari setiap strata atau wilayah ditentukan seimbang atau sebanding dengan banyaknya subjek dalam masing-masing strata atau wilayah. Pengumpulan data dilakukan dengan cara memberikan kuesioner kepada responden dan mencari data dari beberapa sumber tertentu, misalnya pegawai tata usaha dan katalog Fakultas Ekonomi. Dari hasil penelitian menunjukkan bahwa (1) Kelima faktor dari variabel kualitas pelayanan menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi, (2) Faktor bukti fisik I dan Keandalan adalah faktor yang mempunyai pengaruh paling besar dalam menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi, (3) ada faktor yang sangat kurang memenuhi kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi antara lain ruangan kelas yang luas dan representative, kecepatan pegawai dalam melayani mahasiswa, sikap sopan yang ditunjukkan pegawai, dan keamanan dalam penitipan barang di perpustakaan. Dari hasil penelitian disarankan bagi Fakultas Ekonomi agar lebih terbuka dalam menerima saran dan kritik dari mahasiswa baik itu melalui pengadaan kotak saran, call center, maupun melalui saran online di website, meningkatkan keamanan baik didalam perpustakaan maupun di tempat parkir, lebih cepat dalam menanggapi keluhan dari mahasiswa, dan pegawai selalu bersikap sopan dan ramah ketika memberikan pelayanan kepada mahasiswa.

The perceptions of Indonesian speakers of English toward speaker's age as reflected in the choice of words / Krisnawati Lisandi

 

Keywords: group of age, speaker’s age, choice of words, associated words. It has been a common fact that somebody categorizes himself into a particular group through one of many media, that is language. Somebody or a group of people use language as a media, in terms of the use of definite terms or particular vocabularies within the group, in order to show their identities. Age is a group where people can decide which group they belong to, young or old group. Age is also seen as an influencing factor that has a significance toward the language use, that is in people’s choice of words. Thus, it is assumed there are some words that are associated as the vocabularies of certain group. In this study, group of age is divided into two groups, those are: Old Group and Young Group. Both groups are believed to have difference in the use or choice of words in their daily conversation. Through a quantitative method, this study used questionnaire as the instrument, and took 80 respondents from two groups of age as the subject of the study. The researcher could see the tendency of both group in selecting the word through the provied vocabularies that were believed to show the differences of age-graded words. In addition, the words had been set in the form of casual/ informal conversation. The results of the study are used to find out the answers of general research problem, that is about the perception of speakers’ age of English words, especially seen on the associated words of Old or Young group. This perception is viewed from Indonesian speakers as EFL learners. From this study, the researcher obtained the list of the most frequently occuring words among the speakers of each group of age. In casual converstion, there are 15 words that occur the most within old speakers’ conversation, while there are 18 words appear as the most used words among young speakers. Besides explaining about the words that are associated as the most frequently used words by each group, the results of the study also show the words that are used by both group and words that is called data balance in term of its balanced usage by the speakers in a group of age. From the analysis, it can be obtained a conclusion that young speakers shows such a pattern in choosing the word rather than old speakers. It has answered of how Indonesian speakers’ perspective about the associated words related with the speaker who use it. The research can conclude that within Indonesian speakers as the EFL learner, it is not significantly found a sense of speakers’ choice of words related to the difference of speakers’ age.

Penggunaan media benda konkrit untuk meningkatkan pembelajaran siswa kelas IV tentang gaya di SDN Rampal Celaket 2 Malang / Erna Juwariyah

 

Kata Kunci : Media Benda Konkrit, Pembelajaran IPA, HasilBelajar Pembelajaran IPA denganmenggunakanmetodeceramahmenjadikansiswasebagaisubyekbelajar yang pasifkarenahanyamendengardanmencatat, sehingga rata-rata nilai yang dicapaisiswamasih di bawahkriteriaketuntasan yang ditetapkan di KTSP. Hal inimendorongpenelitimenerapkan model pembelajarandenganmenggunakan media bendakonkrituntukmengatasipermasalahantersebut.Denganmenggunakan media bendakonkritdalampembelajaran IPA diharapkansiswadapatterlibatsecaraaktif. Penelitianinibertujuanuntukmendeskripsikan : (1) Penerapan media padapembelajaran IPA, (2) Aktivitassiswadalampembelajaran IPA, (3)hasilbelajarsiswa yang diajarkandengan media bendakonkrit, (4) tanggapan guru tentangpembelajaran IPA yang menggunakan media bendakonkrit, dan (5) tanggapansiswatentangpembelajaran IPA yang menggunakan media konkrit. Rancanganpenelitianinimenggunakanjenis PTK dengan model KemmisdanMc Taggart. Penelitianinidilaksanakandalamduasiklus.Subyekpenelitianadalahsiswakelas IV SDN RampalCelaket 2 Malang semester genaptahunajaran 2010/2011 yang berjumlah 35 siswa. Data penelitiandikumpulkanmelaluiobservasi , tes, wawancara, dandokumentasisedang data hasilbelajarsiswadiperolehdengantes yang dilaksanakanpadasetiapakhirsiklus. Hasilpenelitianmenunjukkanadanyapeningkatanpembelajaransiswakelas IV SDN RampalCelaket 2 Malang. Hal inidapatdilihatdarikeberhasilantindakan guru padasiklus I rata-rata 68% danmeningkatpadasiklus II menjadi 86%, hasilbelajarsiswajugameningkatpadasiklus I sebesar 64,70 danmeningkatpadasiklus II menjadi76,29. Aktivitassiswajugamengalamipeningkatanpadasiklus I. Aktivitassiswamengalamipeningkatan rata-rata padasiklus I adalah 53% menjadi 72% padasiklus II.Tanggapan guru pemanfaatan media sesuaidengankarakteristiksiswadandapatmeningkatkanaktivitassiswa. Tanggapansiswapenggunaan mediadapatmeningkatkanhasilbelajar. Saran dariadanyapenelitianiniadalah guru hendaknyamenggunakan media bendakonkritpadapembelajarangunamencapaihasilbelajar yang lebih baik. Selainitudiharapkanhasilpenelitianiniditindaklanjutigunamemperolehhasil yang lebihbaik.

Manajemen kurikulum di sekolah dasar yang menerapkan sistem pembelajaran full day school (studi kasus di SD Islam Al Azhaar Tulungagung) / Ayunda Windiyani

 

Kata kunci: manajemen kurikulum, sistem pembelajaran full day school. Kurikulum merupakan salah satu substansi dalam manajemen pendidikan. Keseluruhan substansi dalam manajemen pendidikan saling terkait dan saling mendukung satu sama lain untuk mencapai tujuan pendidikan, termasuk kurikulum. Manajemen kurikulum adalah setiap usaha sekolah untuk mengatur seluruh kegiatan, baik yang bersifat intra kurikuler, ko kurikuler, maupun ekstrakurikuler. Sistem pembelajaran full day school adalah sekolah yang sehari penuh, dengan artian siswa berada di sekolah selama seharian untuk lebih mendalami suatu materi pelajaran atau kegiatan lain dimana jam yang digunakan melebihi sekolah pada umumnya. Penelitian ini memiliki fokus yaitu: (1) perencanaan kurikulum di SD Islam Al Azhaar Tulungagung yang menerapkan sistem pembelajaran full day school; (2) pengorganisasian kurikulum di SD Islam Al Azhaar Tulungagung yang menerapkan sistem pembelajaran full day school; (3) pelaksanaan kurikulum di SD Islam Al Azhaar Tulungagung yang menerapkan sistem pembelajaran full day school; (4) pengawasan kurikulum di SD Islam Al Azhaar Tulungagung yang menerapkan sistem pembelajaran full day school. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus karena dengan studi kasus berusaha mengungkap secara deskriptif semua fenomena, kejadian, masalah di suatu lokasi yang mengutamakan kealamiahan atau natural. Teknik yang digunakan dalam penelitian ini meliputi: (1) wawancara mendalam; (2) observasi; dan (3) dokumentasi. Adapun teknik untuk mengecek keabsahan data meliputi: (1) perpanjangan kehadiran di lapangan; (2) triangulasi; dan (3) observasi yang mendalam. Kesimpulan penelitian yang dihasilkan yaitu: (1) perencanaan kurikulum di SD Islam Al Azhaar Tulungagung dilaksanakan awal tahun ajaran baru secara bersama dalam kegiatan yang bernama workshop; (2) pengorganisasian kurikulum di SD Islam Al Azhaar Tulungagung memiliki dua kurikulum sekaligus, dan memiliki waka kurikulum; (3) pelaksanaan kurikulum di SD Islam Al Azhaar Tulungagung adalah dengan menggabungkan antara KTSP Diknas Tulungagung dan kurikulum khas yang dimiliki; (4) pengawasan kurikulum di SD Islam Al Azhaar Tulungagung dilakukan oleh kepala sekolah menggunakan dua cara, yaitu pengawasan langsung dan tidak langsung dalam jangka waktu panjang dan jangka waktu pendek. Saran yang bisa disampaikan dari hasil penelitian ini adalah: (1) kepala sekolah diharapkan terus memberikan pengawasan, arahan, bimbingan kepada wakil kepala sekolah bagian kurikulum, serta guru-guru dalam perencanaan, pelaksanaan kurikulum secara menyeluruh, mengingat kurikulum merupakan substansi inti dalam suatu sekolah, demi meningkatkan akhlak dan prestasi siswa di SD Islam Al Azhaar Tulungagung ini; (2) wakil kepala sekolah bagian kurikulum diharapkan selalu cermat dan teliti dalam pembagian tugas guru serta penyusunan jadwal pelajaran, sehingga kegiatan pelaksanaan kurikulum di SD Islam Al Azhaar Tulungagung berjalan lancar sesuai dengan perencanaan yang sudah disusun sebelumnya; (3) para tenaga pengajar atau guru di SD Islam Al Azhaar Tulungagung diharapkan selalu ikhlas dan sepenuh hati dalam menjalankan ketentuan-ketentuan sekolah, khususnya kurikulum, sehingga tujuan pendidikan di SD Islam Al Azhaar Tulungagung ini tercapai dengan maksimal; (4) para akademisi Administrasi Pendidikan diharapkan lebih meningkatkan kemampuan mengenai kurikulum dan bisa memberikan teori serta praktek yang nyata kepada mahasiswa tentang manajemen kurikulum; (5) peneliti lain dapat dijadikan bahan referensi dan informasi awal untuk mengembangkan dan melaksanakan penelitian sejenis, yaitu mengenai manajemen kurikulum.

Peningkatan hasil belajar PKn melalui model deep dialogue/critical thinking pada siswa kelas V di SDN Arjowilangun 07 Kalipare Kabupaten Malang / Ike Wahyu Puspita Dewi

 

Kata kunci: Pembelajaran Terprogram, Hasil Belajar, IPS Hasil pengamatan pratindakan menunjukkan terdapat beberapa permasalahan dalam pelaksanaan pembelajaran IPS pada siswa kelas V SDN Boro Kec. Kedungwaru Kab. Tulungagung yaitu: (1) pelaksanaan pembelajaran menggunakan model pembelajaran konvensional yang tidak memperhatikan perbedaan yang ada pada setiap siswa, (2) pelaksanaan pembelajaran didominasi guru, (3) nilai rata-rata hasil belajar siswa adalah 58,08, (4) siswa yang mencapai hasil belajar di atas KKM sebanyak 7 siswa atau 28% dari 25 siswa. Penelitian ini bertujuan (1) untuk mendeskripsikan penerapan pembelajaran terprogram pada siswa kelas V SDN Boro Kec. Kedungwaru Kab. Tulungagung, (2) untuk mendeskripsikan peningkatan hasil belajar IPS pada siswa kelas V SDN Boro Kec. Kedungwaru Kab. Tulungagung. Pendekatan yang digunakan adalah Penelitian Tindakan Kelas (PTK) dengan model Kemmis dan Taggart. PTK termasuk penelitian kualitatif, meskipun data yang di kumpulkan bisa saja bersifat kuantitatif, di mana uraiannya bersifat deskriptif dalam bentuk kata-kata. Penelitian ini terdiri dari dua siklus. Tiap siklus dilaksanakan dengan tahapan sebagai berikut: (1) perencanaan, (2) pelaksanaan, (3) observasi, dan (4) refleksi. Hasil penelitian yang dilakukan selama dua siklus pembelajaran menunjukkan adanya peningkatan hasil belajar IPS secara bertahap. Persentase siswa tuntas pada pratindakan sebesar 28%, siklus I 68%, dan siklus II 88%. Peningkatan persentase ketuntasan dari pratindakan ke siklus I yaitu sebesar 40%, sedangkan peningkatan dari siklus I ke siklus II sebesar 20%. Berdasarkan data tersebut dapat disimpulkan bahwa penerapan pembelajaran melalui pembelajaran terprogram dapat meningkatkan hasil belajar IPS siswa. Dari hasil penelitian tersebut diharapkan agar senantiasa meningkatkan kualitas dan kinerjanya dengan menambah pengetahuan dan keterampilannya dalam menerapkan pembelajaran yang baru

Peranan anggota Dewan Perwakilan Rakyat Daerah terhadap peningkatan mutu pendidikan (studi tentang kebijakan bidang pendidikan di Kota Malang) / Dwi Putera Kusuma

 

Kata Kunci : peranan DPRD, kebijakan pendidikan, mutu pendidikan Pendidikan merupakan hak asasi setiap Warga Negara Indonesia dan untuk itu setiap Warga Negara Indonesia berhak memperoleh pendidikan yang bermutu sesuai dengan minat dan bakat yang dimilikinya tanpa memandang status sosial, ras, etnis, agama, dan gender. Pemerataan akses dan peningkatan mutu pendidikan akan membuat Warga Negara Indonesia memiliki kecakapan hidup (life skills), sehingga mendorong tegaknya pembangunan manusia seutuhnya serta masyarakat madani dan modern yang dijiwai nilai-nilai Pancasila. Menteri Pendidikan Nasional (Mendiknas) sebagai penanggung jawab sistem pendidikan nasional memiliki Rencana Strategis (Renstra) sebagai pedoman pengelolaan dan penyelenggaraan pendididkan bagi semua tingkatan pengelola pendidikan, mulai dari pemerintah pusat, pemerintah provinsi, pemerintah kabupaten/kota, satuan pendidikan, dan masyarakat. Dewan Perwakilan Rakyat Daerah (DPRD) merupakan lembaga perwakilan rakyat daerah yang berkedudukan sebagai unsur penyelenggara pemerintahan daerah kabupaten/kota membentuk peraturan daerah yang dibahas bersama bupati/walikota untuk mendapat persetujuan bersama yang nantinya diberlakukan kepada rakyat dengan segala ketentuan yang ditetapkan DPRD Kabupaten/Kota mempunyai fungsi: 1) Fungsi legislasi, 2) Fungsi anggaran, dan 3) Fungsi pengawasan. Tugas yang diemban oleh DPRD Kabupaten/Kota adalah: 1) Membentuk peraturan daerah yang dibahas dengan bupati/walikota, 2) Menetapkan APBD Kabupaten/Kota bersama-sama dengan bupati/walikota, 3) Melaksanakan pengawasan terhadap pelaksanaan peraturan daerah dan peraturan perundang-undangan lainnya, 4) Mengusulkan pengangkatan dan pemberhentian bupati/wakil bupati atau walikota/wakil walikota kepada Menteri Dalam Negeri melalui gubernur, 5) Memberikan pendapat dan pertimbangan kepada pemerintah daerah Kabupaten/Kota, 6) Meminta laporan keterangan pertanggungjawaban bupati/walikota. Berkaitan dengan itu, diperlukan pembahasan mengenai peranan yang dimiliki DPRD sebagai unsur penyelenggara pemerintahan daerah Kabupaten/Kota dalam upaya peningkatan mutu pendidikan bagi masyarakat. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui gambaran umum Kota Malang sebagai Kota Pendidikan, mengetahui kondisi pendidikan di Kota Malang, mendeskripsikan peranan anggota DPRD dalam kepeduliannya meningkatkan mutu pendidikan di Kota Malang, menjelaskan aspirasi masyarakat menyangkut upaya peningkatan mutu pendidikan yang ditampung oleh para anggota DPRD Kota Malang, dan mengetahui upaya yang dilakukan para anggota DPRD Kota Malang dalam rangka meningkatkan mutu pendidikan di Kota Malang. Penelitian ini menggunakan rancangan penelitian deskriptif, memberikan gejala-gejala, fakta-fakta, atau kejadian-kejadian secara sistematis dan akurat mengenai peranan Aggota DPRD Kota Malang. Pengumpulan data dilakukan dengan menggunakan instrumen angket yang diberikan kepada seluruh Anggota DPRD Kota Malang serta wawancara tidak terstruktur dengan Ketua Komisi D DPRD Kota Malang. Analisis data menggunakan tes Kolmogorov-Smirnov (K-S) untuk menguji kesesuaian peranan yang dilakukan oleh Anggota DPRD Kota Malang (distribusi observatif atau hasil pengamatan) dengan frekuensi yang diharapkan (distribusi teoretis) dalam meningkatkan mutu pendidikan. Berdasarkan hasil analisis data tersebut, diperoleh tiga simpulan hasil penelitian. Pertama, Peranan Anggota DPRD Kota Malang sebagai badan anggaran memiliki pengaruh yang signifikan terhadap kebijakan pendidikan di Kota Malang, sedangkan peranan sebagai legislasi dan pengawasan tidak memiliki pengaruh yang signifikan. Secara deskriptif, mereka memiliki peranan yang tinggi terhadap peningkatan mutu pendidikan di Kota Malang. Kedua, aspirasi masyarakat yang ditampung oleh DPRD Kota Malang terkait upaya peningkatan mutu pendidikan adalah menginginkan pendidikan murah melalui dana BOS, menuntut pendidikan gratis bagi anak tani dan buruh, serta menghentikan komersialisasi pendidikan. Ketiga, upaya yang dilakukan oleh para anggota DPRD Kota Malang dalam rangka meningkatkan mutu pendidikan adalah memperjuangkan anggaran pendidikan hingga 10% dari APBD, karena pada tahun-tahun sebelumnya tidak mencapai angka tersebut. Selain itu ada pembiayaan pendidikan tinggi Poltekom, meningkatkan BOSDA, memberikan BKSM di jenjang pendidikan menengah, memberikan bantuan khusus bagi sekolah yang jumlah peserta didiknya sedikit, menggratiskan PPDB, dan memberikan kuota 20% untuk peserta didik miskin.

Makna simbolis ragam gerak tari Lengger di Kelurahan Mangunharjo Kecamatan Mayangan Kota Probolinggo / Rizky Novitasari

 

Kata Kunci: Makna Simbolis, Ragam Gerak, Tari Lengger Kesenian lengger merupakan kesenian tradisional kota Probolinggo yang berfungsi sebagai hiburan. Alasan peneliti memilih kesenian lengger dikarenakan pemahaman masyarakat umum terhadap kesenian Lengger masih sebatas dengan sesuatu yang tekstual (tertulis), tetapi pada dasarnya dalam ragam gerak tari lengger mengandung makna-makna simbolis yang berkaitan dengan nilai-nilai kehidupan. Oleh karena itu penelitian ini bertujuan untuk mendeskripsikan: 1) Sejarah, 2) Bentuk penyajian dan 3) Makna simbolis ragam gerak tari lengger. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Subjek dalam penelitian ini adalah ibu Karni, ibu Lastri, ibu Sariana selaku ledhek dan Drs. Peni Priyono selaku seniman. Lokasi penelitian berada di Pasar Mangunharjo Kota Probolinggo. Prosedur pengumpulan data dilakukan dengan observasi (pengamatan), wawancara, dan studi dokumen. Sedangkan analisis data dilakukan dengan cara seleksi data (data reduction), penyajian data (data display), dan penyimpulan data (conslusion drawing). Dan untuk mengecek keabsahan data dilakukan dengan perpanjangan pengamatan peneliti, ketekunan/keajegan pengamatan peneliti, dan trianggulasi yang terdiri dari trianggulasi sumber serta trianggulasi metode. Hasil penelitian ini menunjukan bahwa: (1) Kesenian lengger dipimpin oleh Waris (alm) sejak tahun 1980-1984 dan pada tahun 1984 diwariskan pada Karni sampai saat ini, (2) Bentuk penyajian meliputi pembuka/pambuka, inti penyajian, penutup dan unsur-unsur pendukung meliputi: Iringan, tata rias, tata busana/kostum, tata lampu (lighting), tata suara (sound), properti, dan tempat pertunjukan dan, (3) Ragam geraknya meliputi gerak Majeg melambangkan kemantapan dalam melakukan gerak, egolan melambangkan keerotisan wanita, lembehan melambangkan sikap pasrah mendekatkan diri kepada Sang Khaliq, untal tali melambangkan pertentangan baik dan buruk, egol muter melambangkan manusia sedang memutari kiblat (jagad/ dunia), kipatan melambangkan kewaspadaan agar terlindung dari segala sesuatu yang kurang baik, penthangan melambangkan penyatuan tujuan dari segala penjuru, arah gerak/langkah, dan seblak sampur melambangkan gambaran dalam menghalau zat-zat yang negatif. Berdasarkan hasil penelitian ini, penulis menyarankan kepada pihak-pihak terkait untuk mensosialisasikan makna simbolis ragam gerak tari lengger kepada masyarakat, agar masyarakat tidak selalu mamandangnya negatif, serta agar kesenian lengger terus dikembangkan dan dilestarikan sebagai produk budaya.

Penerapan permainan kartu bilangan untuk meningkatkan kemampuan kognitif anak dalam mengenal konsep bilangan 1-10 kelas A di TK Dharma Wanita Persatuan 2 Karanganyar Keraton Pasuruan / Endriati

 

Kata kunci : Permainan kartu bilangan, kemampuan kognitif, konsep bilangan Taman kanak-kanak merupakan salah satu bentuk pendidikan prasekolah yang menyediakan program pendidikan usia dini bagi anak 4 tahun sampai memasuki pendidikan dasar. Sesuai dengan tingkat perkembangan anak usia dini lebih menyukai kegiatan pembelajaran dengan bermain. Dengan bermain anak anak-anak memiliki kesempatan untuk berekplorasi, memecahkan masalah, sehingga perkembangan kognitif anak-anak meningkat, akan tetapi kenyataannya di TK Dharma Wanita Persatuan II Karanganyar ditemukan bahwa perkembangan kognitif anak kurang berkembang secara optimal dikarenakan guru kurang kreatif dalam pembelajaran khususnya dalam memahami konsep bilangan 1-10. Oleh karena itu permaenan kartu bilangan sangat tepat digunakan sebagai alternatif pemecahan masalah, karena dengan permainan kartu bilangan anak akan mudah memperoleh pengalaman yang menyenangkan sehingga dapat secara mudah memahami tentang konsep bilangan. Penelitian ini bertujuan (1) Mendiskripsikan penerapan bermain kartu bilagan untuk meningkatkan kemampuan kognitif dalam mengenal konsep bilangan. (2) Mendiskripsikan peningkatan kemampuan kognitif anak melalui bermain kartu bilangan. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) yang terdiri dari dua siklus. Tiap siklus terdiri atas perencanaan, pelaksanaan observasi dan refleksi. Subyek penelitian ini adalah anak kelompok A di TK Dharma Wanita Persatuan II Karanganyar sebanyak 20 anak. Teknik pengumpulan data yang digunakan adalah observasi secara langsung terhadap anak. Hasil penelitian menunjukkan bahwa permainan kartu bilangan dapat meningkatkan kemampuan kognitif anak kelompok A di TK Dharma Wanita Persatuan II Karanganyar terbukti hasil rata-rata observasi anak mulai dari pratindakan (49%) dengan prosentase (15%), meningkat siklus I (63) dengan prosentase (35%) dan meningkat siklus II (83) (85%) yang terus mengalami peningkatan. Saran yang di sampaikan pada guru yaitu agar dapat menerapkan permainan kartu bilangan untuk meningkatkan kemampuan kognitif maupun kemampuan yang lain. Metode pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian lain. Sebagai bahan perbandingan, sehingga di kemudian hari menjadi lebih baik.

Pengembangan paket bimbingan ke arah penerimaan diri untuk siswa SMP / Khuriyatul Ikrimah

 

Kata Kunci: Paket Bimbingan, Penerimaan diri, siswa SMP Siswa SMP yang berada dalam usia remaja sering mengalami masalah terkait penerimaan diri. Penerimaan diri yang rendah akan memicu tindakan-tindakan yang tidak tepat. Kondisi ini tentu saja tidak boleh dibiarkan, apalagi remaja sebagai individu yang sedang berada dalam proses berkembang ke arah kematangan atau kemandirian. Berdasarkan hasil wawancara dengan konselor di SMP negeri 2 Turen sebagai tempat penelitian, diketahui bahwa paket bimbingan ke arah penerimaan diri belum dimiliki. Selain itu layanan bimbingan ke arah penerimaan diri juga belum diberikan oleh konselor, khususnya di kelas 7. Dari hasil analisis need assessment yang dilakukan kepada siswa kelas VII, diketahui bahwa siswa sangat membutuhkan informasi tentang penerimaan diri bentuk paket bimbingan. Tujuan pengembangan ini yaitu menghasilkan Paket Bimbingan ke Arah Penerimaan Diri yang terdiri dari 2 buah buku, yaitu buku panduan bimbingan ke arah penerimaan diri (untuk konselor) dan buku modul bimbingan ke arah penerimaan diri (untuk siswa), yang sesuai standar akseptabilitas. Prosedur pengembangan paket bimbingan ke arah penerimaan diri ini diadaptasi dari model Borg & Gall (1983). Penulis mengembangkan paket bimbingan tersebut hanya sampai pada tahap uji ahli dan uji calon pengguna produk (uji coba lapangan awal). Uji ahli dilakukan oleh 2 orang ahli BK. Uji calon pengguna produk dilakukan oleh 2 orang konselor SMP. Data yang diperoleh dari uji ahli dan uji calon pengguna produk berupa data kuantitatif dan kualitatif. Teknik pengumpulan data melalui skala penilaian akseptabilitas dan masukan/saran perbaikan yang ditulis dalam lembar saran yang tersedia. Hasil penilaian dari 2 ahli BK dan 2 calon pengguna produk terhadap draft paket bimbingan ke arah penerimaan diri, diperoleh rata-rata nilai kegunaan 3,4, rata-rata nilai kepraktisan 3,10, rata-rata nilai ketepatan 3,30, dan rata-rata nilai kemenarikan 3,15, dalam rentang nilai 0-4. Hal ini dapat disimpulkan bahwa produk yang telah dikembangkan sangat berguna, sangat praktis, sangat tepat dan sangat menarik, memiliki keberterimaan segi teoritis. Paket bimbingan ke arah penerimaan diri ini dapat digunakan oleh siswa SMP sebagai sarana memperoleh wawasan dan pengetahuan tentang penerimaan diri dengan sangat praktis, tepat, dan menarik. Paket bimbingan ini juga dapat digunakan oleh konselor SMP sebagai salah satu alternatif media dalam memberikan layanan bimbingan tentang penerimaan diri dengan sangat praktis, tepat dan menarik. Saran-saran yang diberikan oleh Penulis untuk pemanfaatan paket bimbingan ke arah penerimaan diri ini antara lain: (1) konselor sekolah tempat pengembangan, dapat memanfaatkan paket bimbingan ini sebagai salah satu media dalam memberikan layanan bimbingan tentang penerimaan diri. (2) untuk peneliti selanjutnya, perlu melakukan penelitian lebih lanjut sampai pada uji coba produk pada sasaran yaitu siswa, agar diketahui keefektifan paket bimbingan ke arah penerimaan diri yang dihasilka

Kebijakan ordonansi guru dan pendidikan Islam di Jawa Timur 1905-1942 / Akhmad Fajar Ma'rufin

 

Kata kunci: Ordonansi Guru, Pendidikan Islam, Jawa timur Penelitian ini didasari oleh beberapa hal mengenai pendidikan Islam masa Hindia Belanda. Penerapan Ordonansi Guru diharapkan dapat menekan timbulnya revivalis. Perubahan politik pada 1900 mempengaruhi arah kebijakan pemerintah Hindia Belanda, terutama masalah agama. Kebijakan yang semula netral terhadap agama berubah hingga mendeskritkan salah satu agama. Adanya perlawanan dari umat Islam yang dipimpin haji atau guru agama pada abad XIX hingga XX menjadi alasan pemerintah Hindia Belanda memberlakukan kebijakan Ordonansi Guru. Kebijakan ini ini merupakan pengawasan terhadap pendidikan Islam terutama mengenai administrasinya revivalisme (kebangkitan) Islam, yang kita ketahui sebelumnya Islam pernah berjaya sekitar abad XVI dengan berkembangnya kerajaan-kerajaan Islam di Nusantara seperti Aceh, Demak, Mataram, Cirebon, Banten dan sebagainya. Hal tersebut memiliki dampak tersendiri bagi pendidikan Islam terutama pesantren yang kelembagaannya saat itu non administratif dan pada abad XX perkembangannya meluas di Pulau Jawa terutama di wilayah Jawa Timur. Dampak Ordonansi Guru salah satunya yaitu nampak pada pondok pesantren di Jombang yaitu Tebuireng, pengasuhnya yakni K.H Hasyim Asy’ari sebelum melakukan pengajaran harus ijin terlebih dahulu terhadap bupati Surabaya, hal tersebut tentunya mempersulit siar dari seorang guru agama dan pada akhirnya muncul penentangan terhadap Ordonansi Guru oleh organisasi NU yang berbasis di Jawa Timur. Berawal dari uraian diatas masih banyak hal yang dapat digali dan dikaji. Namun pokok tulisan ini diarahkan pada rumusan masalah sebagai berikut. Pertama, Bagaimana Pendidikan Islam masa pemerintahan Hindia Belanda. Kedua, Apa latar belakang perumusan Ordonansi Guru (1905-1942). Ketiga, Bagaimana Dampak Ordonansi Guru bagi pendidikan Islam di Jawa Timur (1905-1942). Tulisan ini merupakan kajian historis maka metode yang digunakan adalah metode sejarah. Metode sejarah meliputi beberapa langkah: pemilihan topik, heuristik, kritik, interpretasi, dan historiografi dengan menggunakan pendekatan kualitatif. Disamping itu melalui wawancara dan mencermati tradisi lisan yang berkembang dikalangan pondok pesantren, kekurangan sumber tertulis bisa diatasi. Hasil penelitian dan pembahasan menunjukkan bahwa (1) Pendidikan Islam di Jawa pada abad XIX hingga XX yakni pesantren mengalami perkembangan yang pesat, khususnya di wilayah Jawa Timur. Meski berada diatas tekanan dan pengawasan pemerintah Hindia Belanda, banyak pesantren besar yang lahir pada abad XX seperti pesantren Tebuireng, Pesantren Tambak Beras, dan Pesantren Gontor dan sebagainya; (2) Latar belakang diberlakukannya Ordonansi Guru yaitu akibat banyak timbulnya perlawanan berbasis tarekat yang dipimpin oleh Haji dan guru agama pada abad XIX hingga abad XX. Ordonansi guru 1905 mewajibkan guru agama meminta izin kepada bupati sebelum mengajar dan diubah pada 1925; (3) Ordonansi Guru memiliki dampak terhadap guru agama dan pesantren. Kebebasan guru agama dalam siar agama menjadi terhambat sedangkan bagi pesantren ordonansi ini tidak mudah dijalankan karena pesantren memiliki kelemahan dalam hal administrasi namun hal ini berdampak positif terhadap perbaikan administrasi pondok pesantren di Jawa Timur yang dipelopori oleh Tebuireng dengan dibentuknya sistem madrasah atau klasikal. Berlakunya Ordonansi Guru menimbulkan reaksi agar peraturan ini dihapuskan. Penentangan ini muncul dari organisasi Islam seperti SI, Muhammadiyah, dan NU. Khusus di Jawa Timur reaksi penentangan yang dilakukan oleh NU yang notabene anggotanya adalah orang-orang dari kalangan pesantren di Jawa Timur. Jadi dapat dikaitkan bahwa pondok pesantren di Jawa Timur juga ikut menentang Ordonansi Guru ini. Berdasarkan penelitian ini, terdapat beberapa saran: (1) Berkenaan dengan pendidikan Islam yakni pesantren diharapkan mampu bertahan dan eksis di era modern ini serta terus membenahi kekurangan terutama pada aspek administrasi. Walaupun kini sudah cukup baik namun tetap perlu adanya inovasi dan kedisplinan dalam menegakkannya.(2) Di harapkan bagi peneliti selanjutnya dapat mengembangkan penelitian ini terutama yang berkaitan dengan pendidikan Islam yakni pesantren. Banyak ruang kosong mengenai Ordonansi Guru yang masih dapat dikaji lebih lanjut dengan diadakannya penelitian yang lebih fokus pada pondok pesantren tertentu. Sekiranya penelitian tersebut berguna khususnya bagi pengembangan pesantren dimasa-masa mendatang.

Profil kader Pos Pelayanan Terpadu (Posyandu) Kecamatan Jombang Kabupaten Jombang / Asif Nizaruddin

 

Kata Kunci: Profil, Kader Posyandu, Jombang Posyandu merupakan salah satu bentuk peran serta masyarakat dalam bidang kesehatan. Keberhasilan Posyandu tidak lepas dari kerja keras kader yang dengan sukarela mengelola Posyandu di wilayahnya masing-masing. Disisi lain Peserta Posyandu ternyata masih banyak yang tidak hadir dalam kegiatan Posyandu, hal ini dibuktikan dengan presentase pencapaian peserta KB di Kecamatan Jombang yang menempati urutan ke-19. Agar menarik minat peserta Posyandu untuk datang ke kegiatan Posyandu maka dibutuhkan pelatihan atau training kader Posyandu. Pelatihan atau training yang akan diadakan dapat lebih maksimal jika telah diketahui informasi tentang kader Posyandu. Berkaitan dengan itu, maka diperlukan pembahasan mengenai profil kader Posyandu. Penelitian ini bertujuan untuk mengetahui karakteristik kader Posyandu, pelaksanaan tugas kader Posyandu, kategori profil kader Posyandu, dan respon peserta posyandu terhadap kinerja kader Posyandu di Kecamatan Jombang Kabupaten Jombang. Penelitian ini merupakan jenis penelitian survey, data penelitian diperoleh dari observasi langsung terhadap responden dengan menggunakan kuesioner serta data sekunder yang diperoleh dari instansi terkait. Pengumpulan data dilakukan dengan menggunakan teknik wawancara dan observasi. Instrumen penelitian yang digunakan adalah pedoman kuesioner dan wawancara. Teknik skor dan skala yang digunakan adalah skala likert dengan kategori baik, sedang, dan buruk atau kurang baik. Analisis datanya menggunakan analisis deskriptif berupa distribusi frekuensi atau tabulasi frekuensi. Berdasarkan analisis data tersebut, diperoleh empat kesimpulan hasil penelitian sebagai berikut. Pertama, karakteristik kader Posyandu se-Kecamatan Jombang Kabupaten Jombang memiliki kategori sedang. Kedua, pelaksanaan tugas kader Posyandu Kecamatan Jombang Kabupaten Jombang sebagian besar memiliki kategori baik. Ketiga, kategori profil kader Posyandu Kecamatan Jombang Kabupaten Jombang sebagian besar memiliki kategori sedang. Keempat, kategori respon peserta Posyandu terhadap kinerja kader Posyandu Kecamatan Jombang Kabupaten Jombang sebagian besar memiliki kategori baik.

Penerapan model pembelajaran card sort untuk meningkatkan keaktifan siswa pada mata pelajaran IPS-Geografi materi keragaman bentuk muka bumi, proses pembentukan, dan pengaruhnya terhadap kehidupan di kelas VII MTs Surya Buana Malang / Saiful Arif

 

Kata Kunci: penerapan, Card Sort, keaktifan, hasil belajar. Salah satu penyebab rendahnya kualitas pembelajaran adalah proses pembelajaran yang kurang maksimal. Hal tersebut disebabkan karena pemilihan model pembelajaran yang kurang sesuai dengan karakter siswa dan materi pelajaran, sehingga menyebabkan siswa tidak begitu antusias dalam mengikuti proses pembelajaran di kelas. Permasalahan tersebut dapat menyebabkan keaktifan dan hasil belajar siswa menurun. Berdasarkan observasi awal yang dilakukan di kelas VII B didapatkan data bahwa nilai rata-rata keaktifan siswa sebelum penelitian yaitu 58. Rendahnya keaktifan siswa berpengaruh terhadap hasil belajar ranah kognitif. Pada ranah kognitif, nilai rata-rata siswa sebesar 48 dengan ketuntasan klasikal sebesar 21,7%. Sehingga, perlu upaya untuk meningkatkan keaktifan dan hasil belajar ranah kognitif siswa, salah satu cara yang dapat dilakukan adalah menerapkan model pembelajaran Card Sort. Tujuan penelitian ini adalah untuk meningkatkan keaktifan siswa kelas VII B MTs Surya Buana Malang pada mata pelajaran IPS-Geografi materi “Keragaman Bentuk Muka Bumi, Proses Pembentukan, dan Pengaruhnya Terhadap Kehidupan” dengan model pembelajaran Card Sort. Penelitian ini merupakan Penelitian Tindakan Kelas yang terdiri dari tahap perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian ini terdiri dari 2 siklus yang masing-masing siklus terdiri dari 2 kali pertemuan. Penelitian ini dilakukan pada bulan Juli-Agustus 2010. Data dalam penelitian ini terdiri dari data keaktifan dan hasil belajar ranah kognitif siswa. Instrument penelitian yang digunakan terdiri dari lembar observasi dan soal tes. Teknik pengumpulan data terdiri dari dokumentasi, observasi, dan tes tulis. Teknik analisis data dalam penelitian ini yaitu analisis data kuantitatif. Data yang diperoleh dianalisis dengan cara membandingkan nilai rata-rata keaktifan dan hasil belajar ranah kognitif siswa pada saat Observasi Awal, Siklus I, Siklus II, dan siklus selanjutnya. Hasil penelitian menunjukkan bahwa jumlah skor keaktifan siswa pada saat observasi awal hanya 161, sedangkan pada Siklus I meningkat menjadi 268. Setelah dilakukan Siklus II, jumlah skor keaktifan siswa meningkat menjadi 287. Penerapan model pembelajaran Card Sort ternyata juga dapat meningkatkan hasil belajar ranah kognitif siswa. Berdasarkan dokumen nilai siswa pada saat observasi awal, nilai rata-rata siswa sebesar 48 dengan ketuntasan klasikal sebesar 21,7%. Pada Siklus I nilai rata-rata meningkat menjadi 68,7 dengan ketuntasan klasikal sebesar 55,6% dan pada Siklus II meningkat menjadi 83 dengan ketuntasan klasikal sebesar 93%. Ketuntasan klasikal pada Siklus II telah melebihi 85%, sehingga tidak perlu dilakukan siklus selanjutnya. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa model pembelajaran Card Sort dapat meningkatkan keaktifan dan hasil belajar siswa. Disarankan kepada guru IPS¬-Geografi di MTs Surya Buana Malang agar menggunakan model pembelajaran Card Sort untuk materi pelajaran yang sesuai sebagai salah satu strategi untuk meningkatkan keaktifan dan hasil belajar siswa, agar kualitas pembelajaran semakin meningkat.

Dampak penambangan bahan galian golongan C terhadap tingkat kerusakan lingkungan dan sosial ekonomi masyarakat di Kecamatan Aikmel dan Kecamatan Pringgasela Kabupaten Lombok Timur / Astuti Handayani

 

Kata Kunci: penambangan, bahan galian golongan C, kerusakan lingkungan, sosial ekonomi Pertambahan penduduk telah meningkatkan kebutuhan hidup diantaranya adalah kebutuhan bahan galian. Kebutuhan akan bahan galian untuk konstruksi dan industri seperti bahan galian golongan C semakin meningkat seiring dengan semakin berkembangnya pembangunan. Tingginya permintaan akan bahan galian tersebut akan memacu kegiatan pertambangan. Industri pertambangan mempunyai potensi besar untuk menciptakan kesejahteraan masyarakat. Namun, di sisi lain industri ini juga menimbulkan berbagai perubahan lingkungan yang mengancam kelestarian fungsi lingkungan dan kehidupan sosial budaya masyarakat. Hal ini terjadi di Kecamatan Aikmel dan Kecamatan Pringgasela Kabupaten Lombok Timur yang mempunyai potensi bahan galian golongan C yang tinggi sehingga terdapat banyak lokasi penambangan yang bisa berdampak negatif terhadap lingkungan dan sosial ekonomi masyarakat. Penelitian ini bertujuan untuk menganalisis hubungan antara kepadatan penduduk dengan intensitas penambangan, menganalisis hubungan antara intensitas penambangan dengan kerusakan lingkungan, dan mengkaji dampak kegiatan penambangan terhadap kondisi sosial ekonomi masyarakat di Kecamatan Aikmel dan Kecamatan Pringgasela Kabupaten Lombok Timur. Metode penelitian yang digunakan adalah metode survei. Teknik pengambilan sampel dalam penelitian ini adalah purposive sampling untuk pengambilan data daerah, sedangkan untuk data responden menggunakan proporsional random sampling. Analisis data dalam penelitian ini adalah analisis korelasi product moment pearson untuk mengetahui hubungan antara kepadatan penduduk dengan intensitas penambangan dan hubungan antara intensitas penambangan dengan tingkat kerusakan lingkungan. Adapun analisis tabel frekuensi digunakan untuk menganalisis dampak penambangan terhadap sosial ekonomi masyarakat. Berdasarkan hasil analisis data dapat disimpulkan bahwa tidak terdapat hubungan yang signifikan antara kepadatan penduduk dengan intensitas penambangan. Hal ini karena intensitas penambangan ditentukan oleh faktor-faktor lain. Namun, terdapat hubungan yang signifikan antara intensitas penambangan dengan tingkat kerusakan lingkungan. Dampak positif penambangan terhadap sosial ekonomi masyarakat yaitu mengurangi jumlah pengangguran, meningkatkan pendapatan masyarakat, meningkatkan kemampuan masyarakat dalam mengembangkan pendidikan anak sedangkan dampak negatifnya yaitu meningkatnya intensitas terkena penyakit, dan kurangnya keamanan dan keselamatan penambang dalam bekerja sehingga mengakibatkan sering terjadi kecelakaan kecil pada sebagian penambang.

Penerapan model teka-teki silang (crossword puzzle) untuk meningkatkan hasil belajar IPS-Geografi siswa kelas VII-A MTs Surya Buana Malang / Anita

 

Kata Kunci: Teka-teki Silang, Hasil Belajar Geografi Hasil observasi yang dilakukan di MTs Surya Buana Malang diketahui bahwa hasil belajar Geografi siswa kelas VII-A masih rendah. Kriteria Ketuntasan Minimal (KKM) yang ditetapkan di MTs Surya Buana Malang adalah 70. Dari 30 siswa, yang memiliki nilai di atas 70 sebanyak 13 siswa, sedangkan yang memiliki nilai di bawah 70 sebanyak 17 siswa. Dengan demikian, hanya 43,3% siswa dalam satu kelas yang mampu mencapai ketuntasan belajar. Sedangkan berdasarkan hasil wawancara dengan siswa diketahui faktor penyebab hasil belajar yang rendah yaitu (1) siswa malas membaca (2) siswa malas belajar (3) pembelajaran di kelas membosankan. Tujuan penelitian ini untuk meningkatkan hasil belajar IPS-Geografi siswa kelas VII-A MTs Surya Buana Malang melalui penerapan model teka-teki silang (crossword puzzle). Penelitian ini merupakan penelitian tindakan kelas yang dilaksanakan dalam dua siklus. Tindakan yang dilakukan yaitu dengan menerapkan model tekateki silang (crossword puzzle). Penelitian ini dilakukan di kelas VII-A MTs Surya Buana Malang. Teknik pengumpulan data hasil belajar dengan menggunakan tes yang dilakukan satu atau dua minggu setelah akhir masing-masing siklus, sedangkan pengamatan terhadap kegiatan siswa menggunakan lembar observasi dan format catatan lapangan. Hasil penelitian ini menunjukkan bahwa hasil belajar IPS-Geografi siswa kelas VII-A mengalami peningkatan. Peningkatan hasil belajar dari pra tindakan ke siklus I sebesar 50% dan siklus I ke siklus II sebesar 6,7%. Pada pra tindakan persentase siswa yang tuntas sebesar 43,3%, pada siklus I meningkat menjadi 93,3% dan siklus II meningkat menjadi 100%. Sedangkan menurut penggolongan kelas, persentase siswa pada kelas atas sebelum tindakan (pra tindakan) sebesar 26,7%, kelas tengah sebesar 50% dan kelas bawah sebesar 23,3%. Pada siklus I kelas atas meningkat menjadi 56,7%, kelas tengah menurun menjadi 43,3% dan kelas bawah menurun menjadi 0%. Pada siklus II siswa kelas atas meningkat menjadi 90%, kelas tengah menurun menjadi 10% dan kelas bawah 0%. Adapun saran yang diberikan yaitu: (1) Bagi guru geografi disarankan untuk menerapkan model teka-teki silang (crossword puzzle) untuk meningkatkan hasil belajar siswa. (2) Guru hendaknya memperhatikan dan melakukan manajemen waktu dengan sebaik-baiknya, supaya pembelajaran dapat berjalan dengan lancar sesuai yang direncanakan dan selesai tepat pada waktunya (3) Bagi peneliti selanjutnya hendaknya melakukan penelitian sejenis dalam rangka memperbaiki kualitas pembelajaran dengan model teka-teki silang (crossword puzzle) untuk materi pelajaran yang berbeda.

Peningkatan aktivitas dan hasil belajar IPS melalui media crossword pada siswa kelas V SDN Pisang Candi 3 Kota Malang / Nuraini

 

Kata Kunci : Media crosswords, aktivitas belajar, hasil belajar, IPS SD Berdasarkan observasi awal siswa kelas V SDN Pisang Candi 3 Kota Malang, ditemukan beberapa permasalahan pada pembelajaran IPS materi Proklamasi Kemerdekaan Republik Indonesia, yaitu (1) siswa kurang tertarik pada pelajaran; (2) siswa cenderung pasif terhadapa pembelajaran; (3) siswa merasa bosan terhadap pembelajaran; (4) aktivitas belajar siswa yang tidak bervariasi; (5) rendahnya hasil belajar siswa. Hal tersebut dikarenakan tidak adanya media yang digunakan untuk proses pembelajaran guru hanya menggunakan metode ceramah dan mendominasi pembelajaran. Untuk mengatasi hal tersebut diadakan pembaharuan dalam hal media pembelajaran. Media pembelajaran yang digunakan adalah media crosswords umumnya di Indonsesia dinamakan Teka-Teki Silang, yaitu suatu permainan dimana harus mengisi ruang-ruang kosong (berbentuk kotak-kotak) dengan huruf sehingga berbentuk sebuah kata sesuai dengan petunjuk. Penelitian ini bertujuan (1) Mendeskripsikan penerapan media crosswords yang dapat meningkatkan aktivitas dan hasil belajar dalam pembelajaran IPS kelas V SDN Pisang Candi; (2) Mendeskripsikan penerapan media crosswords dapat meningkatkan aktivitas belajar IPS siswa kelas V SDN Pisang Candi 3. (3) Mendeskripsikan penerapan media crosswords dapat meningkatkan hasil belajar IPS siswa kelas V SDN Pisang Candi . Rancangan yang digunakan adalah Penelitian Tindakan Kelas (PTK). PTK ini dilaksanakan dalam dua siklus, dari yang diadopsi dari Kemmis dan Taggart. Setiap siklus terdiri dari dua pertemuan, dan empat tahap yaitu perencanaan, tindakan dan obeservasi, refleksi, dan perbaikan rencana. Subjek penelitian ini adalah siswa kelas V SDN Pisang Candi 3 Kota Malang, yang berjumlah 13 siswa yang terdiri dari 11 siswa laki-laki dan 2 siswa perempuan. Instrumen yang digunakan adalah pedoman observasi, wawancara, tes, dan dokumentasi. Hasil penelitian ini menunjukkan bahwa penerapan media crosswords dapat meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Pisang Candi 3 Kota Malang. Perolehan rata-rata aktivitas meningkat dari siklus I ke siklus II untuk komponen Visual Activities sebesar 3,84%, Oral Activities sebesar 17,3%, Listening Activities sebesar 13,4%, Writing Activities sebesar 7,69%, Motor Activities sebesar 11,54%, Mental Activities sebesar 7,69%, dan Emotional Activities sebesar 7,69%. Sedangkan hasil belajar meningkat dari siklus I ke siklus II sebesar 11,53%. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa penerapan media crosswords dapat meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Pisang Candi 3 Kota Malang, Disarankan media ini dapat menjadi salah satu alternatif media pembelajaran yang dapat meningkatkan aktivitas dan hasil belajar.

Implementing numbered head together strategy to improve the speaking ability of the tenth graders of Marketing Department in SMKN 1 Lumajang / Maria Videlis TE.

 

TThesis, English Department, Graduate Program in English Language Teaching, State University of Malang. Advisor 1: Dr. Johannes A. Prayogo, MPd., M.Ed and advisor 2: Prof. M. Adnan Latief, M.A., Ph.D. Key words : Improving speaking ability, Numbered Head Together Strategy. Many Vocational High School, students find speaking hard to master. Based on a preliminary study, in SMKN I Lumajang, it was identified that the students of Marketing X graders find it hard to speak in English. As a result, they had difficulty to answer questions following the dialogue. Besides, they did not participate actively in classroom activities. To solve the problems, the implementation of Numbered Heads Together Strategy was proposed to be applied in teaching speaking, because some researchers have proven the strategy effective to help students to both students’ speaking ability and students’ participation. The objective of this study was to describe how the implementation of Numbered Head Together Strategy can improve the students’ speaking ability. This study used collaborative classroom research. The collaborative English teacher acted as the observer when the researcher implemented the strategy. The research was conducted in two cycles, which consists of three meetings and covers planning, implementing, observing and reflecting. The subjects were 38 students of Marketing X graders in SMKN I Lumajang in 2010-2011 academic years. The instruments used to collect the data were interview guides, questionnaire, observation sheets, field notes, and speaking test. The results of the research show that Numbered Head Together Strategy improved students’ speaking ability and participation. The improvement of the students’ speaking ability could be seen from the increase of students' speaking test from pre test to cycle 1 and cycle 2. In Cycle 1, 57.89% of the students got poor score, 36.84% of the students got average score, 5.26% of the students got good score. In cycle 2, 21.05% of the students got poor score, 68.42% of the students average score, and 10.52% got very good score. Besides, the finding showed that using Numbered Head Together Strategy in asking and giving direction was effective in improving the students’ involvement in the teaching and learning process. Implementing Numbered Head Together Strategy for teaching speaking involved the following steps: The first phase was pre-activities; (1) introducing others. (2) asking the students to predict what the topic will be discussed, (3) asking the students to mention words that might be used in speaking and asked the students to write the words on the board. The second phase was whilst-activities; (1) asking the students to speak about giving direction, (2) asking the students to make groups of four and giving a number, (3) showing the map to the students and discussion, (4) explaining the way on the map, (5) giving time to students for asking something that they still don’t understand. (6) asking the students to answer questions orally, (7)asking the groups to discuss of some questions and encouraging the students to help each other, monitoring and providing assistance if necessary, (8) asking the groups to report their answer. The third phase was post activities, (1) rechecking the students’ answers, (2) writing down the answer on the paper, and (3) making conclusions of the topic and closing the class. The model of Numbered Head Together Strategy includes the following activities: 1) the lesson is explained briefly, 2) students are grouped in each member and is given a different number. Each group is given the same set of questions. Each group member is responsible to answer question(s) whose number is the same as their number. All members answer the questions they are responsible for. They are assigned to discuss their answers with their teammates in order to find the most accurate answer. When the group discussion is over, a number is called. All members in every group whose numbers are the same as the called number raise their hands. One of the students is asked to present and to answer the question. The other students who have the same number as the presenting students were encouraged to give response towards the presented students’ answer, and the answers are concluded. Based on the result of this study, it is recommended that Numbered Head Together Strategy can be used to improve both the students’ speaking ability and the students’ participation in the teaching learning process. Therefore, it is suggested to the English teacher implement it as an alternative strategy in their English class particularly in the speaking activities. For other researchers, it is suggested that they conduct Numbered Head Together Strategy in other school levels and for other language skills such as listening and writing and use the results of this study as a reference.

Perkembangan pementasan kesenian tradisional wayang kulit bagi masyarakat Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung / Kiky Arisandy

 

Kata kunci: Perkembangan Pementasan Wayang Kulit. Wayang kulit merupakan salah satu budaya yang telah lama ada di Indonesia, terutama di pulau Jawa. Di dalam wayang mengandung beberapa unsur yaitu drama, seni sastra (cerita), seni suara (sulukan, dan lagu-lagu pengiringnya), seni musik (gending) dan seni rupa (wujud wayang). Oleh karena itu perlu diusahakan usaha peningkatkan lebih lanjut pelestariannya pewayangan tersebut. Salah satunya dengan mengadakat penelitian.Perkembangan pewayanan di Indonesia terus ditingkatkan sehingga pewayangan tidak hanya di kenal oleh masyarakat Jawa saja namun telah dikenal di seluruh Indonesia, bahkan sampai ke mancanegara. Obyek penelitian ini adalah pementasan wayang kulit yang berada di Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung. Tujuan penelitian adalah untuk mengetahui latar belakang perkembangan pementasan kesenian tradisional wayang kulit di Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung. Pengambilan data dilakukan terhadap informan, analisis data dilakukan secara deskriptif kualitatif. Penelitian ini dilakukan mulai bulan Januari sampai dengan bulan Juli 2011. Data penelitian yang berupa paparan kebahasaan dalam bentuk visual yang terdapat dalam pertujukan ini yang diperoleh dari pementasan wayang kulit dengan lakon “Pandawa Kalah Main Dadu dan Semar Munggah Kahyangan”. Pengumpulan data dilakukan dengan menggunakan teknik wawancara dan observasi. Instrument yang digunakan untuk mengumpulan data berupa informan. Untuk menjaga keabsahan data, dilakukan kegiatan Trianggulasi data. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap identifikasi dan klasifikasi data, dan tahap evaluasi data. Temuan penelitian ini adalah bagaimana perkembangan pementasan kesenian tradisional wayang kulit di Desa Purworejo, Kecamatan Ngunut, Kabupaten Tulungagung. Perkembangan pementasan wayang kulit ternyata selalu mengalami pasang surut dari tahun ke tahun. Dari hasil penelitian ini dapat diambil kesimpulan bahwa dalam perkembangan pementasan wayang kulit dari tahun 1970an mengalami kemunduran, yang menyebabkan wayang kulit berada diujung tanduk kepunahan, kemudian sekitar tahun 1990an pementasan wayang kulit sudah mulai menunjukkan eksistensinya kembali di tengah-tengah masyarakat, akan tetapi perkembangan wayang kulit tersebut tidak bertahan lama karena adanya krisis moneter yang berkepanjangan. Dan pada tahun 2000 sampai sekarang ini wayang mengalami perkembangan yang cukup pesat dan sekarang didukung juga banyaknya pementasan wayang kulit yang diadakan di stasiunstasiun TV besar.

Prediksi laju erosi dengan menggunakan model water erosion prediction project (WEPP) di Sub Das Junggo Hulu Kecamatan Bumiaji Kota Batu / Ichwan Dwi Pratomo

 

Kata Kunci: erosi, sedimen, Model WEPP Seiring dengan pertambahan jumlah penduduk, maka akan mendorong peningkatan kebutuhan hidup, baik secara kualitas maupun kuantitas. Tuntutan pemenuhan kebutuhan manusia tersebut selanjutnya menyebabkan meningkatnya kebutuhan akan lahan untuk tempat tinggal maupun kegiatan pertanian.Pembukaan lahan baru berlangsung secara berlebihan, sehingga mempercepat proses erosi.Kerugian akibat erosi berdampak sangat luas, karena tidak hanya menyebabkan kerusakan di daerah hulu saja, tetapi juga di daerah yang dialiri aliran endapan (daerah tengah), dan di bagian hilir. Jenis penelitian ini adalah penelitian survey dimana teknik pengambilan sampel menggunakan metode purposive samplingyang berdasarkan pada kemiringan lereng, sifat tanah, dan penggunaan lahan, sehingga diperoleh sampel daerah sebanyak dua unit lahan. Penelitian ini bertujuan untuk mengetahuilaju erosi dengan menggunakan model WEPP yang terjadi di sub DAS Junggo bagian hulu, Kecamatan Bumiaji, Kota Batu. Hasil penelitian menunjukkan bahwa sub DAS Junggo hulu yang terbagi ke dalam dua unit lahan, memiliki nilai total sedimen terangkut yang bervariasi, dimana pada unit lahan AKK 26-45% berdasarkan hasil pengukuran pertama berturut-turut sampai pada pengukuran keempat adalah sebagai berikut: (1) pengangkutan sedimen sebesar 7,461677 kg/dt, (2) pengendapan sedimen sebesar -0,69208502 kg/dt (3) pengendapan sedimen sebesar -3,08392743 kg/dt, dan (4) pengendapan sedimen sebesar -0,82869316 kg/dt. Sedangkan total sedimen terangkut di unit lahan AKK 16-25% pada pengukuran pertama berturut-turut sampai pada pengukuran keempat adalah sebagai berikut: (1) pengangkutan sedimen sebesar 10,55165627 kg/dt, (2) pengangkutan sedimen sebesar 1,86448370 kg/dt (3) pengendapan sedimen sebesar -1,13330122 kg/dt, dan (4) pengangkutan sedimen sebesar 0,71693563 kg/dt. Untuk menekan besarnya laju erosi yang terjadi di sub DAS Junggo bagian hulu, maka peneliti merasa perlu memberikan saran yang ditujukan kepada masyarakat setempat agar tidak menggunakan lahan yang memiliki kemiringan lereng curam (16-45%) secara berlebihan dan untuk lahan yang belum diolah sebaiknya tidak dibiarkan terbuka. Sedangkan kepada pemerintah daerah diharapkanagar segera memberi penyuluhan kepada masyarakat daerah setempat dan pembuatan kebijakan-kebijakan khusus yang dapat mencegah erosi agar tidak terjadi lebih besar lagi dan sebagai upaya konservasi terhadap penyelamatan lingkungan.

Manajemen penjaminan mutu guru (studi kasus di SMA Negeri 4 Malang) / Widya Study Sagala

 

Kata kunci: manajemen penjaminan mutu dan penjaminan mutu guru. Manajemen penjaminan mutu guru penting diterapkan di sekolah karena dengan adanya manajemen ini, diharapkan kualitas guru semakin meningkat. Berkaitan dengan hal tersebut, maka lembaga pendidikan membutuhkan suatu manajemen yang dapat mengatur bagaimana agar sekolah dalam manajemen penjaminan mutu dapat berjalan secara efektif dan efisien. Penelitian ini bertujuan untuk mendeskripsikan: (1) manajemen penjaminan mutu guru di SMA Negeri 4 Malang; (2) perencanaan mutu guru di SMA Negeri 4 Malang; (3) pengendalian mutu guru di SMA Negeri 4 Malang; dan (4) perbaikan mutu guru di SMA Negeri 4 Malang . Penelitian ini menggunakan pendekatan kualitatif dan jenis penelitian ini adalah studi kasus. Instrumen kunci adalah peneliti sendiri dan subyek penelitian adalah Ketua Unit penjamin mutu (UPM), anggota Unit penjamin mutu (anggota UPM), waka kurikulum dan guru. Data diperoleh melalui wawancara, observasi dan dokumentasi. Data yang telah didapatkan dianalisis selama pengumpulan data, kemudian diklasifikasikan, disaring dan ditarik sebuah kesimpulan. Keabsahan data yang telah dianalisis menggunakan ketercukupan referensial, triangulasi sumber data dan triangulasi metode. Kesimpulan penelitian meliputi: (1) manajemen penjaminan mutu guru yaitu membentuk tim UPM, memiliki tujuan yaitu meningkatkan mutu SMA Negeri 4 Malang sesuai dengan visi misi sekolah dan pemberian tugas kepada Tim UPM oleh Kepala Sekolah. Dalam manajemen, ada beberapa tahap yaitu: a) perencanaan mutu guru yaitu dengan melakukan sosialisasi konsep penjaminan mutu kepada semua warga sekolah, menganalisis SWOT berdasarkan keadaan dan kebutuhan sekolah, mengadakan sharing dengan guru, Tim UPM merencanakan kegiatan mutu guru dan memilih kegiatan-kegiatan yang akan dilaksanakan, dan kegiatan-kegiatan yang direncanakan adalah mengadakan kursus/pelatihan Bahasa inggris dengan Dosen pendamping mata pelajaran dari Universitas Negeri Malang dan pembinaan ESQ dan penguatan kompetensi antara lain outbound, workshop penguatan dan PCC (Positive Character Camp), b) pengendalian mutu guru yaitu dengan melakukan pengamatan atau penilaian kepada guru, dilaksanakan sepanjang tahun ajaran dan aspek-aspek yang dinilai ada 4 kompetensi sosial, paedagogik, kepribadian dan profesional; c) perbaikan mutu guru yaitu dapat meningkatkan kemampuan guru dalam menggunakan Bahasa Inggris dan mengaplikasikan teknologi dalam melaksanakan pembelajaran dan menjadikan hasil pengamatan sebagai acuan pada program selanjutnya ke arah yang lebih baik lagi yang dilaksanakan pada akhir tahun. (2) perencanaan mutu guru yaitu a) sosialisasikan konsep penjaminan mutu kepada semua warga sekolah, b) menganalisis SWOT berdasarkan keadaan dan kebutuhan sekolah, c) mengadakan sharing dengan guru, d) Tim UPM merencanakan kegiatan mutu v guru dan memilih kegiatan-kegiatan yang akan dilaksanakan (disesuaikan dengan anggaran yang ada) dan e) kegiatan-kegiatan yang direncanakan adalah mengadakan kursus/pelatihan Bahasa inggris dengan Dosen pendamping mata pelajaran dari Universitas Negeri Malang dan pembinaan ESQ dan penguatan kompetensi antara lain outbound, workshop penguatan dan PCC (Positive Character Camp); (3) pengendalian mutu guru yaitu a) melakukan pengamatan atau penilaian kepada guru, b) dilaksanakan sepanjang tahun ajaran dan c) aspek-aspek yang dinilai ada 4 kompetensi sosial, paedagogik, kepribadian dan profesional; 4) perbaikan mutu guru yaitu dapat meningkatkan kemampuan guru dalam menggunakan Bahasa Inggris dan mengaplikasikan teknologi dalam melaksanakan pembelajaran dan menjadikan hasil pengamatan sebagai acuan pada program selanjutnya ke arah yang lebih baik lagi yang dilaksanakan pada akhir tahun. Berdasarkan kesimpulan penelitian tersebut, dapat disarankan bagi: (1) Kepala sekolah diharapkan dapat membuat perbaikan baru yang lebih baik dengan menyusun program-program yang lebih inovatif dan lebih variatif dan membina guru agar dapat meningkatkan kompetensinya; (2) Ketua Tim Unit Penjamin Mutu diharapkan dapat menjadi masukan sebagai bahan pertimbangan dalam melaksanakan program kegiatan yang telah direncanakan untuk meningkatkan mutu di SMA Negeri 4 Malang sesuai dengan tahap manajemen yang dimulai dari perencanaan, pengendalian dan perbaikan mutu guru di sekolah; (3) Diharapkan guru memiliki kesadaran dan komitmen yang tinggi dalam melaksanakan kegiatan mutu guru agar dapat menjadi seorang pendidik yang berkompeten; (4) Ketua jurusan diharapkan lebih memperbanyak pengembangan ilmu manajemen dan mengadakan sosialisasi mengenai pentingnya penjaminan mutu guru; (5) Peneliti lain dapat dijadikan sebagai bahan referensi dan sebagai bahan tambahan dalam pengembangan manajemen penjaminan mutu ini.

Layanan transportasi sekolah untuk menekan tidak masuk dan terlambat ke sekolah bagi siswa (studi kasus di Sekolah Dasar Islam Terpadu Al-Hikmah Bence Garum Blitar) / Kariono

 

Kata Kunci : layanan transportasi, transportasi sekolah, tidak masuk dan terlambat Layanan transportasi sekolah merupakan sarana transportasi bagi siswa untuk kelancaran proses belajar mengajar. Siswa akan merasa aman dan dapat masuk atau pulang sekolah dengan waktu yang tepat. Penyelenggara transportasi sekolah adalah sekolah itu sendiri atau pihak swasta yang bekerja sama dengan sekolah tersebut. Layanan transportasi ini biasa disebut dengan layanan antar jemput siswa karena transportasi ini selalu menjemput dan mengantar siswa mulai dari rumah ke sekolah sampai siswa tersebut pulang ke rumahnya. Adanya layanan transportasi sekolah ini, siswa tidak akan terlambat ke sekolah dan tentunya para orang tua akan merasa terbantu. Penelitian ini dilaksanakan untuk mendeskripsikan fokus penelitian tentang layanan transportasi sekolah, meliputi: (1) Keragaman radius/jarak dan geografis dari tempat tinggal siswa ke sekolah; (2) Transportasi yang digunakan siswa; (3) Siswa yang membutuhkan transportasi sekolah; (4) Pengelolaan layanan transportasi di SD IT Al-Hikmah; (5) faktor pendukung dan penghambat serta upaya mengatasinya; (6) Kegiatan yang dilakukan sekolah untuk meningkatkan layanan transportasi; (7) Kedisiplinan siswa terkait dengan ketepatan waktu masuk sekolah setelah adanya layanan transportasi; (8) Transportasi yang disediakan sekolah menekan terlambat dan tidak masuk siswa di sekolah. Penelitian ini menggunakan rancangan kualitatif. Data penelitian ini dikumpulkan dan dinyatakan dalam bentuk kata-kata, melalui metode observasi, wawancara, dan dokumentasi, sehingga dengan informasi yang diperoleh bisa diketahui bagaimana layanan transportasi sekolah untuk menekan tidak masuk dan terlambat ke sekolah bagi siswa. Instrumen yang digunakan untuk mengumpulkan data yaitu peneliti sendiri. Penjagaan keabsahan data, dilakukan melalui triangulasi data. Analisis data dimulai dari tahap penelaahan, tahap identifikasi dan klarifikasi, dan tahap evaluasi. Berdasarkan hasil analsis data, diperoleh simpulan hasil penelitian sebagai berikut: (1) Keragaman radius/jarak tempat tinggal siswa berbeda-beda, jarak terdekat ± 5 km dan jarak terjauh ± 25 km; (2) Transportasi yang digunakan siswa kebanyakan adalah L300; (3) Siswa yang membutuhkan transportasi ini adalah siswa yang orang tuanya sibuk; (4) Pengelolaan layanan transportasi, yang meliputi perencanaan, pengorganisasian, pengontrolan, dan pengevaluasian. Dalam layanan ini, fungsi menjemen ini sering terlupakan, sehingga proses kegiatan transportasi menjadi kurang maksimal; (5) Pendukung transportasi ii adalah sikap kekelurgaan semua pihak, penghambat meliputi seringnya kemacetan di jalan yang membuat sopir harus mencari jalan pintas, seringnya mobil mogok yang harus dapat diantisipasi dengan selalu mengontrol kondisi mobil; (6) Upaya sekolah meningkatkan transportasi dengan memperketat seleksi mobil, mobil harus keluaran tahun 2000 ke atas, pemberian sangsi yang tegas terhadap pelanggaran; (7) Kedisiplinan siswa tentang terlambat dan tidak masuk ke sekolah berkurang karena adanya layanan transportasi yang selalu berupaya untuk meningkatkan kedisiplinan siswa supaya dapat meningkatkan kualitas pendidikan; dan (8) Transportasi ini menekan tidak masuk dan terlambat siswa ke sekolah karena semua pihak menerapkan kedisiplinan yang tinggi. Berdasarkan implikasi hasil penelitian, maka dikemukakan saran bagi (1) Kepala SD IT Al-Hikmah, pentingnya layanan transportasi sekolah dalam menekan tidak masuk dan terlambat siswa sekolah, disarankan bagi kepala sekolah untuk ikut meningkatkan layanan ini dengan baik, karena layanan ini juga akan berpengaruh terhadap kemajuan sekolah karena layanan ini cukup jarang ada. Secara tidak langsung layanan ini akan menjadi jati diri sekolah dan juga akan meningkatkan kualitas dalam layanan khususnya sehingga akan mampu untuk menyerap peserta didik baru yang lebih banyak; (2) Koordinator, harus lebih bisa mengkondisikan sopir-sopir dan juga aktif mengontrol pelaksanaan antar jemput guna untuk meningkatkan layanan transportasi ini ke arah yang lebih baik; (3) Bagi Siswa, menjadi bahan sumbangan mengenai menejemen layanan transportasi sekolah; (4) Bagi Orang tua, menjadi bahan masukan dalam memilih layanan transportasi; (5) Bagi Sopir, menjadi bahan masukan dalam menjalankan kendaraan agar selamat, juga gambaran dalam melayani transportasi anak usia sekolah dasar.; (6) Bagi Ketua Jurusan Administrasi Pendidikan, hasil penelitian ini bisa dijadikan tambahan referensi bagi jurusan Administrasi Pendidikan dan lebih meningkatkan kompetensi mahasiswa dalam memahami konsep dan manfaat yang diperoleh dari layanan ini; dan (7) Bagi Peneliti selanjutnya, agar lebih menyempurnakan hasil penelitian sehingga dapat mengembangkan kualitas dari layanan transportasi sekolah.

pengaruh computer anxiety dan prestasi belajar mata kuliah pengantar akuntansi terhadap penguasaan komputer akuntansi (MYOB accounting) pada mahasiswa Jurusan Akuntansi Universitas Negeri Malang / Praptiwi Suryaning Tias

 

Kata kunci: Computer Anxiety, Pengantar Akuntansi, Komputer Akuntansi (Myob Accounting) Mengingat pentingnya penguasaan Myob Accounting bagi seorang akuntan, maka mahasiswa akuntansi dituntut tidak hanya mampu menguasai teori-teori akuntansi melainkan juga harus mampu menguasai teknologi komputer. Tujuan pertama dalam penelitian ini yaitu, untuk menjelaskan pengaruh computer anxiety terhadap penguasaan komputer akuntansi (Myob Accounting). Tujuan kedua yaitu, untuk menjelaskan pengaruh prestasi belajar mata kuliah pengantar akuntansi terhadap penguasaan komputer akuntansi (Myob Accounting) Variabel dalam penelitian ini terdiri dari computer axiety (X1), prestasi belajar matakuliah pengantar akuntansi (X2) dan penguasaan komputer akuntansi (Myob Accounting) (Y). Populasi yang digunakan dalam penelitian ini adalah seluruh mahasiswa akuntansi Universitas Negeri Malang angkatan tahun 2006/2007, 2007/2008 dan 2008/2009 dengan diperoleh sampel sebanyak 97 responden yang dipilih berdasarkan Stratified Random Sampling. Angket yang digunakan untuk mengukur tingkat computer anxiety pada mahasiswa akuntansi adalah CARS (Computer Anxiety Rating Scale) dengan skala likert. Teknik analisis data dalam penelitian ini adalah regresi ganda dengan uji hipotesis yang meliputi uji t dan uji F. Hasil analisis data dari penelitian ini menunjukkan bahwa (1) Computer anxiety berpengaruh negatif terhadap penguasaan komputer akuntansi (Myob Accounting).Hasil tersebut berarti bahwa semakin rendah tingkat computer anxiety maka penguasaan komputer akuntansi yang dimiliki tinggi. 2) Prestasi belajar matakuliah pengantar akuntansi berpengaruh positif dan signifikan terhadap penguasaan komputer akuntansi (Myob Accounting) yang berarti, semakin tinggi prestasi matakuliah pengantar akuntansi, maka semakin tinggi pula penguasaan komputer akuntansi. Kesimpulan dari penelitian ini yaitu, computer anxiety berpengaruh negatif terhadap penguasaan komputer akuntansi dan prestasi belajar matakuliah pengantar akuntansi berpengaruh positif terhadap penguasaan komputer akuntansi. Adapun keterbatasan dalam penelitian ini adalah (1) variabel berpengaruh yang digunakan hanya terbatas pada dua variabel saja, (2) mensejajarkan antara variabel computer anxiety dan prestasi matakuliah Pengantar Akuntansi, (3) instrumen CARS tidak diadaptasikan pada kalimat yang mengarah pada software Myob Saran yang dapat diberikan yaitu, (1) hendaknya dosen akuntansi lebih mengintegrasikan setiap materi akuntansi dengan teknologi komputer dan lebih mengefektifkan pembelajaran matakuliah pengantar akuntansi (2) Mahasiswa akuntansi diharapkan mampu meningkatkan keterampilan berkomputer dan meningkatkan prestasi belajar matakuliah pengantar akuntansi, (3) peneliti selanjutnya hendaknya menambahkan variabel diluar penelitian ini, menjadikan variabel computer anxiety sebagai variabel moderating ataupun intervening dan mengadaptasi kalimat yang digunakan pada instrumen CARS

Pengaruh harga saham, trading volume activity dan risk of return terhadap bid-ask spread (studi pada perusahaan LQ-45 periode 2007-2009) / Novie Asri Rahmawati

 

Kata kunci : Harga saham, trading volume activity, risk of return, bid-ask spread Pasar modal merupakan tempat pertemuan antara penawaran dan permintaan surat berharga. Investasi pada hakekatnya merupakan penempatan sejumlah dana pada saat ini dengan harapan untuk memperoleh keuntungan dimasa yang akan datang. Dari tempat inilah para pelaku pasar yaitu individu-individu atau badan usaha yang mempunyai kelebihan dana (surplus funds) melakukan investasi dalam surat berharga berupa saham, obligasi dan beberapa derivatif lain. Perdagangan di pasar modal atau bursa efek menggunakan order driven market system dan continuous auction system. Order driven market system adalah sistem perdagangan atau transaksi sekuritas di pasar modal yang harus melalui perantara broker atau pialang yang menjadi anggota bursa efek. Para broker atau pialang saham akan melakukan transaksi perdagangan dan membuat penawaran jual dan penawaran beli sehingga kedua penawaran tersebut akan memunculkan perbedaan atau selisih yang disebut dengan bid-ask spread. Penelitian ini bertujuan untuk menganalisis pengaruh harga saham, trading volume activity, dan risk of return terhadap bid-ask spread. Penelitian ini menggunakan sampel perusahaan yang tergabung dalam kategori indeks LQ-45 periode 2007 – 2009 sebanyak 19 perusahaan. Pemilihan sampel dilakukan dengan purposive sampling. Teknik analisis yang digunakan untuk menguji hipotesis yang diajukan adalah teknik analisis regresi linear berganda. Hasil penelitian ini menunjukkan bahwa secara parsial harga saham dan trading volume activity berpengaruh negatif signifikan terhadap bid-ask spread, sedangkan risk of return berpengaruh positif signifikan terhadap bid-ask spread. Dari hasil penelitian ini diharapkan bagi investor yang akan melakukan transaksi di pasar modal hendaknya memperhatikan harga saham, trading volume activity , risk of return dan bid-ask spread sebagai acuan dalam pengambilan keputusan investasi. Bagi peneliti selanjutnya yang ingin melakukan penelitian sejenis, hendaknya menambah jumlah sampel dan jenis perusahaan lain yang tidak hanya tergabung dalam indeks LQ-45 dan menggunakan peristiwa seperti stock split, right issue dan kebijakan deviden yang lebih memberikan informasi bagi pelaku pasar modal.

Penerapan model belajar tuntas guna meningkatkan hasil belajar mata diklat pendidikan dasar teknik bangunan pada siswa kelas X TKB 1 di SMKN 1 Singosari / Indavul Khoirunnikmah

 

Kata Kunci: penerapan, model belajar tuntas, hasil belajar, pendidikan dasar teknik bangunan Pendidikan Dasar Teknik Bangunan merupakan salah satu bidang ilmu yang menjadi tumpuan bagi kemajuan teknologi teknik sipil. Dalam rangka transformasi teknologi pada bidang teknik sipil menuju masyarakat maju dan modern hendaknya disadari bahwa pembelajaran Pendidikan Dasar Teknik Bangunan tidak semata mata hanya berupa alih pengetahuan saja, tetapi diharapkan siswa mampu menerapkan pengetahuan yang diperolehnya sehingga dapat memecahkan permasalahan yang dihadapinya. Sesuai dengan cita-cita dari tujuan pendidikan nasional juga, guru perlu memiliki beberapa prinsip mengajar yang mengacu pada peningkatan kemampuan internal peserta didik di dalam merancang strategi dan melaksanakan pembelajaran. Peningkatan potensi internal itu misalnya dengan menerapkan jenis-jenis strategi pembelajaran yang memungkinkan peserta didik mampu mencapai kompetensi secara penuh, utuh dan kontekstual. Penerapan model belajar tuntas ini bertujuan untuk meningkatkan hasil belajar siswa pada mata diklat Pendidikan Dasar Teknik Bangunan yang menurut penelitian awal peneliti terdapat nilai-nilai yang kurang. Pada penelitian ini diharapkan dapat meningkatkan hasil belajar siswa dan mengetahui model belajar yang sesuai untuk pembelajaran mata diklat Pendidikan Dasar Teknik Bangunan. Metode pengumpulan data yaitu metode observasi/pengamatan, metode wawancara, metode tugas serta tes. Data tersebut kemudian akan dibandingkan dengan kajian pustaka sehingga dapat diambil kesimpulan dan saran. Hasil penelitian ini menunjukkan bahwa ada peningkatan hasil belajar siswa pada mata diklat Pendidikan Dasar Teknik Bangunan kelas X TKB1. Berdasarkan penelitian in dapat disarankan dalam proses pembelajaran Pendidikan Dasar Teknik Bangunan digunakan model belajar tuntas untuk meningkatkan hasil belajar siswa.

Peran komite sekolah dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan (studi kasus di SD Negeri Pandesari 1 Pujon) / Chandra Febrian Ika Wati

 

Kata Kunci: peran komite sekolah, pengadaan sarana dan prasarana, kualitas pendidikan. Keberadaan dan peran komite sekolah dalam upaya mendukung kualitas pendidikan sekolah sangat bervariasi, baik dari segi status, kinerja, peran, kualitas SDM, sarana dan prasarana yang dimiliki komite sekolah. Berkaitan dengan kelembagaan tersebut perlu adanya dukungan pemerintah terhadap keberadaan Komite sekolah. Dukungan yang diharapkan dalam peningkatan kualitas pendidikan adalah terpenuhinya kebutuhan dan kelengkapan sarana dan prasarana belajar. Peran Komite sekolah merupakan kunci keberhasilan dalam memberi dukungan terhadap kualitas pendidikan melalui pengadaan sarana dan prasarana. Berdasarkan uraian tersebut di atas, penelitian difokuskan pada: (1) usaha Komite sekolah dalam pengadaan sarana dan prasarana pendidikan untuk mendukung kualitas pendidikan, (2) peran komite sekolah dalam mendukung kualitas pendidikan melalui pengadaan sarana dan prasarana pendidikan, (3) faktor yang mendukung dan menghambat peran komite sekolah dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan, (4) solusi komite sekolah menghadapi hambatan dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan. Penelitian ini dilakukan di SD Negeri Pandesari 1 Pujon dengan pendekatan deskriptif kualitatif dengan rancangan studi kasus. Prosedur pengumpulan data dilakukan melalui: (1) observasi, (2) interview, dan (3) dokumentasi. Analisis data yang digunakan adalah analisis data kualitatif. Untuk mengetahui keabsahan data peneliti menggunakan beberapa teknik, yaitu: (1) triangulasi, (2) pengecekan sejawat melalui diskusi, dan (3) kecukupan referensial. Hasil penelitian menunjukkan bahwa usaha yang dilakukan komite sekolah dalam pengadaan sarana dan prasarana untuk mendukung kualitas pendidikan di SD Pandesari Negeri 1 Pujon adalah dengan (1) penyediaan sarana dan prasarana yang dibutuhkan dalam proses belajar mengajar, (2) menjalin hubungan antara sekolah dengan masyarakat, dan (3) mengoptimalkan sumber daya yang ada. Dalam hal ini komite sekolah berperan sebagai (1) pemberi pertimbangan (advisory agency), (2) pendukung (supporting agency), (3) pengontrol (controlling agency), dan (4) mediator. Dalam menjalankan fungsinya, komite sekolah banyak mendapatkan dukungan dari berbagai pihak, khususnya dalam rangka pengadaan sarana dan prasarana untuk peningkatan kualitas pendidikan, namun juga mengalami beberapa hambatan, diantaranya: (1) keterbatasan waktu dan kemampuan SDM anggota komite sekolah, (2) keterbatasan dana dari swadaya masyarakat termasuk orangtua siswa, (3) seringnya berganti guru yang pindah karena pengangkatan menjadi Pegawai Negeri Sipil, dan (4) kurang semangatnya siswa dalam menghadapi UAN. Berdasarkan hasil penelitian tersebut dimana komite sekolah dalam menjalankan perannya mengalami beberapa hambatan sehingga dapat dikemukakan saran berikut: (1) perlunya dibangun kerja sama yang baik antar warga sekolah, masyarakat, dan pemerintah, (2) mencari terobosan baru yang dapat menggali dan menghasilkan dana untuk menunjang keberhasilan program peningkatan mutu/kualitas pendidikan, (3) perlu adanya monitoring dan mengevaluasi demi peningkatan kualitas pelayanan pendidikan di lembaga, (4) para guru dan anggota komite sekolah, perlu diikutsertakan dalam pelatihan, seminar dan kegiatan-kegiatan lainnya yang dapat menumbuhkan motivasi dan mengembangkan profesionalisme dalam meningkatkan kualitas pendidikan

Classroom interaction in the teaching of speaking to eleventh graders at SMAN 2 Pare / Nani Trisnawati

 

Kata kunci: Interaksi Kelas, FLINT system, pola interaksi kelas. Interaksi merupakan aspek yang penting untuk meningkatkan kemampuan berkomunikasi siswa sebagai tujuan pembelajaran dalam proses pembelajaran bahasa. Komunikasi itu sendiri sangat bergantung pada interaksi dimana segala sesuatu yang terjadi di kelas melalui proses interaksi untuk meningkatkan keterampilan berkomunikasi siswa. Siswa akan dianggap terampil jika mereka mampu berkomunikasi secara lesan yang dikembangkan melalui kegiatan speaking. Oleh karenanya, penelitian terhadap interaksi kelas di pengajaran speaking sangat patut untuk diselenggarakan. Penelitian ini menganalis interaksi kelas dalam pengajaran speaking untuk kelas sebelas di SMAN 2 Pare. Secara rinci, penelitian ini bertujuan untuk menjawab tiga pokok pembahasan yaitu: (1) Kategori dari ungkapan yang digunakan guru (teacher talk) (2) Kategori partisipasi lesan siswa (student talk) (3) dan pola-pola interaksi dalam pembelajaran speaking. Kategori untuk teacher talk dan student talk berdasarkan model FLINT yang dikemukakan oleh Flanders and Mozkowitz yang telah dikutip oleh Brown (2001: 165) yang mencakup masing masing tujuh kategori dari teacher talk dan student talk. Sedangkan pola interaksi menerapkan model dari Thomas (in Mingzhi, 2005: 59) yang mencakup tujuh pola interaksi. Penelitian ini menggunakan metode diskriptif kulitatif dan tempat penelitian ini di SMA Negeri 2 Pare. Subjek penelitian ini adalah guru yang mengajar speaking di kelas XI IA 2 dan siswa di kelas XI IA 2. Data didapat dari observasi selama enam kali pertemuan dalam kelas tersebut. Instrumen yang digunakan dalam penelitian ini adalah: catatan lapangan, lembar observasi, kuesioner, dan pedoman wawancara. Hasil penelitian menunjukkan bahwa subjek menerapkan semua kategori teacher talk dan student talk yang termuat dalam model FLINT. Selain itu, pola interaksi di dalam kelas di dominasi oleh interaksi antara guru dan seluruh siswa di kelas. Namun, inisiasi siswa untuk berinteraksi dengan guru tidak ditemukan dalam penelitian ini. Sehubungan dengan interaksi kelas, guru trampil untuk mengelola suasana kelas menjadi menyenangkan dengan menerapkan kategori Praise and Encouragement. Dan kategori Student Response Specific mendominasi interaksi siswa karena hampir semua pertanyaan guru membutuhkan jawaban yang sifatnya pasti dan dalam kalimat yang sederhana. Selain itu pola interaksi yang mendominasi kelas adalah interaksi antara guru dengan seluruh siswa. Sedangkan pola interaksi yang lain seperti interaksi antara guru dengan salah seorang siswa atau guru dengan siswa dalam kelompok terjadi saat guru memberi masukan terhadap penampilan siswa. Interaksi antara siswa dengan siswa lain dalam kelompok terjadi saat siswa melaksanakan penampilan drama. Kemudian untuk interaksi antara seorang siswa dengan seluruh kelas terjadi saat siswa melakukan kegiatan kelas untuk menceritakan kembali sebuah cerita dan saat mereka tampil dalam drama. Singkatnya, subjek penelitian menerapkan semua kategori untuk teacher talk dan student talk yang diusulkan oleh Flanders dan Mozkowitz. Serta, menerapkan hampir semua kategori untuk pola interaksi yang diusulkan oleh Thomas. Berdasarkan hasil penelitian, peniliti menyarankan kepada guru untuk menerapkan kategori praise and encouragement untuk meningkatkan kategori student response open ended, supaya waktu yang diberikan siswa untuk berbicara lebih banyak. Selain itu, guru disarankan supaya memberikan waktu kepada siswa untuk mengawali interaksi pada awal pemberian materi agar pola interaksi tidak didominasi oleh interaksi antara guru dan kelas. Dengan demikian, interaksi kelas akan lebih efektif untuk meningkatkan kemampaun komunikatif siswa

Dinamika Lembaga Dakwah Kampus Badan Dakwah Masjid Al Hikmah IKIP MALANG tahun 1982-1999 / Hendri Dharmawan

 

Penerapan strategi bertanya dengan media gambar untuk meningkatkan pemahaman tentang pengaruh lingkungan fisik terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya / Ahmad Murdi

 

Kata kunci : strategi bertanya, media gambar, lingkungan Kurangnya pemahaman siswa tentang pengaruh lingkungan fisik terhadap daratan disebabkan kurang tepatnya strategi model pembelajaran yang diterapkan guru. Guru belum menggunakan strategi bertanya dan memanfaatkan media dalam pembelajaran secara maksimal, misalnya media gambar. Padahal penggunaan media gambar akan membantu siswa untuk lebih mudah mencerna dan memahami materi yang diajarkan. Penelitian ini bertujuan untuk meningkatkan pemahaman tentang pengaruh lingkungan fisik seperti erosi, banjir, abrasi dan tanah longsor terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya melalui strategi bertanya dengan media gambar. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK) yang terdiri dari dua siklus. Pada masing-masing siklus dilaksanakan tahap perencanaan, pelaksanaan tindakan, pengamatan, dan refleksi. Subyek dalam penelitian ini adalah siswa kelas IV SDN Kandangan III/621 Surabaya yang berjumlah 30 orang siswa. Pelaksanaan penelitian dilaksanakan dalam rentang waktu dua bulan, mulai bulan April sampai Mei 2010. Pengumpulan data dilakukan dengan menggunakan pedoman observasi, tes, dan catatan lapangan. Analisis data dilakukan secara deskriptif kualitatif dan kuantitatif. Hasil penelitian menunjukkan bahwa strategi bertanya dengan media gambar yang digunakan dalam pembelajaran IPA pada pokok bahasan pengaruh lingkungan fisik terhadap daratan dapat meningkatkan pemahaman siswa. Penugasan membuat pertanyaan juga dapat membuat siswa lebih leluasa untuk mengungkapkan rasa keingintahuannya, sehingga tingkat pemahaman siswa pun ikut meningkat. Berdasarkan hasil tersebut dapat disimpulkan bahwa penerapan strategi bertanya bertanya dengan media gambar dapat meningkatkan pemahaman tentang pengaruh lingkungan fisik terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya. Untuk memperoleh hasil yang maksimal diharapkan dalam penerapan strategi ini digunakan gambar yang lebih kompleks dan penggunaan pertanyaan dalam bentuk uraian.

Kinerja kepala desa dalam upaya pembinaan generasi muda untuk menciptakan partisipasi terhadap pembangunan desa di Desa Ngadirojo Kec. Ngadirojo Kab. Pacitan / Cahya Purnama

 

Kata Kunci: Kinerja Kepala Desa, Pembinaan Generasi Muda, Pembangunan Desa Pembangunan di tingkat desa perlu didukung oleh adanya peran serta masyarakat yang melibatkan peran serta generasi muda, karena hanya dengan dukungan masyarakat itulah pembangunan wilayah desa dapat berjalan secara lebih efektif. Pembangunan desa adalah upaya meningkatkan kemampuan manusia mempengaruhi masa depannya yang memiliki beberapa implikasi utama meliputi: (1) pembangunan berarti membangkitkan kemampuan manusia secara optimal, baik individu maupun kelompok; (2) pembangunan berarti mendorong tumbuhnya kebersamaan, kemerataan nilai dan kesejahteraan; (3) pembangunan berarti menaruh kepercayaan kepada masyarakat membangun dirinya sesuai dengan kemampuannya; (4) pembangunan berarti membangkitkan kemampuan membangun secara mandiri. Dalam hal ini kepala desa mempunyai peranan yang sangat penting dalam menggerakkan partisipasi generasi muda dalam bidang pembangunan. Sesuai dengan tugas, wewenang, dan kewajiban kepala desa, kepala desa mempunyai tanggung jawab yaitu menggerakkan partisipasi masyarakat. Tanggung jawab tersebut menyangkut penyelenggaraan urusan pemerintah desa dan urusan pemerintah umum termasuk pembinaan ketenteraman dan ketertiban serta menumbuh dan mengembangkan jiwa dan semangat gotong royong masyarakat sebagai sendi utama pelaksanaan pemerintahan desa sesuai peraturan perundang-undangan yang berlaku Tujuan dari penelitian ini adalah: (1) mendeskripsikan kinerja kepala desa dalam upaya pembinaan generasi muda, (2) mendiskripsikan partisipasi generasi muda terhadap pembangunan, (3) mendiskripsikan kinerja kepala desa dalam upaya pembinaan generasi muda untuk menciptakan partisipasi terhadap pembangunan desa di desa Ngadirojo Kecamatan Ngadirojo Kabupaten Pacitan. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Kehadiran peneliti dalam penelitian ini dibagi menjadi 3, yaitu studi pendahuluan, pengambilan data, dan pengecekan keabsahan data. Lokasi penelitian di Desa Ngadirojo. Sumber data dalam penelitian ini adalah manusia, peristiwa, sumber tertulis yang berupa sumber buku dan dokumen resmi, foto. Prosedur pengumpulan data, yaitu observasi, wawancara, dan dokumentasi. Teknik yang digunakan dalam analisis data, yaitu reduksi data, penyajian data, dan kesimpulan. Temuan yang diperoleh dalam penelitian ini yaitu: (1) kinerja kepala desa Ngadirojo berdasarkan kepemimpinanannya dalam program pembinanaan ii generasi muda selalu melayanai generasi muda dan berupaya mengarahkan, membimbing, menumbuhkan serta mengembangkan potensi yang dimiliki oleh generasi muda. Berdasarkan komunikasinya adalah melalui komunikasi langsung dan terbuka Sedangkan dalam memotivasi generasi muda dalam pembinaan tersebut kepala desa memberikan dorongan yang berbeda dalam masing-masing bidang. Kepala desa berpartisipasi dalam bidang-bidang pembinaan yaitu sebagai pemimpin dalam penyuluhan masing-masing bidang sekaligus sebagai pembina dan pengarah bagi generasi muda, (2) partisipasi generasi muda terhadap pembangunan desa Ngadirojo didasarkan keinginannya untuk telibat adalah cukup tinggi. Hal ini dibuktikan dengan kesediaaan untuk hadir pada musyawarah rencana pembangunan dan keinginannya untuk terlibat dalam segala bentuk pembangunan yang terjadi di desa Ngadirojo. Ditinjau dari kesadaran untuk terlibat dalam kegiatan pembangunan desa Ngadirojo dapat dilihat dari kesadaran generasi muda dalam memberikan ide atau masukan tentang program pembangunan yang perlu diprioritaskan. Dalam praktek, adanya keterlibatan generasi muda dalam pembangunan dapat diwujudkan dengan kesediaan generasi muda untuk terjun langsung dalam pembangunan-pembangunan desa, (3) kinerja kepala desa dalam membina generasi muda untuk meningkatkan partisipasi terhadap pembangunan terkait dengan kepemimpinannya adalah dengan memberikan kesempatan kepada generasi muda untuk terlibat dalam program pembangunan sesuai bidang-bidang pembinaan. Cara berkomunikasi, kepala desa dan generasi muda terjalin hubungan komunikasi yang baik dalam arti kepala desa mau mengajak generasi muda untuk berkomunikasi terkait pembangunan yang ada di desa. Dalam memotivasi generasi muda agar berpartisipasi dalam pembangunan desa. Partisipasi kepala desa dengan tujuan meningkatkan partisipasi generasi muda terhadap pembangunan desa, kepala desa sebagai pembina sekaligus sebagai pemimpin dalam kegiatan pembangunan yang sedang berlangsung baik pembangunan fisik ataupun nonfisik. Berdasarkan temuan diatas, saran yang diajukan adalah: (1) Bagi Kepala Desa Ngadirojo selain memberikan motivasi pada masing-masing bidang pembinaan, maka diperlukan adanya pertemuan rutin dengan generasi muda dan dilakukan dengan diskusi dengan menghadirkan perangkat desa untuk membahas kebutuhan atau permasalahan yang ada dalam mengembangkan kepemudaan, (2) bagi generasi muda selain berpartisipasi menyumbangkan ide dan tenaga alangkah baiknya dibuat catatan untuk penyempurnaan tertib administrasi, seperti pencatatan kegiatan yang telah dilaksanakan pada setiap bidang pembangunan untuk laporan triwulan, (3) dalam meningkatkan partisipasi generasi muda terhadap pembangunan, usaha kepemudaan yang bersifat ekonomi perlu ditingkatkan lagi sehingga hasilnya dapat untuk mengisi kas organisasi atau untuk keperluan pengadaaan fasilitas yang dibutuhkan dalam pembangunan.

Peranan pemerintah dalam meningkatkan kehidupan sosial ekonomi masyarakat nelayan di Desa Mayangan Kecamatan Mayangan Kota Probolinggo / Vinta Nurul Yuliastutik

 

Kata Kunci: Peranan Pemerintah, kehidupan Sosial Ekonomi, dan masyarakat nelayan Masyarakat nelayan masih hidup dalam keterbatasan baik keterbatasan dalam bidang pendidikan. Keterbatasan ekonomi itu nampak pada tingkat pendapatan nelayan yang pada umumnya masih rendah. Tujuan dari penelitian ini adalah: (1) Mendiskripsikan keadaan sosial ekonomi masyarakat nelayan, (2) Mendiskripsikan upaya yang dilakukan pemerintah dalam ikut mengatasi masalah sosial ekonomi masyarakat nelayan, (3) mendiskripsikan program pemerintah untuk meningkatkan kehidupan sosial ekonomi masyarakat nelayan, (4) hambatan yang dihadapi pemerintah dalam mengatasi masalah sosial ekonomi masyarakat nelayan, (5) Upaya yang dilakukan oleh pemerintah untuk mengatasi hambatan dalam masalah sosial ekonomi masyarakat nelayan Desa Mayangan Kecamatan Mayangan Kota Probolinggo. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Kehadiran peneliti dalam penelitian ini yaitu pada saat studi pendahuluan, pada saat pengambilan data, dan pada saat pengecekan keabsahan data. Teknik yang digunakan dalam prosedur pengumpulan data, yaitu observasi, wawancara, dan dokumentasi. Teknik yang digunakan dalam analisis data, yaitu reduksi data, penyajian data, dan kesimpulan. Kriteria yang digunakan dalam pengecekan keabsahan temuan, yaitu kepercayaan, triangulasi, keteralihan, kebergantungan, dan kepastian. Tahap-tahap yang dilakukan dalam penelitian ini, yaitu tahap persiapan penelitian, tahap pelaksanaan, dan tahap pelaporan. Temuan yang diperoleh dalam penelitian ini yaitu sesuai dengan rumusan masalah: (1) Kehidupan sosial ekonomi masyarakat nelayan di Desa Mayangan berdasarkan pendidikan dapat dilihat dari tingkat pendidikan para nelayan sendiri yang rata-rata sebagian besar tingkat pendidikannya hanya sampai Sekolah Dasar (SD). Hubungan komunikasi antar sesama nelayan dan antar juragan dengan nelayan terjalin dengan sangat baik. Hal ini terbukti dengan jarang ada salah paham dan pertengkaran. Masyarakat nelayan Desa Mayangan mengutamakan kerja sama. Hal ini terlihat dari kegiatan bergotong royong dan saling membantu apabila ada yang membutuhkan. Tingkat pendapatan masyarakat nelayan di Desa Mayangan tergantung dari hasil tangkapan ikan. (2) Upaya yang dilakukan oleh pemerintah Kota Probolinggo untuk mengatasi masalah sosial ekonomi yang timbul dalam masyarakat nelayan di Desa Mayangan sesuai dengan lima kriteria diantaranya dari segi pendidikan, komunikasi antar nelayan, kerja sama, persaingan antar nelayan dan pendapatan. (3) Pemerintah telah memberikan macam-macam program dan kegiatan diantaranya yaitu program PEMP, kegiatan vi beach clean up, dan bantuan langsung pemerintah. (4) Hambatan yang dihadapi Pemerintah Kota Probolinggo dalam mengatasi masalah sosial ekonomi masyarakat nelayan yaitu terbagi sesuai dengan kriteria yaitu hambatan dalam segi pendidikan, komunikasi antar nelayan, kerja sama, persaingan antar nelayan, pendapatan, hambatan dalam administrasi, dan hambatan teknis (5) Upaya yang dilakukan oleh pemerintah melalui dinas perikanan dan kelautan untuk mengatasi hambatan dalam masalah sosial ekonomi masyarakat nelayan ada beberapa tindakan diantaranya yaitu: Perda tahun 2007 tentang restribusi tempat pelelangan ikan, kunjungan pemerintah kepada para nelayan di pelabuhan tanjunga tembaga, hal ini dimaksudkan agar antara pemerintah dengan nelayan tidak ada kesenjangan sosial sehingga hubungan diantara kedua bisa lebih dekat dan pemerintah bisa lebih mengerti apa saja yang dibutuhkan warganya, melakukan pencocokan kembali atas data-data nelayan. Berdasarkan temuan diatas, saran yang diajukan adalah (1) Bagi Pemerintah Kota Probolinggo disarankan dalam mengatasi masalah sosial ekonomi masyarakat nelayan khususnya nelayan di Desa Mayangan dari segi Pendidikan Pemerintah lebih meningkatkan perhatian pada generasi muda yang kurang mampu untuk meneruskan pendidikannya dengan pemberian bermacam-macam bentuk bea siswa agar generasi muda lebih termotivasi untuk tetap mencpai cita-citanya. Dari segi komunikasi antar nelayan, pemerintah lebih giat secara aktif lagi untuk melakukan pendekatan secara langsung kepada masyarakat nelayan dengan melakukan berbagai penyuluhan kepada masyarakat nelayan tentang pentingnya komunikasi yang baik antar sesama. Segi kerja sama, pemerintah lebih giat secara aktif lagi untuk melakukan pendekatan secara langsung kepada masyarakat nelayan dengan melakukan berbagai penyuluhan kepada masyarakat nelayan tentang pentingnya kerja sama dan bergotong royong. Dari Persaingan antar nelayan, pemerintah lebih tertib melaksanaan peraturan daerah mengenai persaingan yang terjadi antar nelayan sehingga masyarakatnya pun ikut tertib. Dari pendapatan, pemerintah berusaha lagi untuk menciptakan berbagai macam lapangan kerja baru bagi masyarakat nelayan khususnya nya agar bisa mengatasi masalah perekonomian masyarakatnya dengan pemberian bermacam-macam keterampilan sehingga bisa membuka peluang usaha yang baru. Bagi peneliti lanjutan disarankan hasil penelitian ini dapat dijadikan acuan, titik tolak, dan tindak lanjut bagi peneliti yang relevan dengan judul yang dibahas pada penelitian yang akan datang. Bagi masyarakat nelayan disarankan para masyarakat nelayan diharuskan lebih memperhatikan kehidupannya sendiri, lebih semangat dan kerja keras demi mempertahankan hidupnya tanpa harus menunggu peran serta dari pemerintah untuk memberi bantuan. Nelayan juga harus mentataati dan tidak melanggar peraturan yang dibuat oleh pememerintah. Semua kegiatan dan program yang dibuat leh pemerintah harus dilaksanakan dengan sebaik-baiknya dengan penuh tanggung jawab.

Penerapan pendekatan pembelajaran kontekstual untuk meningkatkan prestasi belajar kompetensi keahlian membuat gambar rencana balok beton bertulang pada siswa XI GB di SMKN 6 Malang / Anna Zahrotul Fatah

 

Kata kunci: pembelajaran kontekstual, prestasi belajar. Berdasarkan pengamatan hasil belajar siswa kelas XI GB 2 SMK Negeri 6 Malang pada kompetensi keahlian membuat gambar rencana balok beton ber-tulang hanya mencapai Kriteria Ketuntasan Minimal (KKM) saja, yaitu 76,22. Kondisi ini menunjukkan bahwa perlu adanya peningkatan hasil belajar siswa. Pada pengamatan awal pembelajaran, guru menggunakan pendekatan ceramah untuk menyampaikan materinya. Pendekatan yang diterapkan tersebut belum dapat mengaitkan antara materi pembelajaran yang dijelaskan dengan kenyataan yang ada di lapangan atau dengan kehidupan sehari-hari. Untuk meningkatkan hal tersebut maka diperlukan suatu pendekatanpembelajaran yang tepat, yaitu dengan cara menerapkan pendekatan pembelajaran kontestual. Penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK), dimana penelitian tersebut terdiri dari dua siklus. Adapun teknik pengumpulan data yang digunakan dengan cara observasi dan tes/ penugasan. Prosedur peneliti-an tindakan kelas yang dilakukan terdiri dari empat tahap, yaitu: (1) perencanaan, (2) tindakan, (3) observasi, dan (4) refleksi. Hasil penelitian menunjukkan bahwa pada pelaksanaan siklus I prosentase siswa yang mendapatkan nilai ≤ 76,22 sebanyak 60,87% dan siswa yang men-dapatkan nilai ≥ 76,22 sebanyak 39,13%. Ketuntasan kelulusan siswa secara klasikal pada siklus I ≤ 76%, sehingga dilakukan remidial untuk satu kelas. Pada siklus II nilai yang diperoleh telah mencapai KKM. Hal ini ditunjukkan dengan prosentase siswa yang mendapatkan nilai ≤ 76,22 sebanyak 13,05% dan siswa yang mendapatkan nilai ≥ 76,22 sebanyak 86,95%. Siklus I ke siklus II yang telah dilakukan, mengalami peningkatan prestasi belajar sebesar 47,82 %. Perkembang-an siswa setelah pelaksanaan tindakan adalah: (1) siswa aktif dalam pembelajaran, (2) siswa aktif dalam mengajukan pertanyaan dan pendapat, (3) kerjasama dalam kelompok meningkat, (4) siswa sudah berani mempresentasikan hasil belajarnya kedepan kelas, dan(5) siswa bisa mengerjakan tugas dari guru. Dari hasil penelitian tersebut dapat disimpulkan bahwa: (1) penerapan pendekatan pembelajaran kontekstual dapat menciptakan pembelajaran yang efektif dan efisien, dan (2) penerapan pendekatan pembelajaran kontekstual pada kompetensi keahlian membuat gambar rencana balok beton bertulang dapat meningkatkan prestasi belajar siswa XI GB 2 SMK Negeri 6 Malang.

Penggunaan permainan tata angka untuk meningkatkan aktifitas belajar mengenal bilangan di kelompok A TK Satu Atap SDN Tulusrejo 3 Kota Malang / Ida Fariani

 

Perancangan instalasi penerangan pada stadion sepak bola / Januar Saraswanto

 

Kata Kunci: Perancangan Penerangan Stadion, cahaya. Sepak bola merupakan salah satu olahraga yang banyak digemari oleh semua kalangan baik yang kaya maupun yang miskin. Dalam sebuah pertandingan, olahraga ini dimainkan oleh dua kelompok berlawanan yang masing-masing berjuang untuk memasukkan bola ke gawang kelompok lawan. Masing-masing kelompok beranggotakan sebelas pemain, dan karenanya kelompok tersebut juga dinamakan kesebelasan, selain itu dala sebuah kelompok juga terdapat seorang pelatih. Menurut Zubaidi (2009), Olahraga Sepak bola saat ini bukan lagi hanya sekadar olahraga atau permainan, namun telah menjadi industri di berbagai kejuaraan dunia. Salah satunya di ajang Euro 2008, pertandingan sepak bola di kalangan negara-negara Eropa yang telah berlangsung di Swiss dan Austria. Dalam event yang berlangsung empat tahun sekali itu ada mekanisme yang mempertemukan hukum permintaan dan penawaran. Di sana ada tim, pemain, pelatih, dan penyelenggara sebagai pemasok. Di sana ada pula pemirsa yang membeli permainan, tontonan, drama, dan hiburan sebagai komoditas. Oleh karena itu, kenyamanan bagi penonton dalam menonton pertandingan menjadi hal yang penting dalam kelancaran penyelenggaraan pertandingan. Salah satunya yang mempengaruhi kenyamanan penonton adalah sistem penerangan suatu stadion pada malam hari. Penerangan yang baik adalah penerangan yang tidak menyebabkan silau pada mata pemain maupun penonton. Pada perancangan instalasi penerangan sebuah stadion banyak hal yang mempengaruhi kualitas penerangan, diantaranya jenis lampu yang digunakan, posisi lampu dan sebagainya. Perancangan ini menggunakan sistem 6 tiang dan dibuat dengan sebuah simulasi 3D. Perhitungan sudut yang dihasilkan jika lampu pertama memiliki sudut sebesar 600 , maka sudut dari lampu kedua adalah sebesar 62.10. pada sistim 6 tiang rasio kerataan lebih mendekati nilai 1 dibanding sistim 2 dan 4 tiang dengan jumlah dan jenis lampu yang sama tiap tiang, karena semakin banyak terjadi perpotongan cahaya lampu sorot menjadikan pencahayaan pada permukaan lapangan semakin merata.

Pengaruh kebiasaan belajar, kepercayaan diri siswa, dan lingkungan keluarga terhadap hasil belajar mata pelajaran akuntansi (SMA Negeri 1 Sumberpucung Kabupaten Malang) / Nur Khasanah

 

Kata Kunci: Kebiasaan Belajar, kepercayaan diri siswa, dan lingkungan Keluarga, Hasil Belajar. Upayah mencetak sumberdaya manusia yang berkualitas dapat dilakukan dengan melakukan peningkatan mutu di bidang pendidikan. Dalam hal ini peserta didik dan hasil belajar memiliki peran yang sangat penting posisinya dalam meningkatkan mutu pendidikan. Untuk mendapatkan hasil belajar yang baik ada beberapa faktor yang mempengaruhinya yaitu: kebiasaan belajar, kepercayaan diri siswa dan lingkungan keluarga. Dengan demikian, penelitian ini ingin menguji tentang pengaruh kebiasaan belajar, kepercayaan diri siswa, dan lingkungan keluarga terhadap hasil belajar siswa jurusan IPS di SMA Negeri 1 Sumberpucung. Metode penelitian yang digunakan adalah jenis rancangan penelitian eksplanatif dengan desain penelitian menunakan analisis regresi linier berganda. Teknik pengumpulan data dilakukan dengan mengunakan angket dan dokumentasi nilai rapor. Hasil penelitian ini menunjukkna bahwa: 1) ada pengaruh kebiasaan belajar terhadap hasil belajar siswa jurusan IPS di SMA Negeri 1 Sumberpucung dengan melihati hasil uji t yang menunjukkan sig 0,023 < 0,05, 2) ada pengaruh kepercayaan diri siswa terhadap hasil belajar siswa jurusan IPS di SMA Negeri 1 Sumberpucung dengan melihati hasil uji t yang menunjukkan sig 0,005 < 0,05, dan 3) ada pengaruh lingkungan keluarga terhadap hasil belajat siswa jurusan IPS di SMA Negeri 1 Sumberpucung dengan melihati hasil uji t yang menunjukkan sig 0,037 < 0,05. Berdasarkan hasil penelitian yang telah dilakukan, Guru diharapkan mampu memberikan contoh perilaku/kebiasaan belajar yang baik di dalam kelas untuk membentuk disiplin belajar siswa, guru juga diharapkan dapat menggali kepercayaan diri siswa demi kesuksesan proses belajar, sehingga siswa bisa lebih maksimal lagi dalam belajarnya dan dapat memperoleh hasil belajar yang lebih maksimal lagi.

Pengaruh pembuangan limbah cair pabrik bir terhadap kualitas air sungai Cumpleng di Kecamatan Kutorejo Kabupaten Mojokerto / Suprianto

 

Kalimat Kunci: Limbah Industri, Kualitas Air Sungai Di Desa Sampang Agung Kecamatan Kutorejo Kabupaten Mojokerto terdapat pabrik bir yang menghasilkan limbah cair yang di buang ke sungai Cumpleng. Padahal pabrik ini berada pada ketinggian kurang lebih 350m dpl dengan ketinggian tersebut kemungkinan pencemaraan air oleh limbah pabrik ini berdampak secara luas, Dampak pembuangan limbah cair ini sering dikeluhkan oleh warga yang berada di daerah aliran sungai. Karena air sungai menjadi bau dan ada endapan warna hitam. Tujuan dari penelitian adalah untuk mengkaji kualitas limbah industri bir, mengkaji kualitas sungai Cumpleng, dan bagaimanakah hubungan antara jarak dengan kualitas air. Penelitian ini merupakan penelitian survei lapangan dengan pengambilan sampel berupa limbah industri bir dan air sungai Cumpleng. Pengambilan sampel menggunakan metode Purposive Sampling. Analisis data berupa analisis komparasi dan analisis korelasi. Analisis komparasi limbah cair pabrik menggunakan standar baku mutu limbah cair pabrik bir sesuai dengan SK Gubenur Jawa Timur no 45 tahun 2002 dan analisis kualitas air sungai Cumpleng sesuai dengan baku mutu air golongan II berdasarkan PP.RI. No 82 tahun 2001. Analisis korelasi menggunakan korelasi product-moment Berdasarkan hasil uji laboratorium kualitas limbah industri bir tidak memenuhi standar baku mutu limbah industri berdasarkan SK Gubenur Jawa Timur no 45 tahun 2002 hal ini disebabkan 3 parameter tidak memenuhi standar baku mutu meliputi parameter COD sebesar 1088,6 Mg/L, parameter BOD5 sebesar 238 Mg/L dan parameter TSS sebesar 2827 Mg/L sedangkan parameter pH dan fenol memenuhi standar baku mutu yaitu nilai pH sebesar 8,03 dan Fenol sebesar 0,016 µg/L.Berdasarkan hasil uji laboratorium kualitas air sungai Cumpleng nilai pH masih dibawah standar baku mutu kualitas air golongan II, nilai BOD5 titik 2-6 melebihi standar baku mutu, nilai COD titik 2-6 melebihi standar baku mutu, nilai TSS titik 2-6 melebihi standar baku mutu dan nilai fenol masih di bawah standar baku mutu. Terdapat hubungan jarak dengan tingkat pencemaran. Besar kecilnya korelasi menunjukan nilai yang berbeda-beda pada setiap parameter. Untuk korelasi sangat tinggi terdapat pada parameter pH dengan nilai -0,916 dan Fenol dengan nilai -0,904 dan TSS dengan nilai -0,903, korelasi sedang terdapat pada parameter COD dengan nilai -0,779 dan parameter BOD5 dengan nilai -0,714. Pabrik industri bir di kecamatan Kutorejo Kabupaten Mojokerto diharapkan lebih memperhatikan proses pengolahan limbah sebelum dibuang ke sungai harus diolah secara maksimal dan memenuhi prosedur yang ada selain itu diharapkan pemerintah melakukan pengawasan secara intensif terhadap proses-proses pengolahan limbah industri agar limbah tersebut tidak berbahaya apabila dibuang ke sungai

Hubungan pola asuh ibu terhadap status gizi balita di Desa Lenteng Timur Kabupaten Sumenep / Eline Wijaya Rukmi

 

Kata Kunci: Pola Asuh, Status Gizi, Balita Penyebab kurang gizi dipengaruhi oleh faktor langsung yaitu makanan dan penyakit infeksi, tidak langsung yaitu ketahanan pangan keluarga, perawatan kesehatan, dan pola asuh. Pola asuh meliputi feeding (pelaksanaan pemberian makanan balita), caring (perawatan kesehatan balita), pelaksanaan hygiene dan sanitasi lingkungan, dan rangsangan psikososial. Tujuan penelitian ini ialah untuk mengetahui hubungan faktor-faktor pola asuh, caring, hygiene sanitasi lingkungan, dan rangsangan psikososial terhadap status gizi balita. Hipotesis alternatif (Ha) dalam penelitian ini adalah ada hubungan yang signifikan antara pola asuh ibu terhadap status gizi balita. Penelitian ini termasuk dalam penelitian survey dengan metode pendekatan cross sectional. Variabel bebas dalam penelitian ini ialah pola asuh Ibu diukur menggunakan kuesioner tertutup, dan variabel terikat ialah status gizi balita diukur dengan antropometri BB/U dan diinterpretasikan melalui standar baku WHO/NHCS. Uji coba validitas instrument menggunakan pearson product moment, dan uji reliabilitasnya menggunakan rumus cronbach alpha. Koefisien korelasi menggunakan korelasi rank spearman. Hasil penelitian menunjukkan sebagian besar (95,6%) pelaksanaan pemberian makan balita (feeding) pada kategori baik, pelaksanaan perawatan kesehatan (caring) dan pelaksanaan hygiene dan sanitasi lingkungan seluruhnya (100%) pada kategori baik, sebagian besar (92,2%) rangsangan psikososial dalam kategori baik. Pada hasil data pengukuran status gizi balita menunjukkan sebagian besar (77,8%) balita berada pada status gizi baik, masih ditemukan sebagian kecil (1,1%) balita berstatus gizi buruk, hal ini disebabkan riwayat persalinan Ibu yang tidak optimal. Hasil analisis data penelitian menunjukkan nilai koefisien korelasi feeding dan caring oleh ibu terhadap status gizi balita sebesar 0,609, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Sedangkan korelasi antara hygiene dan sanitasi lingkungan terhadap status gizi terhadap status gizi balita sebesar 0,526, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Korelasi antara rangsangan psikososial terhadap status gizi balita sebesar 0,549, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Korelasi antara pola asuh ibu terhadap status gizi balita sebesar 0,625, hal ini menunjukkan bahwa korelasi berpengaruh kuat, signifikan, dan searah. Karena keterbatasan peneliti, beberapa faktor lain yang mempengaruhi status gizi belum diteliti dalam penelitian ini yaitu tingkat ekonomi, tingkat pengetahuan/keterampilan ibu, jumlah anak/keluarga. Pada penelitian lebih lanjut hal tersebut akan lebih baik jika diteliti langsung seberapa kuat hubungannya terhadap status gizi melalui metode lain dalam pengukuran status gizi yaitu antropometri TB/U, atau BB/TB, dan LLA (Lingkar Lengan Atas), apabila biaya dan waktu penelitian mencukupi bisa melalui pengukuran Biokimia, dan Biofisika.

Pembuatan video berbasis animasi tiga dimensi sebagai media pendamping materi front office untuk siswa Jurusan Akomodasi Perhotelan Sekolah Menengah Kejuruan Cor Jesu Malang / Daniel Arya Yudhanta

 

Kata kunci: Front Office, SMK Cor Jesu, Pembuatan Video Animasi Tiga Dimensi Kantor Depan (Front office) adalah cermin dari kualitas hotel pertama kali bagi tamu. Itulah mengapa kantor depan merupakan salah satu materi penting yang harus disampaikan pada siswa terutama pada jurusan akomodasi perhotelan. Sekolah Menengah Kejuruan Cor Jesu adalah salah satu sekolah menengah kejuruan yang menyediakan jurusan akomodasi perhotelan di kota Malang. Sehingga sekolah ini menggunakan materi front office sebagai salah satu materi penting yang harus disampaikan. Hal ini dirasa penting oleh sekolah sebagai salah satu bentuk usaha sekolah mempersiapkan siswa agar mampu menjadi tenaga professional ketika telah menyelesaikan pendidikannya. Proses penyampaian materi front office di SMK Cor Jesu masih menggunakan metode belajar konvensional dimana guru yang mendominasi kelas sedangkan siswa hanya mendengarkan. Adapun media yang sering digunakan adalah power point, dan hand out. Cara belajar yang demikian dirasa masih kurang efektif ketika diterapkan karena cenderung membosankan bagi siswa dan kurang inovatif. Maka perlu dibentuk sebuah cara belajar baru yang lebih menyenangkan dan inovatif. Salah satu alternatif yang dapat digunakan adalah dengan mengembangkan media yang digunakan. Adapun media yang dapat ditawarkan adalah dengan menggunakan video berbasis animasi tiga dimensi sebagai media pendamping dalam proses belajar mengajar. Dalam tugas akhir ini dihasilkan sebuah video berbasis animasi tiga dimensi sebagai media pendamping materi front office untuk siswa jurusan akomodasi perhotelan di SMK Cor Jesu Malang. Diharapkan dengan adanya video ini dapat meningkatkan efektiffitas belajar siswa dan mampu membantu guru dalam penyampaian materi.

Analisis penggunaan pola draping pada gaun mode draperi / Siti Firdausiah

 

Kata kunci: pola draping, gaun mode draperi Menurut sejarahnya, pakaian yang dikenakan manusia awalnya berupa sehelai kain berbentuk segi empat yang diberi lubang tengahnya untuk memasukkan kepala, namun dengan perkembangan mode masa kini, begitu banyak variasi dan mode pakaian baik yang longgar dibadan maupun yang pas badan sehingga menunjukkan lekuk tubuh. Membuat pakaian yang bervariasi tersebut membutuhkan sebuah pola, karena tanpa menggunakan pola suatu pakaian dapat dibuat tetapi hasilnya tidak sesuai dengan yang diharapkan. Ketepatan, kecermatan, dan kemampuan dalam menganalisa posisi titik, garis tubuh si pemakai dan pemilihan media pola akan menentukan kualitas sebuah pola. Ada beberapa macam pola yang dapat digunakan dalam membuat busana diantaranya pola konstruksi dan pola draping. Pola konstruksi membutuhkan banyak ukuran dan dikerjakan pada kertas pola di atas meja datar, pola yang dihasilkan masih berupa pola dasar sehingga harus dibuat pecah pola agar sesuai dengan desain. Pola ini dianggap lebih rumit dibanding pola draping sehingga banyak desainer atau praktisi busana yang lebih condong memakai pola draping karena pembuatan polanya mudah dan hasilnya langsung siap pakai sesuai dengan desain (Sugiyem, 2008). Mode draperi merupakan mode beraliran klasik yang digemari sepanjang masa oleh pecinta mode sehingga desainer maupun praktisi busana dituntut untuk memenuhi kebutuhan konsumen busana mode draperi. Kemudahan dalam penggunaan pola draping pada pembuatan gaun mode draperi sangat dibutuhkan desainer maupun praktisi busana, maka penting kiranya menganalisis penggunaan pola draping pada gaun mode draperi. Draperi yang akan diteliti pada bagian garis leher dan panggul. Penelitian ini merupakan penelitian deskriptif yang bertujuan untuk mendeskripsikan penggunaan pola draping pada gaun mode draperi. Gaun yang diproduksi untuk penelitian ini menggunakan ukuran paspop S standar internasional. Validasi gaun oleh 3 panelis dengan instrumen lembar pengamatan yang terdiri dari beberapa kriteria penilaian. Teknik analisisnya menggunakan analisis persentase. Berdasarkan hasil validasi dari 3 panelis, penggunaan pola draping pada gaun mode draperi dileher, tingkat keluwesan/fleksibilitasnya diperoleh sebesar 77 % karena badan bagian depan menggunakan bahan serong sampai dengan batas potongan rok sedangkan penggunaan pola draping pada gaun mode draperi panggul, tingkat keluwesan/fleksibilitas diperoleh sebesar 100 %. Penggunaan pola draping tepat digunakan pada pembuatan gaun mode draperi pada leher dan panggul dengan ketepatan sebesar 93%.

Manajemen pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Dadapan Bondowoso / Fatahillah Arrozi

 

Tesis, Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing : (1) Prof. Dr. Ahmad Sonhadji, K.H., M.A., Ph.D. (II) Prof. Dr. Willem Mantja, M. Pd. Kata kunci: manajemen, pembiayaan pendidikan, anak kurang mampu Kendala utama dari lembaga pendidikan islam khususnya pesantren dalam menghadapi persaingan saat ini adalah ketidaksiapan sumber daya manusia juga meliputi kemampuan finansial. Hingga saat ini, tidak sedikit yang menjalankan proses belajar mengajarnya dengan SDM (Sumber Daya Manusia) pengajar dibawah rata-rata dan dukungan finansial seadanya. Jumlah santri yang berasal dari golongan tidak mampu terkadang lebih banyak daripada santri mampu, sehingga pondok pesantren pun tidak bisa beharap banyak terhadap sumbangan mereka untuk pelaksanaan pembiayaan pendidikan. Berangkat dari keingintahuan mengenai bagaimana pembiayaan pendidikan dikelola oleh sekolah-sekolah swasta di lembaga mereka, khususnya bagi anak-anak kurang mampu tersebut, maka peneliti tertarik untuk melakukan penelitian lebih mendalam di sebuah lembaga pendidikan swasta berbentuk pondok pesantren modern di sebuah kota kecil yaitu Kabupaten Bondowoso, pondok pesantren tersebut adalah Al-Ishlah Dadapan Bondowoso. Fokus dalam penelitian ini adalah manajemen pembiayaan pendidikan bagi anak-anak kurang mampu di pondok pesantren Al-Ishlah Bondowoso. Dari fokus tersebut diuraikan sebagai berikut: (1) Perencanaan pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Bondowoso, (2) Pengorganisasian pembiayaan pendidikan bagi anak-anak kurang mampu Pondok Pesantren Al-Ishlah Bondowoso, (3) Pelaksanaan pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Bondowoso, dan (4) Pengawasan pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Bondowoso. Pendekatan yang digunakan oleh peneliti yaitu pendekatan kualitatif dan jenis penelitiannya yaitu studi kasus. Pendekatan model ini digunakan karena permasalahan berupa bagaimana manajemen pembiayaan pendidikan bagi anak-anak kurang mampu di Pondok Pesantren Al-Ishlah Dadapan Bondowoso masih belum jelas, kompleks dan penuh makna. Lokasi penelitian adalah Pondok Pesantren Al-Ishlah yang beralamatkan di Jl. Raya Jember No.17-18 Dadapan Grujugan Bondowoso Jawa Timur 68261. Dalam penelitian ini, sampel sumber data dipilih secara purposive dan bersifat snowball sampling. Penentuan sumber data disini masih bersifat sementara, dan akan berkembang kemudian sampai ke titik jenuh informasi setelah peneliti berada di lapangan. Agar diperoleh data yang lebih lengkap dan sesuai dengan fokus dan tujuan penelitian, maka teknik pengumpulan data dalam penelitian ini dilakukan dengan menggunakan tiga cara, yaitu : (1) Wawancara mendalam, (2) observasi partisipan, dan (3) dokumentasi. Dalam penelitian ini ada empat langkah yang dilakukan peneliti untuk menganalisis data yaitu analisis domain, taksonomi, komprehensial, dan analisis tema. Uji keabsahan data dilakukan dengan berbagai cara, yaitu uji kredibilitas data, uji dependabilitas data, uji transferabilitas, dan uji konfirmabilitas. Yang utama dilakukan adalah uji kredibilitas melalui perpanjangan waktu pengamatan, meningkatkan ketekunan, trianggulasi, diskusi dengan teman sejawat, memberi cek dan analisis kasus negatif. Berdasarkan uraian data dan temuan penelitian di lapangan maka peneliti dapat menarik kesimpulan sebagai berikut: (1) Pimpinan Pondok pesantren Al-Ishlah dalam menyusun perencanaan pembiayaan pendidikan bagi anak-anak kurang mampu mengedepankan hal-hal seperti (a) Melibatkan semua pengurus, (b) Merumuskan perencanaan yang fleksibel, dan (c) Mendasarkan kepedulian terhadap anak-anak kurang mampu agar supaya tercapai visi, misi dan tujuan pondok pesantren. (2) Pengorganisasian pembiayaan pendidikan bagi anak-anak kurang mampu dijalankan dengan: (a) Pembagian tugas yang jelas serta pendelegasian wewenang, (b) Penempatan personel yang amanah dan kompeten, dan (c) Melakukan pembinaan personel secara rutin dan berkala. (3) Pelaksanaan pembiayaan pendidikan bagi anak-anak kurang mampu meliputi: (a) Membagi santri ke dalam tiga golongan, yaitu Banuh, Basa dan Taba, (b) Penerimaan sumber pembiayaan pendidikan yang berasal dari sumbangan santri mampu dan BUMP, (c) Alokasi penggunaan pembiayaan pendidikan yang terprogram, dan (d) Prosedur pencairan pembiayaan pendidikan yang terorganisir dan rapi. (4) Pengawasan pembiayaan pendidikan bagi anak-anak kurang mampu dilakukan dalam dua tahap: (a) Dijalankan oleh biro pengawasan secara insidental dan berkala, dan (b) Dijalankan oleh pimpinan pondok dan wakil secara insidental dan berkala. Hasil penelitian ini disarankan kepada: (1) Pemerintah agar lebih memperhatikan pembiayaan pendidikan bagi anak-anak kurang mampu, dalam hal ini khususnya Kementrian Agama agar supaya dalam pembuatan keputusan dapat berkontribusi langsung dalam pembiayaan pendidikan terutama bagi lembaga pendidikan swasta, (2) Kepada penyelenggara pendidikan atau pondok pesantren lain, hasil penelitian ini dapat dijadikan model atau acuan dalam pengelolaan manajemen pembiayaan pendidikan yang tepat terutama bagi anak-anak kurang mampu, agar cita-cita pemerataan pendidikan di Indonesia bisa cepat tercapai,(3) Kepada pengamat pendidikan atau masyarakat pendidikan. Hasil penelitian ini dapat dimanfaatkan untuk memberikan wawasan dan kesadaran masyarakat luas dan masyarakat sekitar pondok bahwa diperlukan manajemen yang tepat dalam pengelolaan pembiayaan pendidikan bagi anak-anak kurang mampu. Secara konseptual dapat memperkaya teori tentang manajemen pembiayaan pendidikan, (4) Kepada peneliti lain, penelitian ini bisa dijadikan bahan referensi untuk memperluas wawasan pengetahuan dan keterampilan dalam kaitannya dengan manajemen pembiayaan pendidikan khususnya bagi anak-anak kurang mampu.

Launching program tabunganku dalam rangka promosi gemar menabung Bank Jatim / Decky Zakariiyah

 

Kata kunci : Launching, TabunganKu, Gemar Menabung Saat ini Bank Jatim telah mengadakan program ”TabunganKu” untuk kalangan Pelajar SD. untuk mulai membidik nasabah kecil melalui program tabungan bersama TabunganKu. Program ini diluncurkan pada tanggal 20 Februari 2010 bersamaan dengan pencanangan Tahun Menabung Nasional. TabunganKu merupakan terobosan program pemerintah guna meningkatkan tingkat menabung di tanah air. karena, tingkat menabung masyarakat saat ini tergolong masih rendah dibandingkan negara-negara tetangga. Harapannya TabunganKu ini bisa mengulang sukses seperti produk Tabanas. Untuk itu, melalui TabunganKu bisa menjadi alternatif produk pilihan investasi. Dalam hal ini Bank Jatim juga memperkenalkan kebiasaan menabung kepada anak sejak dini sebagai awal pembelajaran mereka tentang investasi.Kegiatan perancangan yang dilakukan bertujuan untuk menghasilkan buku cerita bergambar, untuk siswa kelas sekolah dasar dan menengah Bentuk dari media yang dirancangan antara lain : buku bergambar dari 11 buah cerita. Setiap gambar memiliki cerita yang terdiri dari kurang lebih satu sampai dua kalimat. Fasilitas pendukung berupa atm, buku tabungan, penggaris, pembatas buku, magnet lemari es, gantungan kunci yang di rancang khusus special untuk nasabah baru dalam promosi gemar menabung. media pendukung launching berupa poster, dan X banner. Model Perancangan dalam cerita bergambar Gemar Menabung, yang digunakan adalah model perancangan yang membutuhkan data untuk dianalisis mejadi sebuah konsep yang bertolak dari masalah dan hasil dari analisis data, yang bersifat linier dan berurutan langkah-langkah kerjanya atau disebut model prosedural atau rasional. Dalam model perancangan ini, langkah-langkah perancangan dilakukan dengan sitematik serta rasional dan terstruktur dengan menggunakan pendekatan ilmiah dari awal hingga akhir. Hasil dalam perancangan ini adalah buku cerita bergambar, untuk siswa kelas sekolah dasar dan menengah. Fasilitas pendukung berupa atm, buku tabungan, penggaris, pembatas buku, magnet lemari es, gantungan kunci yang di rancang khusus special untuk nasabah baru dalam promosi gemar menabung. media pendukung launching berupa poster, dan X banner. Penulis menyarankan agar perancang selanjutnya dapat membuat media yang lain agar dapat menarik nasabah agar gemar menabung di Bank Jatim

Pengembangan media cakram dari bahan kayu bekas dengan lapisan aluminium untuk pembelajaran lempar cakram kelas VII SMP Negeri 4 Kraksaan Kabupaten Probolinggo / Adhitya Yudha Putra

 

Kata kunci: Pengembangan, Pembelajaran, Lempar cakram, Cakram kayu Di dalam dunia pendidikan, pelajaran Pendidikan Jasmani Olahraga dan Kesehatan merupakan satu mata pelajaran yang harus dimasukan dalam kurikulum di semua jenis dari jenjang pendidikan mulai dari Taman Kanank-kanak (TK), Sekolah Dasar (SD), Sekolah Menengah Pertama (SMP), Sekolah Menengah Atas (SMA), sampai dengan Perguruan Tinggi (PT). Aktifitas jasmani dalam pendidikan jasmani telah mendapat sentuhan didaktik-metodik sehingga dapat di arahkan pada usaha pencapaian tujuan pembelajaran yaitu mengembangkan organik, neuromoskuler, intelektual dan emosional. Salah satu kendala dalam mengembangkan tujuan pembelajaran adalah rendahnya rasa partisipasi pembelajaran siswa khususnya kualitas hasil belajar. Oleh sebab itu, perlu adanya upaya-upaya guna meningkatkan minat dan motivasi pada siswa dalam aktifitas proses pembelajaran, yang pada gilirannya dapat meningkatkan kualitas hasil belajar. Salah satu upaya yang dilakukan adalah merancang pembelajaran secara sistematis, dengan cara memberdayakan teknologi pembelajaran dan media pembelajaran di kelas. Dengan demikian, perlu adanya komitmen tinggi bagi para guru yang lebih menekankan pada pemberdayaan teknologi pembelajaran dan media pembelajaran di kelas. Salah satu yang kurang diperhatikan dalam pengembangan pembelajaran Pendidikan Jasmani Olahraga dan kesehatan adalah pelajaran atletik. Banyak berbagai cabang atletik diantaranya adalah jalan, lari, lompat, lempar. Dalam nomor lempar juga terdapat banyak cabang diantaranya adalah tolak peluru, lempar lembing, lontar martil dan lempar cakram. Dari keempat golangan diatas yang akan dibahas lebih lanjut adalah lempar cakram. Untuk mendukung keberhasilan tujuan pembelajaran lempar cakram di sekolah, tentunya diperlukan adanya sarana dan prasarana yang memadai, hal ini yang menjadi salah satu faktor menghambat proses pembelajaran Pendidikan Jasmani Olahraga dan Kesehatan lempar cakram di sekolah. Dari hasil observasi dan wawancara terhadap guru pendidikan jasmani SMP Negeri 4 Kraksaan, pada saat pembelajaran lempar cakram cakram yang digunakan adalah cakram yang standart, berkaitan dengan jumlah media cakram yang tidak memungkinkan dan dirasakan media cakram terlalu berat yang digunakan dalam proses pembelajran lempar cakram. Hal inilah yang menghambat keberlangsungan pembelajaran dan rendahnya rasa partisispasi siswa dalam pembelajaran lempar cakram. Dari hasil angket siswa yang berkaitan dengan pembelajran lempar cakram di SMP 4 Negeri Kraksaan terdapat banyak keluhan diantaranya adalah: (1) 80% siswa merasa tidak senang dengan pembelajaran lempar cakram dan 20% siswa merasa menyenangkan dengan

Perancangan iklan layanan masyarakat tentang lutung jawa dari ancaman kepunahan / Jangkung Imam Fadli

 

Kata Kunci: Perancangan, Iklan Layanan Masyarakat, Lutung Jawa. Perancangan iklan layanan masyarakat tentang Lutung Jawa dari ancaman kepunahan ini menggunakan model perancangan prosedural. Proses perancangan diawali dengan mempelajari latar belakang dan fakta-fakta tentang Lutung Jawa yang ada di Indonesia pada umumnya. Tahap berikutnya adalah dilakukan pengumpulan data yang dibutuhkan, baik data pustaka maupun data lapangan yang akan dianalisis dan disintesis menjadi sebuah konsep kreatif dan konsep media. Iklan layanan masyarakat yang telah diaplikasikan sesuai dengan target audience diharap akan menekan angka perdagangan Lutung Jawa . Untuk itu perlu dilakukan sebuah evaluasi program kampanye yang telah dilakukan dengan cara mengamati perkembangan dari aktifitas-aktifitas yang merugikan tersebut, kemudian melakukan follow up terhadap semua program kampanye yang dilakukan sehingga kampanye yang dilakukan tidak hanya semata-mata dilakukan pada saat itu saja. Lutung Jawa yang memiliki nama latin (Trachypithecus auratus) merupakan salah satu satwa endemik Indonesia yang dilindungi oleh undang-undang tetapi masih terus diperdagangkan dan populasinya berkurang. Melihat latar belakang tersebut maka perlu dilakukan tindakan untuk melestarikannya, seperti memperbanyak media yang mengangkat tentang permasalahan Lutung Jawa. Bertujuan membantu masyarakat untuk mengetahui permasalahan Lutung Jawa yang terjadi di Indonesia. Keseluruhan menjadi media informasi kepada khalayak atau publik, pentingnya perlindungan, kepedulian, perundangan, antisipasi, kepunahan, da harapan media yang ada menjadi sebuah pembelajaran agar berubah menjadi suatu perubahan yang menuju kebaikan (Sebagai pilihan). ii Imam Fadli, Jangkung. 2011. “Designing Public Service advertising About Java Monkey from the Threat of Extinction”. Thesis, Visual Communications Design Studies Program, Department of Art and Design, Faculty of Arts, State University of Malang. advisors: (I) Rudi Irawanto, S.Pd, M.Sn (II) Mohammad Sigit, S.Sn

Sistem otomatisasi perlengkapan rumah tinggal berbasis PLC / Benny Eko Puji Pramono

 

Kata Kunci: Rumah tinggal, otomatis, kendali PLC. Dewasa ini diketahui perlengkapan pada rumah tinggal pada umumnya masih banyak yang diaktifkan secara manual. Seperti untuk membuka dan menutup pintu gerbang dilakukan dengan mendorong pintu tersebut dengan tangan. Selain itu pengisian air pada tandon yang sering tumpah karena kelalaian pemilik rumah yang lupa tidak mematikan pompa air. Walaupun sudah ada otomatisasi tetapi sifatnya masih manual misalnya menggunakan pelampung saja. Kemudian untuk menyalakan dan memadamkan lampu pada penerangan luar ruangan juga sering lupa melaksanakan tepat waktu akibatnya penggunaan energi listrik tidak optimal. Perlengkapan pada rumah tinggal yang diaktifkan secara manual ini membutuhkan tenaga dan waktu yang sebenarnya dapat dihemat dengan sebuah peralatan elektronik yang otomatis yaitu dengan menggunakan PLC. PLC merupakan salah satu alat otomatis yang biasa digunakan sebagai alat pengendali. Untuk mengatasi masalah pada perlengkapan rumah tinggal seperti lampu penerangan luar ruangan, pompa air, dan pintu gerbang yang masih diaktifkan secara manual, salah satu solusinya adalah dengan sistem otomatisasi perlengkapan rumah tinggal berbasis PLC. Rumah dengan sistem otomatisasi perlengkapan rumah tinggal ini berguna untuk mengontrol penerangan luar ruangan secara otomatis sesuai tingkat kegelapan, level tandon air dan buka tutup pintu gerbang secara otomatis. Keseluruhan dari sistem otomatisasi perlengkapan rumah tinggal ini dikendalikan oleh PLC. Dalam sistem otomatisasi perlengkapan rumah tinggal berbasis PLC terdapat tiga sumber tegangan, yaitu 24 VDC untuk kontak input PLC dan input pada sensor photodioda, 12 VDC untuk input LDR dan 220 VAC untuk output dari relay. Jika PB 1 diaktifkan maka sistem RUN, jika PB 2 diaktifkan maka berfungsi untuk mematikan sistem RUN. Jika Sensor 1 / Sensor 2 aktif maka akan mengaktifkan output PUTAR 1. Selain itu juga jika Limit Switch 1 aktif akan mematikan output PUTAR 1. Jika Sensor 3 aktif akan mengaktifkan output PUTAR 2. Selain itu juga jika Limit Switch 2 aktif maka akan mematikan output PUTAR 2. Jika Sensor 4 aktif maka akan mengaktifkan dan mematikan LAMPU. Jika Limit Switch 3 aktif maka akan berfungsi untuk mengaktifkan POMPA

Pengaruh tingkat suku bunga BI (BI Rate), DER (Debt to Equity Ratio), ROA ( Return on assets), dan CR (Current ratio) terhadap bagi hasil pihak ketiga non Bank pada Bank Umum Syariah periode 2008-2010 / Sukardiono

 

Kata Kunci: BI Rate, Debt to Equity Ratio (DER), Return on Assets (ROA), dan Current Ratio (CR), bagi hasil pihak ketiga non bank. Perbankan syariah mengalami perkembangan yang semakin pesat, hal ini ditunjukkan dengan banyaknya bank konvensional yang mulai membuka unit usaha syariah. Hal ini menunjukkan bahwa sistem bagi hasil menjadi daya tarik bagi kreditor untuk menggunakan jasa perbankan syariah. Sistem bagi hasil merupakan sistem di mana dilakukan perjanjian dalam melakukan kegiatan usaha, dimana dalam usaha tersebut diperjanjikan adanya pembagian hasil atas pendapatan yang akan didapat antara pihak-pihak yang berkepentingan. Ada banyak faktor yang dapat digunakan untuk memprediksi bagi hasil, beberapa diantaranya adalah BI Rate, DER, ROA, dan CR. Permasalahan yang akan dikaji dalam penelitian ini adalah apakah terdapat pengaruh BI Rate, DER, ROA, dan CR terhadap bagi hasil pihak ketiga non bank pada bank umum syariah secara simultan maupun secara parsial. Populasi yang digunakan dalam penelitian ini adalah bank umum syariah yang ada di seluruh Indonesia yang berjumlah 10 pada tahun 2010, sedangkan teknik pengambilan sampel menggunakan purposive sampling. Dari metode tersebut diperoleh tiga bank umum syariah yaitu PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mandiri dan PT Bank Syariah Mega Indonesia. Jenis data yang digunakan adalah data sekunder yang diperoleh dari PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mandiri, dan PT Bank Syariah Mega Indonesia periode 2008-2010. Alat analisis yang digunakan adalah analisis regresi berganda. Hasil penelitian menunjukkan secara parsial BI Rate, DER, dan CR berpengaruh terhadap bagi hasil pihak ketiga non bank dengan tingkat signifikansi masing-masing sebesar 0,035, 0,000, dan 0,000, sedangkan ROA tidak berpengaruh terhadap bagi hasil pihak ketiga non bank dengan tingkat signifikansi sebesar 0,837. Secara simultan BI Rate, DER, ROA, dan CR berpengaruh terhadap bagi hasil pihak ketiga non bank dengan tingkat signifikansi sebesar 0,000. Saran yang dapat diberikan penulis dalam penelitian ini adalah: (1) perusahaan harus selalu menjaga kinerja keuangan yang terdiri dari DER, ROA, dan CR karena rasio tersebut digunakan oleh kreditor sebagai bahan pertimbangan dalam menanamkan modal, selain itu perusahaan harus memperhatikan faktor ekonomi lain seperti inflasi dalam mengambil keputusan, (2) untuk penelitian selanjutnya diharapkan dapat menambah periode observasi dan menambah sampel penelitian, serta menggunakan rasio keuangan lain dalam mengukur kinerja keuangan perbankan.

Pengembangan bahan ajar berorientasi pengajaran kuantum (Quantum teaching) pada materi alat-alat optik untuk sekolah menengah atas (SMA) kelas X / Farid Fatoni Setyawan

 

Kata Kunci : bahan ajar, quantum teaching, alat-alat optik. Proses pembelajaran fisika perlu dilakukan dengan cara yang menarik dan menyenangkan, mengingat pembelajaran fisika merupakan kegiatan yang mempelajari ilmu pengetahuan tentang gejala alam di sekitar kita. Keadaan menarik, santai, dan menyenangkan akan membantu siswa untuk menyerap materi pelajaran dengan baik. Quantum teaching merupakan model pembelajaran yang menekankan pada penciptaan suasana belajar yang efektif dan menyenangkan serta menekankan terciptanya interaksi antara siswa dengan lingkungan. Terciptanya suasana belajar yang menarik dan menyenangkan, dipengaruhi oleh persiapan perangkat pembelajaran yang baik, salah satunya adalah bahan ajar. Bahan ajar yang baik disusun dengan bahasa yang mudah dimengerti dan menarik sehingga dengan bahan ajar yang baik akan mempermudah siswa dalam memahami konsep-konsep fisika. Berdasarkan uraian tersebut maka dikembangkan bahan ajar berorientasi Quantum Teaching pada materi alat-alat optik. Penelitian ini bertujuan untuk mengembangkan bahan ajar berorientasi Quantum Teaching pada materi alat-alat optik untuk SMA kelas X agar mempermudah siswa dalam mempelajari konsep alat-alat optik. Penelitian ini juga bertujuan untuk mendeskripsikan kelayakan produk dan mengetahui karakteristik produk yang dihasilkan. Penelitian ini menggunakan rancangan penelitian & pengembangan dengan langkah-langkah meliputi tahap penelitian dan pengumpulan data, perencanaan, pengembangan produk awal, uji coba lapangan awal dan revisi produk akhir. Penelitian ini menggunakan teknik validasi isi yang dilakukan oleh validator yang berasal dari pihak dosen dan guru sebagai ahli serta dilakukan uji coba awal terhadap siswa. Pengumpulan data dilakukan dengan menggunakan angket yang disertai rubrik. Jenis data penelitian meliputi data kuantitatif berupa penilaian validator berdasarkan Skala Likert dan data kualitatif berdasarkan komentar dan saran dari validator. Produk akhir penelitian ini adalah bahan ajar berorientasi Quantum Teaching pada materi alat-alat optik. Berdasarkan hasil analisis data, produk akhir yang dihasilkan sudah memenuhi kriteria layak dan sudah direvisi pada beberapa bagian berdasarkan komentar dan saran dari validator. Produk akhir yang dihasilkan memiliki karakteristik yang berbeda dari bahan ajar yang lain, diantaranya: setiap awal materi diawali pembahasan yang memotivasi belajar siswa dan pertanyaan-pertanyaan sederhana, terdapat kata mutiara di setiap halaman, setiap pembahasan diperjelas dengan gambar, pembahasannya sederhana dan mudah dimengerti siswa, terdapat Web Link dan Mind Mapping serta desain isi lebih menarik dan full colour.

Pengembangan matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman 1 Kecamatan Tongas Kabupaten Probolinggo / Akhmad Hidayat

 

Kata Kunci: Pengembangan, Matras modifikasi, Pendidikan Jasmani, Senam Lantai Matras modifikasi merupakan salah satu alat bantu belajar yang dapat digunakan dalam pembelajaran pendidikan jasmani dan kesehatan khususnya pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo. Pembuatan matras modifikasi ini memanfaatkan potensi lingkungan alam khususnya daerah Probolinggo yang kaya akan kelapa, sehingga matras modifikasi ini berbahan dasar sabut kelapa. Matras ini dikembangkan sesuai dengan kebutuhan guru serta siswa pada matras yang selama ini sudah rusak. Matras modifikasi yang berbahan dasar sabut kelapa ini diolah, dikembangkan, serta diuji kelayakannya guna mendapatkan hasil yang optimal. Dengan adanya matras modifikasi ini diharapkan dapat membantu pembelajaran serta sebagai pengganti matras yang sudah tidak dapat digunakan lagi. Sesuai dengan latar belakang diatas penelitian dan pengembangan ini bertujuan untuk mengembangkan matras modifikasi sesuai dengan karakteristik siswa sekolah dasar yang memiliki fungsi sebagai pengganti matras matras standar pada senam lantai pada umumnya. Penelitian ini menggunakan metode penelitian dan pengembangan dari Borg and Gall (1983:775). Peneliti tidak menggunakan keseluruhan dari langkah-langkah Borg and Gall tetapi hanya menggunakan 7 langkah yang berpedoman pada Ardhana (2002:9). Adapun 7 langkah yang dipilih oleh peneliti untuk pengembangan matras modifikasi ini adalah sebagai berikut: 1) Riset dan pengumpulan informasi termasuk mengkaji pustaka dan observasi lapangan. 2) Perencanaan bentuk pengembangan matras modifikasi. 3) evaluasi para ahli dengan menggunakan 1 ahli senam lantai dan 1 ahli pembelajaran pendidikan jasmani. 4) Revisi rancangan produk berdasarkan evaluasi para ahli (hasil rancangan berupa produk awal). 5) Uji coba kelompok kecil yang diadakan di sekolah dengan 6-14 subyek dalam yang diteliti menggunakan kuesioner kemudian di analisa. 6) Uji coba lapangan diadakan di sekolah dengan 10-80 subyek yang diteliti. 7) Revisi produk dari hasil uji coba lapangan dengan menggunakan kelompok besar, yang menghasilkan produk berupa matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo. Hasil revisi produk dari tinjauan para ahli menyatakan bahwa produk yang dikembangkan sudah baik dan dapat digunakan untuk uji produk. Dari hasil analisis uji coba (kelompok kecil) diperoleh bahwa pengembangan matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo memenuhi kriteria baik yaitu antara 80-100%. Sedangkan dari hasil analisis uji lapangan (kelompok besar) di atas, maka diperoleh bahwa pengembangan matras modifikasi pada pembelajaran senam lantai di SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo tersebut telah memenuhi kriteria baik yaitu antara 80-100%. Berdasarkan hasil analisis data uji coba kelompok kecil terhadap 14 siswa dan uji kelompok besar yang berjumlah 72 siswa kelas IV dan V SD Negeri Bayeman I Kecamatan Tongas Kabupaten Probolinggo dinyatakan dapat digunakan. Produk pengembangan berupa matras modifikasi sebagai pengganti matras standar yang memiliki harga lebih ekonomis diharapkan dapat dijadikan alat bantu pembelajaran pendidikan jasmani khususnya pada materi senam lantai.

Pengaruh keaktifan berorganisasi terhadap prestasi akademik mahasiswa Jurusan Teknik Sipil Fakultas Teknik Universitas Negeri Malang / Erik Susanto

 

Kata Kunci: Keaktifan Berorganisasi, Prestasi Akademik Aktivitas berorganisasi merupakan kegiatan yang dilakukan mahasiswa diluar jam belajar dalam rangka mengembangkan minat dan bakat yang dimiliki oleh mahasiswa. Organisasi tersebut diperlukan oleh mahasiswa sebagai wadah untuk mengembangkan dan mengasah kemampuan yang dimiliki. Tidak dapat dipungkiri banyak pengaruh positif dan negatif dari keikutsertaan mahasiswa dalam organisasi kemahasiswaan. Pengaruh positif dari keikutsertaan mahasiswa kedalam organisasi adalah mahasiswa dapat mengaktualisasikan dirinya, mengembangkan kemandiriannya, dan mempunyai cara berpikir yang matang jika berada di tengah masyarakat, sedangkan pengaruh negatif yang mungkin timbul adalah mahasiswa lambat dalam menyelesaikan perkuliaahnya, bahkan mahasiswa yang terlalu idealis terhadap organisasinya rawan drop out (DO). Pandangan ini perlu dikaji lebih jauh karena tidak semua mahasiswa yang aktif dalam berorganisasi tidak dapat meraih prestasi akademik yang baik. Penelitian ini dilakukan untuk mengetahui perbedaan prestasi akademik antara mahasiswa yang sangat aktif, aktif, kurang aktif, dan tidak aktif berorganisasi, serta besar pengaruh keaktifan berorganisasi terhadap prestasi akademik. Populasi dalam penelitian ini adalah seluruh mahasiswa Jurusan Teknik Sipil FT-UM tahun 2008-2009, dan sampelnya adalah 30% dari populasi. Teknik pengumpulan data untuk variabel keaktifan berorganisasi menggunakan angket dan variabel prestasi akademik menggunakan teknik dokumentasi. Teknik analisis data menggunakan analisis varian satu jalan(one way anava). Hasil penelitian diketahui terdapat perbedaan prestasi akademik antara mahasiswa yang sangat aktif, aktif, kurang aktif, dan tidak aktif berorganisasi. Kelompok tidak aktif dengan kelompok sangat aktif berbeda secara signifikan dengan bilangan signifikansi sebesar 0,005 < 0,05. Kelompok sangat aktif mempunyai prestasi lebih tinggi (IPK rata-rata 3,03) dari kelompok tidak aktif (IPK rata-rata 2,75). Kelompok tidak aktif dengan kelompok kurang aktif berbeda secara signifikan, dengan bilangan signifikansi 0,026 0,05. Hasil dari pengujian untuk mencari besar pengaruh dari keaktifan berorganisasi terhadap prestasi akademik, didapatkan hasil nilai R square 0,119. Hal ini berarti 11,9% prestasi akademik dipengaruhioleh keaktifan berorganisasi, sedangkan 88,1% dipengaruhi oleh faktor-faktor lain. Kesimpulan dari penelitian ini adalah terdapat perbedaan prestasi akademik antara mahasiswa yang sangat aktif, aktif, kurang aktif, dan tidak aktif berorganisasi. Prestasi akademik mahasiswa yang sangat aktif berorganisasi lebih tinggi dari mahasiswa yang aktif, kurang aktif, dan tidak aktif berorganisasi. Sedangkan pengaruh dari keaktifan berorganisasi terhadap prestasi akademik relatif kecil (11,9%). Saran yang dapat diberikan adalah (1) bagi mahasiswa khususnya yang terlibat secara aktif di organisasi harus bisa mencermati pembagian waktu yang tersedia untuk kuliah dengan kegiatan organisasi guna meninggkatkan kualitas dan prestasi akademik, (2) bagi peneliti selanjutnya yang ingin melakukan penelitian yang sejenis, maka disarankan agar menggunakan subjek yang lebih luas agar didapatkan hasil yang lebih baik.

Implementasi keselamatan dan kesehatan kerja pada praktikum teknik sepeda motor program studi teknik otomotik di SMK Negeri 2 Negara / I Putu Gde Raka Putra

 

Kata kunci: Keselamatan dan Kesehatan Kerja (K3), Praktikum Keselamatan Kerja adalah keselamatan yang berhubungan dengan peralatan, tempat kerja, lingkungan kerja, serta cara-cara dalam melaksanakan pekerjaan. Keselamatan kerja tidak hanya melindungi karyawan yang sedang bekerja di tempat kerja tersebut, tetapi juga orang dari luar perusahaan yang sedang berada di dalam lingkungan tempat kerja untuk keperluan tertentu. Penelitian ini bertujuan untuk mendeskripsikan beberapa hal mengenai implementasi keselamatan dan kesehatan kerja (K3) pada praktikum teknik sepeda motor program studi teknik otomotif di SMK Negeri 2 Negara. Rancangan penelitian ini adalah deskriptif dengan pendekatan kuantitatif. Data dianalisis dari hasil observasi, kuesioner, dan wawancara menggunakan metode statistik deskriptif. Hasil penelitian menunjukan bahwa implementasi keselamatan dan kesehatan kerja (K3) pada praktikum teknik sepeda motor program studi teknik otomotif di SMK Negeri 2 Negara sebagai berikut: a) fasilitas K3 pada ruang praktikum teknik sepeda motor di SMK Negeri 2 Negara rata-rata baik yang mencakup tata tertib praktikum, penerangan dan pencahayaan, penyediaan alat-alat praktikum, tata letak engine stand dan peralatan kerja, dan ketersediaan bahan dan alat pembersih dan tempat sampah. b) pelaksanaan K3 pada praktikum teknik sepeda motor di SMK Negeri 2 Negara rata-rata baik yang mencakup beberapa hal seperti melakukan praktek dengan berdoa terlebih dahulu, senam pemanasan, dan meminta ijin dari guru, menggunakan pakaian praktik lengkap, mengoperasikan peralatan dengan benar dan aman, guru memberikan briefing pra-praktikum, perlakuan pengawasan guru terhadap semua praktikan, instruksi metode yang aman dan c) terdapat kendala implementasi K3 yang dihadapi sekolah, guru dan siswa yaitu; minimnya dana yang dianggarkan untuk pengadaaan dan perbaikan sarana praktikum dan K3, kondisi lingkungan kerja yang tidak aman, dan sebagian siswa tidak mematuhi peraturan pada saat praktik. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa implementasi keselamatan dan kesehatan kerja (K3) pada praktikum teknik sepeda motor program studi teknik otomotif di SMK Negeri 2 Negara tergolong kategori baik, terlihat dari implementasi K3 sudah mencakup sebagian besar aspek dari sub variabel yang meliputi fasilitas K3, pelaksanaan K3, namun masih terdapat kendala. Hal lain yang perlu mendapatkan perhatian khusus adalah aspek perlengkapan K3 pada ruang praktik. Pengawasan yang ketat juga perlu ditingkatkan oleh guru selama kegiatan praktikum, mengingat siswa masih butuh pengawasan dan bimbingan demi kelancaran proses belajar mengajar.

Pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa anak kelompok B di TK PGRI III Kebotohan Kecamatan Kraton / Endang Andayani

 

Kata Kunci : Media gambar, Kemampuan bahasa anak, TK. Taman kanak-kanak adalah salah satu bentuk pendidikan jalur formal yang menyediakan program pendidikan usia dini. Untuk mencapai tujuan pendidikan tidaklah mudah karena diperlukan sarana dan prasarana yang dapat mendukung tercapainya tujuan pendidikan. Keberhasilan pendidikan tidak terlepas dari peran serta guru dalam mengelola pengajaran sehingga siswa dapat belajar dengan tenang dan memungkinkan untuk mencapai prestasi dalam belajar. Kemampuan berbahasa Indonesia pada usia pra sekolah kurang untuk itu peneliti memanfaatkan media gambar untuk mengembangkan kemampuan berbahasa anak. Penelitian ini bertujuan mendeskripsikan pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa dan mendeskripsikan perkembangan kemampuan berbahasa dengan menggunakan media gambar. Rancangan dalam penelitian ini menggunakan penilitian tindakan kelas yang terdiri dari dua siklus, tiap siklus terdiri dari perencanaan, pelaksanaan, observasi dan refleksi. Instrumen pengumpulan data berupa observasi anak dan format, penilaian. Penilaian acuan yang digunakan adalah ketuntasan kelas ( 75 % ) subyek penelitian adalah anak kelompok B di TK PGRI III Kebotohan. Hasil penelitian menunujukkan bahwa pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa anak pada siklus I rata – rata anak mendapatkan nilai 73,95 % pada siklus II meningkat menjadi rata – rata anak mendapat nilai 88,54 %. Kesimpulan yang dapat diperoleh dari penelitian ini adalah : (1) Pemanfaatan media gambar untuk mengembangkan kemampuan berbahasa anak kelompok B di TK PGRI III kebotohan, (2) Pemanfaatan media gambar dapat mengembangkan kemampuan berbahasa anak kelompok B di TK PGRI III Kebotohan. Berdasarkan hasil penelitian ini dapat disarankan kepada guru agar dapat memanfaatkan media gambar untuk mengembangkan kemampuan berbahasa anak dengan mengembangkan pengembangan yang lain. Kegiatan pembelajaran yang akan digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian sebagai bahan perbandingan, sehingga dikemudian hari menjadi lebih baik.

Pengembangan permainan tradisional gedrik untuk pembelajaran fisik motorik anak kelompok B di TK Dharma Wanita 1 Kaibatur Kecamatan Kalidawir Kabupaten Tulungagung / Andriyani

 

Kata kunci: Pengembangan, Permainan, Gedrik, Fisik Motorik Gedrik merupakan permainan tradisional yang sering dilakukan oleh anakanak kampung yang terdiri dari komponen kekuatan, keseimbangan, dengan ukuran lapangan dan jumlah pemain yang beragam antara pelaku yang satu dan yang lain. Pemain akan melempar sebuah pecahan genting (jawa=kreweng) ke dalam kotakkotak tersebut dan pemain akan berjalan melewati kotak-kotak selain yang ada pecahan gentingnya (baik miliknya sendiri atau milik peserta lain) dengan menggunakan kaki satu, merupakan salah satu alternatif kegiatan fisik motorik kasar yang diharapkan dapat dilaksanakan oleh anak-anak kelompok B. Guru di TK Dharma Wanita 1 Kalibatur Kab. Tulungagung belum pernah menerapkan pembelajaran permainan tradisional Gedrik. Tujuan yang ingin dicapai adalah untuk mengembangkan permainan tradisional gedrik yang diharapkan dapat menyenangkan anak, dan mudah untuk dilakukan anak. Prosedur pengembangan permainan tradisional gedrik adalah: 1) Melakukan penelitian dan pengumpulan informasi, 2) Melakukan perencanaan, selanjutnya dievaluasi oleh para ahli, 3) Mengembangkan bentuk produk awal, 4) Melakukan uji coba kelompok kecil dengan 6 subyek, 5) Melakukan revisi terhadap produk awal, 6) Melakukan uji lapangan utama dengan 23 subyek, 7) Melakukan revisi produk. Intrumen yang digunakan adalah berisi tentang rancangan produk dan produk yang telah dibuat. Teknik analisis data yang digunakan adalah analisis kualitatif dan deskriptif berupa persentase. Hasil pengembangan ini berupa model pembelajaran permainan tradisional gedrik untuk pembelajaran fisik motorik pada anak kelompok B di TK Dharma Wanita 1 Kalibatur Kab. Tulungagung, yang mudah, dan menyenangkan anak. Diharapkan hasil pengembangan ini dapat diujicobakan kepada kelompok yang lebih luas dan dapat disosialisasikan kepada sekolah-sekolah dan lembaga pendidikan yang terkait sehingga dapat digunakan sebagaimana mestinya. Selain hal tersebut karena penelitian ini hanya terbatas pada pengembangan produk, diharapkan ada penelitian selanjutnya untuk menguji tingkat keefektifitas dari produk yang dikembangkan.

Isolasi sekuen internal transcribed spacer (ITS 1 -5.88-ITS 2) dari didymoplexis paliens griff. / Mo Awwanah

 

Kata kunci: Isolasi Sekuen, Internal Transcribed Spacer (ITS1-5.8S-ITS2), Didymoplexis pallens Griff. Didymoplexis merupakan salah satu anggrek di Pulau Jawa yang memiliki karakter morfologi serta pola hidup yang menarik untuk dipelajari. Didymoplexis banyak ditemukan di rumpun bambu. Didymoplexis yang ditemukan di Taman Nasional Alas Purwo, Jawa Timur, tumbuh di rumpun Gigantochloa hasskarliana (Kurz) Back dan Bambusa spinosa auct. non Hamilt. Hasil identifikasi secara morfologi terhadap Didymoplexis yang tumbuh di dua rumpun bambu yang berbeda menunjukkan bahwa keduanya tergolong dalam Didymoplexis pallens Griff. ITS adalah salah satu penanda genetik dari gen ribosomal 45S rDNA. Data sekuen ITS pada D. pallens Griff. belum dilaporkan. Penelitian ini dilakukan untuk mengetahui sekuen ITS1-5.8S-ITS2 D. pallens Griff. yang tumbuh di rumpun G. haskarliana (Kurz) Back dan B. spinosa auct. non Hamilt. Sekuen ITS1-5.8S-ITS2 diisolasi dengan metode amplifikasi Polymerase Chain Reaction (PCR) dilanjutkan dengan sekuensing. Sekuen yang diperoleh dianalisis secara deskriptif menggunakan program Peak Trace, BioEdit, BLAST dan Clustal X. Hasil isolasi dari sampel D. pallens Griff. yang tumbuh di rumpun G. hasskarliana (Kurz) Back fragmen DNA sepanjang 377 basa pada dan dari sampel D. pallens Griff di rumpun B. spinosa auct. non Hamilt sepanjang 339. Perbandingan sekuen dari kedua sampel menunjukkan perbedaan pada beberapa basa nukleotida penyusunnya. Hasil analisis dengan BLAST menunjukkan bahwa sekuen yang berhasil diisolasi memiliki kecocokan yang rendah dengan sekuen ITS1-5.8S-ITS2 dari data GeneBank. Kesimpulan dari penelitian ini menunjukkan bahwa sekuen ITS1-5.8S-ITS2 dari kedua sampel tidak diperoleh sehingga penelitian ulang perlu dilakukan untuk mengisolasi sekuen ITS1-5.8S-ITS2 D. pallens Griff. secara utuh dengan rancangan primer dan siklus PCR yang lebih tepat.

Perancangan aplikasi untuk try out Sekolah Menengah Pertama berbasis PHP dan MYSQL / Adistra Candra Pamungkas

 

Kata kunci: aplikasi, try out, Mysql, PHP. Pada saat ini kemajuan teknologi semakin berkembang pesat. Persaingan teknologi antara negara berkembang maupun negara maju semakin ketat. Sebagai negara berkembang supaya tidak ketinggalan kemajuan teknologi harus memiliki sumber daya manusia yang berkualitas dan berdaya saing global. Untuk mewujudkan itu semua diperlukan pendidikan yang berkualitas dan bermutu tinggi agar dapat menghasilkan sumber daya manusia yang berkualitas dan berdaya saing global. Untuk dapat mewujudkan pendidikan yang berkualitas dan bermutu tinggi ada banyak jalan yang bisa ditempuh diantaranya dengan melalui aplikasi try out yang dapat digunakan oleh siswa untuk melakukan latihan soal-soal mata pelajaran dengan adaya aplikasi try out ini. Tujuan pembuatan Tugas Akhir ini untuk peningkatan mutu pendidikan sehingga dapat digunakan pelajar untuk latihan mengerjakan soal-soal UAN sehinga siswa lebih terbiasa pada saat melaksanakan UAN sehingga dapat mengerjakan secara maksimal. Diharapakan aplikasi ini dapat meningkatkan mutu pendidikan sehingga dapat menghasilkan sumber daya manusia yang berkualitas dan memiliki daya saing global. Metode perancangan meliputi: (1)Spesifikasi produk yang dijelaskan dalam entitas dan atribut sistem. (2)Menggambarkan arus data dalam DFD (Data Flow Diagram ). (3)Menggambarkan struktur data dan hubungan antar entitas sebagai pembentuk sistem dalam ERD (Entity Relationship Diagram). (4)Mendeskripsikan hubungan antara entitas dengan relationship antar tabel. (5)Menggambarkan desain antar muka aplikasi. (6)Prosedur pengujian aplikasi Hasil yang didapat dari pembuatan aplikasi try out SMP berbasis PHP dan MySQL adalah aplikasi untuk try out latihan soal mata pelajaran Matematika, Bahasa Indonesia, Bahasa Inggris, IPA. Kesimpulan dari pembuatan tugas akhir ini adalah (1) dalam perancangan aplikasi try out SMP berbasis PHP dan MySQl adalah (a) menentukan sistem kerja alat yang akan dibuat, (b) menentukan desain utama, dan, (c) menentukan hasil yang diinginkan. (2) Dalam pembuatan aplikasi try out SMP berbasis PHP dan MySQl agar dapat bekerja sesuai dengan yang diharapkan adalah (a) menentukan alat yang akan dipakai (software dan hardware), (b) melakukan pemrograman dengan PHP, (3) Pengujian aplikasi try out SMP berbasis PHP dan MySQl dilakukan dengan login sebagai siswa di dua komputer dengan username dan password yang berbeda dan melakukan proses try out apakah hasilnya sama dengan yang diharapkan apa belum.

The Effectiveness of using authentic texts in the teaching of reading comprehension / Jauharotus Sholichatin

 

Key words: authentic text, inauthentic text (artificial text), reading comprehension, effectiveness This study was conducted to investigate whether the use of authentic texts in the teaching of reading comprehension is effective. The problem of the study is "Are the reading comprehension scores of students who are taught using authentic text significantly higher than those who are taught using inauthentic text?. As a tentative answer to the problem stated above, the hypothesis for this study is stated as follows: "The reading comprehension score of students who are taught using authentic texts is significantly higher than those who are taught using inauthentic texts." The design of the study was quasi-experimental with non-randomized pretest-posttest control group. The samples of this study were taken from the population of the eight graders of SMP N 1 Playen Gunungkidul Yogyakarta in the 2010/2011 academic year. The populations were 190 students; distributed in six classes; class VIIIA - VIIIF. In the present study, the sampling technique applied was simple random sampling which was taken by using lottery. The lottery was done toward the sixth groups of the populations. Hence, each of the groups basically had the same possibility to be the sample of the research. The result of the lottery showed that class VIII D was chosen as the experimental group and class VIII F as the control group. In collecting data, the instrument used was in the form of multiple choice test which covered the subject matter of reading comprehension. Pretest was administered to both groups at the same day before the treatment. The same test used in the pretest was also used as post test which was administered after the treatment to both groups at the same day. The experimental group was, then, taught reading comprehension by using authentic texts in the treatment. Meanwhile, the control group was taught reading comprehension by using inauthentic texts in the treatment. The pretest means of both groups were analyzed statistically by using Lavene's. Lavene's Test revealed the significant value is .553 that is higher than .05. This result indicates that the difference between variances is not significant. This indicates that the subjects of experimental and control groups are not significantly different before the experiment in their pretest scores of reading comprehension test. Therefore, an independent t-test was used to analyze the posttest means. On the statistical computation for posttest by using independent t-test revealed that t-value for df 62 is 4.17. It is bigger than t-critical value (1.671) at the level of significance of 0.05 for a one tailed test (t-value: 4.17 > t-critical value: 1.671). This indicates that there is a significant difference of means scores between students who are taught using authentic texts and those who are taught using inauthentic texts in teaching reading comprehension. The gain of reading comprehension means scores of experimental group is significantly higher than the gain of reading comprehension means scores of control group. Therefore, Ho was rejected and the hypothesis works. Based on the result of research findings, it can be concluded that using authentic texts in teaching reading comprehension proved to be effective in increasing the students' reading comprehension achievement. Thus, it is suggested that English teachers/instructors to utilize authentic texts in teaching reading comprehension. Besides, for future researchers, it is suggested to conduct research on authentic texts in higher level. Since for those of higher level students are having much more linguistic knowledge and having much wider world knowledge than students of Junior High, suitable and challenging authentic materials with miscellaneous topics is much easier to find. Moreover using authentic materials in ‘authentic' presentation becomes possible. "Authentic" presentation means we do not present the materials (articles/texts) in copies, instead we present it as the way it is. For example when we are going to use articles from newspaper, we should bring the newspaper consist of the articles in class not in copies. This enable for future researcher to give authentic materials taken from magazines or newspaper (printed/not on-line) to the students as the way they are. Using "authentic" presentation helps put the text into a context.

Pengaruh efikasi diri terhadap stres menjelang sertifikasi pada guru SD di Kecamatan Bantur / Putri Azizah Kholidatun Nikmah

 

Kata kunci : efikasi diri, stres guru sertifikasi Dalam proses sertifikasi, para peserta akan mengalami kejadian-kejadian yang mungkin saja tidak terduga sebelumnya. Kejadian-kejadian tidak terduga ini akan menghambat jika para peserta tidak memiliki efikasi diri. Hal ini dapat menimbulkan stres bagi sebagian guru. Stres bagi guru dapat disebabkan oleh faktor eksternal maupun internal. Salah satu faktor internal stres yang akan diteliti adalah efikasi diri. Penelitian ini bertujuan untuk mengetahui seberapa besar pengaruh efikasi diri terhadap stres guru SD saat mengikuti sertifikasi. Subjek penelitian sebanyak 44 guru, diambil dengan teknik purposive sampling dari guru SD di Kecamatan Bantur pada tahun 2011. Instrumen penelitian yang digunakan adalah skala efikasi diri dan skala DSI. Reliabilitas skala efikasi diri sebesar 0.924. Data hasil penelitian di analisis dengan teknik regresi linier sederhana. Hasil penelitian besarnya pengaruh atau koefisien determinasi efikasi diri terhadap stres guru menjelang sertifikasi dengan menggunakan model regresi linier sederhana adalah R2 = 0,361. Berarti bahwa ada pengaruh efikasi diri terhadap stres saat mengikuti sertifikasi pada guru SD di Kecamatan Bantur sebesar 36,1%, sedangkan 63,9% yang lainnya dipengaruhi oleh variabel-variabel atau faktor-faktor lain yang mempengaruhi stres. Disarankan kepada: (1) guru yang sedang mengikuti sertifikasi memiliki efikasi diri yang tinggi, hal itu akan mempengaruhi tingkat stres guru tersebut. Meningkatkan efikasi diri dengan cara percaya dan yakin pada kemampuan diri, menumbuhkan motivasi diri, mencari dukungan emosional dari orang-orang di sekitar (2) bagi peneliti selanjutnya disarankan meneliti variabel-variabel lain yang diduga mempengaruhi stres, mengingat stres saat mengikuti sertifikasi tidak hanya dipengaruhi oleh efikasi diri saja. Dan mencari subjek dari daerah lain, dengan subjek yang lebih banyak.

Pelaksanaan strategi promosi pada PT. Astra Internasional TBK Auto 2000 malang Sutoyo / Rizky Primadhani

 

Kata kunci : Strategi Promosi. Memasuki era globalisasi yang semakin kompleks dan kompetitif menyebabkan terjadinya perkembangan yang luar biasa dalam bidang bisnis, dimana semua kegiatan-kegiatan yang berhubungan dengan bisnis semakin modern dan maju. Perusahaan baru bermunculan untuk menambah persaingan dengan perusahaan-perusahaan yang telah berdiri sebelumnya. Kondisi persaingan itulah yang menyebabkan perusahaan harus dapat berpikir cerdas dan kreatif agar selalu dapat menciptakan keunggulan kompetitif dari pesaing-pesaingnya, maka dari itu diperlukan strategi promosi yang baik guna memperkenalkan produk perusahaan agar produk tersebut menjadi produk pilihan konsumen. PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo adalah perusahaan yang bergerak di bidang penjualan mobil, penjualan suku cadang asli Toyota, dan servis kendaraan Toyota. Auto 2000 telah memenuhi 3S, yaitu : Sales, Service, Spare part sehingga merupakan jaringan jasa penjualan, perawatan, perbaikan dan penyediaan suku cadang asli Toyota yang manajemennya ditangani penuh PT. Astra Internasional Tbk. Dalam aktifitas bisnisnya, Auto 2000 bergabung dengan PT. Toyota Astra Motor yang menjadi agen tunggal pemegang merek Toyota. Penulisan Tugas Akhir ini bertujuan untuk (1) mengetahui strategi promosi yang telah diterapkan pada PT. Astra Internasional Tbk - Auto 2000 Malang Sutoyo, (2) mengetahui jenis promosi yang paling efektif diterapkan pada PT. Astra Internasional Tbk - Auto 2000 Malang Sutoyo, (3) mengetahui faktor pendukung dan penghambat dalam pelaksanaan strategi promosi pada PT. Astra Internasional Tbk - Auto 2000 Malang Sutoyo. Jenis promosi yang digunakan oleh PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo dalam mempromosikan produk Toyota adalah (1) Periklanan, dengan menggunakan media: televisi, spanduk dan umbul-umbul, koran, brosur, kaos dan seragam, dan simbol atau logo. (2) Promosi Penjualan, dengan cara promosi konsumen dan promosi tenaga penjual. Promosi konsumen dilakukan dengan cara pemberian kupon, promosi harga, demonstrasi, persaingan, pengembalian uang ganti rugi. Sedangkan promosi tenaga penjual dilakukan dengan cara pemberian bonus, kontes tenaga penjual, dan pertemuan penjual. (3) Pejualan perseorangan, dilakukan dengan cara seminar dan customer gathering, FGD (Focus Group Discussion). (4) Hubungan Masyarakat, dilakukan dengan cara mengadakan pameran (exhibition), showroom event, dan pemberian souvenir. Dari jenis promosi yang digunakan PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo terdapat strategi promosi yang paling efektif dalam mempromosikan produk Toyota yaitu promosi penjualan dan hubungan masyarakat. Faktor pendukung dalam pelaksanaan strategi promosi pada PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo diantaranya (1) Nama PT. Astra Internasional Tbk yang sudah dikenal sehingga Auto 2000 merupakan salah satu perusahaan otomotif yang telah dipercaya oleh masyarakat. (2) Adanya biaya yang disediakan oleh Auto 2000 Malang Sutoyo sehingga berbagai program promosi bisa dilaksanakan. (3) Sarana media komunikasi yang medukung pelaksanaan kegiatan promosi sehingga promosi dapat dilakukan secara gencar dan rutin. (4) Terciptanya kerjasama yang harmonis antara pimpinan, staf dan karyawan Auto 2000 Malang Sutoyo sehingga karyawan maupun pimpinan merasa nyaman dalam bekerja. Sedangkan faktor penghambat dalam pelaksanaan strategi promosi pada PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo diantaranya (1) Pelanggan kurang merespon dengan baik kegiatan promosi yang dilakukan oleh Auto 2000 Malang Sutoyo karena waktu pelaksanaan promosi kurang tepat. (2) Saat ini di wilayah Malang bermunculan perusahaan-perusahan otomotif seperti Honda, Daihatsu, dan Isuzu sehingga Auto 2000 Malang Sutoyo harus lebih gencar dalam mempromosikan produk Toyotanya. (3) Biaya promosi yang besar sehingga promosi tidak dapat dilakukan secara terus-menerus. (4) Penyebaran brosur yang tidak merata di setiap wilayah di Malang sehingga konsumen yang ingin mengetahui informasi tentang produk Toyota dari brosur tidak tersampaikan. (5) Kurang luasnya area yang digunakan untuk test drive sehingga test drive hanya bisa dilakukan pada tempat-tempat tertentu. Berdasarkan Praktik Kerja Lapangan (PKL) yang dilakukan penulis, maka saran yang ingin disampaikan penulis kepada PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo, adalah (1) Hendaknya PT. Astra Internasional Tbk – Auto 2000 Malang Sutoyo terus berupaya untuk meningkatkan strategi promosinya dengan lebih memperbanyak mengadakan kegiatan promosi yang berhubungan langsung dengan masyarakat, dimana dalam acara tersebut terdapat permainan dan pembagian souvenir, hadiah atau door prise. (2) Waktu pelaksanaan promosi dilakukan dengan baik dan direncanakan dengan matang. Hendaknya Auto 2000 Malang Sutoyo mengadakan survei untuk mengetahui kondisi pasar, hal ini dikarenakan agar dapat menarik lebih banyak pelanggan. Selain itu Auto 2000 Malang Sutoyo harus terus mengikuti perkembangan mengenai produk dan harus jeli melihat peluang pasar yang ada sehingga mampu memenuhi kebutuhan pasar sebaik-baiknya. (3) Hendaknya Auto 2000 Malang Sutoyo memberikan pelatihan secara berkelanjutan kepada karyawan khususnya kepada tenaga penjual atau sales. Pelatihan ini bisa bertujuan untuk menambah pengetahuan tentang produk yang akan dipasarkan, bagaimana cara berkomunikasi yang tepat dengan pelanggan karena karakter setiap pelanggan berbeda-beda. (4) Penyebaran brosur sebaiknya dibagikan secara merata khususnya pada wilayah kota Malang. (5) Hendaknya area diperluas sehingga test drive dapat dilakukan di Auto 2000 Malang Sutoyo.

Using picture series to improve the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text / Syamsia

 

Thesis. English Language Education, Graduate Program of State University of Malang. Advisors: (1) Prof. Ali Saukah, M.A,Ph.D. (2) Dr. Suharmanto, M.Pd Keywords: Writing Ability, Recount Text, Picture Series Based on the preliminary study, the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text was still unsatisfactory. The students were unable to express their ideas in a good paragraph. They made a number of mistakes in their writing in terms of content, organization, vocabulary, grammar, and mechanic. To overcome this problem, to proposed one of the appropriate strategies in the teaching of English writing recount text using picture series. This research, which aimed at improving the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text using picture series. the research problem is how can picture series be used to improve the ability of the eight grade students of SLTP Negeri 3 Ternate in writing recount text the research design was a collaborative Classroom Action Research (CAR) that was a process in which researcher herself conducts the teaching to improve the students’ learning and to recover the students’ problems or difficulties in the process of writing instruction. The researcher and the collaborator worked together through the cyclic process which consists of four steps, namely planning, implementing, observing, and reflecting. Based on the result of students’ final writing, it was found that the students have a significant improvement. It means that the use of picture series strategy has positive impact in teaching and learning English. The students’ ability in generating ideas, organizing ideas, choosing words, using grammar and mechanic developed better than before the strategy implemented. Additionally, the improvement also can be seen in the gain of 10 points from the preliminary score. In the preliminary study, Most of the students got the score below 5.5 that is minimum criteria/Kriteria Ketuntasan Minimal (KKM). Only 16% (6 of 31) students who pass. In the cycle I, there were 15 students or 49 % of the students reached the criteria of success and the rest (16 students) or about 51 % of the students got under 6.0. Meanwhile, in the cycle II, there were 29 students or 95% students had reached the score greater than 6.0, and 2 students or 5% students got under 6.0. After the picture series strategy is implemented in two cycles, the researcher concludes that a suitable model of the strategy using picture series in teaching writing to the students prove to be very affective to attract the students to get involved in the teaching and learning activity.

Rancang bangun pendeteksi tiket dan pengontrolan kapasitas stadion sepak bola / Heru Prasetyo

 

Kata Kunci : pendeteksi tiket, pengontrolan kapasitas stadion, barcode Olahraga sepak bola merupakan salah satu olahraga yang sangat di gemari dan di minati oleh seluruh rakyat Indonesia. Hal ini dibuktikan dengan semakin banyaknya antusias penonton sepak bola yang datang langsung ke stadion untuk menyaksikan para idola mereka serta memberikan dukungan kepada club ataupun tim kesayangan mereka. Antusias penonton yang besar ini terkadang tidak mendapatakan pelayanan yang baik oleh para penyelenggara pertandingan, sehingga penonton yang datang ke stadion tidak mendapatkan kenyamanan ketika menyaksikan pertandingan sepakbola tersebut. Beberapa kasus yang terjadi di Indonesia antara lain kapasitas stadion yang tidak sesuai dengan jumlah penonton yang hadir. Jumlah penonton biasanya 2x lipat lebih banyak dari jumlah atau batas maksimal yang sudah ditentukan. Satu hal lagi yang tidak kalah meresahkannya adalah adanya tiket palsu yang di jual oleh para calo. Pada alat ini dirancang suatu alat pendeteksi tiket dan pengontrolan kapasitas stadion sepak bola. Alat ini bekerja pada saat penonton akan masuk dengan menggunakan tiket resmi yang memiliki nomor seri. Nomor seri pada tiket resmi difungsikan ketika penonton melewati alat pendeteksi tiket. Tiket yang terdeteksi akan membuka pintu masuk secara otomatis dan setelah penonton melewati pintu tersebut, pintu akan menutup kembali secara otomatis pula. Selain itu, pada alat tersebut juga dilengkapi dengan sensor yang akan menghitung jumlah penonton yang memasuki stadion, sehingga pada saat kapasitas stadion sudah terpenuhi maka pintu masuk tidak akan bisa membuka lagi. Alat ini dapat mencegah penonton yang memaksa masuk ke stadion dengan menggunakan tiket palsu. Pengontrolan kapasitas penonton yang masuk ke stadion pun menjadi lebih baik dan terkendali sehingga penonton tidak perlu berdesak-desakan lagi dan merasa lebih nyaman dalam menyaksikan pertandingan sepak bola. Disarankan sebelum merancangan alat ini hendaknya memeriksa lagi seluruh komponen yang akan digunakan sebelum dirakit, sehingga pada saat alat dioperasikan tidak akan terjadi trouble dalam prosesnya. Dalam pengembangan selanjutnya perangkat keras yang dibuat perlu adanya penambahan tampilan indikator digital.

Penerapan strategi pelayanan untuk meningkatkan kepuasan pelanggan pada Auto 2000 malang Sutoyo / Susanti

 

Kata kunci : strategi pelayanan, kepuasan Pelanggannya. Proses pelayanan yang baik didalam suatu perusahaan akan menciptakan kepuasan bagi pelanggan karena pelanggan merasa puas terhadap produk dan jasa yang telah di terima. Pada dasarnya kepuasan pelanggan mencakup perbedaan antara tingkat kepentingan dengan kinerja atau hasil ynag dirasakan. Hal ini dapat dilihat pada Dealer Auto 2000 Malang Sutoyo yang melaksanakan berbagai strategi pelayanan untuk mendapatkan kepuasan dari pelanggannya. Subyek yang dipergunakan sebagai sumber data laporan adalah Auto 2000 Malang Sutoyo. Tujuan laporan yang saya lakukan pada Auto 2000 Malang Sutoyo yaitu ” (1)Bagaimana strategi pelayanan pada Dealer Auto 2000 Malang Sutoyo, (2)Bagaimanakah bentuk pelayanan yang diberikan oleh Dealer Auto 2000 Malang Sutoyo, (3)Apakah yang menjadi faktor pendukung dan penghambat pada Dealer Auto 2000 Malang Sutoyo Auto 2000 Malang Sutoyo bertujuan untuk memberikan pelayanan dan meningkatkan kepuasan pelanggan. Dalam hal ini strategi pelayanan yang dilakukan pada Auto 2000 Malang Sutoyo (1) Strategi Relationship Marketing (hubungan masyarakat), (2)Strategi Superior Customer Service (pelayanan konsumen yang unggul), (3)Strategi Unconditional Guarantees (jaminan jasa), (4)Startegi penanagan keluhan yang efektif, (5)Strategi peningkatan kinerja perusahaan Strategi pelayanan yang bertujuan untuk memuaskan pelanggan sangatlah penting untuk diterapkan dalam suatu perusahaan dengan tujuan utama perusahaan itu sendiri yaitu mempertahankan suatu usaha. Ada beberapa bentuk strategi pelayanan yang bertujuan untuk meningkatkan kepuasan pelanggan pada Auto 2000 Malang Sutoyo (1) Toyota Home Service, (2) Booking Service, (3) Layanan One Stop Service, (4) Kontak Service, (5) Gratis jasa servis sampai dengan tiga tahun Faktor-faktor yang mempengaruhi pelayanan Auto 2000 Malang Sutoyo terbagi menjadi 2 bagian yang sangat berpengaruh guna kelangsungan usaha Dealer Auto 2000 Malang Sutoyo kedepannya nanti yang digunakan sebagai acuan dan pedoman. Bagian tersebut yaitu faktor pendukung yang dimiliki dan faktor penghambat yang harus dihadapi Auto 2000 Malang Sutoyo. Adapun beberapa keunggulan pelayanan yang dimiliki oleh Dealer Auto 2000 Malang Sutoyo adalah sebagai berikut : (1) Manajemen Auto 2000 ditangani penuh oleh PT. Astra Internasional Tbk, (2) Auto melayani pelanggan secara profesional, (3)Auto memberikan kemudahan bagi pelanggan sebelum dan setelah melakukan servis, (4) Auto 2000 memiliki karyawan yang handal dan memiliki sertifikat Toyota Internasional, (5) Tersedianya toilet, (6) Auto 2000 berada berada di lokasi jalan raya yang sangat strategis, (7)Gratis layanan cuci mobil selesai servis, (8) Tersedianya fasilitas yang memadai. Walaupun memiliki kekuatan dalam pelayanan yang tidak diragukan lagi oleh para konsumen, penerapan strategi pelayanan pelanggan pada Auto 2000 Malang Sutoyo tentunya memiliki beberapa kelemahan yang perlu diatasi dengan segera. Beberapa kelemahan itu antara lain : (1) Masih kurangnya pemahaman karyawan tentang konsep dan prinsip-prinsip pelayanan, (2) Sistem komputerisasi pembayaran di kasir yang pengoperasiannya kurang cepat , (3) Penempatan posisi kerja yang tidak sesuai dengan keahlian mengakibatkan kinerja karyawan tidak sesuai Berdasarkan hasil laporan yang penulis lakukan ini dapat dijadikan bahan pertimbangan oleh seluruh karyawan Auto 2000 Malang Sutoyo dalam penerapan strategi pelayanan pada periode selanjutnya agar mendapatkan hasil yang optimal dari penerapan strategi pelayanan tersebut.

Perilaku komunikasi interpersonal pada kaskuser dengan kecenderungan internet addiction disorder / Aldila Putri Karindra

 

Kata Kunci: Komunikasi Interpersonal, Kecenderungan Internet Addiction Disorder, Kaskuser Perilaku komunikasi interpersonal merupakan semua tindakan atau aktivitas manusia yang secara khusus mengacu pada kegiatan untuk mengungkapkan perasaan, kebutuhan, dan pikiran antara pemberi dan penerima pesan dan mendapatkan timbal balik secara langsung. Internet addiction disorder merupakan tingkat penggunaan Internet secara patologis dan kompulsif, yang muncul pada orang yang merasa bahwa dunia maya (virtual reality) pada layar komputernya lebih menarik daripada dunia nyata kehidupannya sehari-hari yang dilihat berdasarkan kriteria diagnostik. Penelitian ini dilaksanakan dengan tujuan untuk mengungkap perilaku komunikasi interpersonal pada kaskuser dengan kecenderungan Internet addiction disorder, dengan menggunakan metode kualitatif yang dikembangkan dengan model deskriptif-interpretif yang bertujuan untuk memberikan gambaran mengenai suatu fenomena dan menemukan makna serta memberikan interpretasi dan dengan menggunakan teknik analisis isi. Subjek penelitian dalam penelitian ini sebanyak 3 orang kaskuser dengan kecenderungan Internet addiction disorder. Penelitian ini dilakukan dengan wawancara dan observasi. Teknik validasi yang digunakan adalah triangulasi sumber data. Hasil penelitian ini adalah 1) adanya keengganan (unwillingness) untuk ikut terlibat dalam komunikasi langsung (face to face) karena merasa cemas yang disebabkan oleh adanya penilaian serta identifikasi fisik. Sehingga mereka lebih memilih untuk berkomunikasi secara online (mediated interpersonal communication), 2) perilaku anonimitas dalam konteks komunikasi interpersonal bermedia tidak hanya bertujuan menyembunyikan identititas, namun secara tidak langsung merupakan semacam aturan yang tidak tertulis dan ahirnya telah menjadi budaya bagi penggunanya, namun yang lebih pada kondisi dimana seorang individu dapat mengkomunikasikan idenya tanpa harus dilihat dan juga melihat perubahan atau lebih tepatnya reaksi verbal maupun reaksi non verbal, 3) komunikator dapat lebih membuka dirinya, menceritakan sesuatu yang bersifat pribadi atau bahkan mengandung resiko ketika berkomunikasi secara online karena lebih merasa nyaman dan aman sehingga komunikasi dapat berjalan dengan lebih akrab dan terbuka, 4) bahasa gaul kaskus hanya mereka gunakan saat berkomunikasi secara online saja atau ketika menyapa seorang kaskuser dan bahasa gaul kaskus lebih berfungsi sebagai sarana memelihara identitas dan solidaritas kelompok kaskus. Berdasarkan hasil penelitian maka disarankan bagi: 1) kaskuser, untuk mengurangi aktivitasnya dalam mengakses Internet dan lebih menyibukkan diri dalam kegiatan nyata, dapat terhindar dari dampak negatif penggunaan Internet secara patologis. Serta dapat berkomunikasi sebagaimana mestinya dan dengan baik, 2) anggota keluarga atau kerabat, dapat lebih berperan aktif memberikan kontrol terhadap penggunaan Internet, mengajak berkomunikasi secara langsung, memberikan perhatian dan menanamkan rasa percaya diri serta menghindari suatu evaluasi dan identifikasi fisik atas diri kaskuser. 3) peneliti selanjutnya, dapat menggunakan metode lain, misalnya dengan metode eksperimen yakni dengan membuat suatu desain pelatihan komunikasi. Peneliti juga perlu memperbanyak jumlah subyek penelitian agar memperoleh data data yang lebih bervariasi untuk menambah informasi yang dibutuhkan dalam penelitian tersebut.

Improving students' understanding to solve math story problems writen in english thourgh aktivation, exposure, repetition, and producyion (AERP) strategy at public junior high school 8 Malang / Frida Unsiah

 

Graduate Program in English Language Education, State University of Malang. Advisors: (1) Prof. Drs. Bambang Yudi Cahyono, M.Pd, M.A., Ph.D., (2) Dr. Gunadi Harry Sulistyo, M.A. Key Words: Math story problems, AERP Strategy This study was conducted on the basis of the problems faced by the bilingual students of grade seven at Public Junior High School 8 Malang dealing with solving Math story problems written in English. The basic problems were mostly on students’ lack of English vocabularies on technical Math words, phrases, sentences and expressions; and students’ lack of learning experiences in a bilingual program which made it difficult for them to solve Math story problems written in English. In overcoming the problems, a strategy for teaching Mathematics written in English called AERP strategy comprising four stages: Activation, Exposure, Repetition, and Production was implemented. Therefore, the problem of the study was formulated as follows: “How can students’ understanding to solve Math story problems written in English be improved through the AERP Strategy at SMPN 8 Malang?” This study was collaborative action research which was intended to implement AERP strategy to improve the students’understanding to solve Math story problems written in English. The AERP strategy was chosen as the strategy since through the AERP strategy, students’ understanding can be improved significantly because they are provided with schemata activation that will help them to construct their understanding in the present topic. They also get so much exposure on English language focusing on mathematical words and expressions; and the basic concept of a particular topic followed by drilling their pronunciation repeatedly on English words in order to let them produce correct pronunciation. At last, they are equipped with tasks on Math story problems which require them to produce Math problem solving both in oral and written forms. The subjects of the study were 32 bilingual students of grade 7 at Public Junior High School 8 Malang in the 1st semester. Two cycles were conducted in this study applying the procedures of the classroom action research: planning, implementing, observing, and reflecting. The first cycle of this study encompassed three meetings and the second one required four meetings. The data of the study were collected through observation checklists, field notes, Math story problem tests (written and oral forms), and questionnaire. The findings of the study revealed that the implementation of the AERP strategy was successful to meet the objective of the study after the revision and the modification were made to conduct Cycle 2. The stages of the AERP strategy in Cycle 1 were Activation, Exposure and Repetition in meeting 1, Production in written form in meeting 2, and Production in oral form in meeting 3. It was different from the one in Cycle 2. In Cycle 2, Exposure and Repetition were done twice in meeting 1 and meeting 2. Some good points in the implementation of the AERP strategy in Cycle 2 could be noticed from the students’ active participation in joining the activities in every stage of the strategy and achievement in doing the Math story problems either in written or oral form. It was due to the fact that they got much more time in getting exposure on the language and content; and they had experienced in the learning process that they had not gained before. As a result, these learning activities were very helpful for the students to improve their understanding to solve Math story problems written in English. It was shown by their score improvements that in Cycle 1, the average score of the students was 71 that was still below the minimum passing grade and it increased to be 78 in Cycle 2 that passed the minimum passing grade. Furthermore, this is supported by the results of the questionnaire showing that most of the students agreed that learning Mathematics written in English as well as learning English simultaneously, introducing English Mathematical terms and basic concept of the materials by providing examples or illustration as activation, modeling and drilling pronunciation on English words make them able to solve Math story problems written in English better. They also agreed that after having learned Math through the AERP strategy, their understanding to solve Math story problems written in English improved. Referring to the findings above, the following suggestions are proposed. First, Math teachers are suggested to apply the AERP strategy collaboratively with English teachers by following the stages: Activation, Exposure, Repetition, and Production since these stages have successfully worked in this study. Second, considering the limitation in the current study and that the AERP strategy can be employed not only in Math written in English but also in other content subjects such as Science written in English, the future researchers are suggested to conduct research on the other content subjects with some modifications or developments. It is because the AERP strategy has been proven to be useful to improve the quality of the teaching and learning process focusing on content subjects written in English.

Keefektifan reinforcement dalam menurunkan kebiasaan mebolos siswa kelas X SMK Negeri 1 Probolinggo / Kiki Amalia

 

Kata kunci: Reinforcement, kebiasaan membolos Perilaku membolos sebenarnya bukan merupakan hal yang baru lagi bagi banyak pelajar, setidaknya bagi mereka yang pernah mengenyam pendidikan. Membolos merupakan tingkah laku pergi meninggalkan sekolah tanpa alasan yang tepat pada jam pelajaran dan tanpa ijin terlebih dahulu pada pihak sekolah yang dilakukan secara berulang-ulang. Tingkah laku membolos yang dilakukan para siswa di sekolah dapat dipahami sebagai tingkah laku penghindaran, di mana siswa menyelesaikan masalahnya melalui jalan pintas yang menurut mereka sebagai solusi terbaik atas masalah yang mereka alami. Salah satu teknik bimbingan yang dapat dilakukan sebagai upaya untuk menurunkan frekuensi membolos siswa SMK yaitu melalui penggunaan reinforcement. Penelitian ini bertujuan untuk mengetahui keefektifan reinforcement dalam menurunkan kebiasaan membolos siswa kelas X SMK Negeri 1 Probolinggo. Jenis penelitian yang digunakan dalam penelitian ini adalah eksperimen semu, dengan desain eksperimen kasus tunggal (Singgle Case Experimental Desain / SCED) jenis A-B-A'dimana alat ukur yang digunakan sebelum dan setelah perlakuan adalah sama. Subjek penelitian adalah siswa SMK N 1 Probolinggo kelas X yang memiliki frekuensi membolos tinggi. Instrumen penelitian berupa study dokumentasi dengan rekapitulasi absen yang dilengkapi dengan format observasi, dan data penskoran,. Teknik analisis data yang digunakan adalah t-test wilcoxon. Hasil penghitungan didapatkan nilai zhitung sebesar 2,060 dengan signifikansi 0,039. Dari hasil analisis nilai thitung mempunyai signifikansi 0,039 kurang dari 0,05 (sig < 0,05), maka dapat disimpulkan bahwa terdapat perbedaan yang signifikan frekuensi membolos sebelum dan sesudah perlakuan. Kesimpulan penelitian ini adalah penggunaan reinforcement efektif untuk menurunkan frekuensi kebiasaan membolos siswa kelas X SMK N 1 Probolinggo. Berdasarkan hasil penelitian ini, disarankan bagi konselor untuk menggunakan reinforcement sebagai salah satu alternatif dalam menurunkan kebiasaan membolos siswa. Saran yang diberikan pada penelitian ini adalah Guru menggunakan penguatan (reinforcement) secara bervariasi dalam pemberian penguatan baik penguatan secara verbal dan nonverbal dalam kegiatan pembelajaran sehingga siswa tidak merasa jenuh dengan pola pengajaran. Sekolah dapat memfasilitasi dalam memberikan penguatan (reinforcement) kepada siswa sehingga siswa merasa lebih diperhatikan dan lebih bersemangat dalam mengikuti proses pembelajaran. Penelitian eksperiment ini hendaknya dapat dikembangkan dengan meningkatkan desain yang ada, misalnya dengan menggunakan desain A-B-A'-B', ataupun A-B-A-B-C. Bentuk reinforcement yang diberikan hendaknya tidak hanya sebatas reinforcement sosial.

Penerapan metode pembelajaran outdoor study objek lereng gunung kelud guna meningkatkan aktivitas, hasil belajar, dan kemampuan menyusun karya tulis geografi materi pemanfaatan sumberdaya alam siswa kelas XI IPS-2 SMA Negeri 3 Blitar / Moch. Budi Harsono

 

Tesis, Program Studi Pendidikan Geografi, Program Pasca Sarjana Universitas Malang. Pembimbing: (I) Prof. Dr. Sugeng Utaya, M.Pd, (II) Dr. Achmad Amirudin, M.Pd. Kata kunci: outdoor study, aktivitas siswa, hasil belajar, karya tulis , sumberdaya alam. Metode outdoor study atau metode pembelajaran di luar ruangan kelas merupakan metode pembelajaran yang mampu memupuk kreatifitas, inisiatif, kerjasama atau gotong royong dan mengakrapkan siswa dengan lingkungan sekitarnya. Peran guru pada pembelajaran outdoor adalah sebagai motivator, artinya guru sebagai pemandu agar siswa belajar secara aktif, efektif, kreatif dan akrab dengan lingkungaan. Materi geografi yang sesuai dengan metode outdoor study adalah materi kelas XI IPS semester dua yang membahas pemanfaatan sumberdaya alam. Untuk itu peneliti mencoba menerapkan metode pembelajaran outdoor ini pada siswa kelas XI IPS-2 SMA Negeri 3 Blitar dengan objek lokasi bekas aliran lahar gunung Kelud di wilayah Blitar. Tujuan utama dari penelitian ini adalah untuk mengetahui efektifitas penerapan metode outdoor study dalam meningkatkan aktifitas, hasil belajar, dan menyusun karya tulis pada pelajaran geografi, siswa kelas XI IPS-2 SMA Negeri 3 Blitar tahun ajaran 2010-2011. Penelitian ini merupakan penelitian tindakan kelas (clasroom action research) yang dilaksanakan dalam 2 siklus tindakan, sedangkan subjek yang digunakan dalam penelitian tindakan kelas ini adalah siswa kelas XI IPS SMA Negeri 3 Blitar, yang berjumlah 37 siswa, terdiri dari 21 perempuan dan 16 laki-laki. Aktifitas siswa diukur dengan menggunakan descriptor dimana semua kegiatan siswa dicatat, hasil belajar siswa diukur berdasarkan selisih nilai tes pada saat pratindakan, siklus1 dan siklus 2, sedangkan kemampuan menyusun karya tulis diukur berdasarkan selisih nilai pada siklus satu dengan siklus dua. Instrumen yang digunakan adalah soal tes, lembar observasi aktifitas siswa dan format penilaian karya tulis. Berdasakan hasil penelitian diketahui adanya peningkatan aktifitas siswa, hasil belajar, dan kemampuan menyusun karya tulis siswa kelas XI IPS-2 SMA Negeri 3 Blitar. Peningkatan aktifitas siswa ditunjukkan pada siklus I yang mencapai keberhasilan terdapat 51,3% yang terdiri dari 8,1% dengan kriteria baik sekali, 43,2% dengan kriteria baik, sedangkan sisanya 48,7% dapat dikatagorikan belum berhasil. Pada siklus II yang mencapai keberhasilan terdapat 86,4% yang terdiri dari 40,5% dengan kriteria baik sekali, 45,9% dengan kriteria baik sedangkan sisanya 13,6% dapat dikatagorikan belum berhasil. Peningkatan hasil belajar siswa ditunjukkan pada saat pratindakan terdapat 27,0% atau 10 siswa, siklus I terdapat 67,6% atau 25 siswa dan pada siklus II terdapat 89,2% atau 33 siswa yang sudah mencapai ketuntasan belajar. Sedangkan siswa yang belum tuntas belajarnya pratindakan 73,0% atau 27 siswa, siklus I terdapat 32,4% atau 12 siswa dan pada siklus II terdapat 10,8% atau 4 siswa. Sedangkan peningkatan kemampuan menyusun karya ilmiah terlihat pada siklus I terdapat 3 kelompok atau 0,43% yang nilainya dibawah 75 dan pada siklus 2 seluruh kelompok atau 100% nilai rata-ratanya di atas 75.

Pengaruh penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi terhadap hasil belajar di SMA Negeri 8 Malang / Trio Andi Cahyono

 

Kata Kunci: penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi, hasil belajar siswa. Penerapan pembelajaraan kontekstual adalah pendekatan pembelajaran dimana guru menghadirkan situasi dunia nyata ke dalam kelas yang membantu siswa mencari makna isi pembelajaran dalam materi yang sedang dipelajari. Dalam menerapkan pembelajaran kontekstual seorang guru memerlukan alat pemusat perhatian untuk menyampaikan materi. Alat pemusat perhatian tersebut menggunakan bantuan media berbasis teknologi informasi. Dalam penelitian ini media berbasis teknologi informasi menggunakan internet. Melalui keberadaan internet, siswa bisa mendapatkan informasi yang dibutuhkan dimanapun dan kapanpun waktu yang diinginkan. Sebagai sebuah sumber informasi yang hampir tak terbatas, maka jaringan internet dijadikan sebagai salah satu sumber pembelajaran. Penelitian ini bertujuan untuk mengetahui pengaruh penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi terhadap hasil belajar. Sampel dalam penelitian ini adalah siswa kelas XI IPS SMA Negeri 8 Malang yang berjumlah 52 siswa. Jenis penelitian ini adalah penelitian kuantitatif, sedangkan data yang digunakan adalah data primer berupa angket penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi, sedangkan data sekunder berupa nilai ulangan harian. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi linier sederhana. Hasil dari penelitian yang telah dilakukan adalah penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi berpengaruh terhadap hasil belajar siswa dengan nilai signifikansi sebesar 0,625.Berdasarkan hasil analisis tersebut dapat disimpulkan bahwa penerapan pembelajaran kontekstual dengan menggunakan media berbasis teknologi informasi berpengaruh terhadap hasil belajar siswa. Berdasarkan hasil penelitian tersebut, saran yang dapat diberikan adalah: (1) bagi pihak sekolah sebaiknya meningkatkan fasilitas teknologi informasi dan kelengkapan internet untuk menunjang pembelajaran siswa; (2) guru sebaiknya tetap melaksanakan pembelajaran kontekstual dengan menggunakan media teknologi informasi kerena siswa lebih paham terhadap materi yang disampaikan dan dapat meningkatkan hasil belajar siswa.

Pengembangan buku siswa SMP kelas VIII dengan materi prisma dan limas yang berpijak pada masalah kontekstual, penggunaan model, dan penemuan terbimbing / Syarifudin

 

Tesis, Program Studi Pendidikan Matematika, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Edy Bambang Irawan, M. Pd, dan (II) Drs. Tjang Daniel Chandra, M. Si, Ph. D. Kata Kunci: pengembangan, buku siswa, prisma dan limas, masalah kontekstual, penggunaan model, dan penemuan terbimbing. Memperhatikan buku siswa yang beredar di pasaran sekarang yang hanya langsung menyajikan suatu konsep, contoh soal dan diakhiri dengan tugas mandiri, hal ini imbasnya adalah siswa hanya menghafal konsep-konsep dengan tidak memahami proses terbentuknya dari suatu konsep. Oleh sebab itu, maka perlu dikembangkan buku siswa yang mengarahkan siswa dalam menemukan suatu konsep matematika dengan dibantu oleh masalah-masalah kontekstual, berbagai model dan penemuan terbimbing. Pengembangan buku siswa ini mengikuti langkah-langkah model pengembangan Thiagarajan, Semmel dan Semmel. Pengembangan model ini memiliki empat tahap yaitu pendefinisian, perencanaan, pengembangan, dan penyebaran. Namun, pada pengembangan buku siswa ini hanya dibatasi sampai tahap ke tiga yaitu tahap pengembangan. Selain itu, dalam pengembangan buku siswa ini berpijak pada pendidikan matematika realistik (PMR) yang difokuskan pada masalah kontekstual, penggunaan model, dan penemuan terbimbing. Setelah selesai dikembangkan, selanjutnya adalah buku siswa dinilai oleh para ahli dan praktisi serta diuji cobakan di kelas. Penilaian para ahli dan praktisi bertujuan untuk melihat kevalidan buku siswa. Penilaian ahli dan praktisi mendapatkan skor 3,46 atau telah memenuhi kriteria sangat valid. Selanjutnya, diuji cobakan di kelas dengan tujuan melihat kepraktisan dan keefektifan. Kepraktisan buku siswa diukur melalui keterlaksanaan pembelajaran dengan menggunakan buku siswa dalam proses pembelajaran. Data keterlaksanaan buku siswa secara keseluruhan berada dalam kategorikan tinggi. Keefektifan buku siswa diukur melalu tiga indikator yaitu; (1) aktivitas siswa, (2) respon siswa, dan (3) ketuntasan belajar. Setelah diuji-cobakan di kelas diperoleh data tentang hasil observasi aktivitas siswa selama proses pembelajaran secara keseluruhan berada pada kriteria aktif. Data tentang respon siswa secara keseluruhan siswa memberikan respon positif. Data hasil tes siswa setelah selesai mengikuti proses pembelajaran dari 28 orang SMP Negeri 4 Nguling tidak ada siswa yang memperoleh nilai di bawah 65% dari standar tujuan pembelajaran yang harus dicapai. Lebih lanjut, jika dilihat secara klasikal diperoleh rata-rata 83,1%. Berdasarkan hasil penelitian pengembangan ini, ada tiga saran yang bisa diberikan adalah (1) buku siswa hendaknya digunakan secara bersamaan dengan alat peraga, (2) buku siswa ini sebaiknya dikembangkan lebih lanjut dengan materi-materi lainnya terutama materi yang berkaitan dengan geometri, dan (3) buku siswa yang dikembangkan ini hanya terbatas pada kondisi dan karakteristik siswa SMP Negeri 4 Nguling, sehingga bila digunakan pada siswa lain diperlukan penyesuaian seperlunya.

Evaluasi pada jaringan distribusi pembangkit listrik tenaga mikrohidro di Temas Kota Batu / Aka Satriya Bagus Sarosa

 

Kata Kunci: Mikrohidro, Evaluasi, Jaringan Distribusi, Sistem Informasi Tegangan. Penyaluran tenaga listrik dengan kapasitas daya yang kecil seperti Pembangkit Listrik Tenaga Mikrohidro (PLTMh) yang berada di Desa Temas Kota Batu yang memakai generator sinkron 1 fasa dengan daya 10 kVA memiliki kekurangan, dari kekurangan sistem distribusi PLTMh di Desa Temas Kota Batu ini yaitu ukuran kabel yang tidak sesuai standart, tidak ketersediaannya MCB pada masing-masing group dan pentanahan untuk titik netral dan bodi peralatan yang terbuat dari logam seperti besi, sistem informasi pendeteksi jika tegangan naik maupun turun diluar batas standart seperti alarm atau indikator lampu, olehkarenaituperludiadakannyaevaluasiterhadapjaringan distribusi listrik PLTMhsertaperancanganulangdarihasilevaluasi. Adapun tujuan dari evaluasi sistem ini yaitu: mengevaluasipenghantar saluran dari output generator sampai ke jaringan penerangan jalan umum (PJU), mengevaluasibesar arus miniatur circuit breaker (MCB) utama dan saluran yang terdapat pada panel pemutus hubung bagi (PHB), merancang sistem grounding pada titik netral dan body peralatan listrik dan membuatSistem Informasi Tegangan naik dan tegangan turun diluar batas standart. Dari hasil evaluasi didapat besar arus MCB telahrancang ulang sesuai PUIL 2000, yaitu untuk besar arus MCB utama pada penerangan dan tenaga sebesar 10A, untuk besar arus MCB utama pada penerangan sebesar 2A, sedangkan group instalasi motor pompa sebesar 6A, untuk penerangan jalan umum sebesar 2A dan group instalasi power house digunakan MCB 2A, untuk kuat hantar arus (KHA) pada output generator ke PHB menggunakan kabel NYM ukuran 2x2,5mm2, sedangkan KHA instalasi motor pompa menggunakan kabel NYM ukuran 3x1,5mm2, untuk KHA instalasi penerangan jalan umum menggunakan kabel NFA ukuran 2x6mm2, untuk resistansipentanahandidapat nilai memilki 2Ω, pada pengujian hubung singkat MCB, besar MCB sebesar 2A akan trip pada waktu 22 detik, MCB 4A trip pada waktu 0,50 detik, MCB 6A trip pada waktu 0,42 detik dan MCB 10A trip pada waktu 0,30 detik, untuk sisteminformasiteganganakan mengeluarkan sinyal untuk memerintahkan relai jika sistem informasi mendeteksi tegangan diatas 230V untuk menghidupkan lampu merah disertai alarm dan dibawah 200V untuk menghidupkan lampu hijau disertai alarm.

Pengaruh penerapan model pembelajaran cooperative problem solving dan cooperative problem posing terhadap kualitas proses kognitif dan hasil belajar untuk pokok bahasan termodinamika kimia / Dian Novianti

 

Tesis. Program Studi Pendidikan Kimia, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. H. Suhadi Ibnu, M.A., Ph.D., (II) Dra. Surjani Wonorahardjo, Ph.D. Kata Kunci: cooperative problem solving, cooperative problem posing, kualitas proses kognitif, hasil belajar Termodinamika kimia merupakan salah satu topik yang dipelajari di Perguruan Tinggi. Materi termodinamika kimia berisikan konsep-konsep abstrak dan perhitungan matematik. Sebagian besar mahasiswa menemui kesulitan dalam mempelajari termodinamika kimia. Kesulitan ini disebabkan kurangnya kemampuan berpikir abstrak dan kemampuan algoritmik mahasiswa. Masalah ini dapat diatasi dengan menerapkan model pembelajaran problem solving dan problem posing. Problem solving dan problem posing lebih efektif jika dipadukan dengan pembelajaran kooperatif. Hal ini bertujuan memaksimalkan proses kognitif mahasiswa. Tujuan penelitian ini adalah: (1) mendeskripsikan kualitas proses kognitif mahasiswa yang terlibat dalam pembelajaran termodinamika dengan cooperative problem solving dan cooperative problem posing; (2) mengetahui perbedaan peningkatan hasil belajar (gained score) mahasiswa yang terlibat dalam pembelajaran termodinamika dengan cooperative problem solving dan cooperative problem posing; (3) mengetahui perbedaan hasil belajar (final score) mahasiswa yang terlibat dalam pembelajaran termodinamika dengan cooperative problem solving dan cooperative problem posing; dan (4) mengetahui perbedaan persepsi mahasiswa terhadap model pembelajaran yang digunakan. Penelitian ini menggunakan rancangan deskriptif dan eksperimental semu. Subjek penelitian adalah mahasiswa Program Studi Pendidikan Kimia Universitas Negeri Malang yang mengikuti mata kuliah Kimia Fisik I pada semester tiga tahun akademik 2010/2011. Data penelitian adalah data proses kognitif, hasil belajar, dan persepsi mahasiswa. Data proses kognitif dikumpulkan dari angket dan observasi. Data hasil belajar dikumpulkan dari tes hasil belajar. Tes hasil belajar terdiri dari 30 butir soal dengan validitas isi 88,4% dan koefisien reliabilitas, dihitung dengan SPSS 16 for Windows, sebesar 0,78. Data persepsi mahasiswa dikumpulkan dari angket. Kualitas proses kognitif dianalisis secara deskriptif. Hasil belajar dan persepsi mahasiswa dianalisis dengan uji t. Hasil penelitian menunjukkan bahwa: (1) kualitas proses kognitif mahasiswa yang terlibat dalam pembelajaran termodinamika dengan cooperative problem solving termasuk dalam kategori baik (77,5%), sedangkan kualitas proses kognitif mahasiswa yang terlibat dalam pembelajaran termodinamika dengan cooperative problem posing termasuk dalam kategori cukup (67,6%); (2) cooperative problem posing menghasilkan gained score lebih tinggi dibandingkan dengan cooperative problem solving; (3) tidak ada perbedaan hasil belajar (final score) dari penerapan cooperative problem solving dan cooperative problem posing; (4) persepsi mahasiswa terhadap cooperative problem posing lebih rendah dibandingkan terhadap cooperative problem solving.

Implementing mind mapping strategy to improve the writing ability of the seventh graders of Public Junior High School 4 Kediri / Retno Repelitawati

 

Thesis. Graduate Program in English Language Teaching, State University of Malang. Advisor: (I) Dr. Johannes Ananto Prayogo, M.Pd., M.Ed. (II) Dr. Suharmanto, M.Pd. Key words: Writing ability, mind mapping strategy This study is aimed at implementing mind mapping strategy to improve the writing ability of the seventh graders of Public Junior High School 4 kediri. Based on the finding of the preliminary study, the teaching writing in Public Junior High School 4 Kediri has not facilitated students to be skilled in writing yet. The students have problems in: (1) how to start writing, (2) how to generate ideas, (3) how to organize ideas logically, (4) how to make grammatical sentences. Therefore, the researcher is greatly motivated to overcome the problem by implementing mind mapping strategy to improve the writing ability of the seventh graders of Public Junior High School 4 Kediri. Mind mapping Strategy is chosen to solve the problems in Public Junior High School 4 Kediri since it can guided the students to generate ideas, to organize ideas, and to make grammatical sentences. The research problem is how can mind mapping strategy improve the writing ability of the seventh graders of Public Junior High School 4 Kediri?. On the basis of the research problem, this research is intended to use mind mapping strategy to improve the students' ability in writing, especially in descriptive text. The researcher employed the design of collaborative classroom action research, in which the researcher was assisted by collaborative teacher (a colleague) conducts the study. The research is conducted in VII-H class that consisted of twenty-nine students, in which all of the students were taken as the subject of the research. The procedure of the research consisted of four stages: planning, implementation, observation, and reflection. This study consists of two cycles. Each of them consists of 4 meeting for teaching learning process. To collect the data, the researcher used some instrument namely observation checklist, field notes, and students' test. The finding of the research shows that the use of mind mapping strategy in teaching writing can improve the writing ability of the seventh graders of Public Junior High School 4 Kediri and the finding of the study shows that the appropriate steps in implementing mind mapping strategy consists the following procedures: (1) leading students to the topic by giving some question, (2) connecting the topic with the students' background knowledge, (3) introducing the topic and explaining the instructional objectives, (4) showing a picture related to the topic by sticking it on the whiteboard, (5) asking students to observe the picture, (6) asking students to participate in generating their ideas through mind mapping as a model on the whiteboard, (7) distributing the example of descriptive paragraphs, (8) asking students to sit in group of five, (9) distributing other different animal/ person picture, large paper (A4), (10) informing the students about the activities they should do in their groups, (11) asking students to starts the map from the center of paper and write a title based on the picture, (12) asking students to start writing their first draft in group, (13) guiding students to revise their writing in term of content and organize, (14) guiding students to edit their writing in term of grammar and vocabulary, (15) asking students to write their final draft, and (16) asking students to write paragraph individually. The finding also indicates that mind mapping strategy in teaching writing can improve the writing ability of the seventh graders of Public Junior High School 4 Kediri. The improvement can be seen from the increase of the students' writing score which reached the target score that in Cycle 1, 48% (14 students of class) could reach ≥ 75. It has not fulfilled the criterion of success yet. In Cycle 2, the students who got the score ≥ 75 were 82 % (24 students of class) for high achiever and 18% (5 students of class) got the score ≥ 65 for low achiever. It fulfilled the criterion of success in term of the score improvement. Beside, mind mapping strategy was successful in enhancing the students to be active in the class. Examining the result, the study supports the claim that mind mapping enables the learners to solve the problems of ideas and organization in writing and this study may also be in line with the idea that in mind mapping, the connection between one idea to another one is presented so clearly that it describe a clear picture of the idea development of an essay. This study also suggest that an effective way of generating ideas, mind mapping should be implemented as a pre-writing activity in which the students are involved in gathering the ideas for the target topic. Providing more practices for applying mind mapping in a real writing situation is also advisable. By so doing, the learners are equipped with the skill of writing as a means of self-expression, which might be useful for their occupational or academic purpose in the future. Based on the effectiveness of the implementation of mind mapping strategy in teaching writing, it is suggested that the English teachers apply mind mapping strategy, especially in teaching writing. To the future researchers, particularly those who are interested in applying mind mapping strategy in their classroom research, it is suggested that they do follow up research concerning the use of mind mapping strategy and use the results of this present study as a reference. It can be done to teach other different genre in various level of education from junior high school to senior high school.

Pengembangan pembelajaran collaboration blogger learning (CBL) untuk meningkatkan interaksi sosial pada blended learning / Khusnul Khotimah

 

Tesis, Teknologi Pembelajaran, Program Pasca Sarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Punaji Setyosari, M.Pd., M.Ed., (II) Dr. Waras Kamdi, M.Pd. Kata kunci: Pengembangan, disain pembelajaran, kolaborasi, blog, interaksi sosial, blended learning. Media online atau internet saat ini telah dipercaya dunia pendidikan dan pelatihan secara keseluruhan. Hal ini tampak dengan bertambahnya jumlah blended-learning yang ada di Indonesia maupun online-learning di luar negeri. Dengan demikian maka pembelajaran online muncul sebagai area baru yang penting dalam penelitian dan pengembangan di bidang Teknologi Pembelajaran. Internet dengan segala keunggulan yang ditawarkan telah merubah kebiasaan dan cara hidup masyarakat serta dunia pendidikan. Dalam penelitian-penelitian yang sudah dilakukan di sejumlah lembaga pendidikan dalam negeri dan luar negeri ditemukan adanya kekurangan dalam pembelajaran online. Diungkapkan bahwa siswa sering merasa terisolasi dan kurang dapat berinteraksi dengan siswa lain atau pun guru untuk men-konstruk pengetahuan yang diperolehnya. Sedangkan dalam teori belajar dinyatakan bahwa kurangnya interaksi dalam pembelajaran dapat menyebabkan siswa merasa tidak terikat dalam proses pembelajaran yang pada akhirnya mengurangi hasil belajar. Salah satu fasilitasweb yang bersifat umum dan memiliki potensi besar sebagai sarana untuk interaksi sosial adalah web log atau blog. Berdasar hasil observasi pendahuluan yang dilakukan, ternyata blog sangat menarik jika dimanfaatkan dan diintegrasikan dalam proses pembelajaran. SMA Muhammadiyah 2 Surabaya merupakan salah satu sekolah yang telah memiliki situs blog untuk komunitas sekolah yang belum dimanfaatkan untuk keperluan pembelajaran. Hasil observasi menunjukkan bahwa pembelajaran yang dilakukan masih belum bervariasi sedangkan siswa merasa jenuh dengan strategi pembelajaran yang telah ada. Dengan demikian maka penulis mengambil permasalahan bahwa perlu dilakukan suatu upaya pengembangan pembelajaran untuk meningkatkan interaksi sosial pada pembelajaran yang dilakukan pada dua ranah yaitu tatap muka dan online atau disebut blended learning. Dalam kegiatan pengembangan pembelajaran yang dilakukan, metode yang diterapkan adalah dengan mengikuti langkah-langkah pada model Dick dan Carey (2001). Dimana pada model tersebut terdapat sepuluh langkah yang harus diikuti secara berurutan (1) analisis kebutuhan untuk mengidentifikasi tujuan pembelajaran, (2) analisis instruksional, (3) analisis karakteristik siswa, (4) merumuskan tujuan pembelajaran khusus, (5) mengembangkan alat atau instrumen penilaian, (6) mengembangkan strategi pembelajaran, (7) Mengembangkan bahan pembelajaran, (8) evaluasi formatif, (9) merevisi pembelajaran, dan (10) evaluasi sumatif. Untuk ujicoba dilakukan melalui empat tahap, yakni (1) Uji ahli, (2) uji perorangan, (3) uji kelompok, (4) uji lapangan. Dan teknik analisis data yang digunakan adalah analisis deskriptif persentase. Hasil pengembangan berupa metode pembelajaran Collaboration Blogger Learning (CBL) dan buku pedoman penerapan pembelajaran CBL. Metode CBL dikembangkan dari kajian konsep belajar berkolaborasi, pemanfaatan blog untuk pembelajaran dan interaksi sosial pada blended learning. Metode pembelajaran CBL terdiri dari enam tahapan yakni tahap 1 penyampaian tujuan, tahap 2 pengkondisian siswa, tahap 3 penugasan siswa, tahap 4 pelaksanaan kolaborasi, tahap 5 blogger online, tahap 6 review dan penilaian. Hasil pengembangan kedua berupa buku pedoman penerapan pembelajaran CBL. Buku ini terdiri dari enam bagian yaitu (1) Pendahuluan, (2) Landasan ilmiah pembelajaran CBL, (3) Analisis Komponen Pembelajaran CBL, (4) Metode Pembelajaran CBL, (5) Evaluasi Pembelajaran CBL, dan (6) Penerapan pada pelajaran lain. Buku pedoman ini ditujukan untuk guru yang akan menerapkan pembelajaran CBL . Subjek uji coba adalah 1 ahli disain pembelajaran, 2 guru pelajaran Teknologi Informasi dan Komunikasi, 2 guru pelajaran Bahasa Indonesia, dan 18 siswa kelas X SMA Muhammadiyah 2 Surabaya. Pokok bahasan yang diintegrasikan dalam pelaksanaan pembelajaran CBL adalah membangun blog pada TIK dan menulis puisi pada Bahasa Indonesia. Pengembang menyarankan agar para guru dan para pembelajar melakukan inovasi strategi pembelajaran seperti penggunaan media, cara penyampaian, organisasi materi, pemanfaatan teknologi canggih dan sebagainya. Karena hal-hal tersebut mampu menarik minat siswa untuk belajar dan memacu siswa untuk mencapai tujuan pembelajaran secara optimal. Bagaimanapun inovasi yang dilakukan sebaiknya memperhatikan komponen-komponen penting dalam pembelajaran antara lain adalah siswa. Meski demikian tetap saja tidak ada sebuah metode atau strategi yang paling baik dan tepat, yang ada adalah semua metode dan strategi pembelajaran saling melengkapi dan memberi variasi antara satu dengan yang lain. Jadi semua bergantung pada kearifan dan kemampuan pelaksana pembelajaran.

Pembuatan busana pesta dengan hiasan volant / Peny Dewi Anggraini

 

Kata Kunci: Busana Pesta, Hiasan, Volant Busana pesta merupakan busana yang dipakai untuk menghadiri perayaan atau pesta. Pesta dapat bersifat keagamaan maupun berkaitan dengan acara-acara pribadi dan keluarga baik yang bersifat formal, semiformal atau non formal untuk memperingati atau merayakan suatu peristiwa khusus dalam kehidupan seseorang. Busana pesta yang bersifat formal adalah busana pesta yang memiliki aturan tertentu dan digunakan untuk menghadiri acara atau perayaan formal seperti pada acara serah terima jabatan atau acara pelantikan. Busana pesta semiformal merupakan busana pesta yang digunakan untuk menghadiri suatu acara yang hikmat namun tetap santai dan pada acara bertema yang didalamnya terdapat dresscode, atau pada acara pernikahan yang sifatnya hikmat tetapi santai. Busana pesta nonformal merupakan busana pesta yang tidak memiliki aturan tertentu dadat digunakan misalnya pada acara ulang tahun yang diadakan di luar ruangan (outdoor). Pada pembuatan Tugas Akhir ini, penulis membuat sebuah karya busana yang berjudul “Pembuatan Busana Pesta dengan Hiasan Volant”. Busana pesta ini dapat digunakan untuk menghadiri pesta semi formal, misalnya pesta ulang tahun, pertunangan, atau acara semiformal lain yang bertema. Pembuatan busana pesta ini menggunakan kain shantung dan kain bercorak yang jenisnya agak kaku dengan tujuan agar busana terlihat lebih tegas dan menghasilkan bentuk yang unik serta memberi kesan cute pada si pemakai. Tujuan yang ingin dicapai dalam pembuatan Tugas Akhir ini adalah ingin menampilkan suatu karya busana dengan menggunakan teknik pembuatan strapless bertali yang digabungkan dengan hiasan volant yang ditata secara acak dan memanjang pada bagian belakang rok sehingga menyerupai bentuk ekor ikan. Karya busana ini sesuai dengan trend fashion 2011 yang sebagian besar mengangkat tema tentang pesona laut. Adapun manfaat dari hasil Tugas Akhir dengan judul Pembuatan Busana Pesta dengan Hiasan Volant ini adalah meningkatkan keterampilan dan kreatifitas mahasiswa dalam mendesain busana sesuai dengan situasi dan kondisi yang dibutuhkan, sebagai sumber inspirasibagi pembaca dalam pembuatan busana pesta dengan hiasan volant. Proses pembuatan busana pesta dilakukan dengan cara pembuatan draft busana berukuran “s” menggunakan kain blacu, kemudian dilakukan fitting untuk mendapatkan hasil yang pas badan dengan model, selanjutnya proses pembuatan dengan bahan utama hingga proses finishing. Biaya yang dikeluarkan dalam pembuatan busana pesta ini adalah Rp. 292.000,- Hasil yang diperoleh dari pembuatan busana pesta ini adalah berupa Busana Pesta dengan Hiasan Volant yang memiliki kesan elegan dan cute pada si pemakai karena pada bagian bawah busana terdapat hiasan volantyang ditata acak dan memanjang pada bagian belakang. Pada pembuatan busana pesta dengan hiasan volant harus dibuat perencanaan yang tepat tentang penggunaan bahan, cara peletakan hiasan serta teknik sewing lainnya agar menghasilkan busana pesta sesuai dengan yang diinginkan.

Pembuatan cocktail dress dengan hiasan ruffles pleats / Ervin Artistawati

 

Kata Kunci: Cocktail Dress, Hiasan, Ruffles Pleats Busana merupakan kebutuhan pokok yang harus dipenuhi oleh setiap manusia. Keanekaragaman busana yang ada saat ini lebih banyak didominasi oleh busana wanita. Salah satunya adalah busana pesta yang menjadi perhatian khusus bagi para pecinta mode busana. Busana pesta yang menjadi trend saat ini adalah cocktail dress. Cocktail Dress adalah sebuah gaun yang dipakai untuk menghadiri acara pesta di sore hari yang sifatnya semi formal dengan panjangnya tidak melebihi lutut biasanya tanpa lengan dan terbuat dari bahan-bahan seperti sutra, satin, taffeta atau bahan mewah lainnya, tetapi penulis kali ini menggunakan bahan “dobby kombinasi” dengan bahan organdy. Cocktail dress ini dihiasi dengan hiasan ruffles pleats. Hiasan ruffles pleats adalah suatu detail pada busana yang bertekstur lipit-lipit dan berbentuk gelombang yang bagian tepinya dapat diselesaikan dengan bis, di jahit kecil maupun di rol sum. Hiasan ruffles pleats ini disusun full pada gaun. Pleats yang digunakan dalam pembuatan cocktail dress ini adalah knife pleats. Tujuan yang ingin dicapai dalam pembuatan Tugas Akhir ini adalah menjelaskan cocktail dress dengan hiasan ruffle pleats dan menjelaskan teknik pembuatan cocktail dress secara detail. Manfaat yang diperoleh dalam pembuatan Tugas Akhir ini adalah menambah wawasan dan inspirasi pada para pembaca tentang cocktail dress dengan hiasan ruffles pleats. Proses pembuatan yang dilakukan adalah pattern, cutting, sewing, dan finishing. Biaya yang dikeluarkan adalah Rp. 412.000,- Hasil yang diperoleh dari pembuatan cocktail dress ini adalah berupa gaun yang dihiasi dengan hiasan ruffles pleats yang menggunakan bahan berupa ”dobby kombinasi” dan bahan organdy dengan warna dan ukuran yang berbeda. Saran yang dapat diberikan adalah penyelesaian ruffles pleats pada tepi bahan khususnya bahan organdy, sebaiknya tepi bahan dirol sum agar tepi bahan tetap rapi dan tidak bertiras.

Penerapan model pembelajaran Cooperative Integrated Reading and Composition (CIRC) untuk meningkatkan kemampuan menulis karangan deskripsi di kelas IV SDN Madyopuro 2 Malang / Maya Matruty

 

Kata Kunci: Model Pembelajaran CIRC, Meningkatkan Kemampuan Menulis Karangan Deskripsi, Sekolah Dasar. Dari hasil pengamatan yang dilakukan peneliti pada pembelajaran Bahasa Indonesia di Kelas IV SDN Madyopuro 2 Malang dapat diketahui bahwa kemampuan belajar siswa masih kurang, di antaranya adalah siswa cenderung pasif dan merasa bosan dalam pembelajaran Bahasa Indonesia. Dalam pembelajaran berlangsung dikelas masih tergantung pada guru. Nilai rata-rata siswa kelas IV pada kemampuan hasil belajar siswa adalah 59,11%, masih kurang dari kriteria yang ditentukan yaitu 75%. Hal ini dikarenakan metode yang digunakan pada pembelajaran Bahasa Indonesia adalah metode konvensional. Oleh karena itu, pada penelitian ini dicoba untuk meningkatkan kemampuan hasil belajar siswa dengan menerapkan model pembelajaran CIRC untuk meningkatkan kemampuan siswa tentang materi menulis karangan deskrisi melalui Penelitian Tindakan Kelas (PTK). Penelitian ini dilakukan untuk mengetahui kemampuan menulis karangan deskripsi di Kelas IV SDN Madyopuro 2 Malang. Penelitian ini digunakan alur Penelitian Tindakan Kelas (PTK) menurut Kemmis dan Taggart (Sa’dun Akbar, 2010:30) yang terdiri dari: Perencanaan (Planning), Pelaksanaan Tindakan (Acting), Pelaksanaan Tindakan (Acting), Refleksi (Reflecting). Subjek penelitian ini adalah siswa kelas IV SDN Madyopuro 2 Malang dengan jumlah siswa 45 orang, yang terdiri dari 23 siswa laki-laki dan 22 siswa perempuan. Penerapan model pembelajaran CIRC pada pembelajaran Bahasa Indonesia dengan materi menulis karangan deskripsi di kelas IV SDN Madyopuro 2 Malang dikategorikan baik, dengan melihat dari peningkatan kemampuan aktivitas belajar siswa yang diperoleh dari Siklus I, yaitu secara klasikal keberhasilan kelas adalah 80% sedangkan yang belum berhasil 20%. Siklus II yaitu secara klasikal keberhasilan kelas adalah 88,88% sedangkan yang belum berhasil 11,11%. Hasil penelitian menunjukan bahwa penerapan model pembelajaran CIRC pada pembelajaran Bahasa Indonesia dengan materi menulis karangan deskripsi di kelas IV SDN Madyopuro 2 Malang dikategorikan baik, dengan melihat dari peningkatan kemampuan hasil belajar siswa yang diperoleh dari pra tindakan, Siklus I ke Siklus II, yaitu dari rata-rata kelas sebesar 59,11%, meningkat menjadi 70,77 dan meningkat lagi menjadi 84,33%. Berdasarkan hasil penelitian ini, maka peneliti mengharapkan bahwa tidak hanya pembelajaran Bahasa Indonesia saja yang mencoba menggunakan model pembelajaran CIRC tetapi juga untuk pembelajaran yang lainnya bisa menggunakan model pembelajaran ini sesuai dengan kompetensi dasar yang ingin dicapai dalam pembelajaran.

Perbedaan prestasi belajar pada mata diklat menggambar rencana pelat lantai dengan penerapan metode pembelajaran menggunakan multimedia dan metode ceramah untuk siswa kelas X Gambar Bangunan SMK Negeri 6 Malang / Herman Sufiyanto

 

Kata kunci : Prestasi Belajar, Pembelajaran Multimedia, Menggambar Pelat lantai. Prestasi belajar merupakan indikator yang penting untuk mengukur keberhasilan proses belajar mengajar yang dipengaruhi oleh perubahan dan pembaharuan dalam segala unsur-unsur yang mendukung pendidikan. Perkembangan dunia teknologi multimedia menjanjikan potensi besar dalam merubah cara seseorang belajar, memperoleh informasi, beradaptasi dengan informasi, sehingga ada peluang bagi para pengajar untuk mengaplikasikan berbagai teknik pembelajaran. Permasalahan yang dihadapi oleh siswa SMK Negeri 6 Malang pada Mata Diklat Menggambar Rencana Pelat Lantai belum mencapai hasil yang maksimal, yaitu dengan rata-rata nilai ulangan pada setiap kompetensi dasar kurang dari 70,00. Penelitian ini untuk mengetahui perbedaan prestasi belajar pada Mata Diklat Menggambar Rencana Pelat Lantai dengan penerapan metode pembelajaran menggunakan multimedia dan metode ceramah untuk siswa kelas X Gambar Bangunan SMK Negeri 6 Malang. Penelitian ini merupakan penelitian menggunakan desain exsperimen semu (Quasi Eksperimental Design). Populasi penelitian ini adalah siswa kelas X SMK Negeri 6 Malang. Ruang lingkup penelitian ini terdiri dari variabel bebas (metode pembelajaran) dan variabel terikat (prestasi belajar). Dari hasil tes untuk rata-rata nilai pada kelas eksperimen sebesar 86 dan untuk kelas kontrol sebesar 76. Dengan nilai Kriteria Ketuntasan Minimal (KKM) 76,12, maka kelas eksperimen dinyatakan lulus, sedangkan kelas kontrol dengan nilai yang masih dibawah KKM dinyatakan belum memenuhi syarat sehingga harus ujian ulang. Jadi prestasi belajar kelompok eksperimen lebih baik dari pada prestasi belajar kelompok kontrol. Hasil analisis menunjukkan ada perbedaan signifikan antara kelas kontrol dengan kelas eksperimen. Berdasarkan hasil penelitian ini, dapat disarankan agar dilakukan penelitian lebih lanjut tentang prestasi belajar dengan melibatkan variabel-variabel lain seperti suasana belajar, fasilitas pembelajaran, teknik belajar, pengaturan waktu belajar, kemampuan belajar, motivasi belajar, dan interaksi guru.

Peningkatan kemampuan membaca pemahaman dengan model pembelajaran mind mapping di kelas VI SDN Arjosari Kecamatan Rejoso Kabupaten Pasuruan / Silvia Ida Librianti

 

Kata kunci: Membaca pemahaman, Model pembelajaran Mind Mapping Kemampuan membaca besar manfaatnya untuk mempelajari bidang studi lain, sehingga dinyatakan, bahwa membaca dapat dianggap sebagai gerbang untuk mengenal, memahami, dan mendalami pembelajaran lain. Dikemukakan lagi bahwa dalam membaca terkandung prinsip yaitu memahami apa yang di baca/memahami isi bacaan, Pembelajaran melalui metode mind mapping merupakan teknik untuk mengembangkan pendekatan berfikir yang lebih kreatif dan inovatif dengan cara menempatkan siswa dalam kelompok-kelompok kecil yang memiliki kemampuan berbeda. Berdasarkan paparan tersebut di atas maka peneliti ingin mencoba melakukan PenelitianTindakan Kelas: Bagaimanakah langkah-langkah model pembelajaran Mind Mapping pada membaca pemahaman dan apakah model pembelajaran mind mapping dapat meningkatkan kemampuan membaca pemahaman siswa kelas VI SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan? Rancangan penelitian yang digunakan dalam penelitian ini menggunakan rancangan penelitian tindakan kelas (PTK). yang dikembangkan oleh Kemmis dam Mc Tanggart.meliputi empat jalur (langkah), yaitu: Planning –perencanaan; acting– tindakan dan observing - pengamatan; reflecting – perefleksian; dan revise plan – perbaikan rencana. Dalam penelitian ini yang akan menjadi subyek penelitian adalah siswa kelas VI SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan sebanyak 32 siswa. Teknik pengumpulan data akan dilakukan dengan teknik observasi, wawancara, tes, dan dokumentasi. Berdasarkan hasil penelitian, maka dapat ditemukan bahwa Model pembelajaran mind mapping, telah dilaksanakan pada pembelajaran bahasa Indonesia di Kelas VI SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan. Kemampuan membaca pemahaman siswa Kelas VI SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan pada siklus I rata-rata kelas 66,56 sedangkan ketuntasan belajar masih 56,25% belum memenuhi Kriteria Ketuntasan Minimal (KKM). Dengan memperhatikan refleksi pada siklus I diadakan perbaikan dan pada siklus II terdapat peningkatan kemampuan membaca pemahaman siswa Kelas VI SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan setelah menerapkan model pembelajaran mind mapping pada siklus II rata-rata kelas 74,68 sedangkan ketuntasan belajar mencapai 87,50% berarti telah memenuhi Kriteria Ketuntasan Minimal (KKM). Berdasarkan hasil penelitian tersebut di atas, peneliti mengemukakan saran yang diharapkan dapat menjadi rekomendasi dalam upaya meningkatkan mutu pendidikan. Disarankan bagi guru untuk menggunakan model pembelajaran mind mapping sebagai salah satu upaya peningkatan prestasi belajar siswa khususnya pada kemampuan membaca pemahaman, Bagi siswa khususnya Kelas VI SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan hendaknya menyadari betapa pentingnya meningkatkan prestasi belajarnya terutama dengan melalui pembelajaran dengan teknik mind mapping. Hasil penelitian ini akan merupakan referensi dan sumbangan yang berarti untuk pengembangan ilmu pengetahuan yang lebih kualified. Dengan Penelitian Tindakan Kelas ini, penulis disarankan untuk mengembangkan penelitian yang lebih berkualitas dan berdaya guna untuk pengembangan sifat dan karakter ilmiah.

Penggunaan media kartu gambar untuk meningkatkan penguasaan kosa kata anak kelompok B pada TK Angkasa I Malang / Widayati

 

Kata Kunci: Kosa Kata, Media Kartu Gambar. Latar belakang penelitian ini adalah kecenderungan yang tampak adalah anak-anak kelompok B Angkasa I Malang kurang menguasai sejumlah kosakata yang sebenarnya dengan mudah dapat mereka temui sehari- hari, terutama yang sesuai dengan usia anak. Ada ± 5 anak yang kosakatanya masih rendah dikarenakan anak cenderung terpengaruh oleh bahasa yang didengar oleh anak melalui acara televisi, sehingga kosa kata yang digunakan oleh anak tidak baku. Tujuan penelitian ini adalah 1) Mendeskripsikan penggunaan media kartu gambar dalam meningkatkan penguasaan jumlah kosa kata anak Kelompok B TK Angkasa 1 Malang, 2) Mendeskripsikan peningkatan penguasaan kosakata melalui media kartu gambar anak Kelompok B pada TK Angkasa 1 Malang. Penelitian ini dilakukan di TK Angkasa I Malang dengan subjek penelitian sebanyak 14 anak. Rancangan penelitian yang digunakan yaitu Penelitian Tindakan Kelas dengan menggunakan dua siklus. Setiap siklus terdiri atas perencanaan, pelaksanaan, tindakan, observasi dan refleksi. Teknik pengumpulan data observasi dan instrumen yang digunakan adalah pedoman observasi dan dokumentasi. Teknik analisa data yang digunakan yaitu analisa deskriptif. Hasil penelitian ini menunjukkan kemampuan bahasa anak meningkat sesuai dengan indikator yang ingin dicapai seperti: membedakan dan menirukan kembali bunyi suara tertentu, menirukan kembali 4-5 urutan kata, menyebutkan / membedakan kata-kata yang mempunyai suku awal yang sama seperti kali-kali atau suku kata akhir yang sama misalnya nama, sama dan lain-lain, mengelompokkan kata-kata yang sejenis, dan bercerita tentang gambar yang disediakan atau yang dibuat sendiri dengan urut dan bahasa yang jelas pada anak mengalami peningkatan 1,6. Penelitian ini dapat disimpulkan dalam pelaksanaan kegiatan pembelajaran menggunakan kartu gambar anak merasa sangat senang dan gembira. Dan ada beberapa saran-saran dari penulis untuk guru, sekolah TK, dan penelitian lanjutan. Saran untuk guru yaitu untuk meningkatkan kemampuan bahasa anak. Saran untuk sekolah TK yaitu upaya peningkatan mutu pembelajaran yang PAKEMI (Pembelajaran Aktif, Kreatif , Efektif, menyenangkan dan Inovatif). Dan penelitian lanjutan yaitu mencoba teliti lagi dalam aktivitas pembelajaran dengan menggunakan media kartu gambar.

Pengembangan sumber belajar berbasis E-Learning pada materi pengembangan diri untuk SMK kompetensi keahlian pemasaran / Erlina Kurniawant

 

Kata kunci: pengembangan sumber belajar, e-learning, iklan cetak Peningkatan kualitas pengajaran dan kesempatan belajar di Indonesia terkendala oleh keterbatasan ruang dan waktu. Hal ini disebabkan Indonesia yang wilayahnya tersebar di berbagai daerah sehingga mempersulit pelaksanaan pendidikan yang merata. Untuk mengatasi hal tersebut, pendidikan dapat memanfaatkan salah satu teknologi jaringan belajar yang disebut online technology. Teknologi ini sebagai alternatif pemerataan kesempatan belajar yang memungkinkan peserta didik dapat mengakses sendiri materi atau bahan yang dibelajarkan (self contained materials) yaitu dalam bentuk e-learning. Tujuan penelitian ini adalah mengembangkan sumber belajar berbasis e-learning pada materi Pengembangan Diri untuk SMK Kompetensi Keahlian Pemasaran. Model pengembangan yang digunakan dalam penelitian ini adalah model pengembangan Reiser dan Mollenda yang disesuaikan dengan pengembangan sumber belajar berbasis e-learning. Instrumen pengumpulan data yang digunakan pada pengembangan ini berupa angket yang disebarkan kepada ahli media, ahli materi, dan responden. Data yang diperoleh berupa data kuantitatif dan data kualitatif. Sampel uji coba kelompok kecil dan uji coba lapangan diambil dari peserta didik SMK YP Tujuh Belas Selorejo-Blitar, SMK Negeri 1 Panggungrejo-Blitar dan SMK PGRI Sooko Mojokerto. Produk sumber belajar berbasis e-learning ini menggunakan software Moodle. Hasil validasi sumber belajar dari ahli media mendapat persentase 87.5%, dari ahli silabus materi mendapat persentase 90.28%, dari ahli materi mendapat persentase 94.58%, dan dari responden 89.83%. Berdasarkan hasil validasi tersebut, sumber belajar berbasis e-learning pada materi pengembangan diri untuk SMK kompetensi keahlian pemasaran dapat disimpulkan valid/layak dan efektif digunakan sebagai sumber belajar mandiri. Deseminasi sumber belajar ini dapat diterapkan pada SMK jurusan pemasaran. Pengembangan sumber belajar lebih lanjut dapat ditambahkan materi lain baik materi tentang pengembangan diri maupun materi lain.

Problematika guru bahasa Jerman dalam melaksanakan pembelajaran berdasarkan KTSP (studi kasus terhadap guru bahasa Jerman SMAN 7 Malang) / Maria Mulia Sarianti

 

Mata pelajaran bahasa Jerman memiliki peran yang cukup penting bagi perkembangan anak didik di Indonesia sejalan dengan pesatnya perkembangan zaman pada era teknologi informasi saat ini. Pengetahuan dan penelitian menempati kedudukan kuat dalam kehidupan umum di Jerman sehingga pemerhati dan peneliti pengetahuan dan teknologi dunia banyak menyoroti Jerman. Dalam mata pelajaran bahasa Jerman, sesuai dengan Kurikulum Tingkat Satuan Pendidikan (KTSP), aspek-aspek yang dikembangkan adalah: (a) empat keterampilan berbahasa, yaitu mendengar, berbicara, membaca, dan menulis, (b) unsur-unsur kebahasaan meliputi tata bahasa, kosakata, pelafalan, dan ejaan, serta (c) aspek budaya yang terkandung dalam teks lisan dan tulisan. Tujuan yang ingin dicapai adalah peserta didik mampu berkomunikasi baik secara lisan maupun tulisan dalam bahasa Jerman. KTSP sebagai kurikulum yang cukup baru diberlakukan tentunya masih ditemui berbagai problematika dari berbagai segi, antara lain: perencanaan, pelaksanaan, dan evaluasi. Penelitian ini bertujuan untuk mengetahui problematika guru bahasa Jerman SMAN 7 Malang dalam melaksanakan pembelajaran berdasarkan KTSP. Untuk mendapatkan hasil yang diharapkan, penelitian ini menggunakan rancangan deskriptif kualitatif. Teknik pengumpulan data yang digunakan adalah dokumentasi, observasi partisipasi pasif, dan wawancara. Penelitian ini diadakan di SMAN 7 Malang yang terletak di jalan Cengger Ayam I/ 14. Data yang digunakan dalam penelitian ini berupa fenomena pembelajaran bahasa Jerman yang dilakukan oleh guru bahasa Jerman dan siswa-siswi di SMAN 7 Malang, sumber datanya adalah guru bahasa Jerman SMAN 7 Malang. Teknik pengecekan keabsahan data yang digunakan dalam penelitian ini adalah triangulasi sumber. Hasil penelitian menunjukkan bahwa pelaksanaan pembelajaran bahasa Jerman di SMAN 7 Malang sudah sesuai dengan KTSP. Problematika yang dihadapi oleh guru SMAN 7 Malang antara lain (1) dalam perencanaan adalah kesulitan dalam merencanakan media pembelajaran, (2) problematika dalam pelaksanaan pembelajaran adalah penggunaan media yang berupa LCD, kesulitan dalam mencari metode yang digunakan, serta pembelajaran keterampilan berbahasa meliputi hören dan schreiben, dan (3) problematika dalam penilaian adalah kesulitan dalam melakukan penilaian terhadap siswa yang pada saat penilaian berlangsung tidak ada di tempat. Upaya yang dilakukan guru untuk mengatasi permasalahannya adalah dengan menggunakan media manual seperti dadu, gambar dan kartu, menggunakan metode mengajar yang lebih bervariasi. Kesabaran dan ketekunan dalam memberi latihan dilakukan guru untuk mengatasi masalah kesulitan siswa dalam memahami kompetensi dasar, serta penambahan porsi belajar. Untuk mengatasi masalah penilaian, guru memberikan remidi atau tugas bagi siswa yang tidak masuk saat penilaian berlangsung dan bagi siswa yang nilainya belum dapat mencapai Standar Ketuntasan Minimal (SKM) yang telah ditetapkan. Berdasarkan hasil penelitian tersebut, peneliti dapat memberikan saran bagi beberapa pihak. Bagi Jurusan Sastra Jerman penelitian ini dapat menambah bahan pustaka dan sebagai bahan acuan untuk penelitian sejenis di waktu yang akan datang. Bagi guru, disarankan untuk segera mengatasi problematika yang dihadapi dan lebih profesional dalam menerapkan kurikulum. Dari hasil penelitian ini disarankan kepada kepala sekolah untuk mengadakan pertimbangan penambahan jumlah guru untuk mengajar bahasa Jerman guna mendapatkan hasil yang maksimal sesuai dengan tujuan KTSP.

Pelabelan diri dalam interaksi sosial siswa kelas unggulan SMA Negeri 1 Papar Kediri tahun ajaran 2010/2011 / Santy Andrianie

 

Kata Kunci: pelabelan, interaksi sosial, kelas unggulan Penelitian ini dilatarbelakangi oleh adanya label yang digunakan oleh siswa kelas unggulan dalam interaksi sosial mereka. Pemaknaan tentang label dan alasan tentang label yang melekat pada diri siswa kelas unggulan akan berpengaruh pada interaksi sosial mereka. Fokus penelitian ini adalah bagaimanakah pelabelan tersebut berpengaruh terhadap bentuk interaksi sosial siswa kelas unggulan terhadap diri dan lingkungan sosialnya. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus. Pemilihan subjek penelitian menggunakan teknik snowball sampling. Dalam penelitian ini, yang menjadi sumber data utama adalah kata-kata dan tindakan dalam lingkungan sosial siswa kelas unggulan. Data tersebut didukung dengan sumber tertulis yang berkaitan dengan siswa kelas unggulan seperti buku pribadi dan daftar nilai serta foto aktifitas siswa kelas unggulan. Data dikumpulkan dengan melakukan observasi partisipatif, wawancara mendalam, triangulasi dan dokumentasi. Analisis data yang didapat selama satu bulan penelitian ini dilakukan menggunakan teknik deskriptif melalui reduksi data, displai data, dan verifikasi data. Setelah data tersebut diperoleh kemudian dilakukan pengecekan keabsahan data dengan menggunakan perpanjangan keikutsertaan metode trianggulasi, ketekunan pengamatan, dan pemeriksaan sejawat melalui diskusi. Temuan penelitian menunjukkan ada dua label yang melekat pada diri siswa kelas unggulan yaitu label sebagai kelas unggulan-unggulanan dan ita-itu. Label ini muncul pada perilaku siswa kelas unggulan didasari karena adanya keinginan mendapatkan kepuasan jika menunjukkan perilaku label tersebut serta adanya keinginan untuk mendapatkan perhatian dari lingkungan sekitarnya. Perilaku label ini ditunjukkan dengan berbagai cara dalam hampir setiap kegiatan siswa, baik ketika pelajaran maupun saat istirahat dan juga ketika jam kosong di sekolah. Di antara personil sekolah memberikan respon yang berbeda-beda terhadap perilaku label yang ditunjukkan siswa kelas unggulan. Ada yang memberikan respon negatif, dengan menilai bahwa siswa kelas unggulan yang ada saat ini tidak seperti yang diharapkan, ada yang memberi respon positif bahwa perilaku label tersebut merupakan hal yang wajar bagi remaja, dan ada yang bersikap netral yang tidak membenarkan ataupun menyalahkan perilaku label tersebut. Bagi pihak-pihak yang memberikan reaksi netral dan positif perilaku label yang ditunjukkan oleh siswa kelas unggulan, tidak menimbulkan masalah dalam kegiatan interaksi sosial mereka. Namun bagi pihak yang memberikan reaksi negatif terhadap perilaku label yang ditunjukkan siswa kelas unggulan perilaku label ini acapkali memicu adanya konflik dalam interaksi sosial mereka. Berdasarkan hasil temuan penelitian ini, diberikan saran kepada pihak yang terkait dengan penyelenggaraan pendidikan kelas unggulan diharapkan untuk tidak memberikan penilaian secara sepihak terkait label yang ditunjukkan oleh siswa kelas unggulan, namun juga dapat memahami dan mengarahkan siswa kelas unggulan agar dapat maksimal dalam aspek-aspek perkembanggan kognitif, afektif, dan psikomotorik. Kepada penyelenggara kegiatan bimbingan dan konseling di sekolah, diharapkan dapat merancang program layanan yang dapat membantu bagi anak-anak yang diuntungkan dalam pelaksanaan program kelas unggulan ini.

Perbedaan kemampuan interaksi sosial antara remaja adiksi internet dengan remaja non-adiksi di Universitas Negeri Malang / Endhi Ratnani Firdausi

 

Kata kunci: interaksi sosial, adiksi internet Penelitian ini bertujuan untuk mengetahui perbedaan kemampuan interaksi antara remaja adiksi internet dengan remaja non-adiksi di Universitas Negeri Malang. Penelitian ini dilakukan kepada 85 mahasiswa Universitas Negeri Malang. Data dikumpulkan dengan skala internet addiction disorder (koefisien relibialitas 0,938) dan skala kemampuan interaksi sosial (koefisien relibialitas 0,890). Data dianalisis dengan uji Independent Samples t-test. Hasil penelitian menunjukkan bahwa terdapat perbedaan antara kemampuan interaksi sosial antara remaja adiksi internet dengan remaja non-adiksi di Universitas Negeri Malang dengan nilai t sebesar -5,626, nilai F sebesar 0,016, serta signifikansi (0,000 < 0.05).

Pengaruh sikap terhadap tayangan iklan di media televisi dengan perilaku konsumtif mahasiswa di Universitas Negeri Malang / Pitra Nervie

 

Kata Kunci: sikap terhadap iklan televisi, perilaku konsumtif, mahasiswi Remaja biasanya mudah terbujuk oleh rayuan iklan, suka ikut-ikutan teman, dan cenderung boros dalam menggunakan uang (Tambunan, 2001). Iklan merupakan informasi yang memberikan berita yang up to date kepada konsumen mengenai produk yang bertujuan menjaga tingkat produksi. Iklan ternyata mampu menumbuhkan sikap konsumerisme masyaratkat, sehingga masayarakat mengkonsumsi barang dan jasa secara berlebihan (Widyatama, 2007). Penelitian ini dilaksanakan dengan tujuan untuk mengetahui (1) sikap mahasiswi di Universitas Negeri Malang terhadap iklan di televisi (2) perilaku konsumtif pada mahasiswi di Universitas Negeri Malang (3) pengaruh sikap terhadap tayangan iklan di televisi terhadap perilaku konsumtif pada mahasiswi di Universitas Negeri Malang. Populasi dalam penelitian ini adalah mahasiswi di Universitas Negeri Malang, sampel dalam penelitian ini berjumlah 80 orang dengan menggunakan teknik purposive sampling. Penelitian ini menggunakan dua instrumen (1) skala sikap terhadap iklan di televisi dengan reliabilitas 0,934 (2) skala perilaku konsumtif dengan reliabilitas 0,893. Hasil dari penelitian ini adalah (1) Subjek memiliki sikap positif terhadap iklan di televisi sebanyak 10 orang (12,5% ), memiliki sikap netral 56 orang (70%), dan yang memiliki sikap negatif sebanyak 14 orang (17,5%). (2) Subjek sebagian besar memiliki perilaku konsumtif dalam tingkatan sedang yaitu sebanyak 52 orang (65%), 15 orang (18,75%) dalam tingkat yang tinggi, dan 13 orang (16,25%) termasuk dalam tingkat rendah. (3) Uji regresi dengan menggunakan analisis Regresi Linier diperoleh bahwa terdapat pengaruh sikap terhadap tayangan iklan di televisi terhadap perilaku konsumtif pada mahasiswi di Universitas Negeri Malang. Disarankan pada mahasiswi untuk mengurangi atau menghilangkan pola perilaku konsumtif khususnya dalam mengkonsumsi kosmetik. Diharapkan pada pengiklan dapat membuat tayangan iklan yang dapat menimbulkan sikap positif terhadap yang melihatnya, dengan cara menumbuhkan ketertarikan dan kepercayaan akan produk yang diiklankan sehingga konsumen akan mengkonsumsi produk tersebut. Untuk penelitian selanjutnya diharapkan meneliti variabel-variabel lain agar dapat mendeskripsikan fenomena perilaku konsumtif dengan lebih mendalam dan memperluas populasi penelitian agar hasil penelitian yang diperoleh menjadi lebih variatif dan lebih akurat. Perbaikan instrumen dan teknik analisis juga perlu dilakukan agar hasil yang didapat lebih maksimal.

Pengaruh bauran eceran (retailing mix) terhadap keputusan pembelian konsumen (studi pada Apolo Swalayan Jombang) / Retno Sari Dewanti

 

Kata kunci: Bauran eceran, keputusan pembelian konsumen. Seiring dengan perkembangan dunia bisnis dan kebutuhan manusia akan barang dan jasa, banyak bermunculan perusahaan dagang yang bergerak di bidang perdagangan eceran (retail) yang berbentuk toko, minimarket, pasar swalayan dan lain-lain. Jumlah pasar swalayan yang semakin meningkat tersebut menyebabkan persaingan yang semakin ketat. Persaingan yang semakin ketat menuntut pelaku bisnis untuk pandai-pandai mengatur strategi untuk dapat memenangkan persaingan yaitu dengan mengembangkan strategi-strategi pemasaran berdasarkan sasaran dan rencana strategis keseluruhan. Strategi-strategi yang digunakan pengecer untuk mencapai sasarannya yaitu dengan merumuskan bauran eceran (retailing mix). Penelitian ini dilaksanakan dengan tujuan untuk mengetahui: (1) deskripsi bauran eceran (retailing mix) dan keputusan pembelian konsumen pada Apolo walayan, Jombang, (2) Pengaruh positif bauran eceran (retailing mix) secara parsial yang signifikan terhadap keputusan pembelian konsumen pada Apolo Swalayan, Jombang, (3) Pengaruh positif bauran eceran (retailing mix) secara simultan yang signifikan terhadap keputusan pembelian konsumen pada Apolo Swalayan, Jombang. (4) serta untuk mengetahui elemen bauran eceran (retailing mix) yang dominan mempengaruhi keputusan pembelian di Apolo Swalayan, Jombang. Variabel bebas dalam penelitian ini terdiri dari Merchandise (X1), harga (X2), Lokasi (X3), Promosi (X4), retail service (X5), atmosphere (X6),dan variabel terikatnya adalah keputusan pembelian konsumen (Y). Jenis dari penelitian ini adalah asosiatif. Populasi dalam penelitian ini adalah konsumen yang melakukan pembelian di Apolo Swalayan Jombang. Sampel dalam penelitian ini adalah sebanyak 100 responden. Penentuan jumlah sampel menggunakan rumus untuk populasi tak terhingga.. Instrumen dalam penelitian ini adalah kuesioner, skala pengukuran yang dipakai adalah Skala Likert (Sangat Setuju, Setuju, Cukup Setuju, Kurang Setuju, dan Tidak Setuju). Analisis data menggunakan regresi linier berganda dan uji asumsi klasik. Hasil dalam penelitian ini menyimpulkan bahwa (1) terdapat pengaruh secara parsial bauran eceran (X1) terhadap keputusan pembelian konsumen dengan nilai B = 0,264 dan sig t = 0,000, terdapat pengaruh secara parsial bauran eceran (X2) terhadap keputusan pembelian konsumen dengan nilai B = 0,312 dan sig t = 0,000, terdapat pengaruh secara parsial bauran eceran (X3) terhadap keputusan pembelian konsumen dengan nilai B = 0,184 dan sig t = 0,003, terdapat pengaruh secara parsial bauran eceran (X4) terhadap keputusan pembelian konsumen dengan nilai B = 0,185 dan sig t = 0,020, terdapat pengaruh secara parsial bauran eceran (X5) terhadap keputusan pembelian konsumen dengan nilai B = 0,127 dan sig t = 0,003, tidak terdapat pengaruh secara parsial bauran eceran (X6) terhadap keputusan pembelian konsumen dengan nilai B = 0,031 dan sig t = 0,693. (2) Terdapat pengaruh merchandise (X1), harga (X2), lokasi (X3), promosi (X4), retail service (X5), atmosphere (X6),secara simultan terhadap keputusan pembelian konsumen berdasarkan nilai Fhitung sebesar 51,193 dengan tingkat signifikansi 0.000. Sub variabel dari bauran eceran yang dominan berpengaruh terhadap keputusan pembelian konsumen adalah harga (X2) dengan nilai sumbangan efektif sebesar 22,5%. Selain itu, dalam diketahui pula Adjusted R Square sebesar 0,753, ini berarti bahwa variabel merchandise, harga, lokasi, promosi, retail service dan atmosphere secara bersama-sama mempengaruhi keputusan pembelian sebesar 75% sedangkan sisanya sebesar 25% dijelaskan oleh variabel lain yang tidak dijelaskan dalam penelitian ini. Berdasarkan penelitian ini dapat disimpulkan bahwa: (1)Variabel bauran eceran (retail mix) yang terdiri dari variabel merchandise, harga, lokasi, promosi, lokasi, retail service dan atmosphere mempengaruhi keputusan pembelian Apolo Swalayan Jombang baik secara simultan maupun parsial. (2) Setiap variabel bauran eceran (retail mix) dapat mempengaruhi penjualan di Apolo Swalayan Jombang dan satu sama lain saling mempengaruhi. (3) Dari hasil uji t diketahui bahwa variabel yang memiliki nilai koefisien Beta yang distandarisasi yang terbesar adalah variabel harga (X2). Hal ini membuktikan bahwa harga merupakan variabel yang berpengaruh dominan terhadap keputusan pembelian konsumen pada Apolo Swalayan Jombang. (4) Variabel atmosphere kurang berpengaruh terhadap keputusan pembelian konsumen Apolo Swalayan. Saran dalam penelitian ini adalah: (1) pengelola Apolo Swalayan Jombang perlu memperhatikan pengaruh bauran eceran terhadap keputusan pembelian konsumen dalam penyusunan rencana maupun strategi pemasaran Apolo Swalayan Jombang. (2) pengelola Apolo Swalayan dapat melakukan penetapan harga yang mampu bersaing dengan Swalayan lain. (3) pengelola Apolo Swalayan diharapkan dapat melakukan peningkatan kualitas dalam toko, misalnya dalam segi desain interior dan eksterior, memperhatikan suhu ruangan agar membuat konsumen nyaman dalam berbelanja, dll. (4) meningkatkan pelayanan terhadap konsumen sangat penting untuk memberikan kesan yang positif dengan cara pelatihan karyawan dalam melayani baik keterampilan teknis maupun keterampilan antarpribadi. Yang dapat diwujudkan dari komitmen semua karyawan untuk meningkatkan pelayanan (5) bagi peneliti lain yang berminat mengembangkan studi ini disarankan untuk lebih memperdalam kajian melalui pengembangan item-item pernyataan untuk variabel-variabel bauran eceran (retail mix) dan meneliti variabel-variabel lain yang belum masuk dalam model, karena dalam penelitian ini masih terdapat variabel lain yang dapat mempengaruhi keputusan pembelian yang ditunjukkan dengan sisa nilai adjusted R square sebesar 25%.

Penerapan media brettspiel dalam keterampilan berbicara bahasa Jerman siswa kelas XI Bahasa SMA Negeri 8 Malang / Arif Yanuar Pribadi

 

Kata Kunci: Media, Brettspiel, Keterampilan Berbicara Bahasa Jerman. Media adalah alat pembelajaran yang dapat digunakan untuk mengajar bahasa Jerman. Brettspiel merupakan salah satu jenis media pengajaran. Dengan menggunakan Brettspiel guru dapat memberikan rangsangan kepada siswa. Cara bermain media tersebut yaitu dengan bantuan lawan dan tema bicara. Brettspiel dimainkan di atas papan. Untuk itu dibutuhkan pion, kartu, dan dadu. Tujuan dari penelitian ini adalah untuk menggambarkan penerapan media Brettspiel dalam keterampilan berbicara Bahasa Jerman siswa kelas XI Bahasa SMA Negeri 8 Malang. Metode yang digunakan pada penelitian ini adalah metode penelitian kualitatif. Populasi dari penelitian ini adalah siswa kelas XI Bahasa SMA Negeri 8 Malang. Jawaban angket siswa dan hasil observasi digunakan untuk mengetahui penerapan media Brettspiel dalam keterampilan berbicara Bahasa Jerman. Hasil penelitian menunjukkan bahwa siswa dapat lebih aktif dalam berbicara Bahasa Jerman. Enam dari delapan siswa berpendapat bahwa materi pada media Brettspiel sesuai dengan tingkat kemampuan dan pengetahuan siswa. Disarankan kepada guru bahasa Jerman untuk mengatur tempat duduk siswa dengan baik sebelum bermain. Guru disarankan agar memperbaiki pelafalan bahasa Jerman siswa menjadi lebih baik lagi. Kepada peneliti selanjutnya disarankan untuk menyempurnakan permainan ini dengan materi atau tema yang lain.

Evaluasi automatic voltage regulator pada generator sebagai pembangkit listrik tenaga mikrohidro di Kelurahan Temas Kota Batu / Jajang Candra Lesmana

 

Kata Kunci: generator sinkron, AVR, mikrohidro, brush exitation. Pembangkit Listrik Tenaga Mikrohidro (PLTMh) yang terdapat di Kelurahan Temas, Kota Batu. PLTMh tersebut merupakan suatu pembangkit yang perlu di kembangkan, sehingga pembangkit yang sudah ada dapat difungsikan secara optimal, dimana daya keluaran yang dihasilkan sekitar 4,43 kW dengan kapasitas total generator 10 kW. Penulis akan membahas tentang studi evaluasi terhadap generator PLTMh di Kelurahan Temas, Kota Batu dan perencanaan Automatic Voltage Regulator (AVR) pada generator sinkron 1 fasa yang difungsikan sebagai alat pengatur pada sistem penguatan kutub generator tipe Brush Exitation menggunakan sikat-sikat sebagai penghubung dengan slipring pada rotor. Dari hasil pengujian terhadap generator tanpa beban, diketahui daya keluaran generator menunjukkan bahwa jumlah putaran generator pada saat mencapai 1500 rpm menghasilkan tegangan keluaran 230 Volt, dimana hal tersebut sudah sesuai dengan data nameplate pada generator. Sedangkan pada pengujian berbeban baik pada saat frekuensi tetap maupun tegangan tetap menunjukkan penurunan keluaran generator pada setiap kenaikkan beban yang mengakibatkan generator menjadi berputar pelan dan berat, beban yang digunakan mencapai 935 Volt. Dalam pengevaluasian ini, dirancang sebuah Automatic Voltage Regulator (AVR) yang berfungsi untuk memberikan arus eksitasi pada penguatan kutub jenis Brush Exitation yang dihubungkan ke slipring rotor dengan menggunakan sikat-sikat arang. Dimana AVR mampu menghasilkan tegangan keluaran VDC maksimal 60,65 Volt pada saat tegangan input mencapai 150-165 Volt dengan kondisi potensiometer pengatur tegangan input AVR menunjukkan posisi setegah terbuka, apabila potensiometer terbuka penuh maka keluaran AVR mencapai 75,23 VDC. Dan pada saat input > 220 Volt maka tegangan output AVR akan turun hingga mencapai 23 VDC.

Using pictures to improve the speaking skill of the seventh graders of MTs Al-Madany Menganti Gresik in delivering oral description / Siswa Yusbido

 

Thesis, English Language Teaching, Graduate Program, State University of Malang. Advisors: (1) Dr. Enny Irawati, M.Pd. (2) Dr. Sri Rachmajanti, Dip. TESL, M.Pd. Key words: Pictures, Improving Speaking Skill, Delivering Oral Description. The objective of the research is to improve the speaking skill of the seventh graders of MTs Al-Madany Menganti-Gresik by using the pictures. This research was conducted on the basis of the result of preliminary study of the seventh graders of MTs Al- Madany Kec. Menganti Kab. Gresik showed that the speaking skill in delivering oral description was not sufficient based on the minimum adequacy criterion (Kriteria Ketuntasan Minimum) that was 6.0. The students’ average score was 2,5 or only 2 of eighteen students could pass. By using the pictures of people the researcher is greatly motivated to solve some problems arising in the teaching of speaking skill. This research employed classroom-action research design to improve the students’ speaking skill using picture with the research problem: How can using pictures improve the speaking skill of seventh grade students at MTs Al - Madany Kec. Menganti Kab. Gresik in delivering oral description? The procedure of the research consisted of four main steps i.e. planning, implementing, observing and reflecting. This research was conducted in two cycles. Each cycle comprised two meetings. The subjects of the study were class VII of MTs Al-Madany Kec. Menganti Kab. Gresik in the 2010-2011 academic years consisting18 students. The instruments for collecting the data were questionnaire, observation checklist, field notes, and speaking assessment. Implementing pictures for teaching speaking involves: 1) show some pictures to the students, 2) guide students to find some words based on the pictures, 3) asking questions to the students to check the students’ understanding about words related to the pictures, 4) translating and pronouncing the words to make clear what the pictures are about while teacher writes the description of pictures on the board to become a model in describing someone for the students, 5) dividing the students into four or five groups to do short question and answer base on the pictures given, 6) giving a model in describing someone trough pictures, 7) asking the students to make brief notes of their ideas based on the pictures, 8) asking and guiding the students to do a monolog in describing someone based on the pictures, 9) correcting the student’s pronunciation and grammar usage, 10) asking the students with the different pictures in each group or individually to practice more in or out of class to develop their speaking ability. The finding of the research indicated that the uses of pictures were successful in improving students’ speaking skill based on the students’ speaking performance that could achieve the criteria of success (60% students achieve the standard minimum score 60). The improvement could be seen from the increase of the students’ speaking assessment in cycles one two. It found that 5 (28%) of the students who got 34-54 (Poor Score), 7 (39%) of the students who got 55-64 (Average Score), 4 (22%) of students who got 65-84 (Good Score) and 2 (11%) of the students who got 85-100 (Very Good Score) in cycle one. And in cycle two, 1 (6%) of the students who got 34-54 (Poor Score), 5 (28%) of the students who got Average Score, 8 (44%) of students who got 65-84 (Good Score) and 4 (22%) of the students who got 85-100 (Very Good Score). Based on the improvement of the students’ speaking skill after the implementation of using pictures of people in teaching speaking, it is suggested the English teacher and other language teachers who have similar classroom problems to implement the technique in their class particularly in the speaking class. To the principals, they should provide facilities of media to improve the English teachers’ teaching quality, to socialize the teaching technique to the teachers, and to hold an in-service training about teaching methods for the English teachers. For the future researchers, they should conduct the research more attentive with some students’ obstacles arising like pronunciation, grammar and background knowledge of vocabularies, besides implementing pictures in teaching other language skills such as listening and writing.

Pengembangan bahan ajar Computer Assisted Instruction (CAI) IPA terpadu tema air limbah rumah tangga sebagai media belajar siswa SMP/MTs kelas VII / Lailatul Masruroh

 

Kata kunci: CAI, IPA terpadu, media belajar, tema air limbah rumah tangga. Peraturan Menteri Pendidikan Nasional Nomor 22 Tahun 2006 menyatakan bahwa substansi mata pelajaran IPA untuk SMP/ MTs merupakan IPA terpadu. Bahan ajar memiliki peran yang penting dalam pembelajaran terpadu. Pengembangan bahan ajar IPA Terpadu harus disesuaikan dengan perkembangan IPTEK. Oleh karena itu, dilakukan penelitian dan pengembangan dengan tujuan untuk mengembangkan dan menguji kelayakan Bahan Ajar Computer Assisted Instruction (CAI) IPA Terpadu Tema Air Limbah Rumah Tangga sebagai Media Belajar Siswa SMP/MTs Kelas VII. Penelitian ini merupakan penelitian pengembangan yang menggunakan metode Borg dan Gall, yaitu (1) studi pendahuluan yang terdiri dari studi pustaka, survei lapangan, dan rencana pengembangan, (2) pengembangan draft produk yang terdiri dari draft produk, uji kelayakan, revisi draft produk, dan produk hasil pengembangan. Kelayakan diukur dengan menggunakan uji kelayakan oleh ahli media (dosen Fisika dan Biologi) dan ahli materi (dosen Biologi dan guru IPA SMP). Desain uji coba dalam pengembangan bahan ajar CAI ini adalah uji coba terbatas pada siswa SMP Lab UM. Jenis data ada dua yaitu data kuantitatif dan data kualitatif untuk perbaikan bahan ajar CAI. Teknik analisis data yang digunakan adalah teknik analisis skor rata-rata. Hasil analisis rata-rata evaluator ahli media menunjukkan nilai tingkat kelayakan sebesar 3,43 (layak), ahli materi sebesar 3,60 (layak), dan audiens sebesar 3,32 (layak). Secara keseluruhan diperoleh rata-rata total sebesar 3,45 yang berada pada kategori layak. Berdasarkan analisis data kualitatif dari ahli media dan ahli materi, terdapat beberapa bagian produk yang perlu direvisi. Hal ini dilakukan untuk mengoptimalkan manfaat bahan ajar CAI sebagai media belajar di sekolah maupun mandiri. Berdasarkan perolehan uji kelayakan dapat disimpulkan bahwa Bahan Ajar CAI (Computer Assisted Instruction) IPA Terpadu Tema Air Limbah Rumah Tangga untuk Siswa SMP/MTs Kelas VII ini layak untuk digunakan sebagai media belajar siswa.

Peningkatan pembelajaran IPA siswa kelas III SDN Mergosono 2 Malang melalui penerapan problem-based learning / Wiwied Endrayeni

 

Kata-kata kunci : Pembelajaran, Model Problem-Based Learning, IPA Penelitian ini dilatarbelakangi oleh kenyataan bahwa pada umumnya guru IPA terpaku pada metode ceramah, Hasil observasi menyatakan dengan metode ceramah aktivitas siswa cenderung pasif dan hasil belajar siswa rendah. Problem-Based Learning merupakan salah satu model pembelajaran yang dapat digunakan sebagai alternatif dalam upaya meningkatkan aktivitas dan hasil belajar siswa. Penelitian ini bertujuan untuk mendiskripsikan (1) penerapan model Problem-Based Learning pada pelajaran IPA di kelas III SDN Mergosono 2, (2) aktivitas siswa selama pembelajaran, (3) hasil belajar siswa dengan diterapkannya model Problem-Based Learning pada mata pelajaran IPA. Rancangan penelitian ini menggunakan Penelitian Tindakan Kelas model Kurt Lewin dengan tahapan perencanaan (planning), tindakan (acting), observasi (observing), dan refleksi (reflecting). Subjek penelitian ini adalah siswa kelas III SDN Mergosono 2 dengan jumlah siswa 33, laki-laki sebanyak 15 siswa dan perempuan sebanyak 18 siswa. Teknik pengumpulan data menggunakan observasi, tes dan dokumentasi. Analisis data dilakukan secara diskriptif kualitatif. Hasil penelitian menunjukkan bahwa penerapan model Problem-Based Learning dapat dilaksanakan sesuai dengan tahapan-tahapannya yaitu (1) mengorientasi siswa pada masalah, (2) mengarahkan siswa untuk belajar, (3) membimbing siswa menemukan penjelasan dan pemecahan masalah, (4) mengembangkan dan menyajikan hasil karya, dan (5) menganalisis dan mengevaluasi proses pemecahan masalah. Aktivitas siswa selama pembelajaran berlangsung pada siklus I sebesar 74,5, meningkat pada siklus 2 menjadi 87. Hasil belajar pada siklus I mempunyai rata-rata kelas sebesar 72 meningkat pada siklus II menjadi 87. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa model Problem-Based Learning dapat meningkatkan aktivitas dan hasil belajar siswa. Jika peneliti lain ingin menggunakan model Problem-Based Learning dalam penelitiannya disarankan agar memperhatikan pengorganisasian siswa. Selain itu materi pokok yang digunakan juga perlu diperhatikan supaya pembelajaran dapat lebih dikemban

Upaya meningkatkan pembelajaran IPA siswa kelas IV SDN Bandungrejosari I Kota Malang melalui model Attention Relevance Confidance Satisfaction (ARCS) / Riyani

 

Kata kunci: Pembelajaran IPA, SD, Model ARCS Model ARCS merupakan model pembelajaran yang menitik beratkan pengelolaan dan peningkatan motivasi belajar siswa. Berdasarkan hasil observasi yang peneliti lakukan pada saat pembelajaran IPA di kelas IV SDN Bandungrejosari I Kota Malang didapatkan fakta bahwa pembelajaran yang dilakukan masih berpusat pada guru, pembelajaran kurang bervariasi, aktivitas siswa terlihat kurang aktif dan banyak yang mengantuk. Dari nilai siswa pada materi menggolongkan hewan berdasarkan makanannya menunjukkan rata-rata hasil belajar siswa hanya mencapai 48,88 dengan ketuntasan kelas 13%, sedangkan KKM yang ditentukan adalah 70.00 untuk hasil belajar dan 75% untuk ketuntasan kelas. Berkaitan dengan itu, maka diperlukan upaya perbaikan pembelajaran dengan menerapkan model pembelajaran ARCS. Penelitian ini dilaksanakan dengan tujuan untuk mendiskripsikan (1) penerapan model ARCS untuk meningkatkan pembelajaran IPA, (2) aktivitas siswa selama pembelajaran dengan model ARCS, (3) hasil belajar siswa setelah diterapkan model ARCS. Penelitian ini menggunakan jenis penelitian tindakan kelas (PTK) dengan pendekatan deskriptif kualitatif model kolaboratif. Subjek penelitian adalah siswa kelas IV SDN Bandungrejosari I Kota Malang. Dalam penelitian ini peneliti menjadi pengajar dan guru mata pelajaran IPA sebagai pengamat. Hasil penelitian menunjukkan bahwa penggunaan model pembelajaran ARCS pada pembelajaran IPA siswa kelas IV SDN Bandungrejosari I Kota Malang dengan standar kompetensi “Menggolongkan hewan berdasarkan jenis makanannya” dapat dilaksanakan dengan baik sesuai rencana. Hal ini ditunjukkan dengan perolehan keberhasilan guru dalam menerapkan model ARCS pada siklus I yaitu 75% dan meningkat pada siklus II menjadi 92,5%. Aktivitas siswa meningkat, siklus I 10,80% menjadi 12,71% pada siklus II. Hasil belajar juga meningkat dari rata-rata 62,82 dengan ketuntasan 46% pada siklus I menjadi rata-rata 70,64 dengan ketuntasan kelas mencapai 92% pada siklus II. Berdasarkan hasil penelitian, dapat disarankan dalam menerapkan model ARCS ini hendaknya guru mempersiapkan rencana pembelajaran yang matang, Pembelajaran hendaknya terpusat pada siswa, guru memberikan penghargaan berupa hadiah kecil pada siswa yang aktif dalam pembelajaran.

Analisis satuan biaya pendidikan mahasiswa Universitas Negeri Malang / Ahmad Rahman Budiman

 

Kata Kunci: analisis, satuan biaya pendidikan, mahasiswa Pendidikan tidak dapat terhindar dari adanya suatu biaya. “Biaya pendidikan merupakan komponen yang sangat penting dalam penyelenggaraan pendidikan” (Supriadi, 2004:3). Tanpa dukungan biaya, proses pendidikan tidak dapat berjalan dengan lancar. Menurut Peraturan Pemerintah No. 48 Tahun 2008, “pendanaan pendidikan merupakan tanggung jawab bersama antara pemerintah pusat, pemerintah daerah dan masyarakat”. Saat ini mayoritas orang menganggap, bahwa biaya pendidikan semata-mata hanya menjadi tanggung jawab pemerintah; padahal tidak sedikit orangtua dan calon mahasiswa yang telah menyadari, bahwa kuliah di perguruan tinggi dipandang sebagai investasi bagi masa depan mereka. Sementara itu, pemerintah belum bisa memastikan biaya pendidikan di perguruan tinggi yang ideal dan masyarakat mengeluhkan akan tingginya biaya pendidikan di perguruan tinggi, namun keluhan mereka tidak rasional karena tidak menyertakan rincian seberapa besar biaya pendidikan yang diperlukan. Sudah banyak studi, diskusi, dan perhitungan biaya pendidikan yang berbasis dana pemerintah dengan mengabaikan dana dari mahasiswa itu sendiri dan masyarakat. Sementara, dana yang dibelanjakan oleh mahasiswa untuk pendidikannya, misalnya untuk membeli buku kuliah, membayar sewa kamar, biaya konsumsi sehari-hari, dan lain-lain tidak pernah dihitung secara komprehensif. Penelitian ini bertujuan untuk mengetahui: (1) Besar biaya langsung yang dikeluarkan mahasiswa Universitas Negeri Malang per tahun, (2) Besar biaya tidak langsung yang dikeluarkan mahasiswa Universitas Negeri Malang per tahun, (3) Besar biaya pendidikan yang dikeluarkan mahasiswa Universitas Negeri Malang per tahun. Biaya yang diteliti meliputi besarnya biaya langsung yang terdiri dari biaya pokok, merupakan biaya yang dibebankan pihak universitas kepada mahasiswa untuk dapat menempuh proses pendidikan, biaya tidak langsung yaitu biaya ekstra dan biaya hidup, yang merupakan biaya penunjang proses pendidikan. Penelitian ini menggunakan rancangan deskriptif dengan pendekatan kuantitatif yang dilaksanakan di Universitas Negeri Malang (UM) dengan jumlah populasi mahasiswa UM yang berjumlah 19645 orang mahasiswa. Digunakan rumus Sample Size Formula Slovin, sehingga diperoleh jumlah sampel sebanyak 392 orang mahasiswa. Penelitian ini subjeknya berjenjang mulai mahasiswa tahun angkatan 2007, 2008, 2009, dan 2010 serta S1, S2, S3. Teknik penarikan sampel yang digunakan adalah teknik proportional stratified random sampling. Teknik pengumpulan data menggunakan kuesioner dan dokumentasi sebagai pendukung. Teknik analisis data menggunakan analisis deskriptif. Hasil penelitian ini menunjukkan, bahwa biaya langsung mahasiswa UM termasuk kategori sedang. Dan rata-rata biaya langsung per tahun mahasiswa FE sebesar Rp 3.490.977,00; FIK sebesar Rp 3.289.586,00; FIP sebesar Rp 3.064.061,50; FIS sebesar Rp 3.293.600,50; FMIPA sebesar Rp 3.546.817,20; FS sebesar Rp 3.270.756,50; FT sebesar Rp 3.716.440.30; Program Magister sebesar Rp 13.695.001,00; dan Program Doktor sebesar Rp 14.022.223,00. Biaya tidak langsung mahasiswa UM termasuk kategori rendah. Dan rata-rata biaya tidak langsung per tahun, mahasiswa FE sebesar Rp 16.207.815,00; FIK sebesar Rp 16.691.089,25; FIP sebesar Rp 14.948.188,00; FIS sebesar Rp 15.378.289,00; FMIPA sebesar Rp 13.434.437,00; FS sebesar Rp 15.443.430,00; FT sebesar Rp 16.588.784,00; Program Magister sebesar Rp 27.721.252,00; dan Program Doktor sebesar Rp 26.651.369,00. Biaya pendidikan mahasiswa UM termasuk kategori sedang. Dan rata-rata biaya pendidikan per tahun, mahasiswa FE sebesar Rp 19.698.792,00; FIK sebesar Rp 19.980.675,25; FIP sebesar Rp 18.012.249,50; FIS sebesar Rp 18.671.889,50; FMIPA sebesar Rp 16.981.254,20; FS sebesar Rp 18.714.186,50; FT sebesar Rp 20.305.224,30; Program Magister sebesar Rp 41.416.253,00; dan Program Doktor sebesar Rp 40.673.592,00. Berdasarkan kesimpulan tersebut, maka implikasi hasil penelitian ini adalah (1) Ditemukan perbedaan mencolok antara biaya langsung dan biaya tidak langsung, seharusnya mahasiswa atau orangtua mahasiswa menekan komponenkomponen biaya tidak langsung sehingga dapat menghemat pengeluaran, (2) Jika konsolidasi penghematan atas biaya tidak langsung sudah dilakukan dan tetap lebih tinggi daripada biaya langsung, maka harus dilakukan kebijakan menekan opportunity cost dengan langkah kuliah sambil bekerja, (3) Harus dikaji kembali kebijakan pemerintah terhadap pembiayaan pendidikan mengingat apabila investasi pada pendidikan tinggi selama 5 tahun menghabiskan dana Rp 95.000.000,00 dan lost of opportunity cost sejumlah itu pula, maka seharusnya tidak perlu kuliah terlebih dahulu. Lebih baik dana itu digunakan untuk modal usaha dan setelah produktif dapat menempuh pendidikan di perguruan tinggi. Berdasarkan implikasi hasil penelitian, maka dikemukakan saran bagi (1) Rektor UM, mempertimbangkan adanya penetapan tarif pendidikan di UM berdasarkan kemampuan finansial mahasiswa dan fasilitas atau layanan yang disediakan, (2) Mahasiswa dan orangtua mahasiswa UM, hendaknya mahasiswa juga harus berkreasi meciptakan lapangan kerja sendiri (wirausaha) atau kuliah sambil bekerja untuk menekan biaya ekstra. Dan karena biaya pendidikan mengalami kenaikan setiap tahun, hendaknya orangtua menyisihkan pendapatannya, misalnya dengan mengikuti program asuransi pendidikan, (3) Dosen UM, hendaknya memanfaatkan teknologi dalam melaksanakan perkuliahan dengan memberikan materi atau tugas perkuliahan kepada mahasiswa dalam bentuk soft copy sehingga terjadi efisiensi biaya ekstra, (4) Peneliti lain, untuk mengadakan penelitian lebih lanjut tentang hilangnya biaya kesempatan (lost of opportunity cost) yang disebabkan oleh adanya pendidikan.

Pengaruh waktu kontak dan konsentrasi Pb2+ (sebagai garam nitrat) terhadap adsorpsi ion No3- (sebagai garam Cd(NO3)2) menggunakan adsorben nata de coco dengan metode Batch / Binti Afifah

 

Kata kunci : adsorben, adsorpsi, nata de coco, klorofil Adsorpsi merupakan suatu peristiwa yang disebabkan oleh gaya tarik-menarik antara molekul-molekul adsorbat dengan permukaan adsorben. Berbagai jenis adsorben telah banyak digunakan, diantaranya yaitu sekam padi, serbuk gergaji kayu lamtoro gung, dan arang komersial. Tujuan dari penelitian ini yaitu mengetahui pengaruh adanya ion penganggu Pb2+ pada berbagai variasi konsentrasi dan variasi waktu kontak terhadap adsorpsi ion NO3- serta studi profil penyerapan senyawa klorofil oleh serbuk nata de coco. Penelitian ini merupakan penelitian eksperimental dan dilakukan di Laboratorium Jurusan Kimia dan Jurusan Biologi Fakultas MIPA Universitas Negeri Malang. Metode yang digunakan adalah metode batch. Dalam penelitian ini digunakan 1 gram nata de coco kering dengan ukuran 30-40 mesh. Adsorbat yang digunakan yaitu adsorbat anorganik yang merupakan campuran dari Cd2+ dan Pb2+ dengan variasi konsentrasi Pb2+ (0, 10, 25, dan 50 ppm) dengan variasi waktu kontak (20, 40, dan 60 menit) dan adsorbat organik yang berupa klorofil dengan variasi pengenceran 50 dan 100 kali. Sampel anorganik sebanyak 50 mL adsorbat dimasukkan dalam erlenmeyer yang sudah berisi serbuk nata de coco. Campuran dikocok dengan kecepatan 100 rpm pada tiap variasi waktu kontak dan variasi konsentrasi. Setelah proses adsorpsi dilakukan penyaringan. Filtrat yang diperoleh dianalisis dengan metode spektrofotometri yaitu direaksikan dengan larutan fenoldisulfonat dan amoniak, yang diukur pada λ= 410 nm. Adsorpsi senyawa klorofil dilakukan dengan sebanyak 50 mL sampel dimasukkan dalam erlenmeyer yang sudah berisi serbuk nata de coco. Campuran dikocok dengan kecepatan 100 rpm selama 20 menit kemudian disaring. Analisis filtrat dilakukan metode spektrofotometri yang diukur pada λ= 398 nm. Hasil penelitian menunjukkan bahwa (1) persen teradsorpsi ion nitrat menurun seiring dengan kenaikan konsentrasi ion Pb2+ (2) pengaruh waktu kontak terhadap persentase teradsorpsi ion nitrat memberikan hasil yang berbeda pada tiap-tiap konsentrasi ion penganggu Pb2+ (3) perbandingan konsentrasi ion Cd2+ : ion Pb2+ (25:25) ppm persentase ion nitrat pada tiap-tiap waktu kontak (20, 40, dan 60 menit) berturut-turut sebesar 36,27%; 72,88%; 42,86% (4) persentase teradsorpsi senyawa klorofil semakin tinggi seiring dengan menurunnya konsentrasi sampel klorofil.

Penerapan pembelajaran kooperatif model Think Pair Share (TPS) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang Kota Malang / Endang Goulap

 

Kata Kunci : Pembelajaran, TPS, Aktivitas dan Hasil Belajar, IPS SD. Keberhasilan proses pembelajaran di dalam kelas salah satunya di tentukan oleh cara guru menggunakan model pembelajaran. Model pembelajaran di gunakan harus sesuai dengan kebutuhan siswa, karena setiap model pembelajaran mempunyai tujuan, prinsip dan penekanan yang berbeda. Namun dalam kenyataannya guru tidak pernah menggunakan model pembelajaran yang bervariasi, sehingga aktivitas siswa terlihat masih pasif dan hasil belajarnya rendah. Bahkan guru hanya dapat menggunakan model pembelajaran yang berpusat pada guru sendiri , sehingga siswa kurang aktif dalam mengikuti pembelajaran. Penelitian ini bertujuan untuk meningkatakan aktivitas dan hasil belajar siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang Kota Malang melalui model pembelajaran Think Pair Share (TPS). Dalam model ini siswa akan berpikir (Think) secara individu, kemudian siswa secara berpasangan (Pair) saling tukar pendapat untuk melengkapi penemuannya. Selanjutnya tahap berbagi dalam kelompok besar yang di lakukan dengan kelompok besar di dalam kelas (Share). Subyek penelitian ini adalah siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang Kota Malang dengan jumlah 43 siswa. Rancangan penelitian ini menggunakan pengembangan Kemmis dan Taggart. Teknik pengumpulan data peneliti menggunakan observasi, wawancara, test, dan dokumentasi. Sedangkan instrumen penelitiannya menggunakan Rencana Pelaksanaan Pembelajaran, test, lembar observasi, dan dokumentasi. Hasil penelitian menunjukkan adanya peningkatan aktivitas dan hasil belajar siswa kelas V pada mata pelajaran IPS materi pokok tokoh-tokoh perjuangan dalam mempersiapkan kemerdekaan indonesia. Hasil pre test siswa rata-rata 63,25%. Siklus 1 mengalami peningkatan menjadi 84,65% dan siklus 2 terus megalami peningkatan menjadi 95,81%. Penerapan model pembelajaran Think Pair Share berhasil diterapkan pada siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang Kota Malang untuk meningkatkan aktivitas dan hasil belajar. Disarankan bagi peneliti lain, penelitian ini dapat di jadikan sebagai bahan pertimbangan dan acuan dalam penelitian selanjutnya, sehingga hasilnya dapat dijadikan pedoman dan pengembangan profesi dan meningkatkan prestasi belajar.

Validitas isi materi pembelajaran apresiasi prosa dalam buku teks bahasa dan bersastra Indonesia untuk SMP terbitan Depdiknas berdasarkan penilaian guru / Intan Anggar Puspita

 

Kata kunci: validitas, apresiasi prosa, materi Buku teks memegang peranan penting dalam proses belajar-mengajar termasuk pada pengajaran bahasa Indonesia, baik untuk guru maupun peserta didik. Pemilihan dan penggunaan buku teks harus dipertimbangkan agar memberikan sumbangan yang bermakna dalam pembelajaran. Buku yang dipilih harus buku yang memenuhi standar kualitas yang baik yaitu baik dari segi materi, penyajian materi, dan bahasa Setiap tahun ajaran baru cenderung dibarengi dengan buku pelajaran baru. Buku-buku terebut berasal dari penerbit-penerbit swasta maupun buku yang diterbitkan oleh pemerintah. Buku yang diterbitkan oleh pemerintah berupa Buku Sekolah Elektronik (BSE) yang dapat diakses oleh siapa saja. Buku Sekolah Elektronik (BSE) telah dinyatakan lulus penilaian dan dinyatakan valid oleh Badan Standar Nasional Pendidikan (BSNP). Oleh karena itu banyak sekolah yang menggunakan Buku Sekolah Elektronik (BSE). Masalah dalam penelitian ini adalah bagaimanakah validitas isi materi pembelajaran apresiasi prosa dalam buku teks bahasa dan sastra Indonesia untuk SMP terbitan Departemen Pendidikan Nasional (Depdiknas). Validitas isi tersebut dibagi dan berdasarkan penilaian dari guru pada aspek relevansi dengan Kurikulum Tingkat Satuan Pendidikan (KTSP), keakuratan teori pembelajaran apresiasi prosa, keruntutan penyajian pembelajaran apresiasi prosa, kebervariasian pembelajaran apresiasi prosa, keterampilan pembelajaran apresiasi prosa, dan bahasa. Rancangan yang digunakan dalam penelitian ini adalah survey kuantitatif. Data utama dalam penelitian ini adalah skor hasil penilaian guru bahasa Indonesia terhadap buku teks bahasa Indonesia yang dilihat dari aspek relevansi dengan Kurikulum Tingkat Satuan Pendidikan (KTSP), keakuratan teori pembelajaran apresiasi prosa, keruntutan penyajian pembelajaran apresiasi prosa, kebervariasian pembelajaran apresiasi prosa, keterampilan pembelajaran apresiasi prosa, dan bahasa. Sumber data penelitian ini adalah guru mata pelajaran bahasa Indonesia yang mengajar kelas VII,VIII, dan IX. Sumber data dipilih dan ditentukan dengan kriteria-kriteria tertentu. Instrumen yang digunakan dalam penelitian ini berupa panduan penilaian yang berfungsi untuk mengukur hasil penilaian guru terhadap aspek relevansi dengan Kurikulum Tingkat Satuan Pendidikan (KTSP), keakuratan teori pembelajaran apresiasi prosa, keruntutan penyajian pembelajaran apresiasi prosa, kebervariasian pembelajaran apresiasi prosa, keterampilan pembelajaran apresiasi prosa, dan bahasa. Analisis data dalam penelitian ini menggunakan teknik penskoran terhadap aspek yang diteliti. Berdasarkan hasil penelitian, diperoleh hasil penghitungan skor secara keseluruhan pada masing-masing aspek. Untuk masing-masing aspek diperoleh hasil penghitungan sebagai berikut: (1) validitas isi materi apresiasi prosa dikaji dari aspek relevansi dengan KTSP dapat diimplementasikan karena hasil penghitungan skor kelas VII mencapai 75,8%, kelas VIII mencapai 85%, dan kelas IX mencapai 81,6%, (2) validitas isi materi apresiasi prosa dikaji dari keakuratan teori dapat diimplementasikan karena hasil penghitungan skor kelas VII mencapai 64,1%, kelas VIII mencapai 80%, dan kelas IX mencapai 77,5%, (3) validitas isi materi apresiasi prosa dikaji dari keluasan dan kedalaman isi dapat diimplementasikan karena hasil penghitungan skor kelas VII mencapai 56,6%, kelas VIII mencapai 74,2%, dan kelas IX mencapai 78,3%, (4) validitas isi materi apresiasi prosa dikaji dari keruntutan penyajian masih lemah karena hasil penghitungan skor kelas VII mencapai 53,3%, kelas VIII mencapai 79,2%, dan kelas IX mencapai 71,6%, (5) validitas isi materi apresiasi prosa dikaji dari kebervariasian penyajian masih lemah karena hasil penghitungan skor kelas VII mencapai 37,5%, kelas VIII mencapai 45%, dan kelas IX mencapai 60,8%, (6) validitas isi materi apresiasi prosa dikaji dari keterampilan dapat diimplementasikan karana hasil penghitungan skor kelas VII mencapai 68,8%, kelas VIII mencapai 80%, dan kelas IX mencapai 57,5%, dan (7) validitas isi materi apresiasi prosa dikaji dari bahasa dapat diimplementasikan karena hasil penghitungan skor kelas VII mencapai 80%, kelas VIII mencapai 80%, dan kelas IX mencapai 80%. Berdasarkan penelitian ini, saran yang disampaikan peneliti yaitu (1) guru bahasa Indonesia hendaknya dapat memberikan pertimbangan untuk memilih materi khususnya pada pembelajaran apresiasi prosa dalam buku teks yang akan digunakan, (2) penulis hendaknya dapat memberikan metode belajar dan bahan pengajaran yang lebih banyak dan bervariasi sehingga menjadi pilihan bagi pengguna buku, dan (3) penerbit hendaknya dapat memberikan buku-buku yang memiliki kualifikasi yang baik sehingga memiliki konstribusi besar dalam penguatan mutu pendidikan.

Hubungan locus of control dan kematangan emosi dengan stres kerja karyawan CV. Jaya Barokah Malang / Naning Sugiarti

 

Kata kunci: locus of control, kematangan emosi, stres kerja Bidang konstruksi besi dan baja merupakan salah satu bidang pekerjaan yang memiliki resiko tinggi dalam memunculkan stres kerja bagi karyawan. Sebagian besar karakteristik kepribadian berhubungan dengan stres kerja yaitu: locus of control, kepribadian tipe A, rendahnya kontrol diri, kepribadian neurotis, kecemasan dan rendahnya konsep diri. Individu yang berorientasi locus of control internal mengalami ancaman stres kerja lebih sedikit dari pada yang eksternal. Selain itu jika kontrol diri terhadap emosi rendah maka individu akan mudah meledakkan emosi akan memicu munculnya stres kerja. Tujuan penelitian adalah untuk mengetahui gambaran locus of control, kematangan emosi, dan stres kerja karyawan CV. Jaya Barokah Malang. Mengetahui hubungan locus of control dan stres kerja karyawan CV. Jaya Barokah Malang, mengetahui hubungan kematangan emosi dan stres kerja karyawan CV. Jaya Barokah Malang, dan mengetahui hubungan locus of control dan kematangan emosi dengan stres kerja karyawan CV. Jaya Barokah Malang. Penelitian ini dilakukan di CV. Jaya Barokah Malang. Rancangan penelitian yang digunakan adalah penelitian kuantitatif dengan jenis penelitian deskriptif korelasional. Subjek yang dijadikan sampel sebanyak 50 karyawan. Instrumen yang digunakan adalah skala LOC diadaptasi dari Rotter dan skala kematangan emosi serta skala stres kerja disusun oleh peneliti. Teknik analisis data yang digunakan adalah analisis data deskriptif berdasarkan nilai mean, teknik korelasi product moment, dan analisis regresi berganda. Hasil penelitian menunjukkan bahwa sebanyak 23 karyawan atau sebesar 46% memiliki locus of control eksternal dan 27 karyawan atau sebesar 54% memiliki locus of control internal. Kematangan emosi tinggi sebanyak 28 karyawan atau sebesar 56% sedangkan kematangan emosi rendah sebanyak 22 karyawan atau sebesar 44% sedangkan untuk stres kerja sebanyak 26 karyawan atau sebesar 52% termasuk kategori tinggi dan 24 karyawan atau sebesar 48% kategori rendah. Hasil korelasi menunjukkan ada hubungan positif antara locus of control dan stres kerja dengan koefisien korelasi 0,336 dan ada hubungan negatif antara kematangan emosi dengan stres kerja dimana koefisien korelasinya sebesar -0,438. Hasil analisis regresi diperoleh hubungan locus of control dan konsep diri dengan stres kerja diperoleh nilai F 7,188 signifikan pada p = 0,002 < 0,05 dengan nilai R sebesar 0,484. Berdasarkan hasil penelitian yang telah dilakukan maka hendaknya: (1)Karyawan selalu mewaspadai sumber-sumber terjadinya stres kerja dan mengikuti pelatihan-pelatihan untuk mengembangkan kematangan emosi yang tinggi sehingga dapat mengurangi stres kerja; (2)Bagi perusahaan perlu memberi pemahaman akan faktor dan cara mengatasi stres kerja, juga melakukan pelatihan-pelatihan rutin bagi karyawan; (3)Bagi peneliti selanjutnya disarankan untuk lebih memperluas tema dari sudut pandang yang berbeda, meneliti hubungan antara stres kerja dengan faktor- faktor lain seperti faktor-faktor intrisik dalam pekerjaan, peran dalam organisasi, hubungan dalam pekerjaan, struktur dan iklim organisasi dan disarankan menggunakan metode kualitatif.

Peningkatan kemampuan menulis cerpen berdasarkan pengalaman orang lain dengan menggunakan strategi analanting siswa kelas XG MAN Bangil / Evi Afriyanti Rohmah

 

Kata kunci: analanting Kemampuan menulis cerpen merupakan salah satu aspek keterampilan berbahasa yang diajarkan mata pelajaran bahasa Indonesia di SMA/ MA. Menulis cerpen berdasarkan pengalaman orang lain merupakan salah satu kompetensi dasar yang diajarkan di kelas X SMA/ MA. Kompetensi dasar ini bertujuan untuk mengungkapkan ide, gagasan, dan perasaan siswa dalam bentuk tulisan cerpen. Kenyataan di lapangan menunjukkan bahwa siswa mengalami kesulitan dalam menulis cerpen berdasarkan pengalaman orang lain. Kesulitan tersebut antara lain, siswa belum mampu menuliskan rangkaian peristiwa dalam cerpen, siswa belum mampu menuliskan tokoh dan perwatakannya dalam cerpen, siswa belum mampu menuliskan latar dalam cerpen, siswa sering mengabaikan tema dan judul dalam menulis cerpen, dan siswa masih belum menggunakan paparan naratif dengan baik. Penelitian dengan judul Peningkatan Kemampuan Menulis Cerpen Berdasarkan Pengalaman Orang Lain dengan Menggunakan Strategi Analanting Siswa Kelas X G MAN Bangil dimaksudkan untuk memperbaiki kemampuan siswa dalam menulis khususnya pada kemampuan menulis cerpen berdasarkan pengalaman orang lain. Penerapan strategi analanting dalam pembelajaran ini diharapkan dapat meningkatkan kemampuan siswa dalam menulis cerpen berdasarkan pengalaman orang lain dengan mengembangkan unsur-unsur instrinsik cerpen, yakni tema, pelaku (tokoh), peristiwa (alur), latar, teknik naratif, dan judul. Masalah dalam penelitian ini adalah (1) bagaimanakah proses peningkatan kemampuan menulis cerpen berdasarkan pengalaman orang lain siswa kelas X-G MAN Bangil dengan menggunakan strategi analanting? dan (2) bagaimanakah hasil peningkatan kemampuan menulis cerpen berdasarkan pengalaman orang lain siswa kelas X-G MAN Bangil dengan menggunakan strategi analanting? Strategi analanting adalah strategi yang digunakan peneliti untuk meningkatkan pembelajaran menulis cerpen berdasarkan pengalaman orang lain. Analanting reality show yang berbentuk audiuovisual tentang peristiwa yang dialami orang lain. Setelah siswa mengamati tayangan reality show selanjutnya siswa menarasikan cerita dalam lembar kerja siswa yang sudah disiapkan. Tayangan reality show yang digunakan sebagai sumber pembelajaran adalah tayangan “Jika Aku Menjadi”. Tahap ini disebut tahap narasi. Kegiatan mengamati tayangan reality “Jika Aku Menjadi” dan menarasikan inti cerita digunakan sebagai perangsang untuk menulis tema. Tahap selanjutnya adalah membuat kerangka tahapan-tahapan cerpen yang sesuai dengan indikator dalam lembar kerja siswa yang sudah disiapkan dengan cara mengembangkan unsur-unsur instrinsik cerpen, meliputi pelaku (tokoh, dan penokohan), peristiwa (alur), latar, judul, dan menggunakan paparan naratif kemudian mengembangkan kerangka cerpen menjadi cerpen yang utuh. Tahap ini disebut tahap lanjut. Tahap terakhir adalah tahap sunting, yaitu siswa saling menyunting cerpen dengan teman sejawatnya. Penelitian ini dilaksanakan dengan rancangan Penelitian Tindakan Kelas (PTK). Rancangan penelitian tindakan kelas disusun dalam dua siklus. Tiap siklus terdiri atas empat tahap, yaitu perencanaan, pelaksanaan, pengamatan, dan refleksi. Penetapan subjek penelitian didasarkan pada hasil analisis studi pendahuluan oleh peneliti. Subjek dalam penelitian ini adalah siswa kelas X G MAN Bangil yang berjumlah 47 siswa karena mempunyai penilaian proses dan penilaian produk (hasil) di bawah kriteria ketuntasan minimal (KKM) yang ditetapkan oleh MAN Bangil. Penelitian ini dilaksanakan mulai tanggal 22 Maret 2011 sampai dengan 21 Mei 2011 dalam dua siklus. Data penelitian tindakan kelas ini berupa data proses dan data hasil. Data proses berupa transkrip hasil interaksi proses pembelajaran menulis cerpen yang dilakukan siswa dan guru di kelas, sedangkan data hasil berupa kerangka cerpen siswa dan hasil produk cerpen siswa. Pengumpulan data proses dilakukan dengan observasi menggunakan pedoman observasi dan catatan lapangan, sedangkan data hasil dilakukan dengan studi dokumen dengan menggunakan rubrik penilaian hasil menulis cerpen. Data proses dan hasil yang telah dikumpulkan dianalisis dengan mereduksi, memaparkan, dan menarik kesimpulan. Hasil penelitian meliputi peningkatan proses dan peningkatan hasil pembelajaran menulis cerpen dengan strategi analanting yakni tahap amati, narasikan, lanjutkan dan suntingkan. Tahap amati dan tahap narasikan meliputi mengamati penayangan mata acara reality show ‘Jika Aku Menjadi’ dan menarasikan inti cerita dari tayangan yang sudah diamati. Pada tahap ini siswa mampu berkonsentrasi hal ini ditandai dengan sikap tenang yang ditunjukkan siswa. Pada siklus I siswa yang dikategorikan tuntas adalah 94% meningkat pada siklus II yakni 100%. Pada tahap lanjutkan yakni membuat kerangka cerpen dan mengembangkan kerangka cerpen menjadi cerpen utuh. Pada siklus I beberapa siswa tampak antusias dan tidak mengalami kesulitan dalam membuat kerangka cerpen dan mengembangkan kerangka cerpen menjadi cerpen utuh, namun pada siklus II terjadi peningkatan motivasi sehingga sebagian besar siswa serius dan antusias dalam membuat kerangka cerpen dan mengembangkan kerangka cerpen menjadi cerpen utuh. Peningkatan hasil pada tahap lanjutkan ditandai dengan bertambahnya kualitas hasil menulis cerpen siklus I menuju siklus II yakni dari 70% meningkat menjadi 82% . Peningkatan proses kemampuan menulis cerpen pada tahap suntingkan dilakukan dengan kegiatan siswa menyunting aspek ejaan, tanda baca dan bahasa serta memublikasikan cerpen. Penggunaan strategi analanting dapat iii menumbuhkan rasa percaya diri pada siswa untuk membacakan cerpennya di depan kelas, mampu membangun interaksi sosial antar siswa dan merangsang siswa untuk menunjukkan prestasi. Peningkatan hasil tahap suntingkan ditandai dengan meningkatnya kualitas siswa yang melakukan penyuntingan baik di siklus I maupun siklus II. Pada suklus I perolehan skor siswa yaitu 95,7 dengan kategori tuntas sedangkan pada siklus II perolehan skor siswa meningkat yaitu 100% dengan kategori tuntas. Sehubungan dengan hasil penelitian ini, disarankan kepada guru untuk menggunakan strategi analanting dengan lebih kreatif dan inovatif dalam upaya meningkatkan kemampuan siswa dalam menulis cerpen. Kepala sekolah sebagai pengambil kebijakan juga disarankan untuk memberi dukungan dan fasilitas yang memadai kepada guru untuk melakukan kerja sama dengan para peneliti untuk meningkatkan kualitas pembelajaran di sekolah. Bagi peneliti selanjutnya yang ingin menggunakan dan mengembangkan strategi analanting sebagai dasar untuk melakukan penelitian lain dengan cara lebih kreatif. adalah kependekan dari amati, narasi, lanjut, sunting. Pada tahap amati, siswa ditugasi untuk mengamati penayangan mata acara menulis, cerpen berdasarkan pengalaman orang lain, strategi

Electric brooder untuk anak ayam ras pedaging pada peternakan Laisa Poultry Shop / Shellyna Yuri Swastika

 

Kata kunci:Electric brooder , ayam ras pedaging, peternakan. Bibit ayam ras pedaging (Kuri) tidak dapat menstabilkan suhu tubuhnya sendiri. Untuk mendapatkan suhu ideal, kuri harus dipelihara di dalam brooding atau eraman.Brooder merupakan penghangat yang menghasilkan suhu ideal sesuai dengan kebutuhan kuri pada periode brooding. Saat ini jenis brooder yang sering digunakan adalah gas brooder berbahan bakar gas LPG. namun kurang efisien karena gas LPG 3kg hanya bertahan 8jam. Sehingga dibuatlah electric brooder dengan tujuan: (1) mengetahui suhu yang dibutuhkan oleh bibit ayam ras pedaging (kuri); (2) mengetahui komponen-komponen eraman (brooder ) yang digunakan untuk menjaga suhu tubuh kuri; (3) merancang eraman yang menghasilkan suhu yang dibutuhkan kuri; (4) membuat eraman yang menghasilkan suhu yang dibutuhkan kuri; (5) menghasilkan eraman yang telah teruji dapat menghasilkan suhu sesuai kebutuhan kuri. Metode perancangan electric brooder adalah: (1) perancangan sistem; (2) pengujian sistem dan hasil. Proses perancangan dilakukan untuk mengetahui komponen-komponen yang dibutuhkan dalam membangun sebuah electric brooder . Dan proses pengujian dibutuhkan untuk mengetahui kesalahan, kekurangan serta hasil dari perancangan brooder . Pada bagian pengujian, diketahui bahwa brooder dapat menghangatkan 100ekor kuri pada usia 1-3hari dengan pemberian pembatas di sekitar kuri. Area yang diberi pembatas adalah seluas 1x1,5m2 dengan setpoint suhu 320 C-350 C. Ketika usia kuri mencapai 4hari maka pembatas dapat dibuka, dan kapasitas brooder berkurang menjadi 75ekor. Pada usia 14hari dengan setpoint suhu maksimal 330 C, brooder dapat menghangatkan 100-200ekor kuri. Kesimpulan yang didapatkan dari proses perancangan hingga pengujian electric brooder adalah electric brooder mampu menghangatkan kuri pada usia dan jumlah tertentu. Dengan menyesuaikan kondisi alam, kandang serta luas area pemanasan. Kelebihan electric brooder dibandingkan dengan brooder konvensional adalah panas yang dihasilkan lebih standar, yaitu tidak terlalu panas dan tidak terlalu dingin. Electric brooder dapat diatur setpointnya sesuai dengan kebutuhan kuri. Ketika suhu terlalu tinggi maupun terlalu rendah, brooder akan secara otomatis mati dan menyala kembali sesuai dengan kebutuhan.

Studi tentang pengembangan instrumen penilaian prstasi belajar fisika bentuk uraian pada materi kesetimbangan benda tegar di SMA Negeri se-kota Malang / Jihan Amalia

 

Kata kunci: pengembangan instrumen penilaian, bentuk uraian Penilaian merupakan salah satu kompetensi yang harus dikuasai oleh guru maupun calon guru. Penilaian adalah kegiatan pengumpulan dan pengolahan data tentang proses dan hasil belajar siswa, sehingga menjadi informasi yang bermakna dalam menentukan tingkat pencapaian hasil belajar siswa. Agar kegiatan penilaian berjalan sesuai dengan fungsinya, maka ada prosedur yang harus ditempuh oleh guru sebagai penilai. Kualitas instrumen penilaian juga perlu diperhatikan layak atau tidaknya. Dalam prosedur penilaian, guru menyesuaikan dengan dengan teknik penilaian yang dipilih. Salah satu teknik penilaian yang digunakan oleh guru adalah teknik penilaian tes tertulis bentuk uraian. Penilaian bentuk ini berfungsi untuk mengukur kemampuan berpikir tingkat tinggi dan kemampuan kompleks lainnya yang dimiliki oleh siswa. Selama ini informasi tentang prosedur dan kualitas instrumen penilaian bentuk uraian dalam kegiatan pembelajaran sangat sedikit. Oleh karena itu, studi tentang pengembangan instrumen penilaian bentuk uraian penting untuk dilakukan. Tujuan penelitian ini adalah mendeskripsikan prosedur penilaian serta kualitas instrumen penilaian hasil belajar fisika bentuk uraian pada materi kesetimbangan benda tegar yang dilakukan oleh guru fisika SMA negeri se-kota Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Pengumpulan data dilakukan dengan teknik wawancara, angket, dan penilaian produk. Data yang terkumpul dianalisis menggunakan statistik deskriptif. Berdasarkan hasil analisis data diperoleh informasi mengenai keterlaksanaan prosedur pengembangan instrumen penilaian bentuk uraian pada materi kesetimbangan benda tegar, serta kualitas instrumen yang dikembangkan oleh guru fisika SMA negeri se-kota Malang. Hasil penelitian ini menunjukkan bahwa guru fisika SMA negeri se-kota Malang selalu melakukan persiapan penilaian (100%). Sedangkan tahap analisis dan tindak lanjut jarang dilakukan, dengan persentase 47.5% untuk tahap analisis dan 20% untuk tahap tindak lanjut. Tahap analisis meliputi validasi soal, penentuan tingkat reliabilitas soal, tingkat kesukaran butir soal, serta daya beda butir soal. Tahap tindak lanjut berupa kegiatan memperbaiki instrumen untuk digunakan di masa mendatang. Sedangkan untuk kualitas instrumen penilaian bentuk uraian yang dibuat oleh guru, secara keseluruhan kualitasnya baik.

Penerapan model pembelajaran Think Pair Share (TPS) untuk meningkatkan hasil belajar geografi kelas XI IPS 2 SMA Negeri 6 Malang / Dwi Winda Anggraeni

 

Kata kunci: Pembelajaran, Model Think Pair Share, dan Hasil belajar geografi Demi tercapainya peningkatan kualitas pembelajaran, salah satu upaya pemerintah menetapkan standar ketuntasan minimal yang harus dicapai dalam suatu pembelajaran, baik kriteria ketuntasan minimal untuk keterampilan proses maupun hasil belajar yang diperoleh siswa dalam pembelajaran. Berdasarkan observasi awal yang dilakukan pada tanggal 8 Maret 2011 dalam proses pembelajaran Geografi di kelas XI IPS 2 terdapat beberapa kelemahan yang dapat mempengaruhi hasil belajar siswa diantaranya yaitu: (1) Hasil belajar rendah, terbukti dari hasil ulangan tengah semester pada kompetensi dasar Menjelaskan Pemanfaatan Sumber Daya Alam, masih banyak siswa yang nilainya dibawah KKM yang ditetapkan75, sebanyak 15 siswa yang tuntas, sedangkan yang belum tuntas belajarnya sebanyak 23 siswa atau 60,52%; (2) Minat belajar siswa masih rendah; (3) Proses pembelajaran masih didominasi oleh guru; (4) Suasana kelas kurang kondusif; (5) Guru hanya terfokus untuk menjelaskan yang ada di LKS; (6) Penerapan strategi belajar kurang dapat memotivasi siswa, sehingga siswa kurang tertarik dalam mengikuti pembelajaran. Penelitian ini dirancang dengan menggunakan penelitian tindakan kelas.Penelitian ini direncanakan dalam dua siklus. Tiap siklus terdiri dari perencanaantindakan, pelaksanaan tindakan, pengamatan, dan refleksi. Pengambilan data dilaksanakan dengan observasi dan tes tulis. Penelitian dilaksanakan di kelas XI IPS 2 SMANegeri 6 Malang dengan jumlah siswa 38 orang, pada Kompetensi Dasar: Menganalisis Pelestarian Lingkungan Hidup dalam Kaitannya dengan Pembangunan Berkelanjutan. Berdasarkan hasil penelitian ini menunjukkan bahwa hasil belajar Geografi siswa mengalami peningkatan. Peningkatan hasil belajar dari pra tindakan, siklus I dan siklus II. Pada pra tindakan rata-rata nilai kelas 69,47 dengan persentase keberhasilan 39,47%. Siklus I mengalami peningkatan 77,5 dengan persentase keberhasilan tindakan 71,05%. Siklus II juga menunjukkan peningkatan yakni diperoleh rata-rata 83,37 dengan persentase keberhasilan tindakan sebesar 86,84%. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa terjadi peningkatan hasil belajar Geografi setelah diterapkan pembelajaran model Think Pair Share dan disarankan untuk menggunakan model Think Pair Share dengan merencanakan dan melaksanakan proses pembelajaran Geografi khususnya pada materi yang membutuhkan penalaran dan analisa.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 |