Studi komparatif perkembangan jingkat 15 meter anak putra usia 7-10 tahun yang tinggal di dataran rendah dengan dataran tinggi Kabupaten Mojokerto / Yanuar Firman

 

Kata Kunci: Jingkat, Anak Putra, Dataran Rendah, Dataran Tinggi Anak putra usia 7, 8, 9, 10 tahun yang berada di dataran rendah dan dataran tinggi sangat menarik untuk dibedakan. Dapat dilihat dari letak geografis tempat tinggal dan karakteristik anak yang berbeda mempunyai kemampuan yang dapat diketahui dengan cara meneliti lansung. Apalagi karakteristik anak putra, sangat jelas bahwa kekuatannya lebih dari pada anak putri, oleh karena itu apabila ingin mengetahui kemampuan jingkat ini dapat dipengaruhi oleh perkembangan jingkat tiap anak, oleh letak geografis tempat tinggal, kondisi suhu yang berbeda dan aktivitas fisik yang dilakukan dan lingkungan sekitar. Semuanya akan mempengaruhi adaptasi secara fisiologi anak dalam perkembangan jingkatnya. Penelitian ini bertujuan ingin mengetahui apakah ada perbedaan perkembangan jingkat antara anak putra usia 7, 8, 9, 10 tahun yang berada di dataran rendah dan dataran tinggi di Kabupaten Mojokerto. Penelitian ini menggunakan rancangan penelitian cross sectional. Penelitian cross-sectional adalah penelitian yang dilakukan pada satu waktu dan satu kali, tidak ada follow up, untuk mencari hubungan antara variabel independen (faktor resiko) dengan variabel dependen (efek). Metode penelitian adalah cara ilmiah untuk mengumpulkan data dengan tujuan dan kegunaan tertentu. Berdasarkan hasil output SPSS menggunakan analisis Anova terdapat uji hipotesis diperoleh F hitung 29.393 > F.tabel 2.661829061, Jadi dapat disimpulkan bahwa keputusannya yaitu tolak H0 yang berarti perbedaan waktu dalam kemampuan gerak jingkat antar umur tidak signifikan dan terima H1 yaitu perbedaan waktu dalam kemampuan gerak jingkat antar umur signifikan. Kesimpulan dari penelitian ini adalah bahwa nilai signifikansi kurang α=0.05, artinya H0 ditolak. Menurut perhitungan uji-t disimpulkan bahwa terdapat perbedaan antara jingkat anak putra usia 7, 8, 9, 10 tahun di dataran rendah dengan dataran tinggi. Hasilnya lebih baik kemampuan gerak jingkat anak putra yang berada di dataran tinggi. Berdasarkan hasil perhitungan analisis Tukey post hoc test untuk multiple comparisons mengindikasikan bahwa kelompok 7 dan 8 yang memiliki nilai yang signifikan secara statistik. Hasil ini mengindikasikan bahwa perbedaan rata-rata antara waktu jingkat umur 9 dan 10 tahun secara statistik tidak signifikan dan meannya secara signifikan berbeda dari pada mean umur 7 dan 8 yang signifikan secara statistik. Dari kesimpulan di atas dapat ditarik saran, berdasarkan penelitian dan perhitungan ini bahwa hasilnya membuktikan kemampuan gerak jingkat anak putra yang tinggal di dataran tinggi lebih baik dari pada dataran rendah. Hal ini dapat dijadikan pengetahuan baru dan referensi baru buat guru pendidikan jasmani dan peneliti lain untuk memperhatikan aktivitas, letak geografis tanah dan tekanan suhu tempat tinggal. Karena adaptasi fisiologi yang dialami anak tergantung dari faktor lingkungan sekitar yang mendukung untuk perkembangan motoriknya. Dan untuk guru pendidikan jasmani sebaiknya menganalisis terlebih dahulu gerakan-gerakan yang akan dilakukan agar tidak terjadi cidera yang tidak diinginkan sebelum dipraktekkan pada anak didiknya.

Pengaruh model Problem Based Learning (PBL) dan Problem Based Learning (PBL) - SQ3R (survey, Question, Read, Recite, Review) terhadap kemampuan metakogisi dan berpikir kritis siswa kelas X SMA Negeri 1 Bangkalan / Kurrotul Ainiyah

 

Kata kunci: Model Problem Based Learning, SQ3R (Survey, Question, Recite, Review), kemampuan metakognisi, berpikir kritis. Siswa harus dapat berkembang secara optimal dengan kemampuan untuk berkreasi, mandiri, bertanggung jawab, dan dapat memecahkan masalah-masalah yang dihadapi demi mencapai tujuan pendidikan nasional. Standar isi cakupan kelompok mata pelajaran ilmu pengetahuan dan teknologi menyatakan bahwa siswa memperoleh kompetensi lanjut ilmu pengetahuan dan teknologi serta membudayakan berpikir ilmiah secara kritis, kreatif, dan mandiri. Aspek yang bertujuan membuat siswa mandiri adalah aspek kemampuan metakognitif. Tujuan penelitian ini adalah untuk mengetahui pengaruh model Problem Based Learning (PBL) dan Problem Based Learning (PBL)–Survey, Question, Read, Recite, Review (SQ3R) terhadap kemampuan berpikir kritis, keterampilan metakognisi, dan kesadaran metakognisi. Penelitian ini merupakan quasi experiment dengan menggunakan dua kelas yaitu kelas eksperimen 1 dan kelas eksperimen 2. Kelas eksperimen 1 adalah kelas yang belajar dengan menggunakan model PBL dan kelas eksperimen 2 adalah kelas yang belajar dengan menggunakan model PBL-SQ3R. Penelitian ini dilakukan pada pokok bahasan suhu dan kalor dengan sub pokok bahasan suhu dan kalor, perubahan wujud, pemuaian, azas Black. Populasi dalam penelitian ini adalah seluruh kelas X SMA Negeri 1 Bangkalan pada semester genap tahun ajaran 2011/2012. Sampel diambil dengan cara undian dan diperoleh kelas X-1 belajar dengan menggunakan Problem Based Learning dan kelas X-2 belajar dengan menggunakan Problem Based Learning-SQ3R. Data dianalisis dengan menggunakan analisis kovarian, sedangkan untuk menentukan kelas yang lebih baik dilihat rata-rata masing-masing kelas. Hasil analisis menunjukkan bahwa siswa yang belajar dengan PBL-SQ3R mempunyai kemampuan berpikir kritis dan metakognisi lebih baik daripada siswa yang belajar dengan PBL. Untuk kemampuan berpikir kritis siswa yang belajar dengan PBL mendapatkan rata-rata 69,23, sedangkan siswa yang belajar dengan PBL-SQ3R mendapatkan 79,35. Keterampilan metakognisi siswa yang belajar dengan PBL mendapatkan rata-rata 69,47, sedangkan siswa yang belajar dengan PBL-SQ3R mendapatkan 87,7. Kesadaran metakognisi siswa yang belajar dengan PBL mendapatkan rata-rata 74,2, sedangkan siswa yang belajar dengan PBL-SQ3R mendapatkan 91,55. Berdasarkan hasil penelitian dapat diambil kesimpulan bahwa kemampuan berpikir kritis dan metakognisi lebih baik siswa yang belajar dengan PBL-SQ3R.

Persepsi guru dan siswa terhadap pembelajaran mengarang di sekolah dasar se-kecamatan Binangun Kabupaten Blitar / Yanuar Ismi

 

Kata Kunci: Persepsi Guru, Siswa, Mengarang, SD. Bahasa adalah salah satu kunci untuk memasuki wahana informasi. Oleh karena itu bagi bangsa Indonesia, penguasaan bahasa, khususnya bahasa Indonesia sangat penting untuk dapat berperan serta dalam era informasi sekarang ini. Mengarangmerupakankemampuan yang harus dimiliki oleh setiap siswa, karena kemampuan iniselaindigunakanuntukkegiatanpendidikanjuga di butuhkanuntukkegiatankehidupanbermasyarakatdiantaranya :menulissurat, mengisiformulirdansebagainya. Tujuan penulis adalah untuk mengetahui : (1). Persepsisiswakelas 5 SekolahDasardalampembelajaran mengarangBahasa Indonesia, (2). Persepsi guru kelas 5 SekolahDasardalampembelajaran mengarangBahasa Indonesia. Populasi penelitian adalah siswa dan guru kelas 5 SDN se-Kecamatan Binangun Kabupaten Blitar yang berjumlah 28 SD dan diambil 10 SD untuk dijadikan sampel sumber data. Untuk kepentingan pengumpulan data dipergunakan teknik angket yang selanjutnya dilakukan analisis data dengan teknik penelitian deskiptif kuantitatif. Dari hasil penelitiandapat diketahui bahwa(1). Persepsigurukelas 5 SekolahDasar; (a) PenguasaanMateri:Kemampuan guru dalammenyampaikanmateripembelajaranmengarangpadaumumnyasudahsesuaidenganmateripengajaran yang ada, (b) Perencanaan: Penulisanperencanaanpembelajaran yang digunakanoleh guru-guru rata-rata sudahsesuaidenganpedomanpenulisan RPP, (c) Pelaksanaan: Para guru padaumumnyasudahmemenuhibeberapakompetensidalammengajar, baikitukompetensipribadimaupunkompetensiprofesional, (d) Lingkungan: Lingkungan yang harmonisjuga mempengaruhi minat belajar siswa. Sehingga para guru berusaha menciptakan kondisi lingkungan yang nyaman dan aman untuk belajar siswa, (e) Media:Untuk menciptakan ide dan semangat siswa dalam menulis karangan, guru menggunakan media atau alat peraga yang bisa merangsang daya imajinasi anak. (2). Persepsisiswakelas 5 SekolahDasar; (a) PenguasaanMateri:Sebagiankecilsiswakurang menguasai pembelajaran mengarang, akan tetapisebagianbesardarimerekasudahmenguasaimateripembelajaranmengarang, (b). Pelaksanaan: Sedikitsekalisiswa yang kurangikut pro aktifselamapembelajaranberlangsung, padaumumnyaparasiswaaktifdankreatifpadasaatpembelajaranberlangsung, (c) Lingkungan: Padaumumnyasemuasiswamenyukaikondisilingkungan yang kondusif, merekajugaberusahamenciptakansuasanaamandannyaman di dalamkelas, supayamerekabetahbelajar di dalamkelas, (d). Media: Padaumumnyasemuasiswamemerlukan media yang menarikdanberagam, halinibergunauntukmerangsangdayaimajinasimerekadalammenuliskarangan.

Pengembangan pembelajaran gerak dasar lempar lembing menggunakan alat bantu bagi siswa kelas VI di SD Negeri Karang Duren 01 Kecamatan Pakisaji Kabupaten Malang / Aditya Riki Dwi Krisnawan

 

Kata kunci: pengembangan, pembelajaran, alat bantu dan lempar lembing. Atletik merupakan permainan dan olahraga yang termasuk dalam ruang lingkup pendidikan jasmani olahraga dan kesehatan. Atletik khususnya lempar lembing jarang sekali diajarkan di sekolah-sekolah dasar, hal tersebut disebabkan karena faktor sarana dan prasarana serta keamanan menjadi kendala dalam pembelajaran atletik khususnya lempar lembing. Berdasarkan observasi awal yang telah dilakukan guru hanya sekedar mengenalkan materi lempar lembing kepada siswa tanpa mempraktikkan di lapangan, hal itu dikarenakan faktor sarana dan prasarana yang tidak memadai. Faktor keamanan bagi siswa pun menjadi kendala untuk diberikan pembelajaran, oleh karena itu guru pendidikan jasmani di SDN Karang Duren 01 Kecamatan Pakisaji Kabupaten Malang setuju untuk mengadakan penelitian tentang pengembangan pembelajaran lempar lembing dengan menggunakan alat bantu yang aman, menarik dan mudah untuk digunakan bagi siswa, khususnya siswa Sekolah Dasar kelas VI. Penelitian ini merupakan penelitian pengembangan (research and development). Penelitian ini bertujuan untuk mengembangkan pembelajaran gerak dasar lempar lembing dengan menggunakan alat bantu bagi siswa kelas VI SDN Karang Duren 01 Kecamatan Pakisaji Kabupaten Malang agar dapat membantu guru pendidikan jasmani dalam menyampaikan materi lempar lembing dengan aman, menarik dan mudah dilakukan oleh siswa. Hasil penelitian ini menunjukkan bahwa pembelajaran gerak dasar lempar lembing menggunakan alat bantu ini sangat menarik dan mudah digunakan bagi siswa kelas VI SDN Karang Duren 01. Dari uji kelompok kecil dengan subyek uji coba 10 siswa didapatkan hasil sebanyak 100% untuk kemudahan dan 100% untuk kemenarikan pembelajaran menggunakan alat bantu, sehingga dapat dilanjutkan ke uji lapangan (kelompok besar). Dari uji lapangan (kelompok besar) dengan subyek uji coba 30 siswa didapatkan hasil sebanyak 100% untuk kemudahan dan 100% kemenarikan pembelajaran menggunakan alat bantu. Saran, hasil pengembangan ini hanya terbatas pada pengembangan produk, maka diharapkan ada penelitian selanjutnya yang menguji tentang tingkat efektivitas produk yang telah dikembangkan dan hasil penelitian dan pengembangan ini, diharapkan dapat diuji cobakan pada lingkup yang lebih luas.

Peningkatan hasil belajar IPS siswa kelas IV B melalui pakem di SDN Klojen Kota Malang semester II tahun ajaran 2011/2012 / Muti'ah Isfahani

 

Kata Kunci : PAKEM, Hasil Belajar Tugas dan tanggung jawab guru tidak hanya mengajarkan materi pelajaran sesuai dengan kurikulum, melainkan juga memberikan pengalaman belajar yang bersifat mendidik. Kebermaknaan belajar dalam IPS masa sekarang tidak sekedar menghafal fakta dan konsep, tetapi merupakan kegiatan menghubungkan konsep-konsep untuk menghasilkan pemahaman yang utuh sehingga konsep yang dipelajari mudah dipahami dengan baik dan tidak mudah dilupakan. Menurut kurikulum 2004 kegiatan belajar mengajar berpusat pada siswa yang artinya siswa harus lebih aktif menggali informasi sendiri sesuai dengan teori konstuktivis yaitu mengutamakan peran siswa dalam berinisiatif sendiri, keterlibatan aktif dalam kegiatan pembelajaran.. Hasil dari wawancara, observasi dan dokumentasi yang dilakulukan menunjukkan informasi bahwa pembelajaran yang dilakukan kurang menarik siswa sehingga siswa kurang aktif dalam bertanya, malas membaca maupun mencatat hal ini juga berdampak pada tingkat hasil belajar siswa. Untuk itu untuk menyelesaikan permasalahan yang ada maka perlu diadakan penelitian tindakan kelas untuk meningkatkan hasil belajar IPS melalui PAKEM. Rumusan masalah dalam penelitian ini adalah bagaimana pelaksanaan penerapan PAKEM dalam meningkatkan hasil belajar siswa kelas IV B dan adakah peningkatan hasil belajar IPS di SDN Klojen Kota Malang setelah menerapkan PAKEM Tujuan dari penelitian ini adalah untuk mendeskripsikan pelaksanaan PAKEM dan apakah penerapan PAKEM dapat meningkatkan hasil belajar IPS siswa kelas IV B di SDN Klojen. Berdasarkan hasil penelitian yang telah dilakukan maka diperoleh beberapa kesimpulan sebagai berikut, pelaksanaan PAKEM dalam meningkatkan hasil belajar IPS siswa kelas IV B di SDN Klojen Kota Malang yaitu (a) Guru selain sebagai fasilitator juga harus peka terhadap siswa yang membutuhkan bimbingan. (b) Guru mengajukan pertanyaan yang menantang siswa agar aktif menjawab serta mempertanyakan gagasan siswa. (c) Guru memotivasi dan menawarkan siswa untuk bertanya materi yang belum dipahami oleh siswa. (d) Guru menggunakan alat bantu/ media dalam mengajar disesuaikan dengan materi yang disampaikan. (e) Guru menerapkan strategi belajar secara individu namun juga menciptakan kegiatan i       i  belajar yang menyenangkan shingga siswa nyaman dalam belajar. Adanya peningkatan hasil belajar IPS siswa setelah pelaksanaan PAKEM. Hal ini dapat diketahui dari nilai hasil belajar siswa yang meningkat pada siklus II dengan melihat ketuntasan klasikal mencapai 70%. Disarankan kepada guru IPS, agar dapat mengelola kelas dengan baik lagi demi terciptanya suasana pembelajaran yang aktif, kreatif, efektif dan menyenangkan.

Penerapan pembelajaran tematik untuk meningkatkan hasil belajar Calistung kelas 2 SD Negeri Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro / Hevyana Dewi

 

Kata Kunci: Pembelajaran tematik, hasil belajar membaca, menulis, menghitung (calistung) siswa. Hasil wawancara dan observasi di kelas 2 SDN Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro menunjukkan bahwa hasil belajar calistung siswa masih rendah. Hal ini terlihat dari hasil belajar siswa Pra Tindakan, dari 35 siswa yaitu terdapat 18 siswa atau sebesar 51% yang sudah mencapai ketuntasan belajar, dan terdapat 17 siswa atau sebesar 49% yang belum mencapai ketuntasan belajar dan rata-rata hasil belajar siswa 65. Kurangnya kemampuan membaca menulis dan berhitung pada siswa sehingga hasil belajar siswa rendah.Tujuan penelitian ini mendeskripsikan penerapan pembelajaran tematik dalam meningkatkan hasil belajar calistung siswa kelas 2 SDN Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) yang dilaksanakan dalam dua siklus. Satu siklus terdiri dari dua kali pertemuan. Masing-masing pertemuan terdiri dari pertemuan pertama 2 jam pelajaran, pertemuan kedua 2 jam pelajaran dengan alokasi waktu 1 jam pelajaran selama 35 menit. Teknik pengumpulan data yang digunakan dalam penelitian adalah: (1) Observasi (2) Tes (3) Format catatan lapangan (4) Dokumentasi. Subyek penelitian adalah siswa kelas 2 SDN Kauman 1 Kecamatan Baureno Kabupaten Bojonegoro sejumlah 35 siswa. Materi yang diajarkan adalah materi semester 2 dengan tema ” Lingkungan” yang dibuat dari berbagai perpaduan mata pelajaran diantaranya B. Indonesia, IPA, Matematika, IPS, dan SBK. Hasil dari penelitian ini menunjukkan bahwa penerapan pembelajaran tematik dapat meningkatkan hasil belajar calistung siswa. Dibuktikan dengan peningkatan rata-rata nilai hasil belajar siswa pada Siklus 1 sebesar 70 dan meningkat pada Siklus 2 menjadi 77. Persentase pelaksanaan pembelajaran calistung di dalam kelas juga mengalami peningkatan, persentase aktivitas membaca siswa pada siklus 1 sebesar 72%, sedangkan pada siklus 2 meningkat menjadi 78%. Persentase aktivitas menulis pada siklus 1 sebesar 65%, sedangkan pada siklus 2 meningkat menjadi 82%.. Sedangkan aktivitas berhitung pada siklus 1 sebesar 68%, sedangkan pada siklus 2 meningkat menjadi 81%. Adapun saran yang dapat diberikan yaitu Bagi guru yang akan menerapkan pembelajaran pembelajaran tematik sebaiknya mempersiapkan hal-hal yang dibutuhkan secara matang sebelum memulai pelaksanaan pembelajaran seperti menyiapkan RPP dan media pembelajaran yang akan digunakan, guru sebaiknya juga lebih komunikatif dengan siswa dan menggunakan metode yang lebih bervariasi agar siswa tidak bosan

Hubungan latar belakang pendidikan dan motivasi kerja dengan prestasi kerja pegawai negri sipil di SMK Negeri se-Kota Probolinggo / Wahyu Maulita

 

Kata Kunci: latar belakang pendidikan, motivasi kerja, prestasi kerja Prestasi kerja yang tinggi merupakan manifestasi dari kualitas pegawai yang merupakan suatu hal yang sangat penting dalam menunjang kelancaran pencapaian tujuan organisasi/instansi. Dengan prestasi kerja yang tinggi menurut Munasef (1983:30) adalah ”berarti pegawai benar-benar dapat berfungsi sebagai penghasil kerja yang tepat guna dan berhasil guna sesuai dengan sasaran-sasaran organisasi yang hendak dicapai”. Berhasil tidaknya PNS dalam menjalankan tugasnya erat kaitannya dengan motivasi atau dorongan yang mempengaruhinya dalam menjalankan tugasnya sehari-hari. Motivasi atau dorongan pada pegawai di dalam menjalankan tugasnya sangat diperlukan, karena motivasi merupakan perangsang pegawai negeri dalam menjalankan tugasnya sehingga tugas yang dilaksanakan dan dibebankan kepada pegawai negeri tersebut dapat dicapai dengan hasil yang maksimal seperti yang diharapkan. Penelitian ini memiliki tujuan untuk mendeskripsikan: (1) latar belakang pendidikan pegawai negeri sipil, (2) motivasi kerja pegawai negeri sipil, (3) prestasi kerja pegawai negeri sipil, dan (4) hubungan latar belakang pendidikan dan motivasi kerja dengan prestasi kerja pegawai negeri sipil di SMK Negeri Se-Kota Probolinggo. Rancangan penelitian ini yang digunakan adalah ancangan deskiptif korelasional, yang terdiri dari tiga variabel yaitu latar belakang pendidikan dan motivasi kerja sebagai variabel bebas dan prestasi kerja sebagai variabel terikat, dengan menggunakan teknik analisis korelasi Pearson Product Moment. Analisis tersebut dilakukan dengan tujuan untuk menguji hipotesis penelitian yaitu hubungan antara latar belakang pendidikan dan motivasi kerja dengan pestasi kerja. Populasi penelitian ini adalah pegawai negeri sipil di SMK Negeri Se-Kota Probolinggo yang berjumlah 345 orang, dan sampelnya 182 orang yang diambil dengan menggunakan teknik Random Sampling, sehingga setiap PNS berhak menjadi sampel. Teknik pengumpul data dalam penelitian ini menggunakan angket, dengan Skala Likert yang menyediakan empat alternatif jawaban yaitu sangat setuju, setuju, kurang setuju dan tidak setuju. Hasil penelitian ini adalah: (1) sebanyak 69 PNS (37,91%) mempunyai tingkat pendidikan sangat tinggi, 68 PNS (37,36%) mempunyai tingkat pendidikan tinggi, 42 PNS (23,08%) memiliki tingkat pendidikan rendah, sedangkan 3 PNS (1,65%) memiliki tingkat pendidikan sangat rendah dengan nilai rata-rata (mean) sebesar 23 yang berarti memiliki tingkat pendidikan tinggi, (2) sebanyak 95 PNS (52,20%) mempunyai tingkat motivasi kerja sangat tinggi, 70 PNS (38,46%) mempunyai tingkat motivasi tinggi, 14 PNS (7,69%) mempunyai tingkat motivasi kerja rendah, sedangkan 3 PNS (1,65%) mempunyai tingkat motivasi kerja sangat rendah dengan nilai rata-rata (mean) sebesar 69 yang berarti memiliki motivasi kerja sangat tinggi, (3) sebanyak 136 PNS (74,73%) mempunyai tingkat prestasi kerja sangat tinggi, 40 PNS (21,97%) mempunyai tingkat prestasi kerja tinggi, 5 PNS (2,75%) mempunyai tingkat prestasi kerja rendah, sedangkan 1 PNS (0,55%) mempunyai tingkat prestasi kerja sangat rendah dengan nilai rata-rata (mean) sebesar 75 yang berarti memiliki prestasi kerja sangat tinggi. Terdapat hubungan negatif dan tidak signifikan antara variabel latar belakang pendidikan (X1) dengan prestasi kerja PNS SMK Negeri Se-Kota Probolinggo (Y). Terdapat hubungan positif yang signifikan antara variabel motivasi kerja (X2) dengan prestasi kerja PNS SMK Negeri Se-Kota Probolinggo (Y). Terdapat hubungan yang signifikan antara variabel latar belakang pendidikan (X1) dan motivasi kerja (X2) dengan prestasi kerja PNS SMK Negeri Se-Kota Probolinggo (Y). Disarankan kepada: (1) Kepala SMK Negeri Se-Kota Probolinggo diharapkan mengembangkan dan meningkatkan motivasi bagi pegawai para pegawainya di sekolah. Selain itu Kepala Sekolah diharapkan agar bisa memberikan pendidikan jabatan kepada pegawainya guna meningkatkan prestasi kinerja baik bagi guru maupun staf tata usaha dalam meningkatkan motivasi di dalam bekerja, (2) Guru dan Staf Tata Usaha SMK Negeri Se-Kota Probolinggo diharapkan lebih meningkatkan motivasi dalam bekerja, sehingga dapat meningkatkan kualitas kerjanya, dengan tujuan meningkatkan profesionalisme di dalam bekerja yang berupa prestasi kerja pegawai, (3) Ketua Jurusan Administrasi Pendidikan, diharapkan dapat menambah referensi baik berupa buku, maupun pedoman mengenai latar belakang pendidikan dan motivasi kerja dengan prestasi kerja PNS, (4) peneliti lain diharapkan penelitian ini lebih dikembangkan lagi, karena penelitian ini dilakukan dengan keterbatasan-keterbatasan yang ada. Penelitian selanjutnya diharapkan mengembangkan latar belakang pendidikan dan motivasi kerja dengan variabel, populasi, dan instrumen yang berbeda.

Perancangan buku Pop Up tentang pengenalan satwa langka Indonesia untuk anak-anak usia 7-11 Tahun / Yudhistya Ayu Kusumawati

 

Kata Kunci: Buku Pop Up, Satwa Langka Indonesia Indonesia merupakan negara kepulauan yang kaya akan keanekaragaman faunanya. Indonesia memiliki berbagai jenis satwa langka yang terancam punah karena habitatnya yang terus tergeser oleh populasi manusia. Selain itu, perburuan liar ikut mempengaruhi satwa-satwa ini mendekati kepunahan. Pengetahuan tentang satwa langka Indonesia pun masih sangat minim. Masyarakat Indonesia harus belajar untuk lebih peduli terhadap satwa langka karena merupakan salah satu kekayaan negara yang patut untuk kita jaga kelestariannya. Untuk menumbuhkan rasa peduli masyarakat dapat dilakukan dengan cara memperkenalkan satwa langka yang dimiliki Indonesia kepada masyarakat luas. Menanamkan rasa peduli dapat ditanamkan semenjak kecil yaitu dengan cara belajar. Memperkenalkan berbagai macam satwa langka Indonesia sejak dini diharapkan dapat memberikan pengetahuan kepada mereka tentang keberadaan satwa langka di Indonesia. Anak-anak dapat memahami bahwa di Indonesia memiliki banyak keanekaragaman satwa yang menarik dan unik yang terancam punah. Berbagai satwa langka dengan wujud dan keunikan masing-masing diharapkan dapat menarik perhatian dan menumbuhkan rasa kecintaan yang dikemas dengan tampilan visualisasi yang menarik untuk anak-anak. Maka, dibutuhkan suatu inovasi atau sesuatu yang menarik agar minat belajar masyarakat tentang satwa Indonesia semakin tinggi. Satwa yang beragam inilah maka diperlukan suatu media yang menarik. Salah satunya adalah buku pop up tentang satwa langka Indonesia. Buku berbasis pop up saat ini merupakan media yang cukup diminati karena didukung dengan visualisasi 3D. Diharapkan dengan adanya tampilan 3D pada buku pop up akan membuat semakin menarik sehingga pesan yang akan disampaikan akan dengan mudah di terima oleh penikmat buku tersebut. Buku ini diharapkan bisa memenuhi kebutuhan masyarakat tentang pengenalan satwa langka Indonesia yang dikemas dengan menarik dan komunikatif sehingga bisa menumbuhkan rasa kecintaan sang pembaca untuk menjaga dan melestarikan satwa di Indonesia khususnya anak-anak sekolah dasar usia 7 – 11 tahun.

Faktor - faktor yang mempengaruhi minat siswa mengikuti kegiatan ekstrakurikuler batik di SMA Negeri 1 Tumpang Kabupaten Malang / Maria Puspitasari

 

Kata Kunci: faktor-faktor minat, ekstrakurikuler batik, SMA Ekstrakurikuler batik merupakan salah satu kegiatan ekstrakurikuler yang ada di SMA Negeri 1 Tumpang. Kegiatan ini sangat unik dan menarik karena guru pengajar ekstrakurikuler batik menciptakan suatu batik dengan aliran ekspresionisme, yang diberi nama Batika Mandiria Smaneta. Kegiatan ekstrakurikuler batik masih tergolong kurang diminati siswa, hal ini ditunjukkan dari sejumlah 665 siswa kelas X dan XI, hanya 43 siswa yang mengikuti kegiatan ekstrakurikuler batik. Oleh karena itu faktor-faktor yang mempengaruhi minat siswa dalam mengikuti kegiatan tersebut ingin dikaji lebih lanjut, agar dapat dipergunakan sebagai pertimbangan dan meningkatkan kualitas pembelajaran ekstrakulikuler batik di sekolah. Tujuan penelitian ini adalah untuk mengungkap faktor-faktor pribadi dan faktor-faktor sosial yang mempengaruhi minat siswa dalam mengikuti kegiatan ekstrakurikuler batik di SMA Negeri 1 Tumpang. Penelitian ini menggunakan rancangan penelitian deskriptif kuantitatif. Pengambilan sampel dalam penelitian ini menggunakan teknik total sampling. sampel yang digunakan adalah semua siswa yang mengikuti ekstrakurikuler batik yang berjumlah 43 siswa. Pengumpulan data dilakukan menggunakan angket dengan analisis data menggunakan teknik prosentase. Hasil penelitian menunjukkan bahwa Faktor-faktor pribadi yang mempengaruhi minat siswa dalam mengikuti kegiatan ekstrakurikuler batik, yaitu faktor motivasi (95,35%), faktor sifat pribadi (54,26%), faktor latihan (50%), dan faktor kecerdasan (48,84%). Sedangkan faktor-faktor sosial yang mempengaruhi minat siswa dalam mengikuti kegiatan ekstrakurikuler batik yaitu, faktor cara mengajar guru (93,02%), faktor sarana dan prasarana (62,79%), faktor keluarga (40,70%), faktor lingkungan (23,26%), dan faktor motivasi sosial (11,63%).

Pendeteksi bahaya kebakaran menggunakan sensor asap CO-MQ7 dan sensor suhu LM35 berbasis mikro kontrol ATMega 8535 / Henisa Putra Utama Wiyanata

 

Kata Kunci: Pendeteksi Bahaya Kebakaran Menggunakan Sensor Asap Co Mq-7 Dan Sensor Suhu Lm 35 Berbasis Mikrokontrol Atmega8535, ATMEGA 8535. Dalam kurun waktu singkat perkembangan teknologi melaju dengan sangat pesat. Perkembangan teknologi ini merupakan hasil kerja keras dari rasa ingin tahu manusia terhadap suatu hal yang pada akhirnya diharapkan akan mempermudah manusia. Dengan pesatnya laju perkembangan teknologi tersebut banyak bermunculan alat-alat yang canggih yang dapat bekerja secara otomatis. Dalam bidang elektronika, perlahan-lahan peralatan manual mulai digantikan dengan peralatan elektronik yang dapat bekerja secara otomatis, contohnya dalam bidang keamanan. Sistem keamanan merupakan hal yang sangat penting bagi kehidupan kita sehari-hari. Dan seiring dengan perkembangan teknologi, telah banyak kita lihat peralatan-peralatan elektronika yang berfungsi untuk menciptakan keamanan di lingkungan kita sehari-hari. Baik itu keamanan dari pencurian bahkan sampai hal hal yang tidak diinginkan lainnya seperti kebakaran misalnya. Pada kasus kebakaran, tingkat kerugian yang dihasilkan oleh bencana kebakaran tentunya sangat besar. Kebakaran yang terjadi dapat diatasi, dan dapat meminimalkan kerugian yang terjadi apabila kita mengetahui gejala-gejala akan terjadi kebakaran sejak dini. Untuk merealisasikan hal tersebut, diperlukan suatu peralatan yang cerdas yang dapat memberitahukan kepada kita bahwa telah terjadi kebakaran di suatu ruangan atau di tempat umum secara dini sehingga dengan adanya alat ini kita dapat melakukan antisipasi yang lebih lanjut guna menghindari kerugian yang disebabkan oleh kebakaran. Untuk menyikapi berbagai pernyataan di atas maka diperlukan suatu device atau alat yang dapat bekerja maksimal untuk membantu proses pengidentifikasian gejala-gejala yang berpotensi mengakibatkan kebakaran khususnya di perkantoran. Karena keselamatan pekerja sangat dioptimalkan yaitu dengan membuat sistim pendeteksi kebakaran di perkantoran dengan menggunakan sensor asap CO MQ-7 dengan dilengkapi sensor suhu. Dengan media ini diharapkan mampu mengurangi tingkat kecelakaan yang dikarenakan kebakaran di perkantoran. Perbedaan alat ini dengan alat yang sebelumnya yang telah pernah dibuat yaitu pada keluaran dari kedua sensor yang pada alat ini direportkan langsung ke PC user pengamanan kebakaran ataupun security untuk mengetahui tingkatan gas monoksida atau asap sangat dioptimalkan dalam alat ini.

Pelaksanaan pengembangan kawasan agropolitan Kabupaten Malang (studi kasus Kecamatan Poncokusumo) / Lia Sunfianah

 

Kata Kunci : Agropolitan, pembangunan ekonomi, sektor pertanian, ekonomi perdesaan dan perkotaan. Kecamatan Poncokusumo Kabupaten Malang diarahkan menjadi kawasan agropolitan karena wilayah tersebut dinilai sangat potensial di bidang pertanian, khususnya produk tanaman pangan, hortikultura, buah, dan sayur. Konsep agropolitan mengakomodasi dua hal utama, yaitu menetapkan sektor pertanian sebagai sumber pertumbuhan ekonomi utama dan diberlakukannya ketentuan-ketentuan mengenai otonomi daerah. Agropolitan merupakan konsep berpikir, cara pandang, atau strategi untuk melakukan pembangunan di daerah, baik di perkotaan maupun sub perkotaan dengan pertanian berkelanjutan. Fokus dari penelitian ini adalah untuk mengetahui sejauh mana pelaksanaan agropolitan di Kecamatan Poncokusumo Kabupaten Malang dan mengetahui prospek pengembangan kawasan agropolitan di Kecamatan Poncokusumo Kabupaten Malang. Penelitian ini menggunakan pendekatan kualitatif. Tujuan penulis menggunakan pendekatan kualitatif adalah berusaha memberikan gambaran yang sistematis, faktual dan akurat mengenai pelaksanaan pengembangan kawasan agropolitan di Kecamatan Poncokusumo Kabupaten Malang. Jenis data yang digunakan dalam penelitian ini adalah data sekunder yang berupa data dokumen yang diperoleh dari BAPPEDA Kabupaten Malang dan Kecamatan Poncokusumo, data primer yang diperoleh dari wawancara dan observasi. Hasil dari penelitian ini menerangkan bahwa pelaksanaan pengembangan kawasan agropolitan kecamatan poncokusumo saat ini dalam tahap perbaikan infrastruktur dan peningkatan produksi pertanian dan peningkatan sub sistem pendukung peningkatan produksi pertanian. Pada masa yang akan datang diharapkan pengembangan kawasan agropolitan kecamatan poncokusumo bisa menjadi daerah agrowisata. Kesimpulan dari penelitian ini adalah Kecamatan Poncokusumo Kabupaten Malang belum sepenuhnya menjadi kawasan Agropolitan dikarenakan pengembangannya yang belum maksimal. Pelaksanaan pengembangan kawasan agropolitan pada tahun 2008-2010 masih difokuskan pada pembangunan sarana dan prasarana guna menunjang produksi pertanian, sedangkan untuk tahun 2011 sudah mulai dilakukan program peningkatan produksi pertanian dan program peningkatan sub sistem pendukung peningkatan produksi pertanian. Pemerintah setempat mengharapkan di masa mendatang daerah kawasan Agropolitan ini akan menjadi daerah agrowisata dan akan menjadi daerah hinterland untuk kawasan di sekitarnya.

Pengaruh pengalaman dan motivasi mengajar terhadap performansi guru dalam penerapan kegiatan belajar mengajar di SMK Nasional Malang / Septian Jaka Lesmana

 

Kata Kunci : Pengalaman, Motivasi, Performansi Mengajar Kualitas pendidikan akan terwujud jika proses belajar mengajar di kelas berlangsung dengan baik. Untuk mewujudkan hal tersebut diperlukan adanya komponen yang mendukung, yang salah satunya adalah performansi mengajar guru. Performansi mengajar guru dalam proses belajar mengajar dipengaruhi oleh banyak faktor, tetapi penulis mengangkat faktor pengalaman dan motivasi mengajar yang dimiliki oleh setiap guru. Oleh karena itu permasalahan yang diangkat adalah : (1). Adakah pengaruh pengalaman mengajar guru terhadap performansi guru SMK Nasional Malang, 2) Adakah pengaruh motivasi mengajar guru terhadap performansi guru SMK Nasional Malang, 3) Seberapa besar pengaruh pengalaman dan motivasi mengajar terhadap performansi guru SMK Nasional Malang. Penelitian ini dilakukan di SMK Nasional Malang. Populasi penelitian adalah seluruh guru yang berjumlah 76 guru. Variabel bebas yang dikaji dalam penelitian ini adalah pengalaman mengajar (X1) dan motivasi mengajar (X2) sedangkan variabel terikatnya adalah performansi mengajar guru (Y). Pengumpulan data dengan cara angket dan observasi. Data yang telah terkumpul kemudian dianalisis dengan analisis regresi berganda. Hasil penelitian menunjukkan bahwa pengalaman mengajar mempunyai pengaruh positif dan signifikan dengan nilai F-hitung sebesar 10,387 atau lebih besar dari nilai F-tabel sebesar 3,117 dan nilai p-value lebih kecil dari taraf signifikansi α (0,002 < 0,05). Dan motivasi mengajar juga meiliki pengaruh positif dan signifikan dengan nilai F-hitung sebesar 8,383 atau lebih besar dari nilai F-tabel sebesar 3,117 dan nilai p-value lebih kecil dari taraf signifikansi α (0,004 < 0,05) terhadap performansi mengajar. Sementara itu berdasarkan hasil penelitian dapat disimpulkan bahwa, pengalaman mengajar dan motivasi mengajar mempunyai pengaruh yang signifikan terhadap performansi mengajar guru dengan R2 sebesar 0,250 atau sebesar 25%. Berdasarkan hasil penelitian tersebut, dapat disimpulkan secara umum perlu adanya upaya guru untuk mempertahankan dan meningkatkan pengalaman mengajar dan motivasi mengajar agar performansi mengajarnya menjadi lebih baik. Untuk meningkatkan kinerja/performansi mengajar guru terutama untuk kebutuhan kemajuan/berkembang, pihak kepala sekolah dan diknas juga melakukan penilaian secara rutin terhadap kinerja guru dalam proses kegiatan belajar mengajar disekolah, serta memberikan dorongan untuk terus menerus meningkatkan prestasi yang telah dicapai.

Pengembangan CD Multimedia pembelajaran mata pelajaran biologi kelas VIII semester II untuk Sekolah Menengah Pertama Negeri 9 Probolinggo / Rovika Sari

 

Kata kunci: pengembangan, CD, multimedia, pembelajaran , mata pelajaran biologi Belajar adalah suatu proses yang kompleks yang terjadi pada diri setiap orang sepanjang hidupnya. Proses belajar itu terjadi karena adanya interaksi antara seseorang dengan lingkungannya. Oleh karena itu, belajar dapat terjadi kapan saja dan di mana saja. Salah satu pertanda bahwa seseorang itu telah belajar adalah adanya perubahan tingkah laku pada diri orang yang mungkin disebabkan oleh terjadinya perubahan pada tingkat pengetahuan, keterampilan, atau sikapnya. Belajar biologi banyak memerlukan kegiatan pengamatan langsung, interpretasi hasil pengamatan, perancangan percobaan dengan mengendalikan berbagai macam variabel, pengujian hasil pengamatan secara berulang-ulang, penarikan kesimpulan baik secara empirik maupun rasional (hipotesis). Mata pelajaran biologi adalah salah satu bidang studi yang mengungkapkan gejala alam, prinsip dan konsep pengetahuan alam serta keterkaitannya dengan lingkungan, teknologi dan masyarakat. Berdasarkan hasil observasi diperoleh beberapa fakta pembelajaran Biologi di SMP Negeri 9 Probolinggo, sebagai berikut; (1) Proses pembelajaran pada mata pelajaran Biologi kelas VIII semester II belum pernah dilakukan pemanfataan media pembelajaran berupa multimedia, karena kurang tersedianya waktu untuk membuat multimedia dan guru belum mampu merancang dan membuat multimedia, (2) Sebagian besar kegiatan belajar mengajar Biologi diberikan oleh guru dengan menggunakan metode ceramah, diskusi, dan eksperimen. Siswa seringkali hanya mendengarkan dan mencatat materi yang dijelaskan oleh guru, (3) Di dalam kelas terdapat banyak siswa dengan berbagai perbedaan seperti perbedaan dalam hal latar belakang, kecerdasan, kebutuhan, bakat, minat, dan pengalaman yang berasal dari lingkungan sosial masing-masing siswa, (4) Banyaknya siswa yang tidak dapat memahami materi dengan metode pembelajaran yang selama ini digunakan oleh guru, hal ini dapat dilihat melalui hasil belajar siswa. Siswa yang dapat mencapai KKM hanya 20% dari jumlah siswa dalam 1 kelas. Guru memberikan remidi kepada siswa yang belum memenuhi standar kelulusan dengan memberikan tes ulang. Tujuan pengembangan ini adalah menghasilkan media pembelajaran yang menarik dan mudah dipahami sebagai media pembelajaran di kelas VIII SMP Negeri 9 Probolinggo. Tujuan khusus dari pengembangan ini adalah mengetahui kelayakan/kevalidan media yang dikembangkan serta menguji kefektifan media ini dalam proses belajar. Penelitian ini tergolong penelitian pengembangan yaitu penelitian yang mencatat, meneliti dan mengadakan penyempurnaan terhadap semua kejadian yang berhubungan dengan proses pembelajaran, sehingga ditemukan metode penyampaian dengan menggunakan CD multimedia pembelajaran. Berdasarkan uji coba yang telah dilakukan kepada ahli materi, ahli media dan siswa dapat disimpulkan bahwa CD multimedia pembelajaran layak atau valid digunakan sebagai media pembelajaran biologi di kelas VIII. Dengan masing–masing prosentase dari:(1) Ahli materi (83,3%) dengan kriteria valid/ layak, (2) Ahli media (92,5%) dengan kriteria valid/ layak, (3) Siswa perorangan (96,6%) dengan kriteria valid/ layak, (4) Siswa kelompok kecil (98,3%)dengan kriteria valid/ layak, (5) Siswa kelompok besar (92,4%) dengan kriteria valid/ layak.

Outdoor English teaching in the first grade of Madrasah Ibtidaiyah Alam success school center (SSC) Pare / Tri Agusti Setyarini

 

Key word: English Teaching, Young Learners, Outdoor Class Teaching Several studies had been conducted with the focus on English teacher’s techniques in teaching English for young learners, but there was no description about the implementation of outdoor English teaching in the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare. The previous studies were conducted in schools which did not implement outdoor English teaching as their school program. Some of their findings state that young learners at the age of six to seven years old are able to learn English as a foreign language. Next, some of the techniques in teaching that were found were question and answer, listen and repeat, quizzes and games. No studies discussed the implementation of outdoor English teaching in the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare. This research was intended to describe the implementation of outdoor English teaching as the school program that was implemented in teaching English in the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare. Three components were investigated in this research: the implementation of outdoor English teaching in the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare, the reasons of applying outdoor English teaching, and the advantages and disadvantages of the implementation of outdoor English teaching in the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare. This research applied a descriptive qualitative design. The subjects of this study were the English teacher of Madrasah Ibtidaiyah Alam Success School Center Pare and 24 young learners of the first grade. The main instrument to collect data in the research was the researcher, who was supported by some instruments i.e. field notes, an interview guide and supplementary documents. The findings of this research were as follows. First, the implementation of outdoor English teaching for the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare was combined with indoor class teaching. Second, the time allotment of indoor and outdoor class teaching was already set up by the teacher based on the students’ need. The percentage of time allotment of indoor and outdoor class teaching for listening materials was 60% indoor and 40% outdoor, for speaking materials, 40% indoor and 60% outdoor, for reading materials, 40% indoor and 60% outdoor, and for writing materials, 60% indoor and 40% outdoor. Third, the techniques that were used in outdoor class teaching were almost similar with indoor class teaching. The techniques that were used by the teacher at outdoor class teaching were question and answer, practice, listen and repeat, read aloud, sing a song, play games, and do a task (quiz). The techniques that were used in outdoor English teaching did not utilize the objects that were available in the nature and students environment. Fourth, the researcher found five reasons why the teacher implemented outdoor English teaching. The reasons were outdoor English teaching was relax, it was one of the ways to minimize the learners’ boredom, one of the ways to present English for young learners, it was appropriate with the learners’ character, and it was one of the ways to build the learner’s awareness in loving the nature. Fifth, based on the findings of the interview with the teacher, there were eight advantages and two disadvantages of the implementation of outdoor English teaching in the first grade of Madrasah Ibtidaiyah Alam Success School Center Pare. The advantages were increasing the learners’ motivation in learning English, giving a comfortable atmosphere to the learners, minimizing the learners’ boredom, giving a chance for the learners to recognize the nature, engaging the learners’ activeness while teaching and learning process, releasing the learners to express their expression as boundless as possible, increasing the learners’ enthusiasm, and omitting a perception that English was difficult. The disadvantages were it needed a lot of time in preparing the teaching and learning process, and the learners’ attention sometimes did not focus to the lesson. Based on the result of the research, the researcher suggests that the teacher should utilize the objects that are available in the nature or the environment surrounding the students as the objects for teaching and learning process. Next, the researcher suggests that the teacher manage the time and the class as well as possible. Afterwards, the researcher suggests the other schools which conduct or plan to conduct the same program provide sufficient facilities and techniques to the program in order to conduct the program successfully. Last, for future researchers, they are expected to conduct further studies to observe and analyze more deeply on the other aspects such as the students motivation in joining outdoor English teaching, the effectiveness of the implementation of outdoor English teaching, etc.

Pengembangan Multimedia pembelajaran interaktif materi menggunakan mesin bubut untuk operasi dasar pada program studi teknik mesin jurusan teknik pemesinan kelas 10 Semester 1 di SMKN 1 Glagah Banyuwangi / Andreas Setiaji Prawira

 

Kata Kunci :Pengembangan, Multimedia Interaktif, Materi Menggunakan Mesin Bubut Untuk Operasi Dasar, Kelas 10 SMK Pembelajaran mesin bubut adalah pelajaran wajib yang diajarkan pada jurusan teknik mesin di SMK. Permasalahan yang sering terjadi dalam pembelajaran mesin bubut di SMK adalah berkaitan dengan waktu praktek dan teori serta perbandingan jumlah mesin yang dimiliki sekolah dengan jumlah siswa. Karena mesin bubut adalah mesin yang berukuran besar dan sangat mahal sehingga masih sedikit sekolah yang mampu memenuhi jumlah mesin yang sesuai dengan jumlah siswa yang belajar disana. Hal ini juga berdampak dengan pengaturan waktu pembelajaran yang ada di sekolah tersebut agar siswa dapat mempelajari mesin bubut secara optimal. Mesin bubut tergolong mesin berat yang bisa membahayakan penggunanya apabila tidak dioperasikan secara benar. Media pembelajaran berbasis komputer ini berbentuk multimedia yaitu penggabungan berbagai media (teks, suara, gambar, animasi dan video) dengan alat bantu (tool) dan koneksi (link) sebagai alat penyampai pesan. Multimedia pembelajaran tersebut berisi materi yang disampaikan sebagai tahap persiapan sebelum siswa melakukan praktek kerja yang sesungguhnya. Oleh karena itu materi dibuat dalam bentuk video sehingga dapat memberikan tampilan yang benar-benar nyata mengenai mesin bubut, bagaimana bentuknya serta apa saja bagian-bagian yang ada pada mesin bubut itu sendiri dan cara-cara pengoperasiannya. Penggunaan multimedia pembelajaran ini menjadi sarana pembantu guru dalam memberikan gambaran nyata mengenai mesin bubut ketika pelajaran teori dan siswapun dapat melakukan pembelajaran sendiri di rumah sehingga tidak lagi bergantung pada saat melakukan praktek di sekolah untuk dapat belajar dan mendapat gambaran nyata mengenai mesin bubut dan bagaimana cara mengoperasikannya. Tujuan pengembangan ini adalah untuk menghasilkan sebuah media pembelajaran mesin bubut bagi siswa dan guru berbentuk multimedia pembelajaran yang layak dan didalamnya berisi video tutorial sebagai penyampai materi utama untuk memberikan tampilan yang benar-benar nyata tentang mesin bubut pada mata pelajaran Kompetensi Kejuruan dengan materi Menggunakan Mesin Untuk Operasi Dasar pada mesin bubut di SMKN 1 Glagah Banyuwangi dan dilengkapi petunjuk pemanfaatan. Model pengembangan yang digunakan dalam pengembangan multimedia ini diadaptasi dari model Sadiman (2008). Dalam sistematika pengembangannya, terdapat langkah-langkah yang akan dilakukan guna mencapai hasil yang diharapkan. Adapun tahap-tahap tersebut antara: (1) identifikasi kebutuhan; (2) perumusan tujuan; (3) perumusan butir-butir materi; (4) perumusan alat pengukur keberhasilan; (5) penyusunan naskah/storyboard ; (6) produksi; (7) tes/ ujicoba; (8) revisi; (9) Produk siap dimanfaatkan Hasil pengembangan multimedia pembelajaran ini memenuhi kriteria valid, yang meliputi, ahli media 93,75% valid, ahli materi 93,1% valid, siswa perseorangan 90% valid, uji coba kelompok kecil 88,5 valid, uji coba lapangan 84,2% valid. Untuk hasil belajar sebelum dengan setelah menggunakan multimedia, data tersebut menunjukkan peningkatan hasil belajar siswa yang memenuhi SKM sebanyak 66,67% pada uji coba perseorangan, 60% pada uji coba kelompok kecil, dan55,16% pada uji coba lapangan. Saran ditujukan bagi siswa diharapkan menggunakan media sesuai petunjuk pemanfaatan yang ada dan juga lebih banyak menggunakan berbagai jenis media pembelajaran, sehingga dapat meningkatkan minat, motivasi belajar serta hasil belajar siswa. Selanjutnya saran bagi guru diharapkan mempelajari cara penggunaan & pemanfaatan multimedia sehingga dalam pelaksanaanya guru lebih siap dan menguasai penggunaan multimedia. Dan diharapkan pula lebih sering menggunakan variasi dalam proses pembelajaran, salah satunya dengan menggunakan multimedia pembelajaran, sehingga mempermudah guru dalam menyampaikan materi kepada siswa. Dan bagi pengembang selanjutnya diharapkan untuk mengembangkan multimedia ini sampai tahap simulasi dengan memasukkan sejumlah animasi sehingga pembelajaran dapat mendekati nyata. Karena mengingat pembelajaran ini tidak hanya ditekankan pada teori saja, namun juga praktek kerja.

Penerapan pembelajaran kooperatif model numbered heads together (NHT) untuk meningkatkan keaktifan belajar siswa dalam matapelajaran IPS Geografi pada materi atmosfer dan hidrosfer kelas VII-F SMP Negeri 13 Malang / Nur Juanita Fitria N

 

Kata Kunci: pembelajaran kooperatif model NHT, keaktifan belajar siswa, SMP Negeri 13 Malang Berdasarkan hasil Observasi awal pada tanggal 21 Oktober 2011 di kelas VII-F SMP Negeri 13 Malang diketahui bahwa sejauh ini pembelajaran IPS Geografi di kelas tersebut masih didominasi dengan penggunaan metode ceramah yang dilanjutkan dengan pemberian tugas mengerjakan LKS, kegiatan pembelajaran masih terfokus di dalam kelas, siswa cenderung pasif dalam mengikuti proses pembelajaran, dan hanya mengandalkan keterangan serta penjelasan dari guru. Data dokumentasi guru menyebutkan bahwa dari 42 siswa, yang tergolong aktif dalam pembelajaran hanya 21,43% dan selebihnya cenderung pasif. Sedangkan dari hasil observasi secara langsung, didapatkan data pencapaian keaktifan belajar siswa yang meliputi kegiatan: (a) bertanya 16,7%; (b) menjawab pertanyaan 21,4%; (c) berani mengungkapkan pendapat 11,9%; dan (d) bekerja secara kelompok 38,1%. Penelitian ini dirancang dengan menggunakan penelitian tindakan kelas dengan beberapa siklus. Setiap siklus terdiri 4 tahap kegiatan, yang meliputi perencanaan tindakan, pelaksanaan tindakan, observasi, dan refleksi. Pengambilan data dilakukan melalui observasi dengan berpedoman pada lembar observasi keaktifan belajar siswa dan keterlaksanaan kegiatan guru. Penelitian dilakukan di kelas VII-F SMP Negeri 13 Malang dengan jumlah siswa sebanyak 42 orang, pada materi Atmosfer dan Hidrosfer serta Dampaknya bagi Kehidupan. Berdasarkan hasil penelitian, diketahui bahwa setelah diterapkan model pembelajaran NHT pada siklus pertama keaktifan belajar siswa masih cukup rendah, yang ditandai dengan pencapaian keaktifan klasikal sebesar 38,1%. Pada siklus II, guru melakukan beberapa perbaikan pada pelaksanaan proses pembelajaran serta memotivasi siswa supaya lebih aktif, sehingga keaktifan belajar siswa secara klasikal mengalami peningkatan menjadi 88,1%. Selain adanya upaya perbaikan proses pembelajaran yang diupayakan oleh guru, adanya peningkatan keaktifan belajar siswa pada siklus II tersebut juga dikarenakan adanya usaha dari para siswa untuk mempelajari materi sebelum dilaksanakannya proses pembelajaran. Dengan demikian, siswa menjadi lebih siap dan dapat memberikan respon selama mengikuti kegiatan pembelajaran, baik melalui kegiatan bertanya, menjawab pertanyaan, mengungkapkan pendapat, maupun bekerja secara kelompok.

Model pembelajaran kooperatif jigsaw untuk meningkatkan hasil belajar IPS siswa kelas IV SDN Pasina I Lekok Pasuruan / Angga Arinta Luftika

 

Kata kunci: Pembelajaran jigsaw, hasil belajar, keragaman kenampakan alam dan buatan Penelitian ini di latar belakangi oleh kenyataan bahwa nilai ulangan harian dan semester kurang dari standar ketuntasan individu maupun klasikal, pembelajaran cenderung berpusat kepada guru dan metode pembelajaran masih bersifat informatif. Sebagai upaya untuk meningkatkan hasil belajar siswa perlu adanya penerapan pendekatan pembelajaran yang inovatif. Salah satunya adalah Jigsaw. Karena Jigsaw merupakan pembelajaran yang dapat meningkatkan rasa tanggung jawab siswa terhadap pembelajarannya sendiri dan teman yang lain. Siswa tidak hanya mempelajari materi yang diberikan, tetapi mereka juga harus siap memberikan dan mengajarkan materi tersebut pada anggota kelompoknya yang lain. Penelitian ini bertujuan untuk (1) Mendeskripsikan penerapan model pembelajaran Jigsaw dalam meningkatkan hasil belajar siswa pada mata pelajaran IPS materi keragaman penampakan alam dan buatan kelas IV SDN Pasinan I Lekok Pasuruan, (2) Mendeskripsikan aktivitas belajar siswa dalam pembelajaran IPS materi keragaman penampakan alam dan buatan kelas IV SDN Pasinan I Lekok Pasuruan (3) Mendeskripsikan hasil belajar siswa Kelas IV SDN Pasinan I Lekok Pasuruan dalam pembelajaran IPS materi keragaman penampakan alam dan buatan melalui model pembelajaran Jigsaw. Rancangan penelitian ini menggunakan penelitian tindakan kelas dengan pendekatan deskriptif kualitatif. Penelitian dilakukan melalui dua siklus. Masing-masing siklus meliputi tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian ini adalah siswa kelas IV SDN Pasinan I dengan jumlah siswa 20 yang terdiri dari 12 laki-laki dan 8 perempuan. Teknik pengumpulan data menggunakan observasi, wawancara, tes dan dokumentasi. Hasil penelitian dari siklus I dan siklus II menunjukkan bahwa pembelajaran dengan jigsaw mampu meningkatkan aktivitas belajar siswa dan hasil belajar siswa. Pada siklus I aktivitas belajar siswa rata-rata 74,80 dan pada siklus II memiliki rata-rata 82,05. Pada siklus I hasil belajar siswa memiliki nilai rata-rata sebesar 68,15 dengan ketuntasan belajar 60%, dan siklus II memiliki nilai rata-rata sebesar 72,15 dengan ketuntasan belajar 80%. Berdasarkan hasil penelitian dapat disimpulkan bahwa penerapan model Jigsaw dapat meningkatkan aktivitas belajar siswa dan hasil belajar siswa kelas IV SDN Pasinan I Lekok Pasuruan. Oleh karena itu disarankan hendaknya guru lebih banyak memberikan motivasi dan perhatian kepada siswa melalui metode yang bervariasi dan inovatif. Salah satunya model Jigsaw.

Meningkatkan keterampilan meroda pada pembelajaran senam lantai siswa kelas VIII B SMP Negeri 7 Malang menggunakan pendekatan bermain / Arif Faisol Halim

 

Kata Kunci: keterampilan meroda, pembelajaran senam lantai, bermain Meroda adalah suatu gerakan memutar ke samping yang pada suatu saat bertumpu pada kedua tangan dengan kedua kaki terbuka lebar. Berdasarkan observasi awal, diperoleh hasil bahwa penguasaan keterampilan meroda pada pembelajaran senam lantai siswa kelas VIII B SMP Negeri 7 Malang, ternyata kesalahan yang banyak muncul di lapangan adalah pada posisi tangan, posisi tungkai, dan sikap akhir. Penelitian ini bertujuan untuk meningkatkan keterampilan meroda pada pembelajaran senam lantai siswa kelas VIII B SMP Negeri 7 Malang dengan menggunakan pendekatan bermain. Rancangan penelitian yang digunakan dalam penelitian ini adalah penelitian tindakan kelas (PTK). Pelaksanaan tindakan kelas ini dilakukan melalui dua siklus di mana tiap siklus terdiri dari 4 tahap yaitu: (1) perencanaan, (2) pelaksanaan, (3) observasi, (4) refleksi. Subjek dalam penelitian ini adalah siswa kelas VIII B SMP Negeri 7 Malang. Teknik pengumpulan data dalam penelitian ini menggunakan observasi (pengamatan), dokumentasi, dan tes. Hasil penelitian menunjukkan bahwa keterampilan meroda pada pembelajaran senam lantai siswa kelas VIII B SMP Negeri 7 Malang mengalami peningkatan. Hal ini bisa dilihat dari persentase keberhasilan siswa dalam melakukan keterampilan meroda setelah diberi tindakan pada siklus 1. Hasilnya, dari 32 siswa ada 30 siswa mampu melakukan gerakan yang benar pada sikap awal dengan persentase 93,75% dengan kategori baik, 27 siswa mampu melakukan gerakan benar pada posisi tangan dengan persentase 84,37% dengan kategori baik, 25 siswa mampu melakukan gerakan yang benar pada posisi tungkai dengan persentase 78,12% dengan kategori baik, dan 26 siswa mampu melakukan gerakan yang benar pada sikap akhir dengan persentase 81,25% dengan kategori baik. Berdasarkan hasil penelitian dapat disimpulkan bahwa pembelajaran senam lantai dengan pendekatan bermain dapat meningkatkan keterampilan meroda pada pembelajaran senam lantai siswa kelas VIII B SMP Negeri 7 Malang.

Desain alat pereduksi arus transien akibat starting beban pada jaringan listrik skala rumah tangga 900VA / Andri Nugroho

 

ABSTRAK: Setiap peralatan listrik saat awal operasi akan mengambil arus yang relatif lebih besar dari arus nominalnya. Alat listrik yang di dalamnya terdapat transistor dan terdapat gabungan rangkaian juga di dalamnya yang mudah sekali terkena tegangan transien akibat penyalaan awal alat elektronik tersebut. Hal itu yang menyebabkan mudah rusaknya komponen-komponen elektronik terutama pada transistor dan gabungan rangkaiannya. Saat kondisi peralatan itu cepat menyala dibutuhkan arus yang sangat besar jika dibandingkan arus nominal kondisi tunak. Lonjakan arus inilah yang disebut arus transien. Fungsi alat ini berguna untuk mengurangi lonjakan starting alat listrik pada rumah tangga tersebut, terutama pada saat beban puncak terjadi, sehingga mengamankan alat elektronik dari arus transien yang besar. Pada prinsipnya kerja alat ini yaitu ketika mikrokontroler ATMega8 memberikan output berlogika 0 ke pin 2 MOC3041 yang telah diberi tegangan 5 volt pada pin 1, maka LED yang ada di dalam MOC3041 menyala dan disensor oleh photodioda yang terdapat zero crossing didalamnya yang mampu membuat opto-triac ini mulai konduksi saat siklus tegangan masukannya di titik nol. Kemudian memicu gate pada triac yang sudah mengalir tegangan 220Vac, sehingga setelah pemicuan terjadi maka triac akan mengalirkan namun tertunda karena mengalirnya tegangan ke beban di mulai dari titik nol sehingga beban menyala secara aman. Alat pereduksi yang telah dibuat mempunyai kapasitas alat sesuai skala rumah tangga 900VA dengan tegangan AC 220 Volt dan frekuensi 50 Hz dan juga telah dicoba serta diuji dan diambil datanya pada lemari es “LG” berdaya 343 Watt. Dari hasil analisis dan pembahasan sebelum menggunakan alat pereduksi rata-rata arus transien yang terjadi yaitu 1,84 ampere dan dengan menggunakan alat pereduksi, arus transien dapat berkurang sampai 1,26 ampere sehingga kekuatan alat mengurangi lonjakan arus jika diprosentasekan sebesar 31,52 % dari arus sebelum menggunakan alat pereduksi. Kata kunci: Arus Transien, Opto-triac, Triac

Perbaikan gerak melayang pada lompat jauh gaya menggantung melalui metode bermain dalam pembelajaran pendidikan jasmani kelas IV di SDN Asrikaton II Kecamatan Pakis Kabupaten Malang / Eka Ratna Asih Yuliana Sari

 

Kata kunci: Perbaikan Gerak Melayang, Lompat Jauh Gaya Menggantung, Metode Bermain. Lompat jauh merupakan suatu gerakan melompat menggunakan tumpuan satu kaki untuk mencapai hasil jarak terjauh. Pembelajaran lompat jauh di sekolah umumnya belum berjalan dengan lancar, demikian pula yang terjadi pada kelas IV SDN Asrikaton II Kecamatan Pakis Kabupaten Malang. Hal tersebut dikarenakan banyak faktor, salah satu di antaranya penerapan metode pembelajaran yang kurang menarik bagi siswa. Berdasarkan hasil observasi awal, diperoleh hasil bahwa penguasaan keterampilan lompat jauh gaya menggantung siswa kelas IV SDN Asrikaton II Kecamatan Pakis Kabupaten Malang dapat dikatakan kurang baik karena dari keempat teknik dasar yang diamati, yaitu awalan, tumpuan, saat melayang, dan saat mendarat persentase kesalahan masih banyak terlihat pada teknik saat melayang yaitu 90,33%. Penelitian ini bertujuan untuk memperbaiki gerak melayang pada lompat jauh gaya menggantung dengan metode bermain. Metode bermain digunakan agar siswa tidak bosan selama pembelajaran lompat jauh gaya menggantung. Penelitian ini termasuk jenis penelitian tindakan kelas. Teknik pengumpulan data yang dilakukan adalah melalui tes praktik lompat jauh gaya menggantung, observasi, wawancara, dokumentasi dan catatan lapangan. Penelitian tindakan kelas terdiri dari siklus-siklus yang saling berhubungan di mana pada tiap-tiap siklus terdiri dari tahaptahapan: 1. Perencanaan, 2. Pelaksanaan, 3. Pengamatan (observasi), dan 4. Refleksi. Hasil penelitian ini menunjukkan bahwa setelah melakukan pembelajaran dengan metode bermain terjadi perbaikan pada keterampilan gerak melayang siswa selama mengikuti pembelajaran lompat jauh dari tiap siklus. Siklus 1 terdiri dari 3 pertemuan dan siklus 2 terdiri dari 2 pertemuan. Pada siklus 1 dari aspek sikap badan saat melayang yang melakukan dengan benar sebesar 41,9%. Hasil siklus 2 menunjukkan bahwa peningkatan keterampilan lompat jauh khususnya pada gerak melayang di udara dengan keberhasilan dari aspek sikap badan saat melayang yang melakukan dengan benar sebesar 90,3%. Berdasarkan hasil penelitian ini, peneliti menyarankan bagi guru Pendidikan Jasmani di SDN Asrikaton II agar dapat menggunakan metode bermain dalam pembelajaran pendidikan jasmani olahraga, dan kesehatan. Metode bermain dapat dijadikan alternatif dalam pembelajaran lompat jauh gaya menggantung khususnya pada gerak melayang di udara karena berdasarkan hasil penelitian ini, dapat disimpulkan bahwa metode bermain dapat memperbaiki gerak melayang pada lompat jauh gaya menggantung siswa kelas IV SDN Asrikaton II Kecamatan Pakis Kabupaten Malang.

Pengembangan media CD interaktif pembelajaran pada mata pelajaran teknologi informasi dan komunikasi untuk siswa kelas X semester II tahun 2012 SMA Kertanegara Malang / Arya Yudhistira Laksana Putra

 

Kata Kunci: pengembangan, media, pembelajaraninteraktif, pelajaran TIK Media interaktifmerupakansalahsatu media alternative yang akandigunakanmenunjang proses pembelajaran. Kepraktisandankemudahanpenggunaan media interaktifinimembantusiswauntukbelajarsesuaidengan yang diharapkan, karena media inimemilikialurkomunikasiduaarah.Pemanfaatan CD interaktifdenganpenggunaanlayarkomputerbaik di laboratoriumkomputersekolahmaupunkomputerpribadiiniakanmempermudah proses pembelajaransiswasecaramandiridanmemahamimateri yang sifatnyateoritis-praktis, menciptakansituasidansuasanapembelajaran yang menarik, meningkatkanmotivasisertapeningkatankerjasamaantarsiswa. Berdasarkanobservasi yang dilakukanpadatanggal 9 April 2012, diketahuibahwasekolahmemilikifasilitaslaboratoriumkomputer yang lengkapdandipakaiuntukmenunjangpembelajaranmatapelajaranTeknologiInformasidanKomunikasi.Namun SMA belummenerapkanpembelajaransecaraindividubagisiswasehinggapengembangan media CD interaktifinidirasasangatmungkindanperludilakukan di SMA Kertanegara Malang karenapembelajaran TIK tidakbisahanyamenggunakanmetodemengajarsecaraklasikaldanharusdipraktikkanlangsungsecaraindividu, makadengan media inisiswa SMA Kertanegarabisamelaksanakanpembelajarantidakhanyadisekolahnamunjugapraktiklangsung di rumah. Tujuanpengembanganiniadalah: Menghasilkan media pembelajaran CD interaktif yang layaksesuaidengankualitasteknisdanpemanfaatannyasebagai media pembelajaran di kelas X SMA Kertanegara Malang. Penelitianinitergolongpenelitianpengembangan, dalampengertiansangatumum, berartipertumbuhan, perubahansecaraperlahan (evolusi), danperubahansecarabertahap.Dalambidangteknologipembelajaran (instructional technology), pengembanganmemilikiartisebagai proses menterjemahkanataumenjabarkanspesifikasirancangankedalambentukfisik. Ataudenganungkapan lain, pengembanganberarti proses menghasilkanbahan-bahanpembelajaran. Dalam TEP, istilahpengembangantersebutmemilikimaknakonsistendengancirifundamentalnya, yaitusebagai proses pertumbuhandanmerupakansuatu proses yang kreatif. Berdasarkanujicoba yang telahdilaksanakankepadaahlimateri, ahli media dansiswadapatdisimpulkanbahwa media pembelajaraninteraktiflayakatau valid digunakansebagai media pembelajaran TIK di kelas X semester II.Denganmasing-masingprosentasedari: (1) Ahlimateri (95%) dengankriteria valid/layak, (2) Ahli media (95%) dengankriteria valid/layak, (3) Siswaperorangan (95,8%) dengankriteria valid/layak, (4) Siswakelompokkecil (95%) dengankriteria valid/layak, dan (5) UjicobaLapangan (92,87%) dengankriteria valid/layak. Kesimpulan dari pengembangan ini adalah media CD interaktif yang dikembangkan termasuk valid/layak digunakan dalam pembelajaran Teknologi Informasi dan Komunikasi Kelas X SMA Kertanegara semester II pokok bahasan Penggunaan Perangkat Lunak Pengolah Kata. Saran dari pengembangan ini adalah: 1) Bagi Guru, Guru sebaiknya lebih mempelajarilangkah-langkahdandiperhatikan petunjuk pemanfaatan sehingga proses pembelajaran dapat berjalan lancar sesuai dengan tujuan yang ditetapkan. 2) BagiSiswa, siswa dalam menggunakan media pembelajaran ini harus mempunyai keterampilan dasar dalam pengoperasian komputer, dan beberapa kemampuan dan keterampilan lainnya untuk mendukung penggunaan media ini.3) BagiPengembangselanjutnya, hendaknya lebih bisa mengembangkan media interaktif lebih baik lagi, tepat guna dan tepat sasaran sehingga dapat dimanfaatkan sesuai kebutuhan yang ada.

Pengembangan media pembelajaran buku saku tentang signals wasit bola basket untuk peserta matakuliah teori dan praktek bola basket II jurusan pendidikan jasmani dan kesehatan di Universitas Negeri Malang / Dina Charisma Ganda Pratiwi

 

Kata Kunci: pengembangan, media pembelajaran buku saku, signals wasit bola basket Penguasaan terhadap materi signals wasit menjadi salah satu prasyarat kelulusan bagi peserta matakuliah teori dan praktik bola basket II di jurusan Pendidikan Jasmani dan Kesehatan Universitas Negeri Malang. Dalam pembelajaran praktik, dibutuhkan strategi dan metode pembelajaran yang tepat, selain itu, dibutuhkan pula media pembelajaran yang mendukung tercapainya tujuan pembelajaran. Berdasarkan data analisis kebutuhan diketahui bahwa, media yang dipilih oleh peserta matakuliah bola basket II yaitu media pembelajaran tentang signals wasit bola basket yang dikemas dalam bentuk buku saku. Tujuan dari penelitian ini yaitu mengembangkan media pembelajaran buku saku tentang signals wasit bola basket untuk peserta matakuliah teori dan praktik bola basket II jurusan Pendidikan Jasmani dan Kesehatan yang diharapkan dapat membantu dalam pembelajaran. Dalam penelitian ini, peneliti hanya menggunakan 7 langkah dari 10 langkah yang dikemukakan oleh Borg & Gall untuk pengembangan media pembelajaran buku saku signals wasit sebagai berikut: 1) Riset dan pengumpulan informasi dalam melakukan penelitian awal atau analisis kebutuhan dengan menyebarkan kuesioner/angket kepada 60 mahasiswa PJK UM (2) Perencanaan pengembangan produk, (3) Pengembangan rancangan produk, (4) Persiapan uji coba kelompok kecil, menggunakan 12 subjek, (5) Revisi produk pertama berdasarkan hasil uji coba kelompok kecil, (6) Uji coba lapangan (kelompok besar) menggunakan 40 subjek, (7) Revisi produk sesuai hasil uji coba kelompok besar. Berdasarkan hasil analisis data uji coba kelompok kecil diperoleh persentase rata-rata 82,4% dan pada uji coba kelompok besar diperoleh persentase rata-rata 90,9% sehingga dapat disimpulkan bahwa media pembelajaran buku saku tentang signals wasit bola basket untuk peserta matakuliah teori dan praktik bola basket II jurusan Pendidikan Jasmani dan Kesehatan sangat jelas dan menarik untuk digunakan sebagai salah satu sumber belajar. Diharapkan hasil pengembangan ini dapat diujicobakan kepada kelompok yang lebih luas dan dapat disosialisasikan kepada peserta matakuliah teori dan praktik bola basket II dan lembaga terkait sehingga dapat digunakan sebagaimana mestinya. Selain itu, diharapkan ada penelitian selanjutnya, untuk menguji tingkat keefektifitas dari produk yang dikembangkan.

Penerapan teknik Behavior Contract untuk meningkatkan motivasi siswa kelas VII A dalam mengikuti layanan bimbingan dan konseling di SMP Darussalam Kecamatan Kademangan Kabupaten Blitar / Alfida Djawin Nuha

 

Kata kunci: behavior contract, motivasi, siswa SMP. Motivasi adalah suatu dorongan yang timbul pada diri siswa dalam melakukan suatu tindakan untuk mencapai tujuan tertentu. Siswa yang memiliki motivasi tinggi ialah siswa yang memiliki gairah dan semangat, serta menunjukkan antusias saat jam khusus BK. Berdasarkan informasi dari guru pembimbing SMP Darussalam Kecamatan Kademangan Kabupaten Blitar dan hasil observasi awal, terdapat beberapa fakta bahwa siswa kelas VII A memiliki tingkat motivasi yang rendah dalam mengikuti layanan BK di kelas. Hal ini ditunjukkan dengan tingkah laku seperti gaduh, memainkan handphone, tidur-tiduran, membuka buku mata pelajaran lain, dan kurang bergairah dan aktif dalam kegiatan layanan BK. Tingkah laku tersebut, disebabkan oleh anggapan bahwa layanan BK tidak berpengaruh terhadap nilai rapor siswa. Salah satu teknik yang dapat digunakan untuk meningkatkan motivasi siswa yaitu teknik behavior contract. Kontrak tingkah laku (behavior contract) yaitu berupa perjanjian secara tertulis untuk bertingkah laku dengan cara tertentu dalam mengikuti layanan BK di kelas. Tujuan penelitian ini untuk menerapkan teknik behavior contract untuk meningkatkan motivasi siswa kelas VII A SMP Darussalam Kecamatan Kademangan Kabupaten Blitar dalam mengikuti layanan BK di kelas. Penelitian ini menggunakan rancangan penelitian tindakan yang terdiri atas dua siklus. Pada masing-masing siklus dilakukan tahap perencanaan, pelaksanaan tindakan, observasi, dan refleksi. Subyek penelitian adalah siswa kelas VII A SMP Darussalam Kecamatan Kademangan Kabupaten Blitar berjumlah 19 orang siswa. Instrumen penelitian yang digunakan adalah teknik wawancara, pedoman observasi, catatan lapangan, dan dokumentasi kegiatan pemberian kontrak tingkah laku. Analisis data yang digunakan adalah teknik analisis interaktif, yang terdiri atas reduksi data, paparan data, dan penarikan kesimpulan. Hasil penelitian menunjukkan bahwa teknik kontrak tingkah laku dapat meningkatkan motivasi siswa dalam mengikuti layanan BK di kelas. Dibuktikan dengan hasil siklus I mendapatkan skor 64,06% (banyak) dan siklus II sebesar 79,17% (sangat banyak). Dengan demikian, ada peningkatan motivasi siswa kelas VII A, ditunjukkan dengan hasil skor siklus II lebih tinggi dari siklus I. Atas dasar penelitian ini, penulis mengajukan saran bahwa konselor dapat menggunakan teknik behavior contract untuk meningkatkan motivasi siswa. Dalam penelitian selanjutnya, disarankan menggunakan hadiah yang lebih menarik agar siswa lebih semangat dan antusias dalam melaksanakan kontrak.

Strategi pengembangan potensi peserta didik pada anak berkebutuhan khusus di sekolah inklusi (studi kasus di SMP Negeri 18 Malang) / Syaima

 

Kata Kunci : Pengembangan, Anak Berkebutuhan Khusus, Sekolah inklusi. Sesuai dengan Undang-Undang No 20 Tahun 2003 tentang Sistem Pendidikan Nasional Pasal 5 Ayat 1 bahwa setiap warga negara mempunyai hak yang sama untuk memperoleh pendidikan yang bermutu. Adanya undang-undang tersebut dapat dijelaskan bahwa semua warga negara tidak terkecuali anak berkebutuhan khusus berhak mendapatkan pendidikan yang layak, Oleh karena itu, pemerintah menggalakkan program sekolah inklusi yaitu sekolah yang memasukkan anak berkebutuhan khusus ke sekolah reguler. Adanya sekolah inklusi diharapkan sebagai bentuk pemerataan pendidikan di Indonesia dimana siswa reguler dan siswa berkebutuhan khusus dapat belajar bersama sehingga mewujudkan sikap saling menghargai dan menghormati satu sama lain terhadap potensi dan bakat yang dimiliki masing-masing individu. Tujuan dari penelitan ini adalah mendeskripsikan (1) kegiatan pengembangan peserta didik pada Anak Berkebutuhan Khusus (ABK); (2) strategi pengembangan peserta didik pada siswa ABK; (3) kekuatan dan pendayagunaan kekuatan yang ada; dan (4) kelemahan serta pemecahan masalah dalam pengelolaan kegiatan pengembangan peserta didik pada siswa ABK. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus. Dalam penelitian ini penelitin terjun langsung ke lapangan penelitian karena kehadiran peneliti merupakan hal yang mutlak untuk dilakukan dalam penelitan kualitatif. Pengumpulan dilakukan dengan menggunakan teknik observasi, wawancara mendalam, dan dokumentasi. Data yang sudah terkumpul semua melalui tiga teknik tersebut kemudian dianalisis untuk mengetahui kebenarannya yaitu dengan cara mencatat, pengkodean, pengklasifikasian data, perakitan informasi, dan mengambil kesimpulan dari data yang sudah di telaah. Untuk mengecek keabsahan data yang ada dilakukan dengan pengkroscekkan hasil wawancara dengan informan yang berbeda. Kesimpulan yang didapat dari penelitian ini adalah siswa SMPN 18 Malang dibedakan menjadi dua jenis yaitu (1) siswa reguler dan (2) siswa ABK. Untuk kegiatan pengembangan bagi siswa dibagi menjadi dua hal yaitu (1) kegiatan kurikuler dan (2) ekstrakurikuler. Kegiatan kurikuler adalah kegiatan yang berkaitan dengan pengembangan aspek kognitif siswa dan kegiatan ini wajib diikuti oleh semua siswa. Sedangkan kegiatan ekstrakurikuler adalah kegiatan pengembangan pada bakat, minat, dan kemandirian siswa. Program kegiatan kurikuler dan ekstrakurikuler bagi siswa ABK lebih kompleks dibandingkan dengan siswa reguler. Karena pengembangan bagi siswa ABK tidak hanya pada pengetahuan umum saja tetapi juga pengembangan kepada pengendalian emosi dan perbaikan prilaku. Kegiatan kurikuler bagi siswa ABK dibagi menjadi inclass, outclass, dan outdoor. Sedangkan kegiatan ekstrakurikulernya berupa seni musik, terapi, dan outbond. Masing-masing kegiatan ini akan memberikan bantuan kepada siswa ABK untuk mengendalikan emosi dan perbaikan prilakunya. Strategi pengembangan kegiatan siswa ABK yang dilakukan adalah adanya manajemen khusus yang menangani siswa ABK. Seluruh kegiatan yang berkaitan dengan siswa ABK diatur oleh manajemen inklusi SMPN 18 Malang. Pengelolaan kegiatan sesuai dengan teori manajemen pendidikan yaitu adanya perencanaan, penyelenggaraan, pengawasan, dan evaluasi. Kekuatan yang ada dalam pengembangan peserta didik pada siswa ABK adalah adanya dukungan dari berbagai pihak, jumlah Guru Pendamping Khusus (GPK) sesuai dengan jumlah ABK yang ada, siswa tidak diperbolehkan menggunakan shadow, dan pemberian layanan yang maksimal kepada siswa. Pendayagunaan kekuatan yang ada adalah berupa: evaluasi kegiatan, menerima masukan positif dari berbagai pihak, dan adanya rasa keterbukaan dan kekeluargaan dikalangan organisasi SMPN 18 Malang. Faktor kekurangan dalam pengembangan peserta didik ABK adalah waktu pelaksanaan program yang sering berbenturan dengan program lain dan belum jelasnya kurikulum bagi siswa ABK. Strategi mengatasi kekurangan ini adalah dengan menjalin komunikasi dengan orang tua siswa, transparasi program, dan GPK harus mampu untuk memanfaatkan waktu yang ada serta Saran yang dapat diberikan dari penelitian ini adalah (1) Kepala Sekolah dan Manajer Inklusi sekolah inklusi dapat memelihara dan meningkatkan kualitas manajemen pendidikan inklusi khususnya dalam hal adminstrasi untuk siswa ABK di SMPN 18 Malang melalui perencanaan, pelaksanaan, pengendalian dan evaluasi secara menyeluruh sehingga komponen sekolah dapat menerima siswa ABK dengan baik; (2) Guru Mata Pelajaran dan Guru Pendamping Khusus sekolah inklusi hendaknya bisa meningkatkan kerjasama dan menjalin komunikasi yang baik untuk mengembangkan potensi siswa ABK karena ABK membutuhkan bimbingan tidak hanya dari GPK saja tetapi juga dari guru mata pelajaran; (3) akademisi Jurusan Administrasi Pendidikan Universitas Negeri Malang lebih meningkatkan wawasan teori mengenai peserta didik dan perkembangan pendidikan yang ada di Indonesia; dan (4) Peneliti Lain agar dapat meneliti manajemen pendidikan inklusi dari berbagai subtansi manajemen pendidikan, karena setiap subtansi pengelolaan pendidikan inklusi mempunyai permasalahan yang berbeda dan unik untuk diteliti.

Pengembangan panduan pelatihan kesadaran emosi bagi siswa SMP / M. Fatchurahman

 

Kata kunci: pengembangan, panduan pelatihan, kesadaran emosi. Masa remaja juga dikenal sebagai masa dengan “badai dan tekanan” (storm and stress) di mana terjadi pergolakan emosi, sehingga menyebabkan labilnya emosi remaja. Keadaan tersebut dipengaruhi beberapa faktor diantaranya perubahan hormonal. Karena itu remaja perlu mengenal dan memahami emosi yang terjadi pada dirinya. Sebagai upaya untuk mengenal dan memahami emosi siswa adalah melatihkan kesadaran emosi. Untuk melatihkan kesadaran emosi, maka diperlukan panduan pelatihan kesadaran emosi. Panduan tersebut dikembangkan sebagai bekal bagi konselor dalam membantu siswa mengembangkan pengetahuan dan melatih kesadaran emosi siswa. Penelitian ini bertujuan (1) menghasilkan panduan pelatihan kesadaran emosi yang memenuhi kriteria akseptabilitas, dan (2) menghasilkan panduan pelatihan yang efektif meningkatkan kesadaran emosi siswa SMP. Konstruk teori kesadaran emosi yang digunakan dari Goleman. Pengembangan panduan diadaptasi dari prosedur Borg & Gall (1983) yang dimodifikasi menjadi tiga tahapan, yaitu (1) tahap prapengembangan adalah melakukan need assesment dan studi literatur, (2) tahap pengembangan adalah menyusun draf panduan, merumuskan tujuan umum, tujuan khusus, mengembangkan alat evaluasi, serta menentukan strategi pelatihan, (3) tahap pascapengembangan terdiri dari uji ahli, uji kelompok kecil (2 konselor) dan uji kelompok terbatas (8 siswa). Hasil analisis, diperoleh skor rata-rata pretest sebesar 66 dan besarnya nilai skor rata-rata posttest sebesar 87,5 sehingga terdapat perbedaan skor antara posttest dan pretest sebesar 21,5 atau terjadi peningkatan sebesar 32,57%. Dari hasil uji statistik Wilcoxon diperoleh harga Z -2.521a dengan Asymp. Sig. 0,012 < 0,05, maka disimpulkan terjadi peningkatan dari kategori sedang menjadi tinggi. Hal ini berarti bahwa pelatihan kesadaran emosi dengan strategi emotion script learning efektif untuk meningkatkan kesadaran emosi. Disamping itu hasil uji ahli, uji kelompok kecil, dan uji kelompok terbatas terhadap pengembangan panduan pelatihan telah memenuhi kriteria akseptabilitas. Karena itu, produk pengembangan ini dapat dijadikan sebagai salah satu media bimbingan bagi konselor untuk membantu siswa pada aspek pribadi-sosial, khususnya dalam usaha membantu siswa dalam mencapai aspek kematangan emosi. Agar pelaksanaan pelatihan kesadaran emosi dapat mencapai hasil yang baik, maka konselor perlu memiliki kompetensi teknis khususnya dalam memimpin sebuah kelompok serta mempertimbangkan faktor kepribadian dan latar belakang budaya tertentu.

The Use Of Songs in "English Habit" program SMAN 3 Malang / Swasti Nourmawati

 

Key words: songs, “English Habit” program In order to develop students’ English proficiency, many schools provide extracurricular activities focusing on English. SMAN 3 Malang holds a program called “English Habit”. It was first conducted in the year 2010. It is a compulsory program carried out once a month usually in the last Thursday of the month. The program is in the form of ten minutes activity before the regular classes. The activities include reading poem or short story, writing a poem, or listening to songs. In the formal interviews before the research, the students pointed out that listening to songs is one of the most preferable activities in the “English Habit” program. The study was aimed to describe the use of songs in “English Habit” program at SMAN 3 Malang in terms of the selections of songs in “English Habit” program, the kind of songs used, the activities, the advantages, the problems faced in the use of songs in English Habit program, and the students’ opinions toward the use of songs in English Habit program. The research applied descriptive design. It was conducted in SMAN 3 Malang. It is located at Jalan Sultan Agung Utara No 7 Malang. To collect the data, this study used some instruments: interview guide, observation sheets and questionnaires. The data were collected from February to March 2012. The data in this qualitative research were analyzed by data reduction, data display, and discussion/conclusion of the data. It was found that the selection of the songs in “English Habit” program at SMAN 3 Malang were done by the English teachers by selecting the songs which students were familiar with and have understandable lyrics. The genre or kind of songs was always pop-song because it is well-known and easy to learn. From the observations, the activities that students needed to do while listening to songs were filling gaps and vocabulary exercises. It was found that the problems in the use of songs in “English Habit” program were the limited time of the program that makes it difficult to explore the songs more, the unmotivated students, and the problem with the facility. However, most of the students gave positive response toward the use of songs in “English Habit” program. Based on the results of the study, it is suggested that the school should conduct the “English Habit” more often, so the English teachers can prepare more various activities to avoid dullness in every activity in the program, including listening to songs. Besides, the teachers should be more active to encourage and motivate the students to study English especially in encouraging them to listen to songs. The last one is that the school should check the listening equipment such as the speakers in each class regularly.

Penerapan pendidikan budi pekerti dalam pembelajaran PKn di SMP Arrohmah Putri Boarding School Sumbersekar Kecamatan Dau Kabupaten Malang / Dentrik Panggayuh

 

Kata Kunci: penerapan, pendidikan budi pekerti, boarding school. Pendidikan budi pekerti perlu adanya peningkatan, terlebih dengan adanya perkembangan dan perubahan sosial yang berlangsung dengan cepat, yang diakibatkan oleh kemajuan dalam bidang ilmu pengetahuan dan teknologi yang ditengarai bisa berpengaruh negatif terhadap perkembangan dan pencapaian hasil belajar peserta didik. Gejala-gejala pengaruh negatif itu sekarang telah tampak di kalangan generasi muda. Hal itu ditunjukan dengan merebaknya isu-isu moral di kalangan generasi muda seperti penggunaan narkotika dan obat-obatan terlarang, tawuran pelajar, pronografi, pemerkosaan, merusak milik orang lain, perampasan, penipuan, free sex, aborsi, penganiayaan, perjudian, pelacuran, pembunuhan dan lain-lain, sudah menjadi masalah sosial yang sampai saat ini belum dapat diatasi secara tuntas. Selama ini, pendidikan informal terutama dalam lingkungan keluarga belum memberikan kontribusi berarti dalam mendukung pembinaan budi pekerti dalam pribadi anak. Kesibukan dan aktivitas kerja orang tua yang relatif tinggi, kurangnya pemahaman orang tua dalam mendidik anak di lingkungan keluarga, orang tua/ keluarga yang bermasalah (broken home) dan sikap orang tua yang acuh terhadap anaknya. Dengan demikian untuk melaksanakan pendidikan budi pekerti dapat diperkuat oleh lingkungan pendidikan lainnya yaitu lingkungan pendidikan formal seperti SMP Ar-Rohmah Putri Boarding School yang terletak di Sumbersekar Kecamatan Dau Kabupaten Malang. Penelitian bertujuan untuk mengetahui; 1) tujuan penerapan pendidikan budi pekerti dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School, 2) bentuk dan isi pendidikan budi pekerti dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School, 3) penerapan metode pendidikan budi pekerti dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School, 4) penerapan evaluasi pendidikan budi pekerti dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School, 5) faktor-faktor yang menjadi penghambat penerapan pendidikan budi pekerti dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School, dan 6) upaya mengatasi hambatan dalam penerapan pendidikan budi pekerti dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School. Penelitian ini dilakukan di SMP Ar-Rohmah Putri Boarding School Sumbersekar Kecamatan Dau, Kabupaten Malang, bulan Januari sampai dengan Mei 2012. Metode penelitian menggunakan pendekatan deskriptif kualitatif dengan prosedur pengumpulan data berupa observasi partisipan, dokumentasi, dan wawancara secara mendalam dengan kepala sekolah, wakil kepala sekolah, guru PKn, dan beberapa siswa. Analisis data yang digunakan adalah reduksi data, data display, dan conclusion drawing/ verifikasi. Hasil penelitian ini menunjukan (1) tujuan pendidikan budi pekerti di dalam pembelajaran PKn di SMP Ar-Rohmah Putri Boarding School adalah membentuk sikap atau perilaku anak yang dapat menempatkan segala sesuatu pada tempatnya yang menunjukan peserta didik dapat berperilaku sesuai yang diharapkan yaitu baik, dapat menunjukan perilaku sopan santun terhadap setiap orang, bisa menghargai orang lain, rapi dari segi penampilannya, tertib dalam memanfaatkan waktu dan mengikuti pelajaran, serta berakhlak mulia. Serta menjadi manusia yang cerdas, pandai, menjadi warga negara yang tanggap terhadap lingkungannya dan cinta tanah air. (2) Bentuk pendidikan budi pekerti di SMP Ar-Rohmah Putri Boarding School adalah “adab”, yang berisi tentang aturan atau cara bersikap. Isi pendidikan adab dapat disebutkan sebagai berikut; adab kepada guru, adab terhadap pembelajaran, adab terhadap pelajaran dan adab terhadap pribadi. (3) Metode yang digunakan dalam pendidikan budi pekerti (adab) di dalam pembelajaran PKn ada tiga yaitu; metode studi kasus, metode keteladanan, dan metode kedisiplinan. (4) Evaluasi dilakukan dengan dua cara yaitu penilaian akademik dan penilaian adab. Penilaian adab dapat berpengaruh terhadap hasil akademik. Penilaian bermodel kualitatif (berupa pernyataan verbal), dan kuantitatif (berupa angka dengan rentan nilai 1-5). (5) Faktor Kendala atau hambatan yang dapat mempengaruhi proses pembelajaran pendidikan budi pekerti di SMP Ar-Rohmah Putri Boarding School dapat digolongkan menjadi dua, yakni; faktor eksternal dan faktor internal. Faktor eksternal adalah hambatan yang berasal dari luar diri peserta didik yaitu; lingkungan sebelum peserta didik masuk, faktor dari guru dan faktor yang berasal dari fasilitas. Sedangakan faktor internal adalah hambatan yang bersumber dari diri peserta didik itu sendiri. (6) Untuk mengatasi kendala tersebut pihak sekolah berusaha menanganinya dengan ketauladanan. Guru bertugas tidak hanya mengajar namun juga mendidik. Oleh sebab itu pemantapan pemahaman nilai terhadap guru juga dilakukan dengan cara diskusi antar guru (sharing), kajian dan workshop. Faktot internal diatasi dengan menerapkan metode keteladanan dan kedisiplinan. Berdasarkan hasil penelitian ini, dapat disarankan bagi SMP Ar-Rohmah Putri Boarding School sebagai berikut; (1) supaya peserta didik berbudi pekerti luhur atau beradab dan berperilaku sesuai dengan nilai-nilai budi pekerti atau adab, sebaiknya guru selalu menanamkan sikap dan perilaku yang baik yang sesuai adab kepada peserta didik dalam kehidupan sehari-hari. (2) Supaya peserta didik selalu mentaati aturan atau adab yang telah ditentukan di SMP Ar-Rohmah Putri Boarding School maka sebaiknya penilaian tentang adab lebih ditekankan dimana saja. (3) agar wawasan siswa bertambah luas sebaiknya sumber belajar terutama buku yang menjadi bahan pembelajaran PKn ditambah. (4) Supaya peserta didik memiliki budi pekerti yang luhur dan memilki rasa nasionalisme dan cinta tanah air hendaknya diadakan upacara bendera. (5) Supaya kegiatan pembelajaran lebih menarik dan lebih mudah dipahami peserta didik sebaiknya penggunaan metode pembelajaran lebih dikembangkan dan dibuat semenarik mungkin dan lebih bervariasi.

Penerapan pendidikan karakter melalui kegiatan Positive Character Camp (PCC) di SMA Negeri 4 Malang / Dewinta Inggrid Firstlia Putri

 

Kata kunci : penerapan, pendidikan karakter, Positive Character Camp Perilaku negatif siswa yang meningkat berbanding lurus dengan degradasi karakter dalam dunia pendidikan, hal ini dikhawatirkan berdampak pada krisis identitas bagi siswa yang mendorong SMA Negeri 4 Malang berupaya untuk mewujudkan karakter siswa sesuai Undang-Undang Republik Indonesia Nomor 17 Tahun 2007 dan Permendiknas Nomor 78 Tahun 2009 tentang Sekolah Bertaraf Internasional. Tujuan dari penelitian ini untuk mengetahui (1) latar dan tujuan program Positive Character Camp (PCC) di SMA Negeri 4 Malang; (2) rancangan program Positive Character Camp (PCC) di SMA Negeri 4 Malang; (3) pelaksanaan program Positive Character Camp (PCC) di SMA Negeri 4 Malang; (4) kendala yang dihadapi dalam pelaksanaan Positive Character Camp (PCC) di SMA Negeri 4 Malang; (5) upaya yang dilakukan untuk mengatasi kendala dalam pelaksanaan Positive Character Camp (PCC) di SMA Negeri 4 Malang. Penelitian ini dilakukan di SMA Negeri 4 Malang mulai bulan Februari sampai April. Metode yang digunakan pendekatan kualitatif dan jenis penelitian deskriptif dengan rancangan penelitian ex post facto. Sehingga teknik pengumpulan data yang digunakan yaitu wawancara mengenai kejadian yang telah terjadi dan pengumpulan dokumentasi yang telah tersedia. Pengecekan keabsahan data dalam penelitian ini dengan memperpanjang waktu pengamatan dan perpanjangan keikutsertaan sehingga memungkinkan peningkatan derajat kepercayaan data yang diperoleh. Triangulasi dalam penelitian ini adalah sumber dan data yaitu dilakukan dengan mengecek kebenaran data dan membandingkan data tersebut dengan data dari sumber lain. Dari analisis data dapat disimpulkan bahwa (1) latar belakang program Positive Character Camp (PCC) berawal dari terjadinya degradasi karakter dalam dunia pendidikan yang dikhawatirkan berdampak pada krisis identitas siswa sehingga sekolah berupaya melangsungkan pendidikan karakter yang tidak terpusat pada teori saja namun juga pada penerapan yang tercantum dalam RPJPN 2005-2025 mengenai terwujudnya karakter bangsa yang tidak dapat dikesampingkan sesuai dengan Permendiknas Nomor 78 Tahun 2009 tentang SBI; (2) perencanaan Positive Character Camp (PCC) dilakukan melalui tahap pengajuan proposal ke Kepala Sekolah, menyusun struktur organisasi, pengadaan kerjasama dengan Matahati Children Care, penentuan lokasi, penyusunan substansi kegiatan dan jadwal, sosialisasi kepada orangtua siswa, dan penysusunan teknis kegiatan; (3) pelaksanaan Positive Character Camp (PCC) diikuti oleh seluruh siswa dan guru SMA Negeri 4 Malang, dengan dilakukan setiap dua minggu sekali dan pemberangkatan dilakukan bertahap sebanyak dua kelas, pelaksanaan program merupakan wujud dari penerapan nilai-nilai pengembangan karakter yang dicantumkan dalam setiap substansi kegiatan yang telah direncanakan. Pelaksanaan dilakukan di tiga lokasi berbeda selama tujuh kali pemberangkatan, lokasinya yaitu, Desa Bedengan Kecamatan Dau, Desa Durmo Kecamatan Bantur, dan Kecamatan Tajinan; (4) kendala yang dihadapi dalam pelaksanaan program Positive Character Camp (PCC) diantaranya sulitnya alat transportasi yaitu truk masuk ke lokasi kegiatan karena kondisi jalan masih kurang baik, kurangnya bahan makanan yang dibawa ke lokasi merupakan permasalahan pada logistik dan cuaca yang buruk yang dapat menghambat pelaksanaan kegiatan; (5) upaya yang dilakukan dalam mengatasi kendala yang dihadapi diantaranya menyewa truk TNI yang dianggap mampu melewati jalan yang sempit dan kondisi jalan kurang baik, kendala logistik diatasi dengan menyiapkan bahan makanan lebih dari yang diperhitungkan, dan cuaca diatasi dengan upaya melakukan doa bersama sambil bersugesti agar cuaca kembali baik selama pelaksanaan program. Saran yang dapat diberikan diantaranya (1) agar hasil dari program dapat berlangsung secara kontinyu Kepala Sekolah hendaknya menjadikan program ini sebagai program rutin di awal tahun ajaran, dan terus melakukan pemantauan serta peningkatan pada seluruh proses mulai dari perencanaan hingga pengontrolan/ pengevaluasian pasca program; (2) agar nilai pengembangan karakter dapat tertanam dalam diri siswa secara terus menerus, guru sebaiknya lebih memaksimalkan profesionalitasnya dalam mengajarkan pendidikan karakter dengan menjadi model bagi siswanya; (3) agar penerapan pendidikan karakter dapat terus dikembangkan, Ketua Jurusan seyogyanya lebih memperbanyak pengembangan ilmu, dengan mengadakan sosialisasi tentang penerapan pendidikan karakter dalam bentuk pendidikan dan pelatihan juga seminar yang berhubungan dengan bagaimana cara untuk mengelola suatu program yang baik khususnya kepada sekolah-sekolah; (4) agar dapat mengetahui lebih banyak proses penerapan pendidikan karakter di sekolah-sekolah lain, hendaknya peneliti lain disarankan melakukan penelitian pengembangan dengan memperdalam topik dan permasalahan dan kajian teori.

Potensi geografis dan tanggapan penggunjung terhadap sapta pesona objek wisata Pantai Popoh Kabupaten Tulungagung / Rani Dodik Kurniawan

 

Kata kunci: unsur fisik geografis, kesesuaian pantai, tanggapan pengunjung. Pantai Popoh merupakan salah satu objek wisata unggulan yang terdapat di Kabupaten Tulungagung. Berdasarkan statistik data pengunjung pada tahun 2010 jumlah pengunjung di Pantai Popoh mengalami penurunan. Kondisi dari semua fasilitas dan wahana yang ditawarkan kurang begitu terawat sehingga dapat menimbulkan citra negatif di objek wisata Pantai Popoh. Banyaknya potensi yang belum dimanfaatkan secara maksimal belum digunakan secara optimal untuk pengembangan pariwisata. Oleh karena itu perlu adanya penelitian lebih lanjut dalam menggali segala potensi pada objek wisata Pantai Popoh Kabupaten Tulungagung. Dalam penelitian ini dikhususkan pada kondisi geografis, karakteristik pantai, dan persepsi pengunjung terhadap objek wisata tersebut. Penelitian ini bertujuan untuk 1) Mendeskripsikan potensi geografis yang mendukung dalam pengembangan objek wisata Pantai Popoh di Kabupaten Tulungagung. 2) Mengetahui tanggapan pengunjung terhadap Sapta Pesona di objek wisata Pantai Popoh dalam mendukung pengembangan pariwisata di Kabupaten Tulungagung. Jenis penelitian yang dilakukan ini merupakan penelitian deskriptif dengan metode survey. Objek dari penelitian ini adalah karakteristik Pantai Popoh dan tanggapan pengunjung terhadap Sapta Pesona. Jumlah pengunjung yang digunakan untuk yaitu 100 responden dengan metode accidental sampling. Teknik pengambilan data menggunakan metode observasi, kuesioner dan dokumentasi. Analisis data yang digunakan yaitu skoring dan tabulasi tunggal. Hasil penelitian menunjukkan bahwa 1) Kondisi geografis objek wisata Pantai Popoh sangat sesuai untuk pariwisata dengan lokasi yang dekat dengan pusat kota, suhu 29 °C, curah hujan 1898 mm/tahun, jenis tanah Litosol, keberadaan air tawar 0,1 km dari objek wisata, dan kemiringan daerah wisata >15%, 2) Karakteristik Pantai Popoh sesuai untuk pariwisata dengan kemiringan sebesar 4,29%, tipe pantai berpasir dan berbatu. Lebar pantai rata-rata sebesar 61,97 meter, material dasar laut karang berpasir, kecepatan angin rata-rata 0,13 m/s, kedalaman perairan di kawasan wisata sebesar 12,7 meter dan kecerahan perairan yang kurang dari 2 meter, penutup lahan pantai berupa pohon kelapa, dan tidak ada biota berbahaya, (3) Persepsi pengunjung terhadap Sapta Pesona yang terdiri dari unsur aman, tertib, bersih, sejuk, indah, ramah dan kenangan termasuk dalam kategori sangat sesuai untuk pariwisata.

Penggunaan penilaian Autentik berbasis pembelajaran Autentik untuk memantau kemajuan belajar Fisika siswa kelas X-8 SMAN 7 Malang / Miftakhul Huda

 

Kata Kunci: Penilaian Autentik, Pembelajaran Autentik, Kemajuan Belajar Tuntutan-tuntutan baru sebagai akibat dari perkembangan ilmu pengetahuan dan teknologi yang sangat cepat, membuat sistem pembelajaran yang termasuk di dalamnya adalah bentuk penilaian yang diberikan, harus memperhatikan masalah pengalaman belajar dan keterampilan yang harus dimiliki setiap siswa. Pada kenyataannya, kebanyakan guru dalam melakukan penilaian lebih menekankan pada hasil belajar tanpa memperhatikan proses belajar. Pada pembelajaran fisika kelas X-8 SMAN 7 Malang, sistem pembelajaran termasuk juga bentuk penilaian yang diterapkan, juga masih kurang bisa membantu siswa dalam mencapai kompetensi yang diharapkan. Tujuan penelitian ini adalah untuk memantau kemajuan belajar fisika siswa melalui penilaian portofolio, penilaian kinerja dan penilaian sikap siswa.. Penelitian ini merupakan penelitian deskriptif menggunakan penilaian autentik berbasis pembelajaran autentik pada mata pelajaran fisika. Subjek penelitian adalah siswa kelas X-8 SMAN 7 Malang. Penelitian ini terdiri dari tiga tahap. Tahap I terdiri dari 4 pertemuan tentang penyampaian materi Pemantulan Cahaya dan 1 pertemuan untuk tes tahap 1. Tahap II terdiri dari 4 pertemuan tentang penyampaian materi Pembiasan Cahaya dan 1 pertemuan untuk tes tahap 2. Tahap III terdiri dari 4 pertemuan tentang penyampaian materi Alat Optik dan 1 pertemuan untuk tes tahap 3. Kemajuan belajar siswa diamati melalui kemajuan hasil penilaian tugas portofolio, kinerja siswa, sikap siswa, dan kemajuan hasil tes serta nilai akhir siswa. Data dianalisis dengan mengolah dan menghitung nilai tugas portofolio, nilai tes tertulis, nilai akhir siswa, serta hasil penilaian kinerja dan sikap siswa sesuai dengan rubrik penilaian. Hasil penelitian menunjukkan bahwa hasil penilaian portofolio, penilaian kinerja dan sikap, serta tes dan nilai akhir siswa mengalami kemajuan dari tahap 1 sampai 3. Hal ini mengindikasikan bahwa penilaian portofolio, penilaian kinerja, dan penilaian sikap mampu memantau kemajuan belajar siswa.

Desain kendali motor universal menggunakan inverter 1 fasa metode SPWM / Krisdiyanto

 

Kata Kunci: Kendali motor, Inverter, SPWM Terdapat beberapa metode untuk mengatur kecepatan putar motor yang bervariasi dan pengasutan bertingkat (untuk menghindari arus pengasutan yang terlalu tinggi) pada motor DC dan motor AC. Maka diperlukan sebuah peralatan yang bekerja secara konvensional (mekanis) atau secara elektronis (elektronika daya) yang terhubung dengan motor tersebut. Untuk menghasilkan tegangan bolak balik maupun tegangan arus searah yang bervariasi, untuk supply daya motor universal terdapat beberapa alternatif diantaranya dengan menggunakan rangkaian AC atau DC terkontrol maupun rangkaian AC atau DC tak terkontrol. Metode inverter yang banyak dikembangkan adalah inverter dengan modulasi lebar pulsa (Pulse Width Modulation, PWM), karena memiliki efisiensi daya yang tinggi, dapat mereduksi rugi-rugi harmonisa, mampu menggerakkan motor induksi dengan putaran yang halus dan rentang operasi kecepatan yang lebar , tujuan tugas akhir ini adalah merakit dan merancang inverter SPWM dengan kendali ATmega 8. Dengan menggunakan inverter ini, maka pengendalian kecepatan motor AC dapat dilakukan dengan lebih teliti. Rangkaian inverter ini dirancang supaya ringkas, oleh karena itu pada minimum sistem mikrokontroler hanya mengandalkan ragam chip tunggal. Berdasarkan hasil perancangan, perakitan, pengujian dan pembahsan diperoleh kesimpulan sebagai berikut: (1)Dari perancangan desain kendali motor yang dibuat, hasil yang didapat sudah sesuai dengan prinsip kerja yang dirancang. Sinyal PWM satu fase yang dirancang merupakan jenis PWM sinusoida yang dibangkitkan menggunakan perhitungan lebar pulsa yang nantinya akan di operasikan menggunakan flash memori mikrokontroler pada port timer OCR1A dan OCR1B. (2) Hasil pengamatan menunjukan bahwa rancangan pembangkit SPWM telah berfungsi dengan baik. Sinyal SPWM yang dibangkitkan memiliki 126 pulsa setiap setengah periode dan rentang frekuensi antara 20 – 100 Hz dengan kenaikan dan penurunan setiap 10 Hz. (3) Dari hasil pengujian putaran motor dengan loop terbuka, respon putaran motor dari pengelolaan data input analog to digital ADC pada mikrokontroler cukup baik. Namun untuk mendapatkan putaran yang stabil dengan daya maksimal maka motor harus bekerja pada tegangan yang sesuai dengan name plate yang terdapat pada motor.

Pengembangan modul angiospermae untuk siswa kelas X Sekolah Menengah Atas / Ester Maya Wahyu Susanti

 

Kata Kunci: Modul, Angiospermae Pembelajaran dengan modul memiliki tujuan utama yaitu meningkatkan efisiensi dan efektifitas pembelajaran di sekolah baik dari segi waktu, dana, fasilitas maupun tenaga guna mencapai tujuan pembelajaran secara optimal sehingga pembelajaran dengan menggunakan modul merupakan salah satu metode yang dapat dikembangkan.Berdasarkan observasi yang dilakukan pada SMA Laboratorium UM modul yang dibuat oleh guru di SMA berisikan materi dan latihan soal. Komponen-komponen yang seharusnya ada pada modul tidak lengkap. LKS yang ada pada modul sangat kurang karena lebih menekankan pada rangkuman materi dan latihan soal. Modul yang demikian kurang melibatkan siswa secara aktif. Sekolah membutuhkan contoh modul yang mempunyai komponen lengkap untuk digunakan sebagai suatu bahan ajar pembelajaran di kelas. Pembelajaran inkuiri merupakan salah satu strategi pembelajaran konstruktivistik. Belajar akan lebih bermakna bila siswa dapat menemukan sendiri pengetahuan atau keterampilan yang diajarkan dan mampu mengaitkan informasi yang didapat sebagai pengetahuan yang dimilikinya. Strategi pembelajaran inkuiri terbimbing menuntut siswa lebih aktif sehinggasiswa mempunyai pengalaman menggali pengetahuannya sendiri melalui kegiatan eksperimen. Topik modul membahasAngiospermae sebagai tumbuhan dalam Kingdom Plantae dan menjadi materi yang paling banyak dibahas. Penelitian ini bertujuan untuk menghasilkan sebuah produk berupa modul. Penelitian yang dilakukan merupakan penelitian pengembangan. Metode pengembangan yang digunakan adalah Metode Borg dan Gall yang memiliki 10 tahapan. Penelitian ini mencapai tahap kelima yaitu Persepsi lapangan awal karena penelitian ini untuk jenjang Strata 1. Draf hasil pengembangan divalidasi oleh 3 validator untuk Persepsi kelayakan. Persepsi keterbacaan ditujukan pada 10 siswa. Instrumen validasi dan keterbacaan berupa angket. Persepsi keterbacaan dilaksanakan untuk mengetahui keterbacaan modul. Hasil validasi dan Persepsi keterbacaan dianalisis untuk mengetahui kriteria kelayakan modul. Revisi/perbaikan modul dilaksanakan bertolak dari saran dan komentar yang peroleh dari angket. Hasil penelitian dan pengembangan modul memenuhi kriteria kevalidan modul. Hasil diperoleh dari analisis validator berupa penilaian terendah adalah 78% dan data tertinggi adalah 100% kriteria tersebut adalah valid. Data yang diperoleh siswa adalah 65% dan data tertinggi adalah 93%. Hasil tersebut memenuhi kriteria valid. Disarankan menerapkan modul di kelas dalam bentuk penelitian eksperimen atau PTK untuk lebih memantapkan validitas modul ini.

Problematika belajar siswa dalam pembelajaran pendidikan kewarganegaraan di SMP Negeri 1 Sumbergempol Kabupaten Tulungagung / Ratih Dian Mayasari

 

Kunci: Problematika Belajar, Pembelajaran Pendidikan Kewarganegaraan Problematika belajar yang dihadapi oleh siswa satu dengan yang lainya berbeda-beda. Hal ini dikarenakan siswa memiliki kepribadian, pengalaman, tujuan dan kondisi yang beragam. Problematika belajar tidak selalu disebabkan oleh faktor inteligensi yang rendah, akan tetapi dapat disebabkan oleh faktor-faktor non-inteligensi. Faktor-faktor yang mempengaruhi masalah belajar dapat digolongkan menjadi dua faktor, yaitu faktor internal dan eksternal. Salah satunya yaitu problematika belajar pada pembelajaran Pendidikan Kewarganegaraan di SMP Negeri 1 Sumbergempol. Mencari atau menemukan faktor-faktor apakah yang menyebabkan siswa mengalami masalah belajar sangatlah penting, sehingga dapat dilakukan usaha yang tepat dalam mengatasi dan menanggulangi dampak dari masalah belajar tersebut. Penelitian ini dilakukan dengan tujuan untuk: (1) menjelaskan problematika belajar yang dihadapi dalam pembelajaran Pendidikan Kewarganegaraan pada siswa kelas VII SMP Negeri 1 Sumbergempol; (2) mendeskripsikan penyebab problematika belajar dalam pembelajaran Pendidikan Kewarganegaraan pada siswa kelas VII SMP Negeri 1 Sumbergempol; (3) menjelaskan cara mengatasi problematika belajar dalam pembelajaran Pendidikan Kewarganegaraan pada siswa kelas VII SMP Negeri 1 Sumbergempol. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif yaitu jenis penelitian yang menggambarkan, meringkas berbagai kondisi dan situasi yang ada. Peneliti berusaha mengumpulkan informasi secara mendalam dan mendetail terkait dengan problematika yang dihadapi siswa dalam pembelajaran Pendidikan Kewarganegaraan di SMP Negeri 1 Sumbergempol dan upaya yang dilakukan dalam mengatasi problematika tersebut. Subjek yang diteliti adalah guru mata pelajaran Pendidikan Kewarganegaraan dan siswa kelas VII SMP Negeri 1 Sumbergempol. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara dan dokumenatasi. Instrumen dalam penelitian ini adalah peneliti sendiri. Teknik analisis data yang digunakan dalam penelitian ini adalah data reduction (reduksi data), data display (penyajian data), penarikan kesimpulan dan verivikasi. Untuk menjaga keabsahan data dilakukan kegiatan triangulasi dan meningkatkan ketekunan peneliti. Berdasarkan hasil penelitian diketahui bahwa problematika belajar yang dihadapi dalam pembelajaran Pendidikan kewarganegaraan pada siswa kelas VII di SMP Negeri 1 Sumbergempol adalah: (1) kesulitan dalam memahami dan menghafalkan materi pelajaran; (2) kurangnya pemahaman siswa terhadap makna istilah bahasa asing yang digunakan dalam materi pelajaran; (3) siswa kesulitan dalam memahami penjelasan guru. Penyebab dari problematika belajar dalam pembelajaran Pendidikan Kewarganegaraan pada siswa kelas VII di SMP Negeri 1 Sumbergempol dapat dikelompokkan menjadi dua faktor, yang pertama adalah faktor internal diantaranya adalah: (1) minat dan kebiasaan belajar siswa yang masih kurang maksimal; (2) motivasi belajar siswa yang masih kurang; (3) konsentrasi belajar siswa yang terganggu karena kondisi kelas yang tidak mendukung; (4) kurangnya kesiapan belajar siswa. Kedua adalah faktor eksternal diantaranya adalah: (1) terbatasnya sarana dan fasilitas pembelajaran di sekolah; (2) kondisi sosial ekonomi orang tua dan lingkungan rumah yang kurang mendukung; (3) ketertarikan siswa pada guru; (4) metode yang digunakan guru. Cara yang digunakan dalam mengatasi problematika belajar dalam pembelajaran Pendidikan Kewarganegaraan pada siswa kelas VII di SMP Negeri 1 Sumbergempol, yaitu: (1) memberikan stimulus; (2) memberikan motivasi dan pendekatan pada siswa; (3) melengkapi sumber bahan materi pelajaran; (4) menciptakan suasana belajar yang kondusif dan menyenangkan; (5) menggunakan bahasa pengantar yang dimengerti dan mudah di pahami oleh siswa; (6) menggunakan metode pembelajaran yang bervariasi; (7) pembenahan terhadap perangkat pembelajaran. Berdasarkan temuan-temuan yang diperoleh dari hasil penelitian, maka dapat disarankan beberapa hal berikut: (1) sekolah wajib dalam pengadaan, pemeliharaan, dan perbaikan sarana dan fasilitas belajar yang ada disekolah dalam upaya mendukung dan meningkatkan kegiatan pembelajaran; (2) berdasarkan hasil penelitian yang telah dilakukan disarankan agar guru lebih mengetahui permasalahan yang dihadapi siswanya dan mencoba untuk membantu mengatasi kesulitan siswa agar dapat mengikuti pelajaran Pendidikan Kewarganegaraan dengan baik. Selain itu guru harus lebih sering menerapkan metode dan model-model pembelajaran yang menarik dan bervariasi sehingga siswa tidak bosan dan jenuh dalam menerima pelajaran; (3) guru sebaiknya memberikan dukungan dan motivasi kepada siswa agar dalam menerima pelajaran siswa lebih bersemangat; (4) siswa sebaiknya meningkatkan motivasi belajarnya, agar prestasi belajarnya meningkat. Selain itu kebiasaan belajar siswa perlu ditingkatkan, agar lebih memperhatikan penjelasan guru saat mengikuti pelajaran Pendidikan Kewarganegaraan, meningkatkan minat siswa untuk membaca buku-buku pelajaran, dan membiasakan belajar secara teratur untuk meningkatkan prestasi belajarnya.

Implementasi empat pilar keberhasilan dalam manajemen berbasis sekolah di Sekolah Dasar Negeri Kedungkandang 2 Malang / Dinar Imin Supranti

 

Keywords: Implementation, the four pillars of success in school-based management Implementation of school-based management involves four pillars of success is the success of quality, the success of self-reliance, the success of participation, transparency success. The focus of research: (1) how the school program planning with the School Based Management approach in SDN Kedungkandang 2, (2) how the four pillars of implementation of School Based Management in the SDN Kedungkandang 2; how the pillars of quality in the SDN Kedungkandang 2; bagaiamanakah the pillars of self-reliance in SDN Kedungkandang 2; how was the pillar of participation in SDN Kedungkandung 2; how was the pillar of transparency in the SDN Kedungkandang 2, (3) barriers to the implementation of School Based Management in the SDN Kedungkandang2 (4) the solutions to overcome the obstacles in the process of implementing the four pillars of success School-Based Management on SDN Kedungkandang 2. This study used a qualitative approach to the type of case study research. This site is located at SDN Kedungkandang 2. Its strategic location within easy reach from any direction because of the strategic location situated close to the highway. Data obtained through interviews, observation, and documentation. Data obtained from the three techniques was organized, is reduced if not relevant to the focus of the research, analyzed, and concludes the findings of the field. Tested the validity of the data: (1) extend the presence of researchers in the field, (2) triangulation by source. The focus of research: planning programs include: (1) developing the school vision and mission, (2) self-evaluation in order to identify the various needs of development, (3) identification of development needs, (4) formulation of objectives, (5) preparation of program improvement; (6) implementation of the program, (7) self-evaluation for the purpose of improving the quality of the next. Implementation of the four pillars of the school-based management in the SDN Kedungkandang already performing well. Obstacles in the implementation of school-based management in the SDN Kedungkandang 2, did not experience a large and difficult problems. Solutions to overcome the barriers include: a) a solution to overcome the contradictions of government regulations, the school decided to comply with the regulations of the government b) the principal teacher to send representatives to attend seminars and training to improve the quality of learning; c) innovation of learning time, additional teaching hours and hours work is aimed at teachers working memandirikan all school personnel to move forward; d) the school seeks to embrace the parents tried to explain in a transparent use of funds for school programs and describes the implementation of student learning in Bagimana SDN Kedungkandang 2; e) describe the use of financial assistance to parents who not understand as well as the implementation of student learning.

Perilaku berpacaran remaja (study fenomenologi dimensi hasrat, keintiman, dan komitmen remaja berpacaran) / Arsy rila Istikasari

 

Kata Kunci : perilaku berpacaran, hasrat, keintiman, komitmen Salah satu tugas perkembangan remaja adalah perkembangan sosial yang berorientasi pada persiapan pernikahan. Sebagai usaha pemenuhan tugas-tugas perkembangannya tersebut, remaja melakukan usaha melalui hubungan berpacaran (courthip). Dalam menjalani hubungannya, tidak jarang melanggar norma-norma sosial, agama dan susila yang berlaku. Terdapat beberapa remaja yang menyertakan perilaku seksual dalam hubungan berpacarannya. Berdasarkan fenomena tersebut, fokus penelitian meliputi: (1) Alasan remaja memutuskan untuk berpacaran, (2) Faktor yang mempengaruhi adanya perilaku seksual pada remaja berpacaran, dan (3) Dimensi cinta remaja berpacaran yang terdiri dari hasrat, keintiman dan komitmen. Hal ini diteliti karena segala bentuk perilaku dilatar belakangi oleh adanya alasan utama mereka memutuskan berpacaran serta adanya faktor yang mempengaruhi dan mendorong perilakunya tersebut. Metode yang digunakan dalam penelitian ini adalah kualitatif fenomenologis. Kehadiran peneliti sebagai pengamat berperan serta memanfaatkan sumber lain atau informan untuk memperkuat data. Subjek penelitian ditentukan dengan teknik snow bowling. Teknik pengumpulan data dalam penelitian ini menggunakan wawancara dan observasi. Analisis data dalam penelitian ini dilakukan dalam tiga tahap yaitu reduksi fenomenal, reduksi eiditis, dan reduksi transedental. Teknik pemeriksaan keabsahan datanya menggunakan triangulasi sumber. Hasil yang diperoleh dari penelitian ini adalah dalam berpacaran subjek, terdapat perilaku seksual yang menyimpang dari norma sosial, agama dan susila. Alasan utama subjek memutuskan berpacaran merupakan upaya pemenuhan kasih sayang dan menyeleksi pasangan hidup. Adanya perilaku seksual tersebut muncul karena terdapat faktor internal yaitu perubahan hormonal yang meningkatkan hasrat seksualnya. Sedangkan faktor eksternalnya adalah keadaan lingkungan keluarga dan adanya penyebaran informasi dan rangsangan melalui media masa dengan teknologi yang canggih. Selain itu, diperoleh deskripsi cinta yang dirasakan subjek. Keintimanlah yang paling menonjol dalam berpacaran. Hubungan yang semakin dalam tersebut, menjadikan subjek membumbui hubungannya dengan adanya hasrat yg menimbulkan perilaku seksual. Namun terdapat tanggung jawab dari subjek, yaitu komitmen untuk menikah. Saran dari penelitian ini ditujukan kepada konselor, yaitu memberikan layanan informasi bidang pribadi sosial dengan menyediakan media berupa buku saku tentang etika berpacaran. Layanan informasi bidang pribadi sosial tersebut diharapkan akan mengarahkan para siswa agar tidak melakukan perilaku negatif seperti perilaku seksual dalam berpacaran. Saran kepada peneliti selanjutnya jika dilakukan penelitian sejenis, maka perlu menambah subjek penelitian, misalnya lebih dari satu pasang remaja berpacaran. Saran kepada orang tua, diharapkan menanamkan nilai-nilai sosial, agama, dan susila yang ditanamkan sejak dini kepada anak.

Pengembangan video instruksional untuk mempermudah penguasaan teknik pola langkah dengan kombinasi serangan kaki pencak silat untuk siswa tingkat sabuk jambon Persaudaraan Setia Hati Terate Cabang Malang / Trisian Adi Danas

 

Kata kunci: pengembangan, media video, pola langkah dengan kombinasi serangan kaki pencak silat, siswa tingkat sabuk jambon persaudaran setia hati terate. Pencak silat merupakan salah satu hasil budaya bangsa Indonesia yang memiliki unsur seni, beladiri, olahraga, dan unsur mental spiritual. Salah satu organisasi pencak silat yaitu Persaudaraan Setia Hati Terate (PSHT). Dalam organisasi PSHT ini, anggota yang belum menjadi anggota tetap (siswa) harus dapat menguasai materi dalam jangka waktu yang telah ditentukan sesuai dengan kurikulum PSHT. Dari hasil analisis kebutuhan (Need Assesment) didapatkan hasil (1) siswa tidak pernah menggunakan teknik pola langkah dengan kombinasi serangan kaki saat sabung, (2) siswa mengalami kesulitan meletakkan posisi kaki maupun posisi badan, dan (3) pelatih jarang memberikan teknik pola langkah dengan kombinasi serangan kaki. Dari ketiga analisis tersebut bahwa siswa kurang memahami teknik pola langkah tersebut, karena ketika sabung (diadu) teknik pola langkah dengan kombinasi serangan kaki bisa digunakan dan mempunyai nilai “2”, selain itu materi teknik pola langkah dengan kombinasi serangan kaki bisa digunakan pada pencak silat prestasi. Yaitu dengan menggunakan media video instruksional teknik pola langkah dengan kombinasi serangan kaki pencak silat yang dikemas dalam bentuk compact disc/ digital versatile disc (CD/DVD) Penelitian ini bertujuan untuk mengembangkan media video instruksional untuk mempermudah penguasaan teknik pola langkah dengan kombinasi serangan kaki pencak silat siswa tingkat sabuk jambon, diharapkan dengan adanya media video instruksional ini siswa dapat lebih cepat dalam menguasai teknik tersebut. Dalam penelitian ini model pengembangan yang digunakan adalah model pengembangan Research & Development (R & D) dari Borg & Gall (1983:775). Adapun prosedur pengembangan materi teknik pola langkah dengan kombinasi serangan kaki pencak silat meliputi: (1) riset dan pengumpulan informasi dalam melakukan penelitian awal atau analisis kebutuhan (need assesment) dengan observasi di latihan serta penyebaran angket yang ditujukan kepada 15 siswa tingkat sabuk jambon, (2) pengembangan produk awal berupa rancangan produk, (3) evaluasi para ahli dengan menggunakan satu ahli media, satu ahli pembelajaran, dan ahli pencak silat (4) revisi produk pertama (sesuai dari hasil evaluasi para ahli dan uji kelompok kecil sebanyak 12 siswa sabuk jambon, (5) uji lapangan dengan mengujikan hasil produksi pertama pada kelompok besar yaitu pada 30 siswa tingkat sabuk jambon, (6) revisi produk akhir sesuai dari hasil uji lapangan (kelompok besar), (7) hasil akhir produk berupa video instruksional teknik pola langkah dengan kombinasi serangan kaki pencak silat. Teknik pengambilan data yang digunakan adalah dengan cara kuesioner. Dan teknik analisis data yang digunakan adalah analisis kualitatif dan deskriptif berupa persentase. Hasil penelitian pengembangan media video diperoleh data sebagai berikut: (1) Uji coba tahap I (kelompok kecil) yaitu 100% (Baik), (2) Uji coba tahap II (kelompok besar) yaitu 100%(Baik). Hasil produk pengembangan ini berupa video instruksional teknik pola langkah dengan kombinasi serangan kaki pencak silat yang disajikan dalam bentuk video dan bentuk fisik berupa CD/DVD (Compact Disc/ Digital Versatile Disc). Isi dari video ini adalah gambar bisa bergerak, sehingga ketika dilakukan berulang-ulang akan mudah dipahami, keras lemahnya suara juga bisa diatur, gerakan ada yang dibuat secara lambat, langkah-langkah gerakan jelas, secara bertahap dan dibuat secara menarik agar siswa lebih termotivasi untuk melakukan latihan.

Penerapan pembelajaran inkuiri deduktif untuk meningkatkan keterampilan proses sains dan pemahaman konsep materi listrik dinamis siswa kelas X-5 SMAN 6 Malang / Ide Hardiana Santi

 

Kata Kunci: Inkuiri deduktif, keterampilan proses sains, pemahaman konsep. Berdasarkan observasi dan wawancara yang telah dilakukan di SMA Negeri 6 Malang, diketahui bahwa pembelajaran fisika yang diterapkan masih bersifat konvensional dan tidak pernah melaksanakan kegiatan praktikum. Siswa masih sepenuhnya bergantung kepada guru, sehingga keterampilan proses dan pemahaman konsep siswa kurang maksimal. Hal tersebut dapat disebabkan karena model pembelajaran yang kurang tepat sehingga perlu diterapkan model pembelajaran yang dapat meningkatkan keterampilan proses dan pemahaman konsep siswa di SMA Negeri 6 Malang. Salah satu upaya untuk meningkatkan keterampilan proses sains dan pemahaman konsep siswa di kelas X-5 SMA Negeri 6 Malang adalah melalui penerapan pembelajaran inkuiri deduktif. Pembelajaran inkuiri deduktif memiliki empat tahapan, yaitu: pengajuan masalah, penstrukturan masalah, pengajuan hipotesis, dan eksperimen. Penelitian ini adalah penelitian tindakan kelas yang dilakukan dalam dua siklus. Masing-masing siklus terdiri atas empat tahap, yaitu (1) tahap perencanaan, (2) tahap tindakan, (3) tahap observasi, dan (4) tahap refleksi. Analisis data dalam penelitian tindakan kelas ini dilakukan melalui analisis data kualitatif dan analisis data kuantitatif. Analisis data kualitatif yaitu dengan menelaah seluruh data, mereduksi data, membuat kategorisasi, menafsirkan data, dan memberian pemaknaan hasil. Berdasarkan temuan penelitian dapat diketahui bahwa keterampilan proses siswa secara keseluruhan mengalami peningkatan. Rata-rata keterampilan proses sains siswa pada siklus I adalah 65,97% kemudian pada siklus II meningkat menjadi 89%. Rata-rata pemahaman konsep siswa untuk materi listrik dinamis pada siklus I adalah 72,22%. dan mengalami peningkatan pada siklus II menjadi 91,67%. Berdasarkan hasil penelitian dapat disimpulkan bahwa pembelajaran inkuiri dedukti, dapat meningkatkan keterampilan proses sains dan pemahaman konsep siswa pada materi listrik dinamis di kelas X-5 SMA Negeri 6 Malang.

Pengembangan buku ajar pembelajaran teknik dasar lanjutan serangan pencak silat untuk siswa kelas VII semester II SMP Negeri 10 Malang / Nurul Afifah

 

Kata kunci: Buku ajar pembelajaran, Teknik dasar lanjutan serangan, Pencak silat Berdasarkan hasil observasi dan wawancara dengan guru pendidikan jasmani, olahraga dan kesehatan yang dilakukan pada tanggal 15 Januari 2012 di SMP Negeri 10 Malang yang berkaitan dengan masalah pengembangan buku ajar pembelajaran teknik dasar lanjutan serangan pencak silat untuk siswa kelas VII semester II SMP Negeri 10 Malang dapat diketahui bahwa pembelajaran pencak silat disajikan di kelas VII, akan tetapi pembelajaran yang diberikan kurang sesuai karena materi yang diberikan tidak didukung oleh sumber yang berupa buku ajar, sehingga perlu adanya keberlanjutan pengembangan dalam bentuk buku ajar pada semester II. Berdasarkan penyebaran angket analisis kebutuhan (need assessment) kepada guru pendidikan jasmani olahraga dan kesehatan dapat diperoleh kesimpulan bahwa penyampaian materi pencak silat jarang diberikan. Tujuan dari penelitian ini adalah untuk mengembangkan buku ajar pembelajaran teknik dasar lanjutan serangan pencak silat untuk siswa kelas VII semester II di SMP Negeri 10 Malang sehingga dapat membantu dan mempermudah dalam penyampaian materi praktik pencak silat yang ada dalam mata pelajaran pendidikan jasmani olahraga dan kesehatan. Metode yang digunakan penelitian ini adalah pengembangan Borg dan Gall yang diadaptasi menjadi lebih sederhana yaitu: (1) mengumpulkan informasi: (a) mengkaji bahan pustaka, (b) analisis kebutuhan; (2) mendesain produk; (3) validasi desain; (4) revisi I; (5) uji coba tahap I; (6) revisi II; (7) Uji coba tahap II; (8) produk akhir. Berdasarkan hasil evaluasi ahli pencak silat diperoleh persentase 88%, ahli pendidikan jasmani 87%, ahli media 85% dan uji tahap I (8 siswa) diperoleh persentase 86,1% , dan pada uji tahap II (38 siswa) diperoleh persentase 87,2% sehingga panduan pembelajaran teknik dasar serangan pencak silat untuk siswa kelas VII SMP Negeri 10 Malang dapat digunakan. Pengembangan buku ajar pembelajaran teknik dasar lanjutan serangan pencak silat dapat digunakan sebagai sumber belajar yang berguna untuk meningkatkan keterampilan belajar siswa dalam pembelajaran pencak silat. Selain itu, disarankan subjek penelitian lebih luas lagi tidak hanya pada satu sekolah tetapi pada beberapa sekolah yang lain.

Upaya pencapaian ranah afektif pada pembelajaran pendidikan kewarganegaraan (studi kasus di kelas III SDN Dinoyo 3 Kota Malang) / Adinda Pesona Candra

 

Kata Kunci: Upaya Pencapaian Ranah Afektif, Pembelajaran Pendidikan Kewarganegaraan Masalah yang akan dibahas dalam penelitian yaitu upaya pencapaian ranah afektif dalam pembelajaran PKn dalam kelas maupun luar kelas, kendala yang dihadapi guru dalam pencapaian ranah afektif, serta cara mengetahui tingkat pencapaian ranah afektif siswa pada pembelajaran kewarganegaraan yang telah dilaksanakan. Penelitian ini menggunakan pendekatan kualitatif deskriptif dengan rancangan studi kasus.Data utama dalam penelitian kualitatif adalah kata-kata atau tindakan dan selebihnya adalah dokumentasi. Berdasarkan paparan data, temuan penelitian dan pembahasan diperoleh empat kesimpulan. Pertama, upaya pencapaian ranah afektif pada pembelajaran PKn dalam kelas, tidak hanya dengan mentransfer pengetahuan saja, guru juga menanamkan nilai, moral dan sikap yang baik.Upaya pencapaian ranah afektif dimulai guru dengan pembuatan RPP yang benar, mengembangkan indikator-indikator sesuai dengan tahap perkembangan siswa, pemberian teladan yang baik, penggunaan model pembelajaran yang bervariasi, serta penggunaan metode yang tepat. Dalam kegiatan pembelajarannya, dilakukan guru dengan pemberian stimulus awal yang kemudian mendapat respon dari siswa. Selain itu guru juga melakukan kegiatan persuasif sebagai upaya pencapaian ranah afektif. Kedua, kegiatan pencapaian ranah afektif luar kelas yang sesuai dengan pengimplementasian pembelajaran PKn, dilakukan SDN Dinoyo 3 dengan berbagai upaya yang beragam, mulai dari upacara, bimbingan akhlak untuk pembinaan budi pekerti dan kepribadian, kegiatan pramuka, penilaian kepribadian serta kegiatan senyum, sapa dan salam. Selain dari berbagai upaya tersebut, adanya poster-poster yang ada di setiap sudut sekolah secara tidak langsung juga dapat meningkatkan ranah afektif siswa melalui kata-kata yang mengandung ajakan/persuasi. Ketiga, kendala pencapaian ranah afektif untuk anak kelas III terletak pada penginternalisasian nilai positif, untuk menginternalisasikannya tidak bisa hanya dilakukan dengan memberi tahu saja, tapi dengan pemberian teladan secara langsung. Cara ini pun tidak bisa hanya dilakukan sekali, tapi harus berkali-kali secara intensif. Sedangkan kendala pencapaian ranah afektif di luar kelas (tingkat sekolah) yaitu kegiatan guru yang banyak dilakukan di dalam kelas dan adanya beberapa indikator pelanggaran yang belum terdeteksi, menyebabkan adanya beberapa pelanggaran yang dilakukan siswa selama istirahat berlangsung. Keempat, cara mengetahui tingkat pencapaian ranah afektif siswa pada pembelajaran kewarganegaraan dapat diketahui dari sikap dan tingkah laku siswa dalam kelas maupun luar kelas. Di dalam kelas, cara mengetahuinya dapat dilihat dari nilai reward dan punishment yang ditempelkan di dinding kelas dan pada pajangan yang menggambarkan jam kedatangan siswa. Sedangkan untuk di luar kelas, cara mengetahui pencapaian ranah afektif dapat dilihat dari penilaian kepribadianyang dilakukan sekolah sehari-hari. Penulis memberikan saran kepada pihak sekolah agar beberapa upaya pencapaian ranah afektif yang belum disadari potensinya, seperti adanya poster-poster di setiap sudut sekolah, dapat dimaksimalkan fungsinya. Faktor penentu keberhasilan dari upaya pencapaian ranah afektif adalah komitmen guru serta kepala sekolah, sehingga perlu adanya komitmen antar keduanya. Selain itu, diharapkan upaya-upaya yang telah dilakukan SDN Dinoyo 3 dapat dibinakan pada sekolah-sekolah lain yang belum menerapkannya.

Pembelajaran mengungkapkan informasi dalam bentuk laporan di kelas VIII SMP Negeri 8 Malang tahun pelajaran 2011/2012 / Novi Dwi Cahyanti

 

Pengembangan pedal keseimbangan untuk pembelajaran keseimbangan dinamis siswa kelas II SD Permata Jingga Global School Malang / Tomy Ariyanto

 

Kata Kunci: pedal keseimbangan, antropometri, keseimbangan. Sekolah Dasar Permata Jingga Global School Malang merupakan lembaga pendidikan formal yang dalam kegiatan pembelajarannya mencantumkan mata pelajaran pendidikan jasmani kesehatan dan olahraga sebagai mata pelajaran yang wajib diajarkan. Ruang lingkup pendidikan jasmani kesehatan dan olahra meliputi (1) Permaianan dan olaharaga meliputi : olaharaga tradisional, permaianan, eksplorasi gerak, keterampilan lokomotor non-lokomotor, dan manipulatif, atleteik, kasti, rounders, sepak bola, bola basket, bola voli, tenis, tenis lapangan, bulu tangkis, dan bela diri, serta aktivitas lainya. (2) Aktivitas pengembangan meliputi: mekanika sikap tubuh, komponen kebugaran jasmani, bentuk postur tubuh serta aktivitas lainya. (3) Aktivitas senam meliputi: ketangkasan sederhana ketangkasan tanpa alat, ketangkasan dengan alat, dan senam lantai, serta aktivitas lainya. (4) Aktivitas ritmik meliputi: gerak bebas, senam pagi, SKJ, dan senam aerobik, serta aktivitas lainya. (5) Aktivitas air meliputi: permaianan di air, keselamatan air, keselatan bergerak di air, dan renang serta aktivitas lainya. (6) pendidikan luar kelas meliputi: piknik/karyawisata, pengenalan, pengenalan lingkungan, berkemah, berjelajah dan mendaki gunung. (7) kesehatan meliputi: penanaman budaya hidup sehat dalam kehidupan sehari-hari, khususnya yang terkait dengan perawatan tubuh agar tetap sehat, merawat lingkungan yang sehat, memilih makanan dan minuman yang sehat, mencegah dan merawat cidera, mengatur waktu istirahat yang tepatdan berperan aktif dalam kegiatan P3K dan UKS, Aspek kesehatan merupakan aspek tersendiri, dan secara implisit masuk ke dalam semua aspek. Pendidikan jasmani, kesehatan dan olahraga yang diajarakan di Sekolah Dasar Permata Jingga Global School Malang meliputi materi materi yang diberikan meliputi aktivitas permainan, kebugaran jasmani, senam, renang, budaya hidup sehat. Pembelajaran kegiatan senam terutama materi keseimbangan guru memberikan pembelaran dengan cara siswa berjalan diatas garis dan berlari diatas garis. Berdasarkan hasil observasi dan analisis kebutuhan awal terhadap guru pendidikan jasmani, olahraga dan kesehatan di Sekolah Dasar Permata Jingga Global School Malang pada tanggal 26 Januari 2012, di Sekolah Dasar Permata Jingga Global School Malang, guru pernah melakukan pembelajaran keseimbangan dinamis namun tidak pernah menggunakan alat bantu pembelajaran berupa pedal keseimbangan dikarenakan belum adanya alat berupa pedal keseimbangan.

Pemetaan dan perhitungan luas wilayah kampus I Universitas Negeri Malang berbasis Global Positioning System (GPS) / Vivi Aprilia

 

Kata kunci: GPS, Wolfram Mathematica 7.0, Peta digital, Luas wilayah Kampus I UM. GPS merupakan sistem navigasi untuk menentukan posisi berbasiskan satelit yang berhubungan disetiap orbitnya. GPS memberikan berbagai macam informasi seperti koordinat garis lintang dan garis bujur. Informasi posisi dari garis lintang dan garis bujur tersebut merupakan triangulation 3 satelit, dimana setiap satelit memancarkan gelombang elektromagnetik dengan membawa kode yang berbeda secara kontinyu. Koordinat ini dapat diaplikasikan untuk pemetaan wilayah kampus I Universitas Negeri Malang (UM) sehingga dapat diperoleh luas wilayah tersebut. Berkaitan dengan itu, maka diperlukan pembahasan mengenai pemetaan dan perhitungan luas wilayah Kampus I UM. Adapun tujuan dari skripsi ini adalah memetakan wilayah kampus I Universitas Negeri Malang menggunakan Wolfram Mathematica 7.0 dan menghitung luas wilayah Kampus I Universitas Negeri Malang dengan menggunakan Global Positioning System (GPS). Pemetaan wilayah Kampus I menggunakan software Wolfram Mathematica 7.0 yang mampu membuat peta digital sesuai dengan input data. Peta digital ini dapat memberikan informasi sesuai dengan keinginan seperti perbesaran gambar, perputaran gambar, informasi nilai panjang, nilai lebar dan nilai luas masing-masing bangunan. Sedangkan pada perhitungan luas wilayah Kampus I UM diperoleh dari selisih antara garis lintang/ garis bujur 2 titik. Selisih antara 2 titik tersebut kemudian di konversi dari DMS menjadi DD dan konversi panjang (km). Dari konversi inilah dapat diketahui luas Kampus I UM. Berdasarkan pengukuran konvensional, Kampus I UM menempati area seluas 453.860 m2. Namun, pada pengukuran GPS, Kampus I UM menempati area seluas 454.008,51m2. Berdasarkan hasil analisis data tersebut, diperoleh 2 simpulan hasil penelitian sebagai berikut. Pertama, simulasi pemetaan dan perhitungan luas wilayah Kampus I UM menggunakan Wolfram Mathematica 7.0 menghasilkan peta digital dengan interpretasi hasil sebagai berikut: perbesaran gambar, perputaran gambar, pemberian inset, pemberian informasi panjang, lebar dan luas masing-masing bangunan. Kedua, perbandingan data luas konvensional dengan pengukuran GPS sangat berbeda sekitar 50-100 m2. Hal ini memperlihatkan bahwa GPS tipe navigasi tidak cocok digunakan untuk pemetaan wilayah berdasarkan garis lintang dan garis bujur.

Keefektifan multimedia dalam pembelajaran menggambar bentuk pada siswa kelas VII A SMP Negeri 2 Grujugan Bondowoso / Angga Satrya Atma Nagara

 

Kata Kunci: Keefektifan, Multimedia, Pembelajaran, Menggambar Bentuk Pendidikan seni rupa sangat berhubungan erat dengan istilah menggambar. Menggambar bentuk merupakan salah satu bahan ajar pendidikan seni rupa yang bertujuan melatih peserta didik untuk meningkatkan kecerdasan visual spasial. Dengan kecerdasan visual spasialnya, peserta didik dapat menggali ide bentuk dan keruangan serta dapat mengkomunikasikannya secara visual. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui keefektifan penggunaan multimedia dalam pembelajaran menggambar bentuk pada siswa kelas VII A SMP Negeri 2 Grujugan Bondowoso. Serta untuk mengetahui apakah penggunaan multimedia dapat meningkatkan kualitas proses dan hasil pembelajaran menggambar bentuk. Pendekatan yang digunakan dalam penelitian ini adalah diskriptif kualitatif, yang dimaksud dengan penelitian kualitatif adalah penelitian yang dilakukan dalam situasi wajar. Pengumpulan data dilakukan dengan teknik wawancara, observasi, dokumentasi dan catatan lapangan. Untuk mejaga keabsahan data, dilakukan kegiatan triangulasi data. Kegiatan analisis data dimulai dari tahap reduksi data paparan data verifikasi/penarikan kesimpulan. Hasil penelitian menunjukkan bahwa penggunaan multimedia dalam proses pembelajaran menggambar bentuk pada siswa kelas VII A SMP Negeri 2 Grujugan Bondowoso dapat dikatakan efektif karena dapat meningkatkan kualitas proses dan kualitas hasil. Hal ini dapat dilihat dari hasil analisis data yang menunjukkan aktivitas siswa mengalami peningkatan sebagai wujud dari perbaikan perilaku belajar siswa yang semakin memiliki kepercayaan diri untuk mengembangkan potensi kepribadiannya secara optimal.Penerapan materi menggambar bentuk dengan menggunakan multimedia pembelajaran dapat memotivasi siswa dalam mengikuti kegiatan belajar mengajar dan meningkatkan kemampuan siswa dalam menggambar bentuk. Kemampuan menggambar bentuk siswa semakin meningkat sebagai wujud perkembangan kecerdasan visual spasial, perkembangan kemampuan berkreasi dan apresiasi karya seni rupa. Hasil belajar siswa mengalami peningkatan ketuntasan individu dari 40% menjadi 96,42% setelah diterapkan penggunaan multimedia pembelajaran.

Sikap nasionalisme di kalangan pecinta lagu dan penyanyi Korea yang tergabung dalam komunitas Korea Pop Fandom Malang / Dian Mariani

 

Kata Kunci: KFM, fandom, Korea, komunitas, nasionalisme. Komunitas Korea Pop Fandom Malang (KFM) adalah salah satu komunitas pecinta lagu dan penyanyi Korea yang ada di Kota Malang. KFM ini merupakan salah satu komunitas yang tersubordinasi oleh budaya Korea yang mendunia. Adanya fenomena ini, maka penulis berusaha mengkaji dan meneliti dari aspek sikap nasionalisme dari anggota KFM tersebut. Masalah yang diteliti adalah pertama, bagaimana karakteristik anggota Komunitas Korea Pop Fandom Malang? Kedua, bagaimana wawasan nasionalisme anggota Komunitas Korea Pop Fandom Malang? Ketiga, bagaimana pendapat anggota Korea Pop Fandom Malang terhadap sikap nasionalisme? Keempat, bagaimana bentuk-bentuk perwujudan sikap nasionalisme anggota Korea Pop Fandom Malang ? Penelitian ini dilaksanakan dengan tujuan untuk. Menjelaskan karakteristik anggota Komunitas Korea Pop Fandom Malang, menjelaskan wawasan nasionalisme anggota Komunitas Korea Pop Fandom Malang, menjelaskan pendapat anggota Korea Pop Fandom Malang terhadap sikap nasionalisme, dan menjelaskan bentuk-bentuk perwujudan sikap nasionalisme anggota Korea Pop Fandom Malang. Penelitian ini menggunakan pendekatan kualitatif. Subyek penelitiannya adalah ketua, pengurus, dan anggota KFM. Pengumpulan datanya dilakukan dengan teknik observasi partisipatif, wawancara mendalam, dan dokumentasi. Analisis datanya dilakukan dengan reduksi data, penyajian data, dan penarikan kesimpulan (verifikasi). Sedangkan pengecekan keabsahan temuan dilakukan dengan perpanjangan keikutsertaan, ketekunan pengamatan, dan triangulasi. Penelitian ini dilakukan melalui tiga tahap yaitu: tahap persiapan penelitian, tahap pelaksanaan, tahap pelaporan. Hasil yang diperoleh dari penelitian adalah pertama, karakteristik dari anggota KFM adalah anggota perempuan lebih mendominasi, anggota KFM didominasi oleh mahasiswa, anggota KFM berasal dari Kota Malang dan dari luar Kota Malang, KFM menyukai jenis lagu Korea pop, ballad, dan R&B, anggota KFM memiliki berbagai alasan untuk menyukai lagu-lagu dan penyanyi Korea, dan cara anggota KFM menunjukkan bentuk rasa cinta terhadap lagu dan penyanyi Korea. Kedua, wawasan nasionalisme anggota KFM memaknai nasionalisme sebagai cinta tanah air dan anggota KFM memberi contoh wujud nasionalisme. Ketiga, pendapat anggota KFM mengenai nasionalisme ialah pendapat mengenai alasan cinta tanah air sebagai sikap nasionalisme dan pendapat tentang wujud sikap nasionalisme. Keempat, wujud sikap nasionalisme mereka ialah membuat gathering yang bernuansa bakti sosial, menggabungkan antara tarian tradisional bali dengan dance cover korea, memperingati hari kemerdekaan Indonesia, dan anggota KFM memakai baju batik sebagai dresscode dalam acara Indonesia loves Taeyeon by SONEID. Dari penelitian ini dapat ditarik empat simpulan,yaitu pertama, karakteristik yang dimiliki oleh anggota KFM ialah anggota perempuan dan mahasiswa lebih mendominasi jumlah anggota KFM, anggotanya berasal dari Kota Malang dan dari luar Kota Malang, menyukai jenis lagu Korea pop, ballad, dan R&B, menyukai penyanyi solo, boy band,dan girl band Korea, dan memiliki berbagai alasan menyukai lagu dan penyanyi Korea. Kedua, anggota KFM memiliki wawasan nasionalisme sebagai cara pandang terhadap cinta tanah air dan perlu adanya perwujudan terhadap cara pandangan tersebut dalam kehidupanny. Ketiga, anggota KFM berpendapat bahwa sikap nasionalisme itu merupakan perwujudan sikap kebangsan yang cintai tanah air Indonesi dengan cara berprestasi untuk bangsa Indonesia, menyeleksi budaya asing yang masuk ke Indonesia, mencintai pahlawan nasional Indonesia, menjaga budaya dan wilayah Indonesia dari klaim bansa asing,dan tidak setuju dengan pihak yang membenci terhadap lagu kebangsaan Indonesia Raya. Keempat, wujud sikap nasionalisme dari anggota KFM adalah berupa gathering yang bernuansa bakti sosial, menggabungkan antara tarian tradisional Bali dengan dance cover Korea, dan memakai baju batik sebagai dresscode dalam acara Indonesia Loves Taeyeon By SONEID. Saran yang dapat disampaikan dari penelitian ini pertama, bagi ketua KFM, agar engajak aggota KFM agar tidak melupakan nasionalisme Indonesia, membuat gathering yang bernuansa nasionalisme, tetap memasukkan budaya Indonesia di dalam komunitas KFM, dan berrsifat selektif terhadap pengaruh budaya Korea yang tidak sesuai dengan budaya bangsa Indonesia. Saran bagi anggota KFM yaitu, untuk dapat meningkatkan pemahaman anggota KFM tentang konsep nasionalisme, aggota KFM perlu memperdalam pemahaman dan pengetahuan mereka tentang konsep nasionalisme, dan sikap nasionalisme yang telah disebutkan oleh anggota KFM sebaiknya digunakan sebagai sikap nasionalisme dalam kehidupannya. Bagi penelitian lanjutan yaitu diharapkan pada penelitian lanjutan dapat meneliti lebih dalam mengenai bentuk dari wujud nasionalisme yang dilakukan oleh Komunitas Korea Pop Fandom Malang. Bagi pendidikan kewarganegaraan yaitu diharapkan sikap nasionalisme ini ditanamkan di pendidikan sekolah dasar sampai dengan perguruan tinggi. Karena dalam pendidikan ini generasi penerus bangsa akan muncul dan menjadi individu yang nasionalis dan tidak melupakan jati diri bangsa.

Alat pengunci pintu berpassword berbasis atmega 8535 / As'ad Shidqy Aziz

 

Kata Kunci: Pengunci Pintu, Berpassword, ATMEGA 8535. Sistem keamanan merupakan sistem yang sangat diperlukan oleh orang- orang saat ini dengan banyaknya kasus pencurian terutama kasus pencurian yang menjadi target utama dari para pencuri adalah rumah kosong yang di tinggal penghuninya. Kasus ini banyak terjadi di setiap pelosok daerah bahkan dapat merugikan penghuninya sampai ratusan juta rupiah. Hal ini terjadi karena kelalaian dari para pemilik rumah sendiri. Selain itu juga karena sistem keamanan yang kurang. Dari maraknya pencurian itu diperlukan sebuah sistem pengaman yang terintegerasi. Pembuatan tugas akhir ini bertujuan untuk membuat sebuah inovasi baru terhadap sistem keamanan yang ada sekarang yaitu dengan menggabungkan software dan hardware untuk sistem penguncian pintu yaitu pengunci pintu berpassword dengan komponen utama keypad sebagai masukan password, ATMEGA 8535 yang berfungsi sebagai pengolah masukan dari keypad, LCD sebagai penampil password, RTC DS 1307 sebagai penghasil waktu yang digunakan untuk mengetahui waktu akses terakhir yang dilakukan oleh user, Solenoid door sebagai pengunci pintu dan buzzer sebagai alarm apabila password yang telah dimasukkan salah sebanyak tiga kali. Pembuatan alat ini juga sebagai pengembangan alat yang sudah ada dimana dalam alat yang sudah ada masih menggunakan sebuah IC AT89S51 yang masih menggunakan bahasa tingkat rendah yaitu assembly untuk diganti menjadi ATMEGA 8535 yang dalam pemogramannya sudah menggunakan bahasa C, adanya penampilan password pada LCD akan memudahkan dalam penggunaannya, serta terdapat pencatatan waktu terakhir akses user dan pemblokiran password ketika salah memasukkan sebanyak tiga kali.

Penerapan model pembelajaran problem based learning (PBL) disertai mind mapping untuk meningkatkan keterampilan berfikir kritis dan hasil belajar kognitif siswa kelas XI-SSI SMA Laboratorium UM tahun ajaran 2011/2012 / Galuh Edytiantika

 

Kata Kunci: Pembelajaran berbasis masalah, Mind Mapping, Keterampilan berpikir kritis, Hasil Belajar Kognitif Hasil observasi awal yang telah dilakukan peneliti di SMA Laboratorium UM khususnya kelas XI-SSI, menunjukkan bahwa keterampilan berfikir kritis di kelas tersebut masih rendah, hal ini bisa diketahui dari kesulitan yang dialami siswa untuk menuliskan dugaan awal pemecahan masalah serta menganalisis data untuk memperoleh jawaban saat diskusi berlangsung karena kedua hal tersebut merupakan indikator dalam keterampilan berfikir kritis. Hal tersebut berdampak pula pada hasil belajar kognitif siswa ketika UTS rata-rata nilai siswa hanya 60, padahal KKM yang ditetapkan adalah 78. Sehingga seluruh siswa dalam kelas tersebut mengikuti remedial. Untuk itu, diperlukan suatu model pembelajaran yang mampu meningkatkan hasil belajar kognitif serta keterampilan berfikir kritis siswa. Model Pembelajaran yang ditawarkan adalah pembelajaran berbasis masalah, di mana siswa diberikan masalah untuk dipecahkan atau dicari jawabannya, sehingga siswa terbiasa berfikir menyelesaikan masalah. Namun diperlukan juga cara mencatat hasil rekaman informasi selama pembelajaran agar siswa dapat menggunakannya sebagai catatan belajar. Mind mapping dapat digunakan sebagai metode mencatat yang efektif dan menarik berisi informasi lengkap seputar materi dilengkapi warna dan gambar. Penelitian yang dilakukan adalah penelitian tindakan kelas (PTK), yang terdiri atas dua siklus dengan 6 kali pertemuan. Subjek penelitian adalah siswa kelas XI-SSI SMA Laboratorium UM dengan jumlah 24 siswa. Instrumen penelitian berupa RPP, LKS, lembar observasi keterlaksanaan pembelajaran berbasis masalah, tes keterampilan berpikir kritis, catatan lapangan, tes evaluasi akhir. Teknik analisis data yaitu reduksi data, penyajian data, penarikan kesimpulan. Hasil penelitian menunjukkan bahwa model pembelajaran berbasis masalah disertai mind mapping dapat meningkatkan keterampilan berpikir kritis dan hasil belajar kognitif siswa. Hal ini ditunjukkan dengan peningkatan rata – rata persentase keterampilan berpikir kritis 52.4 % pada siklus satu dan 72 % pada siklus II. Hasil belajar kognitif siswa pada siklus I sebesar 21 % meningkat pada siklus II menjadi 79 %.Keterlaksanaan pembelajaran berbasis masalah 69 % pada siklus I dan 84 % pada siklus II. Kesimpulannya bahwa penerapan pembelajaran berbasis masalah disertai mind mapping dapat meningkatkan keterampilan berfikir kritis dan hasil belajar kognitif siswa kelas XI-SSI SMA Laboratorium UM.

Penerapan Laufdiktat pada pembelajaran bahasa Jerman siswa kelas X SMA Negeri 7 Malang / Ellysa Yuniar Eka Wardhani

 

Kata Kunci: Metode Laufdiktat, kosakata Pengajaran kosakata saat ini semakin mendapatkan perhatian karena telah disadari bahwa pengajaran bahasa yang bersifat gramatikal dapat dikatakan kurang efisien. Pembelajaran kata benda bahasa Jerman merupakan salah satu dari sekian banyak macam pembelajaran dasar yang harus diajarkan kepada siswa, terutama untuk pebelajar pemula. Kata benda dianggap paling penting karena kata benda merupakan bagian pokok suatu kosakata. Kosakata tersebut harus dikuasai oleh siswa agar mudah memahami suatu materi pembelajaran. Kata benda dalam bahasa Jerman selalu diawali dengan Artikel (kata sandang), yaitu jenis maskulin (der), feminin (die), dan neutral (das). Hal-hal tersebut tidak pernah ditemukan sebelumnya oleh siswa dalam bahasa Indonesia. Mengajarkan kosakata akan semakin menarik dan efektif jika menggunakan metode yang tepat. Laufdiktat (dikte berlari) merupakan salah satu bentuk dari metode dikte yang tepat dan dapat meningkatkan kosakata siswa. Penelitian ini bertujuan untuk mendeskripsikan penerapan Laufdiktat dalam pembelajaran bahasa Jerman siswa kelas X di SMAN 7 Malang, karena di sekolah ini belum pernah melaksanakan metode ini. Selain itu, siswa mengalami kesulitan dalam menghafalkan kata benda. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Sumber data yang digunakan adalah seluruh siswa kelas X.3 tahun pelajaran 2009/2010 sebanyak 36 siswa. Untuk mendapatkan data, instrumen yang digunakan adalah lembar observasi, wawancara, angket respon guru dan siswa, dan lembar hasil pekerjaan siswa. Hasil penelitian ini menunjukkan bahwa penggunaan metode Laufdiktat merupakan salah satu metode pembelajaran yang dapat diterapkan dalam pembelajaran. Melalui metode ini siswa dapat meningkatkan kosakata dalam bahasa Jerman dan juga dapat menulis ejaannya dengan benar. Suasana belajar di dalam kelas akan lebih menyenangkan, sehingga siswa lebih aktif dalam mengikuti kegiatan pembelajaran. Hal ini terlihat dari hasil angket siswa sebanyak 75%, yang menyatakan bahwa siswa menjadi lebih aktif ketika menggunakan metode ini dalam pelajaran. Berdasarkan hasil penelitian disarankan agar metode ini dapat diterapkan dalam matapelajaran bahasa asing, pada keterampilan berbahasa yang berbeda dan sekaligus menggunakan penelitian ini sebagai dasar penelitian selanjutnya.

Pengembangan media pembelajaran fisika berbantuan komputer dengan swishmax pada materi teori kinetik gas untuk siswa SMA kelas XI / Syarafina Nur Amalia

 

Kata Kunci : pengembangan, media, SwishMax, teori kinetik gas Teori kinetik gas adalah salah satu materi Fisika yang di dalamnya banyak konsep yang bersifat abstrak. Dengan demikian dibutuhkan suatu alat yang dapat mengambarkan materi tersebut secara jelas dan terlihat nyata. Alat yang tepat digunakan dalam pembelajaran teori kinetik gas adalah berupa media pembelajaran berbentuk animasi. Tujuan dari penelitian ini adalah untuk membuat media pembelajaran Fisika berbantuan komputer pada materi teori kinetik gas dan untuk mengetahui kelayakan media pembelajaran berbantuan komputer yang telah dibuat Metode yang digunakan dari penelitian ini sesuai yang dikemukakan oleh Dick dan Carey. Langkah-langkah pengembangan tersebut, yaitu identifikasi tujuan pembelajaran, analisis instruksional, identifikasi tingkah laku awal/karakteristik siswa, merumuskan tujuan kinerja, mengembangkan instrument penilaian, mengembangkan strategi, mengembangkan produk, melakukan evaluasi, dan revisi. Pengambilan data dilakukan dengan memberikan angket kepada ahli media dan ahli materi. Data evaluasi tersebut kemudian dianalisis dengan menggunakan teknik persentase untuk mengetahui kevalidan (kelayakan) dari produk media pembelajaran. Hasil analisis data dengan teknik persentase dari masing-masing subjek coba adalah 80% menurut ahli media dan 91,25% menurut ahli materi. Dari hasil analisis data tersebut menunjukkan bahwa media pembelajaran berbantuan komputer materi teori kinetik gas memiliki desain dan kebenaran materi yang ditampilkan pada kategori valid (layak).

Pengembangan software permainan simulasi asertif untuk meningkatkan percaya diri siswa SMP / Mulita Isnaini

 

Kata kunci: Software, permainan simulasi, asertif, percaya diri, siswa SMP. Percaya diri adalah sikap positif yang dimiliki individu untuk mengembangkan penilaian positif baik terhadap diri sendiri maupun terhadap lingkungannya. Dalam mengatasi dampak rasa kurang percaya diri siswa, maka diperlukan bimbingan yang terpadu. Salah satu bentuk bimbingan untuk meningkatkan percaya diri siswa adalah dengan melatihkan perilaku asertif. Perilaku asertif adalah kemampuan untuk mengkomunikasikan apa yang diinginkan, dirasakan, dan dipikirkan kepada orang lain namun dengan tetap menjaga dan menghargai hak-hak serta perasaan pihak lain. Perilaku asertif dapat dilatihkan dengan berbagai cara, salah satunya dengan melakukan permainan simulasi. Permainan simulasi adalah permainan yang dimaksudkan untuk merefleksikan situasi-situasi yang terdapat dalam kehidupan yang sebenarnya. Agar siswa lebih tertarik untuk memainkan permainan simulasi ini, permainan simulasi dapat dikemas dalam bentuk software. Pengembangan ini bertujuan menghasilkan produk berupa software permainan simulasi asertif untuk meningkatkan percaya diri siswa sebagai media yang praktis bagi konselor untuk pelaksanaan kegiatan bimbingan. Dengan pengembangan software permainan simulasi ini, diharapkan siswa dapat mengembangkan perilaku asertif untuk meningkatkan percaya diri siswa. Penelitian ini menggunakan rancangan penelitian dan pengembangan yang dikemukakan Borg and Gall (1983), yaitu: 1) melakukan penelitian dan pengumpulan informasi, 2) melakukan perencanaan, 3) mengembangkan produk awal, 4) melaksanakan uji lapangan permulaan, 5) melakukan revisi produk utama, 6) melakukan uji lapangan terbatas, 7) revisi terhadap produk operasional. Berdasarkan penilaian dari ahli bimbingan dan konseling, yang ditinjau dari aspek kegunaan, kepraktisan dan kemenarikan, software yang dikembangkan sudah memenuhi syarat kelayakan sebagai media bimbingan. Berdasarkan penilaian dari ahli media, ditinjau dari aspek kegunaan, kepraktisan dan kemenarikan, software yang dikembangkan sudah memenuhi syarat kelayakan untuk digunakan sebagai media pembelajaran. Berdasarkan penilaian dari calon pengguna produk (konselor), ditinjau dari aspek kegunaan, kepraktisan dan kemenarikan, software yang dikembangkan sudah memenuhi syarat kelayakan sebagai media bimbingan di sekolah. Berdasarkan penilaian dari calon pengguna produk (siswa), ditinjau dari aspek kegunaan, kepraktisan dan kemenarikan, software yang dikembangkan sudah memenuhi syarat kelayakan sebagai media pelatihan perilaku asertif untuk meningkatkan percaya diri. Berdasarkan hasil penelitian ada beberapa saran dari peneliti: 1) bagi pengguna; (a) konselor yang akan menggunakan software permainan simulasi ini diharapkan mempunyai latar belakang pendidikan Bimbingan Konseling sehingga akan lebih mudah untuk memahami materi yang ada dalam software permainan simulasi ini; (b) konselor diharapkan memberikan motivasi kepada siswa untuk terus berlatih perilaku-perilaku yang telah diajarkan agar siswa dapat menunjukkan perilaku yang diharapkan; 2) bagi peneliti selanjutnya; (a) pengembangan software permainan simulasi perlu dilakukan uji lapangan untuk dapat mengetahui keefektivan software yang dikembangkan.

Meningkatkan efektivitas pembelajaran lari jarak pendek pada siswa kelas VII G SMP Negeri I Batu dengan metode bermain dan berlomba Rudi Handoko

 

Kata kunci: efektivitas pembelajaran, lari jarak pendek, metode bermain dan berlomba Tingkat efektivitas pembelajaran yang dilakukan oleh guru merupakan salah satu faktor utama kesuksesan guru dalam melaksanakan proses belajar mengajar. Efektivitas suatu kegiatan belajar dapat terlihat dari proses pembelajaran itu sendiri. Guru pendidikan jasmani, olahraga dan kesehatan harus kreatif dalam merancang pembelajaran, salah satunya adalah dalam pembelajaran lari jarak pendek. Pembelajaran lari jarak pendek dapat dilakukan dengan metode bermain dan berlomba. Metode bermain dan berlomba merupakan salah satu pendekatan pembelajaran dalam pendidikan jasmani yang berpusat pada permainan dan siswa, untuk membelajarkan tentang permainan yang berhubungan erat dengan olahraga dengan sifat pembelajaran yang konstruktif. Penelitian ini adalah tentang “Meningkatkan Efektivitas Pembelajaran Lari Jarak Pendek pada Siswa Kelas VII G SMP Negeri I Batu dengan Metode Bermain dan Berlomba”. Permasalahannya yaitu bagaimana meningkatkan efektivitas pembelajaran lari jarak pendek di kelas VII G SMP Negeri I Batu dengan metode bermain dan berlomba. Populasi penelitian ini adalah siswa kelas VII G SMP Negeri I Batu. Penelitian ini termasuk jenis penelitian tindakan kelas. Penelitian tindakan kelas terdiri dari siklus-siklus yang saling berhubungan di mana pada tiap-tiap siklus terdiri dari tahap-tahapan; 1. Perencanaan, 2. Pelaksanaan, 3. Pengamatan (observasi), dan 4. Refleksi. Dalam penelitian ini menggunakan dua siklus. Pada siklus pertama terdiri dari dua pertemuan dan pada siklus kedua terdiri dari satu kali pertemuan. Dari hasil pembelajaran lari jarak pendek dengan metode bermain dan berlomba pada siklus I diketahui indikator teknik start jongkok Pada aba-aba “bersedia” sikap yang dilakukan dengan benar oleh siswa adalah sebanyak 21 siswa atau 56,8%. Pada aba-aba “siap” sikap yang benar adalah sebanyak 23 siswa atau 62,2%. Pada aba-aba “ya” sikap yang benar yang dilakukan oleh siswa adalah sebanyak 25 siswa atau 67,6%. Pada teknik berlari persentase gerakan benar adalah 86,5%. Sedangkan teknik memasuki garis finis persentase gerakan benar sebesar 81,1%. Pada siklus II indikator teknik start jongkok pada aba-aba “bersedia” sikap yang dilakukan dengan benar oleh siswa adalah sebanyak 29 siswa atau 78,4%. Pada aba-aba “siap” sikap yang benar adalah sebanyak 31 siswa atau 83,8%. Pada aba-aba “ya” sikap yang benar yang dilakukan oleh siswa adalah sebanyak 33 siswa atau 89,2%. Pada teknik berlari persentase gerakan benar adalah 94,6%. Sedangkan teknik memasuki garis finis persentase gerakan benar sebesar 89,2%.

Proses penerbitan akta kelahiran anak luar kawin di Dinas Kependudukan dan Pencatatan Sipil Kabupaten Jombang / Udia Wati

 

Kata kunci : Penerbitan akta, akta kelahiran, anak luar kawin, catatan sipil. Setiap kelahiran perlu memiliki bukti tertulis dan otentik karena dapat membuktikan identitas seseorang dengan pasti dan mempunyai kekuatan pembuktian yang sempurna. Asal-usul seseorang dapat dilihat pada akta kelahiran yang dikeluarkan oleh suatu lembaga yang berwenang untuk mengeluarkan akta tersebut yaitu Dinas pendaftaran penduduk dan catatan sipil. Di Jombang Tingkat pengetahuan masyarakat akan pentingnya akta kelahiran dirasa kurang menyeluruh, hal ini dibuktikan masih banyaknya masyarakat kabupaten Jombang melalui program dispensasi pelayanan pencatatan akta kelahiran ada yang belum mempunyai akta kelahiran baik akta kelahiran anak sah dan anak di luar kawin. Permasalahan yang dikaji adalam penelitian ini adalah (1). Apakah syarat-syarat yang dibutuhkan dalam dalam proses penerbitan akta kelahiran anak luar kawin? (2). Bagaimana proses pelayanan penerbitan akta kelahiran anak luar kawin di Dinas Kependudukan dan Pencatatan Sipil kabupaten Jombang? (3). Apakah hambatan yang muncul dalam proses penerbitan akta kelahiran anak luar kawin dan bagaimana cara penyelesaiannya? (4). Apakah fungsi akta kelahiran anak luar kawin bagi kehidupan orang yang bersangkutan?. Penelitian ini bertujuan untuk (1). Untuk mengetahui syarat apa saja yang dibutuhkan dalam penerbitan akta anak luar kawin (2). Untuk mengetahui pelayanan proses penerbitan akta kelahiran khusus di Dinas Kependudukan dan Pencatatan Sipil Kabupaten Jombang (3). Untuk mengetahui hambatan dan cara penyelesaian dalam proses penerbitan akta kelahiran anak luar kawin (4).Untuk mengetahui fungsi akta kelahiran anak luar kawin bagi kehidupan pribadi yang bersangkutan. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Lokasi dalam penelitian ini adalah Dinas Kependudukan dan Pencatatan Sipil Kota Jombang. Sumber data dalam penelitian ini adalah Ibu Sri Kuntari, Ibu Sri Winarsih, Ibu Tatik Sri Berdikariwati, Bapak Beny Iskandar, Bapak Bonasir, peristiwa dan dokumen. Teknik pengumpulan data menggunakan metode observasi, wawancara, dan dokumentasi. Prosedur analisis data menggunakan model interaktif Milles dan Huberman. Alat pengumpulan data dalam penelitian ini adalah wawancara, observasi dan dolumentasi. Data ini dikumpulkan dengan metode deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa akta kelahiran merupakan bukti otentik dan mempunyai kekuatan hukum yang pasti. Proses penerbitan akta kelahiran anak luar kawin sama seperti anak sah pada umunya. Hambatan dalam penerbitan akta kelahiran adalah kurangnya syarat dari pemohon sehingga dalam proses penerbitan akta mengalami sedikit kendala, cara penyelesaiannya adalah pemeriksaan berkas dari pemohon lebih teliti sehingga penerbitan akta berjalan dengan lancar. Temuan penelitian menunjukkan bahwa (1) Syarat-syarat yang dibutuhkan dalam pengurusan akta kelahiran anak luar kawin itu sama saja dengan persyaratan anak sah, yang membedakan adalah dalam syarat anak luar kawin pemohon tidak melampirkan akta nikah melainkan surat keterangan dari desa bahwa pemohon (ibu) tidak pernah menikah sewaktu melahirkan. (2) Proses Pelayanan penerbitan akta kelahirana anak luar kawin perlu meningkatkan upaya sosialisasi pencatatan kelahiran secara menyeluruh melalui program “Jemput Bola”. (3) Hambatan yang muncul dalam pengurusan akta kelahiran anak luar kawin sejauh ini tidak mengalami hambatan yang sangat rumit, akan tetapi masalah yang menjadi hambatan yang paling sering adalah kurangya syarat-syarat yang diajukan oleh pemohon, cara mengatasi agar tidak terjadi kekeliruan dalam proses penerbitan akta kelahiran, maka perlu sebelum ada penerbitan akta tersebut dilakukan pengecekan sekali lagi kelengkapan berkas atau syarat-syarat dari pemohon sebelum akta kelahiaran dientrimoleh petugas. (4) fungsi akta kelahiran anak luar kawin sama halnya dengan funngsi akta kelahiran secara umum, diantaranya adalah sebagai syarat masuk sekolah dasar sampai perguruan tinggi, membuat KTP, SIM, Paspor, mengurus warisan, mengurus lamaran kerja.dll. Berdasarkan penelitian ini disarankan Dinas Kependudukan dan Pencatatan Sipil kabupaten Jombang secara berskala perlu mengadakan penyuluhan untuk meningkatkan kesadaran masyarakat mengenai arti pentingnya akta kelahiran. Mengingat akta kelahiran merupakan bukti yang otentik dalam pembuktian, maka setiap masyarakat wajib mendaftarkan atau mencatatkan setiap peristiwa di Dinas Kependudukan dan Pencatatan Sipil kabupaten Jombang. Kemudian Dinas Kependudukan dan Pencatatan Sipil kabupaten Jombang harus lebih aktif dalam meningkatkan pelayanan yang lebih prima kepada masyarakat, perlu ditunjang dengan alokasi pelayanan yang tidak lambat dan efisien sehingga jelas tepat waktunya sesuai alur sistem yang sudah ada.

Hubungan persepsi siswa tentang kompetensi guru bidang studi teknik mekanik otomotif dengan motivasi belajar siswa di SMK Ma'arif Batu / Twin Satriyanto

 

Kata kunci: persepsi siswa, kompetensi guru, motivasi siswa. Dalam proses pembelajaran terdapat interaksi antara guru dan siswa. Dalam keadaan demikian tidak dapat dipungkiri kompetensi guru turut memberi andil dalam mempengaruhi kelancaran proses pembelajaran. Pengajaran dari guru adalah bagian dari konteks pembelajaran yang merupakan pengalaman pertama yang dihadapi oleh siswa dalam seluruh rangkaian pembelajaran di sekolah, siswa memaknai pengalaman ini melalui proses persepsi dan hasil persepsi mempengaruhi aktivitas mental selanjutnya. Aktivitas mental yang terpengaruh salah satunya adalah motivasi belajar siswa. Persepsi siswa terhadap guru antara lain persepsi tentang kompetensi guru dalam proses pembelajaran. Tujuan penelitian ini adalah untuk mengetahui adanya hubungan antara persepsi siswa tentang kompetensi guru bidang studi teknik mekanik otomotif yang meliputi kompetensi kepribadian, kompetensi pedagogik, kompetensi professional, dan kompetensi sosial terhadap motivasi belajar siswa SMK Ma’arif Batu. Penelitian ini dirancang menggunakan deskriptif korelasional yang dilakukan pada siswa kelas X dan XII Program Keahlian Teknik Mekanik Otomotif SMK Ma’arif Batu dengan jumlah populasi 64 siswa. Penelitian ini menggunakan angket dan observasi sebagai alat pengumpul data. Kesimpulan penelitian diperoleh ada hubungan positif yang signifikan antara persepsi siswa tentang kompetensi guru dengan motivasi belajar siswa di SMK Ma’arif Batu dengan nilai Fhitung sebesar 41,222 dan signifikansi 0,000 (0,000<0,05) serta dengan sumbangan efektif sebesar 73,68%. Saran yang diajukan berkaitan dengan motivasi belajar siswa Teknik Mekanik Otomotif adalah dengan meningkatkan kompetensi yang dimiliki seorang guru khususnya kompetensi yang wajib dimiliki oleh seorang guru sehingga siswa mampu meningkatkan motivasi belajar secara maksimal.

Meningkatkan kemenarikan pembelajaran lari estafet menggunakan metode pembelajaran kooperatif model TGT untuk siswa kelas IV SD Muhammadiyah 04 Batu / Indraswari Amelia

 

Kata Kunci: Kemenarikan Pembelajaran, Lari Estafet, Kooperatif Model TGT Olahraga atletik diajarkan mulai jenjang SD/MI hingga jenjang SMA/MA. Lari estafet merupakan salah satu cabang atletik yang diajarkan di SD Muhammadiyah 04 kota batu khususnya pada siswa kelas IV diharapkan dalam pembelajaran ini siswa bisa ikut berperan aktif dalam pembelajaran tetapi dalam kenyataan yang ada di lapangan ditemui fakta bahwa siswa tidak senang dan kurang aktif dalam pelaksanaan pembelajaran lari estafet . Penelitian ini bertujuan untuk mengetahui peningkatan kemenarikan pembelajaran lari estafet setelah mengunakan pendekatan pembelajaran kooperatif model TGT. Instrumen yang digunakan dalam penelitian ini adalah tes, lembar observasi, dokumentasi dan catatan lapangan. Rancangan penelitian yang digunakan dalam penelitian ini adalah penelitian tindakan kelas (PTK). Melalui PTK ini dilaksanakan pembelajaran lari estafet mengunakan pendekatan kooperatif model TGT. Melalui pembelajaran kooperatif model TGT ini, siswa melakukan lari estafet dalam bentuk permaianan dan perlombaan dalam melaksanakan pembelajaran. Hal ini penting mengingat tidak semua siswa menyenangi olahraga lari estafet. Dalam penelitian ini, peneliti berkolaborasi dengan guru merencanakan tindakan pembelajaran yang berlangsung selama 3 siklus. Hasil penelitian menunjukan bahwa kemenarikan pembelajaran mengunakan pendekatan kooperatif model TGT pada siswa kelas IV SD Muhammadiyah 04 Kota Batu mengalami peningkatan. Hasil tindakan siklus 1 dari perhatian dalam pembelajaran sebesar 47,02%, 2) senang dalam pembelajaran sebesar 51,92%, 3) motivasi dalam pembelajaran 53,84%, 4) keinginan lebih lama untuk belajar sebesar 49,03%. Hasil tindakan siklus 2 dari perhatian dalam pembelajaran sebesar 63,45%, 2) senang dalam pembelajaran sebesar 65,38%, 3) motivasi dalam pembelajaran 69,22%, 4) keinginan lebih lama untuk belajar sebesar 72,11%.. Hasil tindakan siklus 3 dari perhatian dalam pembelajaran sebesar 89,42%, 2) senang dalam pembelajaran sebesar 88,45%, 3) motivasi dalam pembelajaran 86,53%, 4) keinginan lebih lama untuk belajar sebesar 92,30%. Berdasarkan hasil penelitian dapat disimpulkan bahwa Pembelajaran Lari Estafet Dengan Pendekatan Kooperatif Model TGT dapat Meningkatkan Kemenarikan Pembelajaran Siswa Kelas IV SD Muhammadiyah 04 Kota Batu.

Pelaksanaan pembelajaran model STAD untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran melakukan prosedur administrasi (Studi kasus siswa kelas X APK SMK Wisnuwardhana Malang) / Erna Fitria Novianti H.W

 

Kata Kunci: Pembelajaran Model STAD, Aktivitas Belajar, Hasil Belajar. Permasalahan yang melatari penelitian ini adalah bahwa metode pengajaran yang digunakan oleh guru mata pelajaran Melakukan Prosedur Administrasi di SMK Wisnuwardhana Malang masih menggunakan metode konvensional sehingga peran aktif siswa dalam proses pembelajaran sangat kurang. Masalah ini membuat hasil belajar siswa menjadi kurang maksimal. Salah satu strategi yang dapat memberikan peran aktif siswa dalam proses belajar adalah menerapkan pembelajaran model STAD agar dapat melatih siswa dalam mengembangkan kemampuan berpikir, meningkatkan aktivitas belajar siswa, dan melatih kerjasama di dalam kelompok. Tujuan penelitian ini adalah, untuk mendeskripsikan penerapan pembelajaran model STAD, untuk mengetahui pembelajaran model STAD dapat meningkatkan aktivitas dan hasil belajar siswa, untuk mengetahui hambatan sekaligus solusi dalam pelaksanaan pembelajaran model STAD di kelas X APK SMK Wisnuwardhana Malang. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif yang berusaha mengungkapkan penerapan pembelajaran model STAD dapat meningkatkan aktivitas dan hasil belajar siswa secara menyeluruh yang menghasilkan data deskriptif. Data penelitian dikumpulkan melalui observasi, wawancara, tes, angket, catatan lapangan, dan dokumentasi. Subyek penelitian adalah siswa kelas X APK SMK Wisnuwardhana Malang yang berjumlah 35 siswa. Analisis data dalam penelitian ini dilakukan melalui tiga tahap, yaitu: 1)Reduksi data, 2)Penyajian data, dan 3)Penyimpulan hasil analisis. Hasil penelitian ini menunjukkan bahwa penerapan pembelajaran model STAD dapat meningkatkan aktivitas dan hasil belajar siswa. Hal ini berdasarkan pada siklus I prosentase aktivitas belajar siswa adalah 74,09% dan mengalami peningkatan sebesar 9,14% menjadi 83,23% pada siklus II. Perbandingan rata-rata nilai awal siswa dengan rata-rata nilai post test 1 adalah 10,27 dari yang semula 53,17 menjadi 63,44 hal ini terus meningkat pada nilai rata-rata post test 2 yaitu dari rata-rata nilai awal 53,17 menjadi 75,14 pada post test 2. Aspek psikomotor pada siklus I rata-rata nilai siswa sebesar 90,71 mengalami peningkatan sebesar 7,14 menjadi 97,85 pada siklus II. Berdasarkan hasil penelitian ini saran yang bisa diberikan adalah pembelajaran model STAD perlu diterapkan dalam proses pembelajaran Melakukan Prosedur Administrasi untuk meningkatkan aktivitas dan hasil belajar siswa. Bagi siswa SMK biasakan memahami makna suatu materi bukan hafalan, biasakan mengeksplorasi pemahaman yang dimiliki sebelum bertanya kepada guru. Untuk penelitian selanjutnya hendaknya model ini dikembangkan lagi, tidak hanya dalam pelajaran Melakukan Prosedur Administrasi tetapi juga pada mata pelajaran yang lain.

Peningkatan kemampuan menulis puisi dengan pemanfaatan lingkungan di kelas V SDN Ngadirejo 2 Kec. Tutur Kabupaten Pasuruan / Eis Saptaningsih

 

Kata Kunci: menulis, puisi, lingkungan Pembelajaran di sekolah-sekolah masih banyak yang menggunakan pembelajaran konvensional sehingga siswa belum terlibat secara aktif dalam proses pembelajaran. Pada kenyataannya pembelajaran di SDN Ngadirejo II masih didominasi guru dengan metode ceramah, akibatnya aktivitas dan hasil belajar tidak sesuai dengan tujuan yang diharapkan. Untuk itu diperlukan pendekatan pembelajaran yang memfokuskan pada keterlibatan siswa secara aktif dalam proses menulis. Salah satu alternatif yaitu pemanfaatan lingkungan sekolah dan Adapun tujuan penelitian ini adalah untuk mendeskripsikan 1) perencanaan pembelajaran menulis puisi dengan pemanfaatan lingkungan, 2) implementasi pembelajaran penulisan puisi dengan pemanfaatan lingkungan, dan 3) peningkatan kemampuan menulis puisi dengan pemanfaatan lingkungan di Kelas V SDN. Ngadirejo II. Penelitian ini menggunakan Rancangan Penelitian Tindakan Kelas yang dilaksanakan secara bersiklus. Setiap siklus terdiri dari tahap perencanaan, pelak-sanaan, observasi dan refleksi. Subyek penelitian ini siswa kelas V SDN Ngadi-rejo II Kecamatan Tutur Tahun Pelajaran 2011/2012, yang berjumlah 14 siswa. Data diperoleh melalui observasi, tes tulis, dan wawancara. Hasil penelitian menunjukkan bahwa dengan pemanfaatan lingkungan, aktivitas dan hasil belajar siswa meningkat. Hal ini dibuktikan dengan peningkatan kemampuan siswa dalam menulis puisi, dari 62,1% pra tindakan menjadi 72,8% pada siklus I kemudian meningkat pada siklus II menjadi 80%. Serta peningkatan partisipasi siswa dalam pembelajaran mulai dari pra kegiatan sampai siklus II. Sehingga dapat disimpulkan bahwa pembelajaran yang menggunakan lingkungan, dapat meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Ngadirejo II Kecamatan Tutur Pasuruan. Pembelajaran dengan pemanfaatan lingkungan ini membutuhkan waktu, perhatian, dan bimbingan guru yang lebih banyak. Karena memang pembelajaran ini sedikit menyulitkan bagi guru maupun siswa bila tidak direncanakan secara tepat. Untuk itu dalam penerapannya perlu diperhatikan penyusunan rencana pembelajaran dengan memperhatikan alokasi waktu secara cermat, tingkat kesulitan materi, dan tingkat perkembangan anak didik.

Validasi model pembelajaran dengan memanfaatkan museum sebagai media pembelajaran di TK Sriwedari / Tsabita Shabrina

 

Pengembangan CD interaktif pembelajaran biologi materi bakteri (KD 2.2) untuk siswa kelas X SMA/MA dengan pendekatan inkuiri / Fika Anugeraheni

 

Kata kunci: Pengembangan, CD interaktif, bakteri, kelas X SMA/MA, pendekatan inkuiri. Ilmu Pengetahuan Alam (IPA) merupakan ilmu pengetahuan yang berkaitan dengan cara mencari tahu (inquiry) tentang alam secara sistematis. Biologi merupakan ilmu yang mempelajari segala kehidupan, baik yang kasat mata maupun yang tidak kasat mata. Bakteri sebagai salah satu materi dalam biologi merupakan organisme prokariotik, uniseluler, bersifat heterotrof dan memiliki ukuran tubuh renik. Berdasarkan wawancara diketahui bahwa sifat abstrak pada bakteri disertai istilah-istilah asing yang membingungkan menjadi alasan bagi kebanyakan siswa merasa kesulitan dalam mempelajari materi bakteri. Agar materi bakteri lebih mudah dipahami, maka perlu adanya media yang dapat mengkomunikasikan materi tentang bakteri kepada siswa, oleh karena itu dilakukan penelitian berupa pengembangan CD interaktif untuk materi bakteri. Penelitian pengembangan ini menggunakan model the ASSURE dengan pendekatan inkuiri. Tahapan dalam model the ASSURE yaitu menganalisis pelajar, menyatakan tujuan, memilih metode; media; dan bahan, menggunakan media dan bahan, partisipasi pelajar dalam kelas, serta melakukan penilaian dan revisi. Hasil pengembangan diperoleh dua macam produk yaitu CD interaktif yang terdiri dari komponen-komponen seperti animasi, teks, audio, dan fasilitas berupa tombol-tombol navigasi, dan buku panduan guru sebagai acuan guru ketika menggunakan CD interaktif materi bakteri. CD interaktif dibuat dengan bantuan software Adobe Flash CS 5. Persentasi hasil validasi diperoleh rata-rata sebesar 87,09%, dan 87,01% dalam uji terbatas. Persentase ini menunjukkan bahwa media CD interaktif materi bakteri beserta panduan guru hasil pengembangan baik dari segi isi maupun tampilan dan kemudahan dalam penggunaan sudah layak dan dapat digunakan sebagai alat bantu dalam proses pembelajaran materi bakteri di sekolah. Uji terbatas pada siswa juga menunjukkan peningkatan nilai pasca tes dibandingkan nilai pra tes. Agar dapat mengetahui efektifitas CD interaktif, media hasil pengembangan ini perlu diimplementasikan dalam proses pembelajaran yang sebenarnya baik dalam skala kelas maupun pemanfatan secara mandiri oleh siswa.

Pola perubahan jumlah dan klasifikasi sunspot diamati dari laboratorium astronomi jurusan fisika FMIPA UM pada bulan Februari - April 2012 / Desy Hosenainy

 

Kata Kunci: Sunspot, Aktivitas Matahari, Klasifikasi Zurich Aktivitas matahari berulang rata – rata setiap 11 tahun sekali. Saat ini Matahari memasuki siklus 24 yang dimulai sejak Desember 2008. Siklus 24 diprediksi maksimum terjadi tahun 2013. Menurut kondisi perkembangan sunspot selama kala hidupnya dapat diklasifikasikan ke dalam kelas – kelas perkembangan Sunspot Zurich. Tujuan dari penelitian ini adalah mengetahui aktivitas dan klasifikasi sunspot di permukaan matahari yang diperoleh di Laboratorium Astronomi Fisika UM pada bulan Februari - April 2012 dengan melakukan observasi langsung. Metodologi yang digunakan dalam penelitian ini adalah deskriptif, yaitu memaparkan data yang diperoleh dari hasil pengamatan. Penelitian ini dilakukan di Laboratorium Astronomi Fisika UM dengan menggunakan Teleskop Celestron. Hasil penelitian menunjukkan perbandingkan nilai 10g+f di Laboratorium Astronomi Fisika UM terhadap Kanzelhöhe Solar Observatory (KSO) yang berada di Universitas Karl Franzen, Graz, Austria didapatkan sebesar 1,154 yang merupakan faktor koreksi Laboratorium Astronomi Fisika UM terhadap Kanzelhöhe Solar Observatory (KSO). Aktivitas Matahari tertinggi yang diamati pada bulan Februari – April 2012 terjadi pada bulan Maret 2012 dengan bilangan sunspot sebesar 76,74. Sedangkan Pola perubahan grup sunspot tidak menunjukkan adanya pola perubahan tertentu. Selama perkembangan grup sunspot memperlihatkan perubahan – perubahan struktur atau fisik grup baik kelas grup, jumlah bintik maupun panjang grup. Penelitian terhadap jumlah dan klasifikasi sunspot tiap bulannya harus terus dilakukan, mengingat perubahan yang terus meningkat pada tahun 2012 dan diprediksi puncak aktivitas matahari berada pada tahun 2013.

Peningkatan kemampuan motorik kasar anak melalui tari kupu-kupu pada kelompok B di TK Pratiwi Pesudukuh Bagor Nganjuk / Eka Wijiastutik

 

Pemetaan resistivitas dengan metode geolistrik flashres 64 61-channel untuk mengidentifikasi deposit bijih emas, titanium dan kalium di Desa Sukorejo Kecamatan Kalidawir Kabupaten Tulungagung / Yunita Agustin

 

Kata kunci: Geolistrik, Deposit , FlashRES64 61-Channel. Batuan sebagai sumber mineral yang berharga merupakan sumber daya alam yang banyak dibutuhkan dan digunakan untuk kehidupan manusia. Desa Sukorejo, Kecamatan Kalidawir, Kabupaten Tulungagung masih belum memiliki informasi secara detail mengenai potensi deposit sumber daya mineral yang dimiliki. Penelitian ini bertujuan untuk memprediksi besar deposit dan pola sebaran bijih Emas, Titanium dan Kalium. Hasil uji laboratorium menggunakan XRF menunjukkan bahwa pada lapisan atas di daerah tersebut mengandung bijih Emas (Au) 0,22%, Titanium (Ti) 3,0% dan Kalium (K) 10%. Untuk itu perlu dilakukan penelitian untuk mengungkap besar deposit yang ada di daerah tersebut. Penelitian dilakukan dengan survei lapangan, penentuan line elektroda, pemasangan elektroda, mengalirkan arus melalui elektroda, akuisisi data dengan ZZ Resistivity, pengolahan data dengan software Surfer 9.0, dan prediksi deposit. Jarak line elektroda adalah 11 meter dan jarak spasi elektroda adalah 10 meter dengan kedalaman 100 meter. Dari hasil penelitian, diprediksi volume batuan mineral yang mengandung bijih Emas (Au), Titanium (Ti), dan Kalium (K) adalah 36.575 m3. Tetapi tidak menutup kemungkinan mencapai 419.650 m3.

Penerapan pembelajaran kooperatif model group investigation (GI) untuk meningkatkan hasil belajar teknologi informasi dan komunikasi (TIK) siswa kelas X SMA Negeri 4 Blitar / Resa Subhan Effendy

 

Kata kunci: pembelajaran kooperatif, model Group Investigation (GI), hasil belajar. Salah satu permasalahan yang terjadi selama pelaksanaan pembelajaran Teknologi Informasi dan Komunikasi (TIK) di kelas X SMA Negeri 4 Blitar adalah rendahnya hasil belajar siswa. Dari hasil belajar pra tindakan diketahui bahwa hanya 12 siswa (40%) yang memenuhi SKM, sedangkan 18 siswa (60%) belum memenuhi, dengan rata-rata hasil belajar pra tindakan sebesar 69. Rendahnya hasil belajar ini dikarenakan guru masih menggunakan metode pembelajaran tradisional dan bersifat teacher oriented seperti ceramah. Akibatnya aktivitas dan keterlibatan siswa dalam belajar menjadi berkurang karena guru mendominasi kegiatan pembelajaran. Untuk itu perlu diterapkan model pembelajaran yang banyak melibatkan aktivitas siswa dalam belajar, salah satunya pembelajaran kooperatif model Group Investigation (GI). Tahap-tahap penerapannya yaitu: 1) pengelompokan, 2) perencanaan, 3) penyelidikan, 4) pengorganisasian, 5) presentasi, dan 6) evaluasi. Rancangan penelitian ini sendiri menggunakan Penelitian Tindakan Kelas (PTK) yang dilaksanakan selama dua siklus. Dimana pada setiap siklusnya terdiri dari 4 tahapan meliputi: 1) perencanaan, 2) pelaksanaan, 3) observasi, dan 4) refleksi. Data dalam penelitian diperoleh dari tes hasil belajar, lembar observasi, catatan lapangan, dan dokumentasi. Data ini kemudian dianalisis dan diolah untuk mengetahui peningkatan hasil belajar siswa. Hasil penerapan model pembelajaran Group Investigation (GI) pada siklus I menunjukkan bahwa rata-rata hasil belajar siswa adalah 72,5. Sebanyak 17 siswa (56,6%) sudah memenuhi SKM, sedangkan 13 siswa (43,4%) belum memenuhi SKM. Besarnya peningkatan rata-rata hasil belajar siklus I jika dibandingkan dengan hasil belajar pra tindakan sebesar 4%. Pada siklus II rata-rata hasil belajar siswa meningkat menjadi 79 dengan keterangan 24 siswa (80%) memenuhi SKM, sedangkan 6 siswa (20%) belum memenuhi SKM. Besarnya peningkatan rata-rata hasil belajar pada siklus II sebesar 8,9%. Berdasarkan hasil penelitian dapat disimpulkan bahwa penerapan model Group Investigation (GI) dapat meningkatkan hasil belajar Teknologi Informasi dan Komunikasi (TIK). Beberapa saran yang dapat disampaikan yaitu: 1) penerapan model Group Investigation (GI) dapat digunakan sebagai referensi sekaligus pertimbangan dalam pemanfaatan model pembelajaran untuk mencapai tujuan pembelajaran di sekolah, 2) guru perlu melakukan persiapan yang matang, rajin memberikan motivasi, dan semangat kepada siswa agar penerapan pembelajaran kooperatif model Group Investigation (GI) dapat berjalan sesuai dengan perencanaan.

Penerapan demokrasi di lingkungan siswa SMP Negeri 17 Malang / Ahmad Sanusi

 

Kata kunci: Penerapan Demokrasi, Lingkungan Siswa Demokrasi adalah pemerintahan dari, oleh dan untuk rakyat. Tetapi dalam penerapannya dari Indonesia merdeka hingga sekarang selalu ada penyimpangan pada setiap rezim pemerintah yang pernah berkuasa di negeri ini. Angin segar sempat menginggapi penerapan demokrasi di Indonesia ketika runtuhnya rezim otoriter Orde Baru pada tahun 1998. Namun penerapan demokrasi pada zaman reformasi ini di nilai menyimpang. Agar pemahaman terhadap demokrasi tidak menyimpang maka perlu dilakukan pendidikan demokrasi. Lebih khusus, agar pemahaman siswa terhadap demokrasi tidak menyimpang maka pendidikan demokrasi perlu dilakukan. Sekolah merupakan tempat yang tepat untuk melakukan pendidikan demokrasi, oleh karena itu SMP Negeri 17 Malang sebagai lembaga pendidikan juga melakukan pendidikan tentang penerapan demokrasi. dengan melakukan pendidikan penerapan demokrasi diharapkan siswa-siswi SMP Negeri 17 Malang dapat memahami penerapan demokrasi dengan baik. Penelitian ini bertujuan untuk (1) mendeskripsikan latar belakang penerapan demokrasi di lingkungan siswa SMP Negeri 17 Malang, yang mencakup tujuan penerapan demokrasi di lingkungan siswa SMP Negeri 17 Malang; (2) mendeskripsikan wujud nyata penerapan demokrasi di lingkungan SMP Negeri 17 Malang; (3) mendeskripsikan tata cara penerapan demokrasi di lingkungan siswa SMP Negeri 17 Malang; (4) mendeskripsikan faktor penghambat penerapan demokrasi di lingkungan siswa SMP Negeri 17 Malang; (5) mendeskripsikan upaya untuk mengatasi faktor penghambat penerapan demokrasi di lingkungan SMP Negeri 17 Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Data penelitian yang berupa dokumentasi dan hasil wawancara dengan beberapa informan kunci seperti peserta didik, kepala SMP Negeri 17 Malang, guru pengajar, dan guru Pembina OSIS. Pengumpulan data dilakukan dengan menggunakan teknik wawancara, observasi dan dokumentasi. Berdasarkan hasil penelitian ini dihasilkan kesimpulan sebagai berikut: (1) latar belakang penerapan demokrasi di lingkungan siswa SMP Negeri 17 Malang adalah mengacu apa yang telah diamanatkan oleh pancasila sila keempat yang berbunyi “kerakyatan yang dipimpin oleh hikmat kebijaksanaan dalam permusyawaratan/perwakilan” dan pembukaan UUD 1945 alinea pertama hingga alinea keempat. (2) Wujud nyata penerapan demokrasi di lingkungan siswa SMPN 17 Malang adalah dengan adanya pemilihan OSIS, melakukan musyawarah untuk memperoleh kata mufakat serta memberi kebebasan kepada siswa-siswi untuk menyampaikan inspirasinya kepada guru dan kepala sekolah. (3) Tata cara penerapan demokrasi di lingkungan SMP Negeri 17 Malang adalah melaksanakan pemilihan OSIS dengan cara seperti pemilihan umum yang secara langsung dan semua siswa dapat memberikan hak suaranya untuk memilih dan dipilih serta melakukan kampenye bagi calon ketua OSIS. (4) Faktor penghambat penerapan demokrasi di lingkungan SMP Negeri 17 Malang pemahaman siswa-siswi terhadap materi demokrasi atau penerapan demokrasi yang sangat rendah, selain siswa-siswi ketua OSIS nya saja juga tidak paham tentang penerapan demokrasi sehingga sangat menghambat penerapan demokrasi di lingkungan SMP Negeri 17 Malang. (5) Upaya untuk mengatasi faktor penghambat penerapan demokrasi di lingkungan SMP Negeri 17 Malang adalah Sering melakukan sosialisasi kepada siswa tentang penerapan demokrasi yang baik dan benar agar siswa paham dan tidak keliru dalam mengartikan demokrasi serta melakukan praktek-praktek yang berkaitan dengan penerapan demokrasi khususnya penerapan demokrasi disekolah. Berdasarkan hasil penelitian ini peneliti mengajukan beberapa saran diantaranya adalah: (1) Guru perlu meningkatkan motivasi agar siswa memiliki semangat untuk belajar,baik belajar tentang materi yang mengenai demokrasi maupun penerapan demokrasi. misalnya dengan cara memakai metode belajar belajar yang menyenangkan, dan sekolah memberikan fasilitas yang lebih memadai. (2) Guru pembina OSIS Lebih sering melakukan sosialisasi kepada siswa-siswi bagaimana cara berdemokrasi yang baik, misalnya dengan cara menempelkan tulisan-tulisan di mading sekolah tentang pentingnya penerapan demokrasi di sekolah.(3) Siswa harus lebih kreatif dalam memperoleh sumber dana sendiri agar tidak terlalu bergantung pada sekolah. Misalnya dengan cara mengelolah koperasi untuk menjual barang-barang keperluan siswa SMPN 17 Malang. (4) Sekolah Perlu menciptakan kondisi lingkungan sekolah yang kondusif agar siswa lebih nyaman dan tidak merasa takut untuk menyampaikan aspirasinya kepada guru, misalnya dengan mengembangkan sikap sopan santun sesama siswa maupun kepada guru (5) Sebagai tempat pendidikan bagi calon guru PKn perlu melakukan penambahan referensi buku-buku tentang demokrasi di perpustakaan jurusan HKn agar mempermudah bagi mahasiswa yang ingin mengembangkan ilmu khususnya tentang demokrasi, mengingat sangat pentingnya masalah penerapan demokrasi bagi calon pendidik atau bagi masyarakat umum.

Hubungan intensitas pengasuhan orang tua dengan perkembangan sosial-emosional anak usia dini di PAUD Nurusy Syamsi Tanggung Turen Malang / Ria Novita Ningsih

 

Kata Kunci: Intensitas Pengasuhan Orang Tua, Perkembangan Sosial Emosional, Anak Usia Dini. Intensitas pengasuhan orang tua merupakan bentuk interaksi pengasuhan secara langsung mulai dari perkembangan sosial emosional masing-masing anak yang sangatlah unik. Perkembangan sosial emosional anak timbul dari adanya rasa kasih sayang, marah, senang, iri hati, dan sebagainya. Penelitian ini bertujuan untuk mengetahui a) hubungan intensitas pengasuhan orang tua dengan perkembangan sosial emosional anak usia dini, b) hubungan intensitas pengasuhan orang tua dengan perkembangan sosial anak usia dini usia dini, c) hubungan intensitas pengasuhan orang tua dengan perkembangan emosional anak usia dini pada aspek amarah, d) hubungan intensitas pengasuhan orang tua dengan perkembangan emosional anak usia dini pada aspek takut, e) hubungan intensitas pengasuhan orang tua dengan perkembangan sosial emosional anak usia dini pada aspek ingin tahu, f) hubungan intensitas pengasuhan orang tua dengan perkembangan emosional anak usia dini pada aspek iri hati, g) hubungan intensitas pengasuhan orang tua dengan perkembangan emosional anak usia dini pada aspek gembira, h) hubungan intensitas pengasuhan orang tua dengan perkembangan emosional anak usia dini pada aspek sedih, i) hubungan intensitas pengasuhan orang tua dengan perkembangan emosional anak usia dini pada aspek kasih sayang. Penelitian ini menggunakan metode penelitian kuantitatif korelasional. Populasi dalam penelitian ini adalah orang tua warga belajar di PAUD Nurusy Syamsi yang berjumlah 125 orang dengan menggunakan teknik simple random sampling karena populasi dianggap homogen dan diperoleh sampel sebanyak 50 orang. Pengumpulan data menggunakan angket dan dokumentasi. Analisis data yang digunakan oleh peneliti adalah analisis deskriptif dan kualifikasi presentase. Hasil penelitian ini menunjukkan bahwa dari 50 responden intensitas pengasuhan orang tua termasuk kategori sangat baik sebesar 51,72%, perkembangan sosial anak usia dini termasuk kategori sangat baik sebesar 51,72%, perkembangan emosional anak usia dini dibagi menjadi tujuh aspek, pada aspek amarah termasuk kategori tdak baik sebesar 100%, pada aspek takut termasuk kategori tidak baik sebesar 100%, pada aspek ingin tahu termasuk kategori tidak baik sebesar 100%, pada aspek iri hati termasuk kategori tidak baik sebesar 100%, pada aspek gembira termasuk kategori tidak baik sebesar 100%, pada aspek sedih termasuk kategori tidak baik sebesar 100%, pada aspek kasih sayang termasuk kategori tidak baik sebesar 100%. Tetapi pada hasil korelasi menunjukkan adanya hubungan positif dan signifikan antara variabel X dan Y. Kesimpulan penelitian ini adalah ada hubungan yang positif dan signifikan antara intensitas pengasuhan dengan perkembangan sosial emosional anak usia dini di PAUD Nurusy Syamsi Tanggung Turen Malang. Dari hasil penelitian ini juga disarankan agar orang tua lebih mengembangkan intensitas pengasuhan yang diterapkan pada anak usia dini. Bagi jurusan PLS hendaknya lebih mengembangkan lagi parenting khususnya pada intensitas pengasuhan orang tua. Bagi peneliti lanjutan lebih difokuskan pada intensitas pengasuhan anak usia dini dengan perkembangan emosional anak usia dini.

Analisis isi buku teks ilmu pengetahuan sosial (IPS) kelas 4 SD terbitan pusat pembukuan Departemen Pendidikan Nasional / Dani Prasetiyo

 

Kata Kunci: analisis buku teks, Ilmu Pengetahuan Sosial SD Bahan ajar merupakan bahan pembelajaran yang digunakan untuk membantu siswa dalam belajar. Bahan ajar yang dimaksud, bisa berupa bahan tertulis maupun bahan tidak tertulis. Buku teks merupakan salah satu bahan ajar tertulis. Buku teks merupakan salah satu bagian yang tidak terpisahkan dalam kegiatan belajar mengajar, terlebih bagi guru yang yang belum mampu membuat bahan ajar sendiri berdasarkan kurikulum yang berlaku. Buku teks yang baik adalah buku teks yang isinya sesuai dengan kurikulum yang berlaku, karena memang buku teks pembuatannya mengacu pada kurikulum yang berlaku pada saat itu. Berdasarkan hasil kajian terhadap buku IPS kelas 4 terbitan Pusat Perbukuan Departemen Pendidikan Nasional karangan Irawan Sadad Sadiman dan Shendy Amalia pada pokok bahasan peta pada minggu ke-3 bulan Desember, ditemukan terdapat indikator yang belum muncul dalam buku teks tersebut. Indikator tersebut yaitu mendeskripsikan jenis-jenis peta, maka ketika siswa membaca buku tersebut pengetahuan yang didapat siswa tidak menyeluruh. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Penelitian deskriptif kualitatif dalam penelitian ini bermaksud untuk mengetahui presentase kesesuaian indikator yang termuat dalam kurikulum dengan materi yang terdapat dalam buku teks dan kesesuaian buku teks dilihat dari aspek kognitif yang meliputi adanya fakta, konsep, dan generalisasi. Tidak hanya itu, tetapi dilanjutkan dengan mendeskripsikan hasil analisis pada cakupan materi yang ada pada buku teks berdasarkan aspek afektif dan psikomotor, serta mendeskripsikan hasil analisis evaluasi pada buku teks berdasarkan aspek kognitif, afektif, dan psikomotor. Sampel dalam penelitian ini adalah buku teks IPS SD kelas 4 terbitan Pusat Perbukuan Departemen Pendidikan Nasional karangan Irawan Sadad Sadiman dan Shendy Amalia. Sampel pada penelitian ini diambil dengan cara sampel bertujuan (purposive sample). Berdasarkan hasil analisis terhadap buku teks terbitan Pusat Perbukuan Departemen Pendidikan Nasional karangan Irawan Sadad Sadiman dan Shendy Amalia diketahui kesesuaian cakupan yang terangkum dalam buku IPS SD tersebut berdasarkan kurikulum dapat diketahui sangat sesuai. Hal ini dapat dilihat dari hasil analisis Kompetensi Dasar 1.1 sampai Kompetensi Dasar 2.4 terdapat 53 materi pokok yang ingin dicapai. Materi pokok yang belum muncul ada 11 materi pokok atau 20,76%, dan yang telah muncul berjumlah 42 materi pokok atau 79,24%. Dalam analisis selanjutnya, diketahui kesesuaian cakupan yang terangkum dalam buku teks terbitan Pusat Perbukuan Departemen Pendidikan Nasional karangan Irawan Sadad Sadiman dan Shendy Amalia berdasarkan aspek kognitif yang berupa fakta, konsep, dan generalisasi dapat dikatakan cukup sesuai. Hal ini dapat dilihat dari hasil analisis terdapat 78 fakta, 103 konsep, dan 25 generalisasi yang seharusnya dicapai. Dari data tersebut fakta yang belum muncul ada 29 atau 37,18% dan yang telah muncul ada 49 atau 62,82%, konsep yang belum muncul ada 39 atau 37,86% dan yang telah muncul ada 64 atau 62,14%, dan generalisasi yang belum muncul ada 5 atau 20,00% dan yang telah muncul ada 20 atau 80,00%. Selanjutnya dalam analisis buku teks terbitan Pusat Perbukuan Departemen Pendidikan Nasional karangan Irawan Sadad Sadiman dan Shendy Amalia terhadap cakupan materi berdasarkan aspek afektif dan aspek psikomotor dapat dikatakan sangat kurang. Hal ini dapat dilihat dari 117 materi pelajaran yang ada pada buku tersebut hanya terdapat 20 materi pelajaran yang terdapat aspek afektif dan 97 materi pelajaran tidak terdapat aspek afektif. Sedangkan untuk aspek psikomotor, dari 117 materi pelajaran yang ada hanya terdapat pada 9 materi pelajaran dan 108 materi pelajaran tidak terdapat aspek psikomotor. Dalam analisis selanjutnya, diketahui soal evaluasi yang terdapat pada buku teks terbitan Pusat Perbukuan Departemen Pendidikan Nasional karangan Irawan Sadad Sadiman dan Shendy Amalia berdasarkan aspek kognitif, afektif, dan psikomotor sangat tidak sesuai. Hal ini dapat dilihat dari 310 butir soal evaluasi yang ada pada buku tersebut hanya berada pada aspek kognitif, sementara aspek afektif dan psikomotornya tidak muncul. Dari 310 butir soal kognitif tersebut, 290 butir soal masuk pada C1, 16 butir soal masuk pada C2, dan 4 butir soal masuk pada C3. Saran dalam penelitian ini yaitu, guru sebagai pengajar hendaknya lebih selektif dalam memilih bahan ajar, khususnya buku teks yang sesuai dengan kurikulum yang ada dan juga disesuaikan dengan karakteristik peserta didik, sehingga materi yang terangkum dalam buku teks dapat dengan mudah dipahami oleh siswa sehingga membantu dalam belajar, dan peneliti menyarankan agar peneliti lain dapat melakukan penelitian yang sejenis namun cakupan analisisnya bisa lebih banyak, misalnya dari aspek bahasa dan media dalam buku teks.

Kegiatan melukis kaca siswa kelas XI IPS 1 pada pembelajaran seni rupa semester 2 (genap) di SMA Negeri 2 Batu / Tiara Astriani

 

Kata Kunci: Melukis kaca, Siswa XI IPS, Pembelajaran Seni Rupa, SMA 2 Batu Kreatifitas siswa SMA yang berkembang memerlukan variasi kegiatan baru dalam pembelajaran seni budaya untuk menambah pengalaman baru bagi siswa. Variasi tersebut yaitu melu¬kis dengan media kaca. Tujuan penelitian ini ada¬lah untuk mengetahui proses pembela¬jar¬an lukis kaca di SMAN 2 Batu, hasil krea¬tifitas siswa, dan fak¬tor-faktor yang mempengaruhi proses pembelajarannya. Pene¬litian ini menggunakan pendekatan deskriptif kualitatif dengan melakukan obse¬rva¬si, wawancara, dokumentasi dan angket. Hasil penelitian menunjukkan bahwa pembelajaran melukis kaca pada sis¬wa kelas XI IPS I belum menunjukkan hasil yang maksimal. Hasil dari segi tema kom-posisi, variasi warna yang digunakan masih belum maksimal. Sela¬in itu minat siswa menurun saat melakukan proses pembelajaran. Siswa ma¬sih merasa kesulit¬an dalam men¬cari ide dan melakukan proses pembuatan sket gambar. Dalam pro¬ses pewarnaan, siswa hanya menggunakan bahan seadanya saja tanpa ada usaha un¬¬tuk menampilkan karya yang maksimal. Hal itu disebabkan ka¬rena da¬¬lam pem-belajaranya guru tidak menggunakan metode dan pendekatan yang te¬pat. Terdapat beberapa faktor yang mendukung proses pembelajaran lukis kaca diantaranya yaitu dari pihak sekolah dan orang tua yang mendu¬kung sepenuhnya proses pembe¬lajar¬an lukis kaca. Selain itu biaya yang digunakan ekonomis dan mudah menda¬patka alat dan bahan. Faktor penghambat dalam pembelajaran lukis kaca yaitu ke¬tidak¬siapan guru diantaranya RPP, metode dan pendekatan yang ku¬rang mendu¬kung, waktu dan sarana yang terbatas sehingga proses melukis kaca tidak bisa dikerjakan sepenuhnya disekolah. Dari hasil penelitian disarankan model pembe¬lajar¬an, metode dan pendekatan yang digunakan dalam pembelajaran dirancang secara mudah dan dapat dicerna oleh siswa. Isi materi pembelajaran sebaiknya mengikuti kurikulum yang berlaku. Pihak sekolah sendiri diharapkan mendukung proses pembelajaran seni dengan menyediakan ruang khusus untuk pembelajaran seni.

Cerita fiksi dalam buku teks Bahasa Indonesia SMP / Dini Pangestuning Tyas

 

Kata Kunci: cerita fiksi, buku teks bahasa Indonesia SMP. Buku teks yang baik hendaknya menarik dan sesuai dengan kemampuan penggunanya. Buku teks bahasa Indonesia terdapat teks sastra dan nonsastra. Teks yang diteliti dalam penelitian ini adalah teks sastra yang meliputi cerpen dan dongeng. Novel tidak diteliti karena dalam buku teks bahasa Indonesia SMP, novel berupa kutipan sehingga kurang tepat untuk diteliti. Penelitian ini bertujuan mendeskripsikan Cerita Fiksi dalam Buku Teks Bahasa Indonesia SMP. Jenis penelitian yang digunakan adalah penelitian kualitatif. Data penelitian ini adalah paparan kalimat yang berupa kutipan cerita. Sumber data penelitian ini adalah cerpen dan dongeng yang terdapat dalam buku teks bahasa Indonesia SMP kelas VII, VIII, dan IX. Teknik pengumpulan datanya menggunakan teknik dokumentasi. Instrumen yang digunakan berupa tabel pengumpul data dan untuk mengenali cerita fiksi, maka digunakan tabel identifikasi cerita. Tahapan analisis data (1) menganalisis tokoh utama, (2) menganalisis sudut pandang, (3) menganalisis penokohan tokoh, (4) menganalisis latar pada cerita, (5) menganalisis alur cerita, (6) menganalisis tema, dan (7) menganalisis kesesuaian cerita fiksi dengan penggunanya. Pengecekan keabsahan data pada penelitian ini dengan tiga cara, yaitu (1) ketekunan pengamatan, (2) kecukupan referensial, dan (3) diskusi kesejawatan. Berdasarkan hasil analisis data diketahui dan disimpulkan bahwa (1) tokoh utama dalam cerita fiksi sebagian besar adalah rakyat biasa dan penokohan dalam cerita fiksi sebagian besar menggunakan teknik dramatik, (2) latar cerpen dan dongeng ditemukan bahwa sebagian besar tempat yang digunakan dalam cerita fiksi tersebut adalah di rumah, (3) alur cerita fiksi dalam buku teks bahasa Indonesia SMP sebagian besar bersifat kronologis, (4) sudut pandang yang digunakan pengarang dalam cerita fiksi sebagian besar menggunakan sudut pandang orang ketiga, (5) tema yang ditemukan berupa tema sosial dan egoik, (6) kesesuaian cerita fiksi dalam buku teks bahasa Indonesia SMP dengan aspek psikologi siswa SMP dan latar, sebagian besar sesuai dengan keadaan sekarang. Dari kesimpulan hasil penelitian dapat dikemukakan beberapa saran, yaitu (1) siswa dianjurkan untuk lebih meningkatkan kegemaran membaca karya sastra karena melalui karya sastra, wawasan pengetahuan bisa bertambah luas, (2) guru agar memanfaatkan hasil penelitian ini untuk mengetahui dan memahami karakteristik cerita fiksi dalam buku teks bahasa Indonesia SMP serta dapat memilih teks sastra yang sesuai untuk siswa, dan (3) peneliti selanjutnya agar dapat memanfaatkan penelitian ini sebagai masukan untuk penelitian selanjutnya yang berhubungan dengan cerita fiksi dalam buku teks bahasa Indonesia.

Pelaksanaan pembelajaran ekstrakurikuler melukis di SD Muhammadiyah 1 Malang / Yulistine Dwi Susanti

 

Kata Kunci : Ekstrakurikuler , Melukis, SD (Sekolah Dasar) Ekstrakurikuler merupakan kegiatan yang dilakukan diluar jam kurikuler, yang ditujukan agar siswa dapat mengembangkan kepribadian, bakat, dan kemampuannya di berbagai bidang di luar akademik. Sehingga dalam pelaksanaannya harus disesuaikan dengan bakat dan kemampuan yang dimiliki siswa tersebut. SD Muhammadiyah 1 Malang adalah salah satu sekolah dasar di Malang yang menyediakan beragam kegiatan ektrakurikuler, termasuk kegiatan ekstrakurikuler melukis. Pelaksanaannya merupakan kegiatan wajib yang diikuti oleh siswa kelas 1 dan kelas 2. Sekolah menyediakan fasilitas menunjang untuk kegiatan ekstrakurikuler ini, misalnya krayon dan buku gambar yang diberikan kepada masing-masing siswa. Pelaksanaannya dibimbing oleh pengajar dari LKM (Lembaga Kesenian Malang). Siswa diajarkan untuk mewarnai menggunakan krayon dengan metode pemberian pola. Penelitian ini dilaksanakan untuk mendeskripsikan beberapa hal yang berkaitan dengan pelaksanaan ekstrakurikuler melukis di SD Muhammadiyah I Malang yang berfokus pada bagaimana pengelolaan kegiatan ekstrakurikuler melukis dan bagaimana pelaksanaan kegiatan pembelajaran ekstrakurikuler melukis serta bagaimana hasil karya siswa peserta ekstrakurikuler melukis di SD Muhammadiyah I Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Pengumpulan data dilakukan dengan cara menggunakan teknik wawancara, observasi dan dokumentasi. Untuk menjaga keabsahan data, dilakukan kegiatan triangulasi data. Analisis data dimulai dari tahap reduksi data, sajian data, dan tahap penarikan kesimpulan dan verifikasi. Berdasarkan hasil analisis data tersebut didapatkan beberapa kesimpulan hasil penelitian sebagai berikut: (1) mengenai pengelolaan kegiatan ekstrakurikuler melukis, sekolah belum mengalami kendala selama 3 tahun ekstrakurikuler melukis diadakan, hingga saat ini belum tampak hasil atau prestasi yang menonjol yang ditunjukkan oleh siswa peserta ekstrakurikuler melukis; (2) Pelaksanaan ekstrakurikuler melukis di SD Muhammadiyah I Malang merupakan kegiatan yang menekankan kegiatan mewarnai dengan menggunakan metode pemberian pola, bukan merupakan kegiatan menggambar bebas ataupun melukis. Minat sangat berpengaruh dalam kegiatan pembelajaran, kaitannya dengan kegiatan pembelajaran ekstrakurikuler melukis guru kesulitan mengarahkan dan menertibkan siswa, siswa cenderung menunjukkan sikap kurang perhatian pada pembelajaran, memberontak, bermain-main, enggan atau hanya diam saja dan mengerjakan tugas dari guru, sehingga tujuan pembelajaran sulit dicapai; (3) karya siswa dalam satu kelas cenderung menghasilkan karya yang memiliki kemiripan.

Perilaku seks dan kehamilan pranikah remaja (studi fenomenologi) / Diah Megawati

 

Kata Kunci: perilaku seks, kehamilan pranikah remaja, fenomenologis Masa remaja merupakan masa untuk mencari jati diri. Remaja yang sedang dalam masa pubertas atau yang akan memasuki masa puber lebih dipengaruhi oleh libido atau kematangan seksual yang sedang memuncak. Karakteristik remaja yang sedang berproses untuk mencari identitas diri juga sering menimbulkan masalah pada diri remaja. Bagi sebagian remaja, seks pranikah dianggap suatu hal yang wajar seiring dengan perubahan zaman saat ini, sehingga dipersepsikan sebagai gaya hidup yang dapat dikonsumsi oleh siapa pun. Bagi mereka yang awalnya hanya mencoba-coba melakukan hubungan atau kontak seksual, cenderung ketagihan dan akan melakukan lagi, sebab mereka telah mendapatkan kenikmatan dari hubungan terlarang ini. Hal yang paling menonjol dan nyata dari kasus ini adalah meningkatnya angka kehamilan pranikah yang tidak diinginkan oleh pasangan remaja yang pernah melakukan hubungan seksual. Penelitian ini bertujuan untuk mengetahui secara jelas dan rinci mengenai fenomena di lapangan tentang: (1) pemaknaan perilaku seks pranikah bagi remaja, dan (2) pemaknaan kehamilan pranikah bagi remaja. Fenomena atau kasus tersebut akhir-akhir ini marak terjadi pada kehidupan remaja. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif. Rancangan atau desain penelitian yang digunakan oleh peneliti adalah desain penelitian fenomenologis. Pendekatan kualitatif dipilih oleh peneliti untuk memperoleh data mengenai fenomena remaja yang terkait dengan pemaknaan perilaku seks pranikah bagi remaja dan pemaknaan kehamilan pranikah bagi remaja. Sumber data penelitian terdiri dari tiga informan yaitu subyek penelitian sebagai sumber primer, saudara kandung laki-laki subyek penelitian sebagai sumber sekunder, dan teman subyek penelitian sebagai sumber tersier. Sumber data dalam penelitian kualitatif ini menggunakan teknik bola salju (snowball sampling). Pengumpulan data dilakukan dengan menggunakan wawancara, observasi, dan catatan lapangan. Subyek penelitian dalam kasus ini bernama Mawar. Berdasarkan penelitian yang telah dilakukan oleh peneliti terhadap Mawar, diperoleh hasil penelitian bahwa kegiatan subyek penelitian pada kesehariannya sering nongkrong dengan pacar dan teman-temannya di alun-alun, berboncengan, dan makan ramai-ramai. Subyek penelitian menyukai kehidupan atau pergaulan yang bebas sehingga dia cenderung mudah terpengaruh oleh ajakan pacar atau teman-temannya. Sedangkan di rumah, orang tua memberikan kebebasan bergaul dengan semua orang kepada subyek penelitian. Orang tua juga tidak menanamkan aturan-aturan yang berlaku di rumah yang dapat membuat pergaulan subyek penelitian menjadi terkontrol. Orang tua kurang perhatian kepada subyek penelitian sehingga membuat dia akhirnya terjerumus ke dalam dunia seks pranikah, bahkan sampai mengalami kehamilan pranikah. Perilaku seksual subyek penelitian berawal dari ciuman yang dilakukan setiap kali bertemu dengan pacar. Hal ini membuat subyek penelitian menjadi terdorong untuk mempraktikkan hubungan seksual pranikah. Selain itu, adanya kesempatan juga turut menjadi faktor pendukung bagi subyek penelitian dan pacarnya dalam melancarkan aksi ini. Sekedar mencoba-coba mempraktikkan, subyek penelitian akhirnya menjadi ketagihan untuk berhubungan badan. Perilaku seks pranikah dimaknai oleh subyek penelitian sebagai wujud rasa cinta kepada pacarnya. Perilaku seks pranikah ini dilakukan atas dasar suka sama suka, sehingga tidak ada unsur paksaan, agar dapat menimbulkan kenikmatan ketika berhubungan badan. Subyek penelitian pernah melakukan making love dengan dua orang laki-laki lain yang berbeda, di waktu yang berbeda pula. Kehamilan pranikah sudah dua kali menimpa subyek penelitian. Subyek penelitian menyesal, takut, dan bingung, sampai membuat subyek penelitian pasrah dengan kehamilan yang menimpa dirinya. Sebab, dia hanya menginginkan adanya tanggung jawab atas janin yang dikandungnya.Kehamilan pranikah yang dialami oleh subyek penelitian dimaknai sebagai ujian hidup yang harus dia terima dan harus dijalani. Berdasarkan temuan penelitian di atas, maka disarankan kepada para remaja agar lebih berhati-hati dalam bergaul. Remaja sebaiknya dapat selektif dalam memilih dan memilah teman. Kepada para orang tua, diharapkan agar orang tua dapat menerapkan aturan yang berlaku di rumah. Aturan ini dapat dijadikan sebagai bentuk kepedulian dan kontrol perilaku terhadap pergaulan anak. Untuk konselor, agar lebih intensif dalam memberikan layanan informasi tentang pendidikan seksualitas yang benar kepada siswa. Upaya pemahaman, pencegahan, dan perbaikan dapat menyelamatkan siswa dari pergaulan yang semakin bebas dan kurang kontrol. Agar lebih menarik, konselor dapat mengemas materi seksualitas dalam bentuk media, misalnya saja menggunakan media buku saku. Selain itu, antara konselor dan pihak sekolah dapat bekerja sama dengan pihak lain dalam rangka menyelenggarakan seminar atau workshop kepada siswa tentang pendidikan seksualitas.

Problematika pembelajaran menulis karangan kelas IV sekolah dasar di gugus 4 Kec. Turen Kab. Malang / Kartika Sari Romadhani

 

Kata Kunci : Problematika, Pembelajaran menulis karangan Menulis pada dasarnya merupakan suatu keterampilan berbahasa berupa kegiatan produktif dan ekspresif yang membutuhkan kesabaran, keuletan, dan kejelian tersendiri. Dibandingkan dengan keterampilan menyimak, membaca, dan berbicara, ketermpilan menulis siswa sekolah dasar masih rendah. Diantaranya kendala yang membuat pembelajaran mengarang menjenuhkan adalah kurangnya keterampilan guru dalam menggunakan berbagai model pembelajaran, kurangnya pemahaman guru terhadap materi mengarang. Akibatnya pembelajaran mengarang menjadi kegiatan yang menjenuhkan. Tujuan dari penelitian ini antaralain: pertama mengetahui persepsi guru terhadap materi sajian mengarang, kedua mendeskripsikan persepsi guru terhadap perencanaan pembelajaran, ketiga mengetahui persepsi guru terhadap pelaksanaan pembelajaran, keempat mengetaui sejauh mana persepsi siswa terhadap materi sajian mengarang, serta kelima mendeskripsikan persepsi siswa terhadap pelaksanaan pembelajaran mengarang. Metode yang digunakan dalam penelitian ini adalah deskriptif kuantitatif. Populasi dalam penelitian ini adalah gugus 4 sekolah dasar di Kecamatan Turen Kabupaten Malang. Teknik pengambilan sampel yang digunakan adalah teknik random sampling. Guru sebagai populasi sampel karena jumlahnya hanya 9, sedangkan untuk sampel siswa 20% dari 249 siswa yaitu 50 siswa. Berdasarkan hasil penelitian dapat dipaparkan bahwa 78% guru belum memahami persamaan ide pokok dengan gagasan utama, 89% guru bisa menjelaskan jenis-jenis latar, dalam pelaksanaan pembelajaran informasi materi dan informasi tujuan tidak disampaikan, guru masih menggunakan metode yang monoton, tidak menyimpulkan materi dan refleksi pada pelaksanaan pembelajaran. kurangnya faktor pendukung dalam pembelajaran mengarang seperti buku ajar, alat peraga, serta media pembelajaran. Disarankan kepada guru-guru sekolah dasar agar menguasai materi yang akan disampaikan pada siswa, seperti ide pokok, jenis latar, tanda baca, dan jenis kata sebelum melaksanakan pembelajaran mengarang. Hendaknya guru meyusun sendiri rencana pelaksanaan pembelajaran, serta menggunakan media dan metode dalam pembelajaran mengarang yang bervariasi agar siswa tidak merasa bosan dengan pembelajaran yang dilakukan oleh guru.

Hubungan penguasaan kosa kata dengan kemampuan menulis cerita pengalaman siswa kelas IV di gugus 2 Kecamatan Sampung Kabupaten Ponorogo / Dheny Wahyuningtyas

 

Kata Kunci : penguasaan kosakata, menulis cerita, SD. Penguasaan kosakata adalah kemampuan yang dimiliki oleh siswa Kelas IV di Gugus 02, Kecamatan Sampung, Kabupaten Ponorogo dalam memahami kosakata yang meliputi morfologi, fungsi sintaksis, dan ejaan. Penguasaan kosakata sangat penting dalam menulis cerita pengalaman. Untuk itu diperlukan kemampuan penguasaan kosakata untuk menulis cerita pengalaman tersebut. Tujuan penelitian ini untuk mendeskripsikan: (1) tingkat penguasaan kosakata siswa kelas IV di Gugus 2 Kecamatan Sampung Kabupaten Ponorogo, (2) tingkat kemampuan menulis cerita pengalaman siswa kelas IV di Gugus 2 Kecamatan Sampung Kabupaten Ponorogo, dan (3) ada tidaknya hubungan penguasaan kosakata dengan kemampuan menulis cerita pengalaman siswa kelas IV di Gugus 2 Kecamatan Sampung Kabupaten Ponorogo. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan deskriptif korelasional. Populasi penelitian adalah siswa kelas IV SDN di Gugus 2 Kecamatan Sampung Kabupaten Ponorogo yang berjumlah 60 orang dan semuanya diteliti, sehingga disebut sampel total. Data dikumpulkan menggunakan instrumen soal tes pilihan ganda untuk menghitung tingkat penguasaan kosakata siswa dan uraian untuk menghitung kemampuan menulis cerita pengalaman siswa. Data yang terkumpul dianalisis secara deskriptif kuantitatif dan korelasional yang menggunakan teknik korelasi product moment. Instrumen sebelum digunakan untuk mengumpulkan data dilakukan uji validitas dan reliabilitas. Hasil analisis validitas dan reliabilitas semua soal dinyatakan valid dan reliabel. Hasil analisis deskriptif terhadap penguasaan kosakata siswa tergolong baik terbukti dengan sebanyak 76,6% siswa mendapatkan nilai 60 sampai dengan 100. Sedangkan hasil kemampuan menulis cerita pengalaman siswa tergolong baik sekali terbukti dengan hasil analisis yang menunjukkan bahwa siswa yang memperoleh nilai 61 sampai dengan 100 mencapai 100% yang berarti bahwa semua siswa mempunyai kemampuan dalam menulis cerita. Dari hasil penelitian diketahui bahwa rhitung lebih besar dari rtabel yaitu 0,637>0,330 pada taraf signifikansi 1%. Jadi dapat dikatakan bahwa ada korelasi yang positif dan signifikan antara penguasaan kosakata dengan kemampuan menulis cerita pengalaman siswa kelas IV di Gugus 2 Kecamatan Sampung Kabupaten Ponorogo.

Perbedaan hasil belajar IPA siswa kelas III yang diajar menggunakan model starter eksperimen dengan yang diajar menggunakan metode ceramah bervariasi di SDN Penganggungan Malang / Choirin Nisa'

 

Kata Kunci: model starter eksperimen, hasil belajar IPA Ilmu Pengetahuan Alam (IPA) merupakan hasil kegiatan manusia yang diperoleh dari pengalaman melalui metode ilmiah. Dalam pembelajaran IPA, siswa diajak belajar mengungkapkan gejala-gejala alam dengan mengikuti kaidah ilmiah. Pada pembelajaran IPA di SDN Penanggungan Malang, guru belum pernah melaksanakan eksperimen, sehingga siswa belum pernah diajak belajar dengan mempraktekkan prinsip-prinsip metode ilmiah. Dalam penelitian ini, peneliti ingin mengetahui perbedaan hasil belajar siswa yang diajar menggunakan model starter eksperimen dengan yang diajar menggunakan metode ceramah bervariasi pada mata pelajaran IPA. Model pembelajaran starter eksperimen merupakan salah satu model penerapan pembelajaran kontekstual yang melatih dan mengajarkan siswa untuk belajar konsep IPA sama halnya dengan seorang ilmuwan IPA. Model starter eksperimen mempunyai ciri khusus yaitu mengetengahkan lingkungan alam sebagai penyulut (starter) yang ditunjukkan pada tahap percobaan awal melalui demonstrasi guru, selanjutnya pembelajaran dilakukan dengan mempraktekkan prinsip-prinsip metode ilmiah meliputi pengamatan, penyusunan hipotesis, desain percobaan, percobaan pengujian dan laporan hasil penelitian. Siswa belajar aktif dengan mengikuti tahap-tahap pembelajaran, dengan demikian siswa akan menemukan sendiri sesuai hasil yang diperoleh selama pembelajaran. Penelitian ini bertujuan untuk (1) memaparkan hasil belajar siswa yang diajar menggunakan metode ceramah bervariasi (2) memaparkan hasil belajar siswa yang diajar menggunakan model starter ekaperimen dan (3) memaparkan ada atau tidak adanya perbedaan hasil belajar siswa yang diajar menggunakan model starter eksperimen dengan yang diajar menggunakan metode ceramah bervariasi di SDN Penanggungan Kota Malang. Penelitian ini menggunakan pendekatan kuantitatif dengan model penelitian eksperimen semu (quasi experimental). Desain eksperimen yang digunakan adalah desain nonequivalent control group design. Sampel penelitian ini adalah seluruh siswa kelas III SDN Penanggungan Kota Malang yang berjumlah 65 siswa. Instrumen yang digunakan untuk mengunpulkan data berupa soal tes hasil belajar. Pada analisis data digunakan rumus Uji-T Independen dengan menggunakan data rata-rata hasil belajar siswa. Berdasarkan hasil analisis dapat diketahui rata-rata hasil belajar siswa yang diajar menggunakan model starter eksperimen sebesar 85,53 lebih tinggi daripada rata-rata hasil belajar siswa yang diajar menggunakan metode ceramah bervariasi yang hanya mencapai 78,84. Sesuai tabel analisis uji t, diperoleh thitung sebesar 4,120 sedangkan pada taraf signifikansi 5 % dengan N = 65 diperoleh ttabel sebesar 1,990. Hal tersebut menunjukkan bahwa nilai thitung > ttabel. Maka dapat disimpulkan ada perbedaan yang signifikan antara hasil belajar IPA siswa kelas III yang diajar menggunakan model starter eksperimen dengan yang diajar menggunakan metode ceramah bervariasi di SDN Penanggungan materi Gerak Benda. Berdasarkan hasil penelitian ini dapat disarankan (1) Guru sebaiknya terampil dalam mengembangkan model-model pembelajaran untuk diterapkan dalam pembelajaran IPA, khususnya model pembelajaran starter eksperimen. Dengan model starter eksperimen, guru dapat mengembangkan kemampuan berfikir dan kreativitas siswa untuk menyusun sendiri konsep-konsep baru dalam struktur kognitifnya melalu metode ilmiah dan (2) Hasil penelitian ini diharapkan dapat menjadi masukan bagi peneliti lanjut yang ingin meneliti dan mengembangkan penelitian ini pada lingkup subjek penelitian yang lebih besar lagi atau menggunakan rancangan True Experiment.

The implementation of life skills education at public senior high schools in Malang / Dewi Ni'matin

 

Kata kunci: penerapan, pendidikan kecakapan hidup Tujuan pendidikan Indonesia yang tertuang dalam lampiran Peraturan Menteri Nasional Pendidikan No.22 tahun 2006 adalah untuk mengembangkan potensi siswa sehingga menjadi manusia yang beriman dan bertaqwa terhadap Tuhan, mulia, sehat, berilmu, berkompeten, creative, mandiri, dan demokrasi juga bertanggung jawab. Sekolah seharusnya menjadi miniatur dari kehidupan yang sebenarnya dalam masyarakat. Oleh karena itu, pemerintah memasukkan unsure pendidikan kecakapan hidup dalam proses belajar pembelajaran, sehingga siswa mempunyai modal untuk menghadapi masalahnya dkemudian hari. Metode penelitian ini adalah survey karena tujuan penelitian ini adalah untuk mendeksripsikan penerapan pendidikan kecakapan hidup di SMA Negeri di Malang. Peneliti mengambil tiga sekolah sebagai sampel penelitian melalui beberapa tahapan. Pertama, mendata seluruh SMA Negeri di Malang berdasarkan ranking pada ujian nasional tahun 2010. Kedua, mengelompokkan sekolah tersebut menjadi tiga kelompok; tinggi, sedang, dan rendah. Terakhir, memilih satu sekolah dari masing-masing kelompok untuk dijadikan sampel. Data dikumpulkan dengan menyebarkan kuesioner kepada semua guru bahasa Inggris disekolah sampel. Hasil penelitian akan ini disajikan dalam bentuk paparan setelah diklasifikasikan ke dalam aspek yang terkait. Hasil dari penelitian menunjukkan bahwa guru SMA Negeri di Malang menanggapi penerapan pendidikan kecakapan hidup di SMA sebagai program yang bagus karena bermanfaat untuk siswa dan bisa membantu siswa menghadapi masalah mereka dikemudian hari. Dalam pelaksanaanya, guru-guru telah menerapkan pendidikan kecakapan hidup dalam kegiatan pembelajaran mulai dari kegiatan awal, kegiatan inti, dan kegiatan penutup. Mereka mengalami beberapa hambatan dalam penerapan kecakapan hidup dalam kelas. Sebagian besar hambatan itu berasal dari siswa yaitu siswa tidak mengerti pentingnya pendidikan kecakapan hidup untuk mereka dan beberapa siswa memang memiliki kelemahan dalam bahasa Inggris. Beberapa saran ditujukan kepada beberapa pihak. Guru disarankan untuk memperbanyak variasi kegiatan pembelajaran di kelas sehingga siswa bisa mengasah kemampuan mereka dengan berbagai cara. Untuk Diknas, disarankan untuk menyelenggerakan seminar tentang pendidikan kecakapan hidup agar guru mendapatkan pemahaman lebih tentang kecakapan hidup (life skills). Untuk mahasiswa Universitas Negeri Malang, disarankan untuk mulai membuat kegiatan pembelajaran yang variatif dan menarik yang bisa diterapkan kepada siswanya nanti. Peneliti selanjutnya disarankan untuk meneliti unsur lain tentang pendidikan kecakapan hidup seperti menganalisis teknik dan materi pendidikan.

Peningkatan kemampuan membaca pemahaman melalui pembelajaran Cooperative model intergrated Reading and Compesition (CIRC) pada siswa kelas V SDN II Kenoireng Kecamatan Besuki Tulungagung / Triaswuri Kartikasari

 

Kata Kunci: Membaca Pemahaman, Model Cooperative Integrated Reading and Composition (CIRC), SD Hasil observasi yang dilakukan peneliti di kelas V SDN II Keboireng kecamatan Besuki kabupaten Tulungagung pada pembelajaran bahasa Indonesia dengan materi membaca pemahaman didapatkan fakta bahwa pembelajaran yang dilakukan guru kurang bervariasi. Dari hasil pra tindakan diketahui bhwa dari 30 orang sisa hanya 5 orang yang mendapatkan nilai lebih dari KKM yang ditentukan yaitu 65,00. Untuk itu untuk agar dapat meningkatkan kemampan membaca pemahaman siswa , maka perlu diadakan perbaikan pembelajaran yaitu dengan menggunakan pembelajaran kooperatif model Cooperative Integrated Reading and Composition (CIRC). Penelitian ini bertujuan untuk mendeskribsikan peningkatan kemampuan membaca pemahaman siswa dengan menggunakan model pembelajaran CIRC. Penelitian ini menggunakan jeni penelitian tindakan kelas dengan pendekatan deskriptif kualitatif model kolaboratif. Subjek penelitian ini adalah siswa kelas V SDN II Keboireng kecamatan Besuki kabupaten Tulungagung. Dalam penelitian ini, peneliti bertindak sebagai pengajar dan guru kelas sebagai observer. Proses pembelajaran bahasa Indonesia dengan menggunakan model pembelajaran CIRC dapat dilaksanakan dengan efektif delam 2 siklus, setiap siklus terdiri dari 2 pertemuan. Terbukti dari tercapainya hampir semua indikator sesai dengan RPP yang telah dibuat dengan baik. Aktivitas pembelajaran tersebut meliputi keaktifan dan kerjasama dalam kelompok. Hasil belajar, aspek-aspek yang ditekankan adalah menjawab pertanyaan, menemukan gagasan utama, menceritakan kembali dan memberikan tanggapan sesuai teks bacaan. Hasil penelitian menunjukkn bahwa penerapan model CIRC untuk materi membaca pemahaman cerita rakyat maupun artikel sangat efektif. Kemampuan membaca pemahaman sisa melipuiti pemahaman literal, inferensial, kritis dan kreatif. Hasil belajar pada siklus I memperoleh rata-rata 56,66 dengan prosesntase ketuntasan belajar sebesar 13,33% dan pada siklus II memperoleh rata-rata nilai ebesar 72,17% dengan prosesntase ketuntasan belajar sebesar 80,00%. Berdasarkan hasil penelitian dapat disarankan bahwa penelitian ini dapat dijadikan sebagai sarana rujukan penelian lebih lanjut dengan memperhatikan dan melakukan persiapan yang matang dalam pembagian tugas kelompok.

Kesulitan guru SD dalam pembelajaran membaca permulaan siswa kelas I Gugus 5 Kecamatan Beji Kabupaten Pasuruan / Heni Widi Astutik

 

Keyword : Difficulty of teacher in study read start. Membaca merupakan alat bagi siswa untuk mengetahui mata pelajaran yang dipelajarinya di sekolah. Pembelajaran Bahasa Indonesia Berdasarkan Kurikulum 2004, diarahkan pada pengajaran terpadu untuk lebih menumbuhkan kemampuan berbahasa Indonesia. Dalam pembelajaran baik lisan maupun tulisan. Dalam pengajaran bahasa indonesia mempunyai berbagai kemampuan berbahasa Indonesia, terdapat empat aspek keterampilan yang dilakukan secara terpadu . Keempat aspek yang di lakukan secara terpadu, adalah (1) keterampilan menyimak, (2) keterampilan berbicara, (3) keterampilan membaca, dan (4) keterampilan menulis (Santoso. 2009:3.29) Membaca permulaan merupakan suatu proses keterampilan dan kognitif. Proses keterampilan menunjuk pada pengenalan dan penguasaan lambang-lambang fonem, sedangkan proses kognitif menunjuk pada penggunaan lambang-lambang fonem yang sudah dikenal untuk memahami makna suatu kata dan kalimat. Dalam pembelajaran membaca permulaan guru di beri kebebasan untuk memilih dan menerapkan model pembelajaran membaca permulaan agar mencapai hasil yang diharapkan. Pembelajaran permulaan di SD ditekankan pada penguasaan lambang-lambang tulisan dengan tujuan, agar siswa mampu membaca lancar dengan lafal yang tepat, karena dengan kemampuan membaca lancar siswa mudah memahami arti dan maksud sebuah kalimat atau bacaan.

Penerapan teori bruner untuk meningkatkan penguasaan konsep keliling dan luas jajaran genjang pada siswa kelas IV SDN Banjarejo 03 Pakis / Rina Hikmatul Mufida

 

Kata Kunci: teori Bruner, penguasaan konsep, SDN Banjarejo 03 Berdasarkan hasil observasi awal, diketahui bahwa siswa kelas IV SDN Banjarejo 03 Kecamatan Pakis Kabupaten Malang banyak yang mengalami kesulitan ketika menentukan keliling dan luas jajaran genjang. Dari hasil tes awal, diketahui bahwa banyak siswa yang masih bingung dalam membedakan konsep keliling dan luas jajaran genjang. Penelitian ini bertujuan untuk: (1) mendeskripsikan pelaksanaan penerapan teori Bruner untuk meningkatkan penguasaan konsep keliling dan luas jajaran genjang pada siswa kelas IV SDN Banjarejo 03, (2) mendeskripsikan peningkatan penguasaan konsep keliling dan luas jajaran genjang pada siswa kelas IV SDN Banjarejo 03 setelah dilaksanakan pembelajaran dengan menerapkan teori Bruner, dan (3) mendeskripsikan kesulitan yang dialami siswa dan guru selama mengikuti pembelajaran dengan menggunakan teori Bruner untuk meningkatkan penguasaan konsep keliling dan luas jajaran genjang di kelas IV SDN Banjarejo 03 Penelitian ini menggunakan pendekatan deskriptif kualitatif dengan jenis Penelitian Tindakan Kelas. Data yang dikumpulkan dalam penelitian ini yaitu data tentang proses dan hasil pembelajaran baik sebelum dan sesudah dilakukan tindakan. Teknik pengumpulan data yang digunakan oleh peneliti meliputi: observasi, wawancara, catatan lapangan, tes, dan dokumentasi. Penelitian ini mengambil sampel siswa kelas IV SDN Banjarejo 03 Pakis Kabupaten Malang. Berdasarkan hasil penelitian dapat disimpulkan bahwa pelaksanaan pembelajaran dengan menerapkan teori Bruner dilakukan berdasarkan tiga tahapan yaitu enaktif, ikonik dan simbolik, penerapan teori Bruner dalam pembelajaran Matematika materi keliling dan luas jajaran genjang dapat meningkatkan penguasaan konsep siswa. Hal tersebut terbukti dari hasil evaluasi yang mengalami peningkatan. Pada hasil pretes yang tuntas mendapatkan nilai di atas KKM hanya 9 siswa (42,9%), pada siklus I mengalami peningkatan menjadi 14 siswa (66,7%), sedangkan pada siklus II mengalami peningkatan lagi yaitu menjadi 18 siswa (85,7%). Berdasarkan hasil penelitian, disarankan bagi guru yang akan mengajarkan konsep Matematika dapat menerapkan teori Bruner sebagai model pembelajaran. Bagi peneliti lain, kelemahan dalam penelitian ini dapat digunakan sebagai bahan pertimbangan dalam penelitian lanjutan mengenai teori Bruner agar dapat merancang pembelajaran yang efisien sehingga tidak memerlukan banyak waktu dan hendaknya peneliti memperkenalkan langkah-langkah penerapan teori Bruner terlebih dahulu pada materi yang lain, sehingga pada saat pelaksanaan penelitian siswa dan guru tidak merasa canggung dan kesulitan.

Manajemen perpustakaan sekolah dalam pembinaan minat baca siswa di SD Negeri Percobaan 1 Malang / Arief Ardiansyah

 

Kata Kunci : Manajemen perpustakaan, pembinaan, minat baca. Sekolah merupakan suatu tempat yang digunakan untuk atktivitas pembelajaran. Aktivitas pembelajaran tidak hanya dapat dilakukan di dalam kelas saja, namun dapat juga dilakukan di luar kelas, salah satunya di perpustakaan. Pemanfaatan layanan perpustakaan bertujuan agar proses belajar mengajar di sekolah dapat berjalan lancar sebagai penunjang sarana belajar dan media belajar. Karena perpustakaan sekolah merupakan bagian yang integral dan bagian dari manajemen pendidikan yang vital. Membaca adalah masalah yang penting di dalam dunia pendidikan, sebab dengan membaca seseorang dapat memperoleh ilmu pengetahuan dan informasi yang penting.Upaya pengembangan minat baca siswa erat kaitannya dengan keberadaan perpustakaan sekolah. Membaca merupakan sebuah proses menangkap atau memperoleh konsep-konsep yang dimaksud oleh pengarangya, mengintepretasi, mengevaluasi konsep-konsep pengarang dan merefleksikan atau bertindak seperti yang dimaksud oleh konsep itu. Penelitian ini merupakan penelitian kualitatif deskriptif, sedangkan rancangan penelitian yang digunakan adalah studi kasus observasional. Lokasi penelitian di Perpustakaan Sekolah SD Negeri Percobaan 1 Malang. Penelitian ini dilaksanakan dengan fokus penelitian manajemen perpustakaan sekolah dalam pembinaan minat baca siswa dengan jabaran sebagai berikut: (1) perencanaan perpustakaan sekolah; (2) pengorganisasian perpustakaan sekolah; (3) layanan perpustakaan sekolah; dan (4) pengawasan perpustakaan sekolah. Pada penelitian ini, peneliti merupakan pengumpul data yang utama. Adapun pengambilan data digunakan melalui teknik: (1) pengamatan/ pengamatan tidak berperan serta; (2) wawancara; (3) dokumentasi. Data yang terkumpul kemudian dilakukan pengecekkan untuk menguji keabsahan data tersebut dengan menggunakan teknik ketekunan pengamatan, trianggulasi, meliputi trianggulasi sumber data dan metode. Hasil dalam penelitian ini adalah: (1) manajemen perpustakaan sekolah dalam pembinaan minat baca siswa adalah dengan memberikan hadiah kepada siswa yang paling sering meminjam buku melalui poin membaca, penambahan koleksi pustaka, pengadaan jam wajib kunjung perpustakaan untuk tiap-tiap kelas, memberikan kebebasan membaca kepada pengunjung, dan memberikan himbauan tentang pentingnya membaca melalui poster-poster atau tulisan-tulisan yang berisikan ajakan-ajakan agar siswa gemar membaca; (2) perencanaan program perpustakaan sekolah dilakukan sesuai tujuan, penambahan bahan pustaka, serta penambahan sarana dan prasarana pendukung perpustakaan yang diperlukan; (3) perpustakaan sekolah ini memiliki struktur organisasi yang memperlihatkan hubungan kerja sama antara bagian-bagian yang ada di dalam organisasi; (4) pelayanan perpustakaan sekolah memilki kegiatan untuk memberikan layanan kepada setiap pengunjung baik berupa layanan sirkulasi maupun referensi; dan (5) pengawasan perpustakaan sekolah dilakukan oleh kepala sekolah sebagai pihak pembina dan penanggung jawab, petugas memberikan hasil kerjanya dalam bentuk tertulis berisi catatan mengenai data keluar-masuknya buku dan jumlah pengunjung perpustakaandalam tiap semester yang dilaksanakan pada tiap akhir tahun ajaran. Sedangkan untuk meningkatkan profesionalitas kerjanya, petugas perpustakaan mengikuti pelatihan-pelatihan yang berkaitan dengan perpustakaan.

Karakterisasi mineral magnetik pasir besi di Daerah Pasirian Kabupaten Lumajang untuk pembuatan bahan baku tooner / Ike Yunia Trisdamayanti

 

Kata Kunci: Mineral magnetik, pasir besi, tooner Salah satu sumber deposit pasir besi di Indonesia berada di Pasirian Lumajang. Komposisi sampel didapat dari uji X-Ray Fluorenscene (XRF), dan uji mineral magnetik didapat dari uji suseptibilitas dan dari kestabilan remanen magnetik. Tujuan dari penelitian ini untuk mengetahui unsur yang mendominasi di dalam sampel dan untuk mengetahui nilai median destructive field (MDF) kedua sampel pasir dan toner. Dengan membandingkan karakteristik kedua sampel, kita dapat menyiapkan senyawa magnetik dari sampel pasir besi sebagai bahan tooner. Komposisi besi dalam sampel berkisar antara 34,4% tanpa ekstasi dan bertambah menjadi 58% setelah ekstrasi. Kemudian setelah penyaringan dengan mesh 200 konsentrasi besi meningkat menjadi 70%. Suseptibilitas dari pasir besi antara 1.5 x 10-4m3kg-1 (tanpa ekstrasi) sampai 1,8 x 10-4m3kg-1 (untuk sampel ekstrasi dan sampel ayak), sementara suseptibilitas toner adalah 2.1 x 10-4m3kg-1 . Sementara itu, nilai MDF toner dan pasir ayak menunjukkan nilai yang hampir sama, yaitu 24 dan 26. Dari data kita dapat menyimpulkan mineral magnetik dari pasir besi dapat dijadikan material toner.

Pengembangan pembelajaran gerak dasar lari menggunakan media kertas untuk siswa kelas 3 Sekolah Dasar Laboratorium Universitas Negeri Malang / Elok Dian Fatmawati

 

Kata kunci: Pengembangan, Gerak Dasar lari, Media Kertas. Sekolah Dasar Laboratorium Universitas Negeri Malang telah menerapkan pembelajaran Pendidikan Jasmani dimana dalam standart kompetensinya terdapat kompetensi gerak dasar, berdasarkan hasil observasi dan analisis kebutuhan guru belum pernah melaksanakan pembelajaran gerak dasar lari menggunakan permainan, sehingga siswa kurang tertari dan aktif dalam pembelajaran gerak dasar lari. Maka disusun rancangan produk pengembangan pembelajaran gerak dasar lari menggunakan media kertas. Media kertas yang digunakan berupa kertas yang dibentuk menjadi 3 macam yaitu: (1) baling-baling kertas, (2) spiral kertas, (3) lembaran kertas. Model pengembangan yang digunakan dalam penelitian ini mengacu pada model pengembangan (research and development) dari Borg dan Gall (1983: 475) yang terdiri dari sepuluh langkah. Namun menurut Ardhana (2002: 9) setiap pengembang tentu saja dapat memilih dan menentukan langkah-langkah yang paling tepat bagi peneliti dengan mempertimbangkan kondisi yang dihadapi dalam proses pengembangan. Maka peneliti melakukan modifikasi untuk menggunakan 7 langkah dari langkah Borg and Gall dengan tidak menggunakan langkah ke delapan hingga kesepuluh. Sehingga prosedur penelitian yang digunakan oleh peneliti adalah: 1) melakukan penelitian awal (need assesment), 2) melakukan perencanaan, selanjutnya dievaluasi oleh para ahli, 3) mengembangkan produk awal, 4) melakukan uji coba kelompok kecil dengan 6 subyek, 5) melakukan revisi terhadap produk awal, 6) melakukan uji coba lapangan(kelompok besar) denga 33 subyek, 7) melakukan revisi produk. Instrumen yang digunakan adalah berupa angket berisi tentang rancangan produk dan produk yang telah dibuat. Teknik analisis data yang digunakan adalah analisis kualitatif dan kuantitatif berupa persentase. Pembelajaran ini dikembangkan melalui saran dan evaluasi para ahli, yaitu satu orang ahli pembelajaran dan dua orang ahli atletik. Hasil analisis data yang diperoleh adalah 100% siswa mudah dalam melakukan pembelajaran gerak dasar lari menggunakan media dari kertas, 100% siswa senang dalam melakukan pembelajaran gerak dasar lari menggunakan media kertas, pembelajaran gerak dasar lari menggunakan media dari kertas 100% aman untuk dilakukan siswa. Sehingga diharapkan pengembangan pembelajaran gerak dasar lari menggunakan media dari kertas ini bisa menjadi salah satu alternatif pembelajaran pendidikan jasmani khususnya pada materi gerak dasar lari, agar lebih menarik sehingga siswa lebih aktif dalam kegiatan pembelajaran.

Isolasi dan karakterisasi bakteri proteolitik, lipolitik, dan amilolitik dari asinan kedelai (Glycine soja) sebagai bahan pembuatan kecap di Probolinggo / Dyah Ayu Aryani

 

Kata kunci: Asinan kedelai, bakteri, indeks hidrolisis, enzim Enzim merupakan biokatalisator yang memegang peranan penting dalam bidang industri. Tiga enzim yang memiliki nilai komersil yang diperdagangkan dalam dasawarsa ini adalah protease, lipase dan amilase. Penelitian tentang isolasi bakteri penghasil enzim banyak dilakukan pada limbah-limbah pembuangan hasil industri makanan sedangkan penelitian mengenai isolasi bakteri penghasil enzim pada makanan masih sedikit dilakukan. Penelitian ini bertujuan untuk membuktikan, mengetahui indeks hidrolisis, dan mengidentifikasi isolat bakteri proteolitik, lipolitik dan amilolitik indigen dari asinan kedelai yang dibuat secara tradisional di Probolinggo. Penelitian ini merupakan penelitian deskriptif dengan pendekatan eksploratif yang dilakukan di Laboratorium Mikrobiologi jurusan Biologi FMIPA-UM pada bulan Maret-Mei 2011. Sampel penelitian ini adalah asinan kedelai yang diperoleh dari industri kecap yang dibuat secara tradisional yang terletak di Probolinggo. Sampel dihomogenkan dengan medium pengayaan spesifik yaitu medium Skim Milk Agar (SMA) untuk bakteri proteolitik, medium Nutrien Agar + Amilum 1% untuk bakteri amilolitik, dan Nutrien Agar + Olive oil 1% untuk bakteri lipolitik, selanjutnya dipilih 3 isolat untuk masing-masing kelompok bakteri proteolitik, lipolitik, dan amilolitik yang mempunyai kemampuan hidrolisis tertinggi. Penentuan tiga isolat berdasarkan nilai indeks hidrolisis protein, lemak dan amilum tertinggi. Pengamatan dilanjutkan dengan melakukan pengamatan mikrobiologi yang meliputi karakterisasi sifat morfologi koloni bakteri dan karakterisasi sifat sitologi bakteri. Kelengkapan identifikasi hingga tingkat spesies dengan menggunakan Microbact TM GNB 12 A/B/E, 24E Identification Kits. Hasil penelitian menunjukkan ada 6 isolat bakteri proteolitik, 5 isolat bakteri lipolitik, dan 4 isolat bakteri amilolitik asinan kedelai yang ditemukan dan dipilih 3 isolat bakteri yang memiliki indeks hidrolisis terbesar pada masingmasing kelompok bakteri yang bersifat proteolitik, lipolitik, dan amilolitik. Tiga indeks hidrolisis protein tertinggi dengan nilai 2,22 (kode PB), 2,05 (kode PA), dan 1,81 (kode PD), kode tiga isolat yang memiliki indeks hidrolisis lemak tertinggi dengan nilai 1,30 (kode LB), 1,25 (kode LD), dan 0,98 (kode LA) sedangkan indeks hidrolisis amilum tertinggi dengan nilai 2,26 (kode AC), 2,12 (kode AF), dan 2,04 (kode AB). Hasil identifikasi 3 isolat bakteri proteolitik yang memiliki indeks hidrolisis protein tertinggi adalah Bacillus lincheformis, Bacillus subtillis, dan Bacillus thuringiensis, spesies bakteri lipolitik yang ditemukan adalah Serratia liquefaciens, dan Enterobacter gergoviae, sedangkan bakteri amilolitik yang ditemukan adalah Actinomyces spp dan Eubacterium spp.

Potensi novel remaja mutakhir (2000-AN) sebagai alternatif sumber belajar apresiasi prosa berbasis pendidikan karakter / Renny Lutviana

 

Kata Kunci: novel remaja, unsur intrinsik, unsur ekstrinsik, pendidikan karakter, pembelajaran apresiasi prosa. Novel remaja adalah karya fiksi berbentuk prosa yang isinya mencermin-kan kehidupan sosial para remaja. Permasalahan yang diangkat dalam novel remaja tidak jauh dari kehidupan remaja pada kenyataannya, seperti persahabatan dan percintaan. Novel remaja banyak diminati dan layak untuk dijadikan sumber belajar apresiasi prosa. Pengajaran apresiasi sastra, termasuk apresiasi prosa, penting dilakukan untuk mengembangkan potensi siswa dan dapat menumbuhkan penghargaan terhadap hasil karya sastra. Pembelajaran apresiasi prosa, saat ini, dikembangkan menggunakan strategi pembelajaran berbasis pendidikan karakter. Penelitian ini penting dilakukan untuk memudahkan guru memilih novel remaja yang berkualitas yang dapat digunakan sebagai sumber belajar sekaligus sesuai dengan pendidikan karakter. Penelitian ini dilakukan dengan tujuan untuk (1) mendeskripsikan karakteristik unsur intrinsik novel remaja mutakhir (2000-an), (2) mendeskripsi-kan karakteristik unsur ekstrinsik novel remaja mutakhir (2000-an), dan (3) mengetahui potensi novel remaja mutakhir (2000-an) sebagai alternatif sumber belajar apresiasi prosa berbasis pendidikan karakter. Penelitian ini merupakan penelitian deskriptif yang menggunakan pendekatan kualitatif. Peneliti berkedudukan sebagai instrumen utama dalam penelitian ini. Sumber data penelitian ini adalah data verbal dan nonverbal dari novel remaja mutakhir (2000-an). Sumber data dipilih dengan cara (1) mencari daftar novel remaja yang terbit pada tahun 2004-2011, (2) mengklasifikasikan novel remaja menurut tahun terbitnya, (3) memilih novel best seller, (4) memilih novel yang memiliki rating tertinggi, (5) memilih novel yang pernah diresensi dan resensi tersebut pernah dipublikasikan. Pengumpulan data dilakukan dengan menggunakan teknik dokumentasi. Untuk menjaga keabsahan data, dilakukan dengan cara memperpanjang keikutsertaan, ketekunan pengamatan, dan pengecekan sejawat. Berdasarkan hasil analisis data dapat disimpulkan bahwa (1) karakteristik unsur intrinsik novel remaja mutakhir (2000-an) yang berupa (a) tema yang banyak muncul adalah impian dan cinta dapat diraih melalui usaha keras, (b) amanat yang banyak muncul adalah berusahalah dengan keras agar impian dan cinta dapat tercapai, (c) tokoh utama dalam novel masih remaja dan tokoh bawahannya adalah tokoh yang dekat dengan kehidupan remaja, seperti guru, teman, dan orang tua, (d) penokohan digambarkan sesuai dengan usia remaja, (e) seting tempat dan seting waktu berkaitan dengan kehidupan sosial remaja, seperti rumah dan sekolah, (2) karakteristik unsur ekstrinsik novel remaja mutakhir (2000-an) yang berupa (a) biografi pengarang yang dapat membangkitkan motivasi pembaca dan (b) nilai-nilai yang bersifat positif ditemukan dalam semua novel , dan (3) novel yang berjudul Cybercrime Fighters adalah novel yang paling berpotensi untuk dimanfaatkan sebagai media pembelajaran berbasis pendidikan karakter karena memiliki nilai pendidikan karakter yang paling banyak daripada novel lainnya, kedua adalah novel Jilbab Funky, ketiga adalah novel Kintaholic, keempat adalah novel Rahasia Bintang, kelima adalah novel Fairish, keenam adalah novel FBI vs CIA, ketujuh adalah novel Dealova, dan terakhir adalah novel Unbelievable. Dari kesimpulan hasil penelitian dapat dikemukakan beberapa saran, yaitu (1) bagi guru Bahasa Indonesia, penelitian ini dapat dijadikan sebagai sumber belajar dalam melaksanakan pembelajaran apresiasi prosa, (2) siswa disarankan menggunakan penelitian ini sebagai sarana menambah wawasan dan pengetahuan mengenai novel remaja mutakhir, dan (3) bagi peneliti lain, disarankan penelitian ini dapat menjadi contoh atau rujukan dalam mengembangkan sumber belajar seputar prosa.

Analisa tingkat kenyamanan celana wanita sistem Soekarno ( pantalon) pada tubuh ukuran S, M, L SNI / Yoanita Martina Sutino

 

Kata kunci: Kenyamanan, Celana Wanita, SNI Celana adalah pakaian luar yang menutupi badan dari pinggang ke mata kaki dalam dua bagian kaki yang terpisah. celana telah dipakai oleh pria dalam bentuk yang satu ke bentuk yang lainnya, sejak zaman dahulu kala. Zaman sekarang wanita suka sekali memakai celana, ini karena praktis. Apalagi wanita yang suka bergerak. Di Indonesia mayoritas penduduknya adalah muslim, dan banyak busana – busana muslim di Indonesia yang terdiri dari dua bagian yaitu blus dan celana, wanita muslimah Indonesia suka memakai celana karena terlihat trendi dan simple. Pola sistem soekarno, pola ini dalam mengambarnya lebih detail karena menggunakan ukuran control, misalnya untuk ukuran bagian pinggang, ukuran bagian paha, ukuran bagian kaki, bagian lutut, letak kantong dan lipit, dan letak kupnat memiliki rumus-rumus yang detail perhitungannya. Dalam metode Soekarno ukuran yang diperlukan dalam pembuatan pola celana antara lain lingkar pinggang, lingkar panggul, lingkar pesak, lingkar paha, lingkar lutut, lingkar kaki, panjang celana. Untuk menentukan besar paha system Soekarno menggunakan rumus tertentu Penelitian ini merupakan penelitian deskriptif. Obyek penelitian ini yaitu celana wanita pantalon sistem soekarno. Sampel yang digunakan adalah sample jenuh. Dalam penelitian ini, tidak ada uji instrumen ( uji validitas dan uji reliabilitas) karena dalam menyusun pertanyaan yang terdapat dalam kuesioner tersebut sudah berdasarkan teori yang ada di buku dan sudah di validasi ketika bimbingan oleh dosen pembimbing yang setara dengan panelis ahli. Melakukan pengamatan secara langsung ke objek penelitian untuk melihat dari dekat hasil jadi celana wanita yang sudah dipas Kemudian data yang diperoleh dicatat dalam lembar pengamatan berupa kuesioner Berdasarkan penilaian titik pas atau fitting factor diketahui frekwensi rata-rata tingkat kenyamanan pola dasar celana wanita pantaloon system Soekarno pada ukuran (S) adalah sebagai berikut. Penilaian dikatakan nyaman memiliki presentase sebanyak 85,71% kurang nyaman sebanyak 14,29% dan tidak nyaman sebesar 0%. pada ukuran (M) adalah sebagai berikut. Penilaian dikatakan nyaman memiliki presentase sebanyak 71,43% kurang nyaman sebanyak 14,29% dan tidak nyaman sebesar 14,28%. pada ukuran (L) adalah sebagai berikut. Penilaian dikatakan nyaman memiliki presentase sebanyak 75% kurang nyaman sebanyak 14,29% dan tidak nyaman sebesar 10,71%.

Faktor-faktor keterlambatan penyelesaian skripsi mahasiswa S1 Pendidikan tata busana input non SMTA angkatan 2007,2008,2009 / Prayogo Widyastoto Waluyo

 

Kata Kunci: Faktor- Faktor Keterlambatan Penyelesaian Skripsi, Faktor Internal, Faktor Eksternal. Skripsi merupakan mata kuliah wajib dengan SKS (Sistem Kredit Semester) sebesar empat SKS dengan kode PTS 448, mahasiswa harus sudah mencapai 80 % dari total SKS yang bertujuan untuk memiliki kemampuan untuk secara mandiri dan terbimbing menyusun karya ilmiah berwujud skripsi. Skripsi digunakan sebagai salah satu prasyarat bagi mahasiswa untuk memperoleh gelar sarjana. Akan tetapi banyak dari mahasiswa S1 Pendidikan Tata Busana Input Non SMTA angkatan 2007,2008, 2009 yang mengalami keterlambatan penyelesaian skripsi dari batas waktu yang telah ditentukan ( tiga semester) Tujuan dari penelitian ini adalah untuk mengidentifikasi faktor-faktor keterlambatan penyelesaian skripsi mahasiswa S1 Pendidikan Tata Busana Input Non SMTA. Rancangan penelitian yang digunakan dalam penelitian ini adalah penelitian deskriptif dengan pendekatan kuantitatif. Populasi dalam penelitian ini adalah mahasiswa S1 Pendidikan Tata Busana Input Non SMTA angkatan 2007-2009 yang berjumlah 78 mahasiswa. Teknik pengambilan sampel dengan proportional random sampling sebanyak 40 mahasiswa. Instrumen penelitian yang digunakan untuk mengumpulkan data adalah angket tertutup. Teknik analisis data yang digunakan adalah analisis statistik deskriptif dengan porsentase. Berdasarkan hasil analisis data dapat disimpulkan bahwa faktor keterlambatan penyelesaian skripsi mahasiswa terletak lebih besar pada faktor internal mahasiswa itu sendiri yaitu ketersediaan waktu pengerjaan skripsi (42,5%), mahasiswa masih kurang mengintenskan waktunya untuk melakukan proses konsultasi skripsi dengan dosen pembimbing. Hal ini terbaca pada data yang menunjukkan bahwa mahasiswa hanya menggunakan waktunya untuk konsultasi sekitar dua sampai tiga kali seminggu. Faktor internal selanjutnya adalah mahasiswa banyak yang mempunyai masalah pribadi cukup serius bersamaan dengan pengerjaan skripsi (42,5%). Banyak mahasiswa yang ternyata mempunyai rasa ketakutan dengan dosen pembimbing saat proses konsultasi skripsi (80,0%). Selain itu, tingkat pengetahuan mahasiswa tentang prosedur penelitian, analisis data dan kosa kata yang mempunyai tingkatan sedang, menjadi faktor keterlambatan penyelesaian skripsi (65%). Faktor eksternal yang menunjukkan angka sedang adalah kualitas bimbingan dosen pembimbing skripsi terhadap mahasiswanya (77,5%). Kurangnya ketersediaan literatur menjadi kendala dalam penulisan skripsi (55%). Dari hasil penelitian ini dapat disarankan (1) mahasiswa harus segera menyadari bahwa skripsi merupakan tugas akhir yang harus segera diselesaikan. Oleh karena itu perlu adanya motivasi, keinginan yang kuat disertai usaha yang kuat pula agar keinginan untuk menyelesaikan skripsinya dapat terwujud. (2) Perlu adanya persamaan persepsi dan komunikasi yang terjalin antara mahasiswa dengan dosen pembimbing skripsi agar proses bimbingan skripsi lancar.

Hubungan kematangan emosi dan locus of control dengan sikap terhadap induced abortion pada mahasiswa S1 Psikologi Universitas Muhammadiyah Malang angkatan 2009 dan 2010 / Pepita Chriastianda Apriasta

 

Kata kunci: kematangan emosi, locus of control, sikap terhadap induced abortion. Aborsi yang disengaja atau induced abortion marak terjadi di Indonesia dan sekitar 700 ribu pelakunya adalah remaja di bawah 20 tahun. Perilaku ditentukan oleh intensi dan intensi dibentuk salah satunya oleh sikap sehingga menyelidiki sikap remaja terhadap induced abortion menjadi penting untuk mengetahui kemungkinan perilaku remaja berkenaan dengan aborsi yang disengaja di masa mendatang. Sikap terhadap induced abortion dihubungkan dengan variabel lainnya, yakni kematangan emosi yang membuat individu dapat mengekspresikan emosinya dengan cara yang dapat diterima secara sosial dan locus of control yang merupakan keyakinan individu atas sumber kontrol dari peristiwa dalam hidup individu. Tujuan dari penelitian ini adalah untuk mengetahui apakah terdapat hubungan antara: 1) kematangan emosi dengan sikap terhadap induced abortion, 2) locus of control dengan sikap terhadap induced abortion, dan 3) kematangan emosi dan locus of control dengan sikap terhadap induced abortion. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan penelitian deskriptif dan korelasional untuk mengetahui hubungan kematangan emosi dan locus of control dengan sikap terhadap induced abortion. Subyek penelitian adalah 48 mahasiswi Psikologi Universitas Negeri Malang angkatan 2009 dan 2010 dengan rentang usia 18 sampai 22 tahun. Instrumen penelitian yang digunakan adalah skala, yakni skala kematangan emosi (α=0,901), skala locus of control (α=0,776), dan skala sikap terhadap induced abortion (α=0,970). Pengumpulan data diambil dari pilihan jawaban subyek pada ketiga skala. Hasil penelitian menunjukkan bahwa: 1) terdapat hubungan negatif antara kematangan emosi dengan sikap terhadap induced abortion (r= -0,303; sig.<0,05), semakin tinggi kematangan emosi maka semakin rendah persetujuan terhadap induced abortion, 2) tidak terdapat hubungan antara locus of control dengan sikap terhadap induced abortion (r=0,220; sig.>0,05), dan 3) tidak terdapat hubungan antara variabel kematangan emosi dan locus of control secara bersama-sama dengan sikap terhadap induced abortion. Penelitian selanjutnya diharapkan menggunakan subyek dengan karakteristik yang relevan dengan fenomena induced abortion dan dengan jumlah lebih banyak, serta perlu dilakukan penambahan jumlah aitem dalam pengembangan skala locus of control. Saran bagi para remaja akhir adalah untuk mengupayakan pencapaian dan peningkatan kematangan emosi melalui katarsis, sehingga diharapkan dapat turut mengurangi angka aborsi di Indonesia.

Pengaruh gel Aloe vera terhadap kadar caspase-3 pada ginjal Rattus norvegicus model diabetes mellitus / Rista Puji Kaprianti

 

Kata kunci: caspase-3, diabetes mellitus, gel Aloe vera Diabetes mellitus (DM) merupakan penyakit degeneratif yang menyebabkan kematian nomor tujuh di dunia. Kadar Reactive Oxygen Species (ROS) akibat hiperglikemia disinyalir menjadi pemicu timbulnya komplikasi DM. Aloe vera yang mengandung antioksidan diprediksi dapat menyeimbangkan peningkatan kadar ROS yang menyebabkan pengaktifan caspase-3 yang memicu apoptosis sel. Penelitian ini bertujuan untuk mengetahui pengaruh gel Aloe vera terhadap kadar caspase-3 pada ginjal Rattus norvegicus model DM. Rancangan yang digunakan dalam penelitian ini adalah rancangan acak kelompok (RAK). Tikus diukur kadar glukosa tiga hari setelah injeksi dengan Streptozotocyn dalam dosis 60 mg/kg-BB dan dinyatakan diabetes apabila kadar gula puasa >200 mg/dl. Terapi gel Aloe vera dilakukan secara oral kepada 8 kelompok perlakuan yang terdiri atas kelompok kontrol negatif, kelompok kontrol positif, kelompok non DM dengan pemberian Aloe vera (dosis 30 mg, 60 mg, 120 mg), dan kelompok DM dengan pemberian Aloe vera (dosis 30 mg, 60 mg, 120 mg). Setelah diterapi selama dua minggu, diukur kadar caspase-3 dari sampel ginjal tikus dengan metode ELISA dan diperoleh data dalam satuan µg/ml. Data dianalisis secara statistik dengan one way anova dan menunjukkan bahwa gel Aloe vera berpengaruh secara signifikan dalam menurunkan kadar caspase-3 ginjal Rattus norvegicus model DM, namun tidak berbeda nyata di antara dosis-dosis yang digunakan. Kadar caspase-3 kelompok kontrol positif (tikus model DM) sebesar 2161.78 µg/dl dan kadar caspase-3 dalam keadaan normal (kontrol negatif) adalah 1642.89 µg/dl. Kelompok tikus model DM yang diterapi gel Aloe vera dengan dosis 30 mg/hari memiliki kadar caspase-3 lebih rendah yaitu sebesar 1886.22 µg/dl dibandingkan kelompok tikus model DM yang diterapi gel Aloe vera dengan dosis 60 mg/hari(1922.889 µg/dl) dan dosis 120 mg/hari (1930.67 µg/dl). Kadar caspase-3 tikus non DM normal yang diterapi gel Aloe vera mengalami peningkatan dibandingdingkan kelompok kontrol negatif. Kadar caspase-3 tikus non DM normal yang diterapi gel Aloe vera dosis 120, dosis 60, dan dosis 30 adalah sebagai berikut: 1642.89 µg/dl, 1815.11 µg/dl, 1972.78 µg/dl, 1935.11 µg/dl secara berurutan. Kesimpulan dari penelitian ini adalah gel Aloe vera berpotensi sebagai anti apoptosis melalui penurunan kadar caspase-3 tikus model DM.

Penerapan model bermain tebak warna geometri untuk meningkatkan kemampuan kognitif anak kelompok A RA Hidayatul Mubtadiin Sumber Anyar Nguling Pasuruan / Kartini

 

Kata kunci : Peningkatan kemampuan kognitif, bermain tebak warna geometri Penelitian ini berlatar belakang pada kurangnya kemampuan kognitif anak dalam mengenal warna, bilangan dan bentuk-bentuk geometri pada kelompok A di RA Hidayatul Mubtadiin Sumberanyar Nguling Pasuruan. Guru belum menggunakan media yang tepat dalam meningkatkan kemampuan kognitif anak dalam mengenal warna, bilangan dan bentuk-bentuk geometri. Hasil observasi awal ditemukan bahwa anak belum mampu mencapai kriteria ketuntasan belajar siswa yang ditentukan sekolah yaitu 67% ketuntasan individu. Penelitian ini diidentifikasi dari masalah 1) Bagaimanakah penerapan metode bermain tebak warna geometri untuk meningkatkan kemampuan kognitif anak kelompok A RA Hidayatul Mubtadiin Sumberanyar? 2) Apakah metode bermain tebak warna geometri dapat meningkatkan kemampuan kognitif anak kelompok A RA Hidayatul Mubtadiin Sumberanyar?. Penelitian ini dilaksanakan di RA Hidayatul Mubtadiin Sumberanyar Nguling Pasuruan dengan rancangan penelitian tindakan kelas (PTK) yang dilaksanakan dalam 2 siklus. Subjek penelitian anak kelompok A yang berjumlah 20 anak. Instrumen penelitiannya menggunakan lembar observasi, lembar unjuk kerja, lembar wawancara dan dokumentasi. Teknis Analisis data menggunakan observasi, wawancara, dokumentasi dan penilaian. Hasil penelitian ini menunjukkan bahwa penerapan metode bermain tebak warna geometri dapat meningkatkan kemampuan kognitif anak terbukti dari hasil observasi 25% anak yang mencapai ketuntasan individu, pada siklus I rata-rata (64,25) dengan persentase (55%) dan meningkat pada siklus II rata-rata (77,25), dengan persentase (100%) yang terus mengalami peningkatan. Kesimpulannya bahwasannya dengan bermain tebak warna geometri dapat meningkatkan kemampuan kognitif anak kelompok A RA Hidayatul Mubtadiin Sumberanyar Nguling Pasuruan. Saran yang disampaikan kepada guru yaitu agar dapat menerapkan metode bermain tebak warna geometri dalam meningkatkan kemampuan kognitif anak dengan pengembangan lain. Metode pembelajaran yang digunakan dalam penelitian ini juga dapat digunakan dalam penelitian-penelitian lain sebagai bahan perbandingan sehingga dikemudian hari menjadi lebih baik.

Kontribusi pajak dan retribusi daerah terhadap pendapatan asli daaerah Kota batu (tahun 2007-2014) / Sinta Maula Wati

 

Wati, Sinta. M. 2014. Pengaruh Penerimaan Pajak Daerah dan Retribusi Daerah Terhadap Pendpatan Asli Daerah (Analisis Terhadap Kota Batu Tahun 2009 – Tahun 2013). Skripsi, Jurusan Ekonomi Pembangunan Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Drs. Mardono. M. Si. (II) Drs. Prih Hardinto, M. Si. Kata kunci : Pajak Daerah, Retribusi Daerah, Pendapatan Asli Daerah. Pendapatan asli daerah merupakan sektor penerimaan yang sangat penting bagi keberlangsungan pembangunan daerah. Semakin tinggi penerimaan terhadap pendapatan asli daerah maka semakin besar pula kemampuan bagi daerah tersebut untuk melaksanakan dan mensukseskan pembangunan daerah. Dalam hal ini pajak daerah dan retribusi daerah memegang peranan yang sangat penting yaitu sebagai sektor penyumbang pendapatan asli daerah. Kota Batu dituntut untuk melakukan pembenahan struktural yang meliputi identifikasi potensi PAD, peningkatan kapasitas dan kapabilitas aparat dan peningkatan identifikasi potensi dari sektor pajak dan retribusi daerah, agar sumber-sumber potensi yang ada dapat digali secara maksimal.Metode penelitian yang digunakan dalam penelitian ini adalah deskriptif kuantitatif. Variabel independen (bebas) dalam penelitian ini terdiri dari variabel pajak daerah (X1) dan variabel retribusi daerah (X2). Sedangkan untuk variabel dependen (terikat) dalam penelitian ini adalah pendapatan asli daerah. Populasi dalam penelitian ini adalah pendapatan asli daerah Kota Batu dalam tahun 2007 hingga tahun 2014. Sedangkan sampel dalam penelitian kali ini adalah pajak daerah dan retribusi daerah Kota Batu dalam tahun 2007 hingga tahun 2014. Fokus dari penelitian ini adalah (1) untuk menganalisis perkembangan pajak daerah, retribusi daerah dan pendapatan asli daerah Kota Batu, (2) untuk menganalisis kontribusi dari pajak daerah dan retribusi daerah terhadap pendapatan asli daerah. Untuk menganalisis beberapa fokus penelitian diatas, maka peneliti menggunakan beberapa alat analisis diantaranya analisis deskriptif dan analisis kontribusi.dan Dari hasil penelitian ini diketahui bahwa (1) Persentae atas perkembangan pajak daerah Kota Batu yang terbesar selama tahun 2007 hingga tahun 2014 Kota Batu terjadi pada tahun 2014. (2) Persentase atas perkembangan retribusi daerah Kota Batu yang terbesar selama tahun 2007 hingga tahun 2014 terjadi pada tahun 2014. (3) Persentase atas perkembanagan pendapatan asli daerah Kota Batu yang terbesar selama tahun 2007 hingga tahun 2014 terjadi pada tahun 2014. Selanjutnya dari hasil penelitian ini dapat disimpulkan bahwa (1) perkembangan pajak daerah, retribusi daerah dan pendapatan asli daerah mengalami pertumbuhan yang fluktuatif setiap tahunnya. (2) Variabel bebas yang mempunyai pengaruh kuat terhadap variabel terikat pendapatan asli daerah adalah variabel pajak daerah (X1). (3) Pemerintah daerah Kota Batu menerapkan kebijakan intensifikasi dan ekstensifikasi pajak serta kebijakan ekstensifikasi retribusi untuk meningkatkan pendapatan asli daerah Kota Batu. Adapun saran yang dapat dijadikan petimbangan dalam megoptimalkan penerimaan pajak daerah dan retribusi daerah Kota Batu adalah dengan usaha intensifikasi dan ekstensifikasi yang dilakukan dengan cara aktif dimana petugas pemungut harus lebih giat dalam usaha melakukan penagihan baik pembayaran atau tunggakan. Meningkatkan kualitas aparat pemungut antara lain dengan diadakannya pembenahan dalam hal yang berkenaan dengan manajemen perpajakan seperti : pelatihan dan studi banding maupun diskusi-diskusi sehingga petugas dapat mengetahui dan lancar dalam menjalankan tugasnya. Peningkatan disiplin dan loyalitas para petugas pemungutan lapangan dalam memungut pajak serta perlu dipertimbangkan intensif kerja. Mengadakan penyuluhan dan meingkatkan motivasi masyarakat guna menumbuhkan kesadaran dalam diri masyarakat atas kewajibannya membayar pajak yang merupakan langkah penting dalam usaha meingkatkan laju pemasukan pendapatan asli daerah. Perlunya sanksi tegas terhadap penyimpangan dan penyelewengan bagi wajib pajak ataupun pemungut pajak dan sanksi dengan pelaksanaan hukum bagi pelanggar pengumpul atau pemungut retribusi. Penyempurnaan sistem kerja sehingga tidak terjadi kebocoran-kebocoran dari penerimaan yang tidak diinginkan.

Hubungan nem mata pelajaran IPA dan Matematika SMP dengan prestasi belajar siswa pada mata diklat statika bangunan program keahlian gambar bangunan SMK Canda Bhirawa Pare

 

Kata Kunci : NEM, prestasi belajar Pandangan siswa terhadap matadiklat statika bangunan sebagai matadiklat paling sulit masih banyak didapatkan, hal tersebut mengakibatkan prestasi belajar matadiklat statika bangunan yang belum bisa dikatakan baik. Peneliti akan menghubungkan masalah tersebut dengan mata pelajaran yang bersifat menghitung sewaktu di SMP/MTs yaitu IPA dan matematika, dimana kedua mata pelajaran tersebut merupakan mata pelajaran yang didalamnya terdapat pembahasan mengenai masalah perhitungan. Dengan anggapan siswa yang menguasai mata pelajaran IPA dan matematika dengan baik diharapkan mampu juga untuk mengusai matadiklat statika bangunan. Tujuan penelitian ini adalah untuk mengetahui: (1) hubungan antara NEM pelajaran IPA SMP dengan prestasi belajar siswa pada matadiklat statika bangunan program keahlian Gambar Bangunan, (2) hubungan antara NEM pelajaran matematika SMP dengan prestasi belajar siswa pada matadiklat statika bangunan program keahlian Gambar Bangunan, dan (3) hubungan NEM mata pelajaran IPA dan matematika SMP dengan prestasi belajar siswa pada matadiklat statika bangunan program keahlian Gambar Bangunan. Rancangan penelitian yang digunakan adalah penelitian korelasional yang terdiri dari tiga variabel, yaitu NEM mata pelajaran IPA dan matematika SMP variabel bebas, sedangkan prestasi belajar matadiklat statika bangunan sebagai variabel terikat. Data dalam penelitian ini dianalisis menggunakan analisis korelasi product moment dan kolerasi berganda dengan menggunakan bantuan komputer program SPSS 17 for Windows. Dalam hal ini yang menjadi populasi adalah siswa kelas X program keahlian Gambar Bangunan SMK Canda Bhirawa Pare yang berjumlah 2 kelas dengan siswa sebanyak 70 orang. Sampel yang diambil sebanyak jumlah populasi, yaitu sebanyak 70 siswa. Hasil penelitian: (1) tidak ada hubungan antara NEM mata pelajaran IPA SMP dengan prestasi belajar siswa pada matadiklat statika bangunan dengan nilai signifikansi p (0,191), (2) tidak ada hubungan antara NEM mata pelajaran matematika SMP dengan prestasi belajar siswa pada matadiklat statika bangunan dengan nilai signifikansi p (0,782), dan (3) tidak ada hubungan NEM mata pelajaran IPA dan matematika SMP dengan prestasi belajar siswa pada matadiklat statika bangunan dengan nilai signifikansi F (0,424) >  (0, 05). Implikasi dari hasil penelitian ini, bahwa dalam menyeleksi penerimaan siswa baru SMK tidak menggunakan nilai NEM semata, tetapi bisa menggunakan nilai lain seperti: nilai rapor waktu SMP, melakukan interview, dan mengadakan tes terlebih dahulu, bisa berupa tes bakat ataupun minat.

Pengaruh penggunaan metode pembelajaran kontekstual model react terhadap hasil belajar IPA pada materi gaya siswa kelas IV di SD Negeri Tanjungrejo 5 Malang / Mukhammad Luqman Hakim

 

Kata Kunci : Pembelajaran Kontekstual Model REACT, hasil belajar. Selama ini proses pembelajaran masih menganggap bahwa pengetahuan siswa diperoleh dari menghafal teori dan guru sebagai sumber utama belajar sedangkan siswa hanya bertindak pasif untuk menerima apa yang diberikan oleh guru. Untuk itu perlu diterapkan metode pembelajaran kontekstual model REACT yaitu model pembelajaran yang mengaitkan materi dengan kehidupan sehari-hari, penggalian materi dari kehidupan nyata serta menerapkannya serta melatih siswa bekerja kelompok untuk bertukar ilmu pengetahuan kemudian diharapkan siswa mampu menyelesaian permasalahan yang diberikan oleh guru. Tujuan penelitian ini adalah untuk mengetahui pengaruh penggunaan metode pembelajaran kontekstual model REACT terhadap hasil belajar pada mata pelajaran IPA kelas IV SD Negeri Tanjungrejo 5 Malang. Jenis penelitian ini adalah quasi experiment (eksperimen semu). Penelitian ini dilakukan di SDN Tanjungrejo 5 Malang. Populasi dan sampel dalam penelitian ini diambil dari 2 kelas yang mempunyai kemampuan yang sama atau setara. Instrumen hasil belajar dalam penelitian ini menggunakan pretest dan postest. Teknik analisis hasil belajar menggunakan uji t (t-test). Dari hasil analisis hasil belajar kelas eksperimen dan kelas kontrol diketahui bahwa nilai thitung adalah 5.213 dan probability sebesar 0.000. Karena nilai probability menunjukkan 0.000< 0.005 maka H0 ditolak, sehingga dapat disimpulkan ada perbedaan yang signifikan antara hasil belajar kelas kontrol dan kelas eksperimen. Telah diketahui nilai thitung adalah 5.213 sedangkan nilai ttabel adalah 1.691. Berdasarkan data ini, uji t dilakukan dua sisi dengan daerah penerimaan H0 antara (-1.691) sampai (1.691). Nilai thitung sebesar 5.213 berada pada daerah penolakan ttabel atau daerah penolakan H0 serta nilai thitung > ttabel, maka dapat diketahui H0 ditolak. Berdasarkan hasil tersebut dapat disimpulkan bahwa hipotesis (H0) yang menyatakan “tidak ada pengaruh penggunaan metode pembelajaran kontekstual model REACT terhadap hasil belajar mata pelajaran IPA kelas IV SDN Tanjungrejo 5 Malang” ditolak. Dengan demikian dapat disimpulkan bahwa ada pengaruh penggunaan metode pembelajaran kontekstual model REACT terhadap hasil belajar mata pelajaran IPA kelas IV SDN Tanjungrejo 5 Malang. Berdasarkan kesimpulan di atas, maka disarankan (1) Sebelum kegiatan belajar mengajar sebaiknya guru mempersiapkan alat dan media yang akan digunakan. (2) Pada saat pelaksanaan kegiatan pembelajaran, sebaiknya guru benar-benar memperhatikan waktu agar tahapan-tahapan dapat terlaksana sesuai alokasi waktu yang tersedia (3) Penelitian ini perlu dikembangkan di kelas-kelas dengan materi yang berbeda pula.

Perkembangan teknologi ala tangkap nelayan Mayangan Probolinggo (2003-2010) / Ullyl Danik Karyani

 

Kata Kunci: Alat tangkap, nelayan Mayangan Probolinggo. Usaha penangkapan ikan merupakan mata pencaharian yang banyak dilakukan di wilayah pesisir Indonesia. Di Indonesia alat tangkap ikan bersifat tradisional kini telah dimodifikasi menggunakan alat bantu mesin sehingga menimbulkan perubahan sosial ekonomi masyarakat. Perubahan ini mendorong penulis untuk mengkaji lebih lanjut tentang kehidupan masyarakat nelayan, khususnya di Mayangan. Karakteristik lokasi Mayangan yang stategis dilihat dari jaraknya strategis terletak di jalur lalu lintas utama Jawa Timur. Alasan pemilihan angka tahun 2003-2010 yang aktivitas penangkapan ikan oleh nelayan di Pelabuhan Tanjung Tembaga yang telah terorganisir tahun 2003 dengan keberadaan KUD Mina Mayangsari merupakan cikal bakal pendirian Tempat Pelelangan Ikan Mayangan dan berdirinya Paguyuban Putra Samudra. Masalah pokok kajian ini adalah: pertama, Bagaimana perkembangan alat tangkap ikan nelayan Mayangan? kedua, Bagaimana menjelaskan pengaruh alat tangkap ikan terhadap pendapatan nelayan? Dan ketiga, Bagaimana relevansi antara teknologi penangkapan ikan dengan materi bahan ajar sejarah Tingkat SMA? Penelitian ini menggunakan metode diskriptif kualitatif. Langkah-langkah dalam penelitian deskriptif pendekatan kualitatif adalah: Observasi, Wawancara, Studi dokumentasi. Hasil dari penelitian menunjukkan beberapa hal: pertama, perkembangan alat tangkap tahun 2003 sampai 2010 ikut mempengaruhi armada perikanan antara lain seperti Pukat cincin yang digunakan Purse seine, Payang yang digunakan kapal Jonggrang ,Gill net dan Tramel net yang digunakan motor tempel dan Bubu dan prawe dasar digunakan perahu Jukung. Dominasi kapal yang berkuasa di Pelabuhan Mayangan ialah kapal Jonggrang dan Purse seine karena hasil tangkapan lebih banyak sehingga memunculkan jaringan sosial pada masyarakat Mayangan.Kedua alat tangkap berpengaruh terhadap pendapatan nelayan. Pendapatan nelayan dikategorikan sesuai nelayan Jukung, nelayan Motor tempel, dan kapal Motor menggunakan bagi hasil sistem teloan kesepakatan antara lain Juragan,Tekong,Pandega sehingga banyak timbul patron-klien berpusat pada pemilik modal. Ketiga, relevansi teknologi penangkapan ikan dengan materi sejarah tingkat SMA dapat dikaji dalam kurikulum KTSP kelas VII pada Semester 2 yang menjelaskan asal mula teknologi yang muncul pada Revolusi Industri yang berdampak bagi masyarakat Indonesia. Penelitian tentang perkembangan alat tangkap ini dapat digunakan sebagai acuan sejarah maritim dan sejarah sosial dalam pembelajaran guna menambah pengetahuan tentang penggunaan alat tangkap nelayan di Indonesia.

Implementasi program ekstrakurikuler dalam mewujudkan pembentukan karakter siswa SMA Negeri 2 Malang / Nefi Ruspitasari

 

Kata Kunci : Program Ekstrakurkuler, Pembentukan Karakter Kegiatan ekstrakurikuler merupakan wadah yang disediakan oleh satuan pendidikan untuk menyalurkan minat, bakat, hobi, kepribadian, dan kreativitas peserta didik yang dapat dijadikan sebagai alat untuk mendeteksi talenta peserta didik. Kegiatan ekstrakurikuler jika didesain secara profesional maka akan menjadi wahana dalam melahirkan bakat terbesar dalam diri anak, membentuk karakter positif pada siswa, dan tempat aktualisasi diri pada siswa. Penelitian ini bertujuan untuk mendeskripsikan: (1)program ekstrakurikuler di SMA Negeri 2 Malang, (2)pelaksanaan program ekstrakurikuler di SMA Negeri 2 Malang, (3)implementasi program ekstrakurikuler di SMA Negeri 2 Malang dapat mewujudkan pembentukan karakter pada siswa. Penelitian ini menggunakan pendekatan deskriptif kualitatif. Subjek penelitian ini adalah siswa yang mengikuti program ekstrakurikuler di SMA Negeri 2 Malang. Teknik pengumpulan data yang digunakan pada penelitian ini adalah observasi, wawancara, dan dokumentasi.. Pengecekan keabsahan temuan menggunakan teknik perpanjangan kehadiran, ketekunan pengamatan, dan triangulasi. Hasil penelitian ini menunjukkan bahwa di SMA Negeri 2 Malang terdapat berbagai macam jenis kegiatan ekstrakurikuler yang dibagi kedalam 6 bidang, diantaranya: (1) bidang olahraga terdiri dari bola basket dan bola voli; (2)Bidang bela negara terdiri dari Paskib dan PMR; ( 3)bidang IPTEK terdiri dari KIR dan Jurnalistik; (4) bidang seni terdiri dari tari tradisional, teater dan breakdance; (5) bidang keagamaan terdiri dari Badan Dakwah Islamdan ru’yah; dan, (6) bidang rekreatif terdiri dari pecinta alam. Jumlah ekstrakurikuler yang ada di SMAN 2 malang keseluruhan berjumlah 11 jenis namun tidak semua ekstrakurikuler tersebut aktif mengadakan latihan. Ekstrakurikuler yang tidak aktif diantaranya tenis meja, bulu tangkis, pramuka serta ru’yah. Ekstrakurikuler yang tidak aktif ini dikarenakan berbagai hal antara lain kurangnya siswa yang berminat, tidak adanya tenaga yang mampu mengoordinasi.Dukungan yang diberikan oleh pihak sekolah untuk semua kegiatan ekstrakurikuler berupa sebagai fasilitator, menyiapkan segala kebutuhan yang diperlukan oleh siswa maupun sebagai motivator yakni mendukung kegiatan yang akan dilaksanakan oleh ekstrakurikuler tertentu. Adanya program ekstrakurikuler di SMAN 2 Malang diharapkan mampu menjadi wadah dari berbagai bakat yang dimiliki oleh siswa-siswa SMAN 2 Malang. Selain untuk menjadi wadah penyalur bakat siswa SMAN 2 Malang program ekstrakurikuler juga mampu membentuk karakter positif bagi siswa. Karakter yang dapat dibentuk oleh semua jenis ekstrakurikuler diantaranya karakter disiplin, karakter tanggungjawab, karakter tekun.Sementara karakter kerja sama dapat dibentuk melalui kegiatan ekstrakurikuler yang biasanya dilaksanakan secara berkelompok seperti KIR, Bola basket, Bola voli. Karakter percaya diri dapat dibentuk melalui ekstrakurikuler tari tradisional dan teater. Karakter produktif dapat dibentuk melalui ekstrakurikuler jurnalistik. sementara itu melalui BDI diharapkan siswa dapat mengembangkan karakter taqwa. Ekstrakurikuler PMR serta Pecinta alam siswa mampu mengembangkan karakter peduli. Selain dapat mengembangkan karakter peduli PMR juga mampu mengembangan sikap tanggap terhadap keadaan disekitar.Melalui pendidikan karakter seorang siswa akan menjadi cerdas emosinya. Kecerdasan emosi adalah bekal penting dalam mempersiapkan anak menyongsong masa depan karena dengannya seseorang akan dapat berhasil dalam menghadapi segala macam tantangan, termasuk tantangan untuk berhasil secara akademis Berdasarkan hasil penelitian ini maka saran yang diberikan antara lain: Sebagai tempat mencari ilmu dan mengembangkan ilmu, maka perlu adanya penambahan referensi buku mengenai Pembentukan karakter di Perpustakaan Jurusan Hukum dan Kewarganegaraan, sehingga mahasiswa yang ingin mengembangkan ilmu yang berhubungan dengan Pembentukan karakter bisa mendapatkan bahan dan tambahan referen mengingat begitu urgennya pembentukan karakter untuk dilaksanakan kepada generasi muda. Pembahasan tentang kajian teori dan kajian lapangan dalam penelitian ini akan menambah referensi tentang keilmuan, khususnya mengenai pembentukan karakter. Sehingga dalam hal ini dapat digunakan untuk pengembangan pembentukan karakter, mulai dari strategi, metode, media dan juga pelaksanaan evaluasinya.Perlu meningkatkan motivasi guru pembina maupun pelatih ekstrakurikuler dalam pelaksanaan kegiatan ekstrakurikuler dalam mewujudan karakter siswa SMA Negeri 2 Malang, misalnya dengan memberikan fasilitas pendukung proses pembelajaran dan tambahan insentif.

Pengembangan multimedia pembelajaran mata pelajaran fisika SMA kelas X pokok bahasan arus listrik di SMA Negeri IV Kediri / Miftahudin

 

Kata kunci : pengembangan, multimedia pembelajaran, fisika Multimedia pembelajaran merupakan salah satu media pembelajaran yang saat ini banyak digunakan dalam proses pembelajaran. Multimedia merupakan perpaduan antara tulisan, gambar, serta suara. Dalam pemanfaatannya yang menggunakan Komputer menjadi daya tarik tersendiri bagi siswa untuk mempelajari fisika. Berdasarkan observasi di SMA Negeri 4 Kediri, dalam pembelajaran fisika media yang digunakan belum maksimal. Media yang digunakan kurang menarik, Ini dapat dilihat dari kegiatan pembelajarannya yang selalu memanfaatkan media papan tulis yang hanya bisa menghasilkan gambar statis sehingga siswa lebih banyak membayangkan dalam memahami konsep materi. Kegiatan pembelajarannya masih didominasi oleh guru dengan banyak menjalaskan materi, sehingga siswa lebih pasif dalam menerima materi. Oleh karena itu, multimedia dijadikan pilihan untuk digunakan sebagai media pembelajaran karena dengan multimedia siswa akan lebih memahami materi dengan konkrit dengan bantuan gambar dan animasi. Pengembangan multimedia pembelajaran ini bertujuan menghasilkan multimedia pembelajaran mata pelajaran fisika pokok bahasan arus listrik yang menarik dan bermanfaat bagi siswa. Sedangkan subyek uji coba pengembangan ini adalah siswa kelas X SMA Negeri 4 Kediri. Pengembangan multimedia pembelajaran ini divalidasi oleh seorang ahli media, dua orang ahli materi, diikuti uji coba individual sebanyak tiga siswa dan uji coba lapangan sebanyak dua puluh siswa. Hasil dari penelitian ini menunjukkan multimedia pembelajaran yang dihasilkan dinyatakan valid/layak digunakan sebagai media pembelajaran pada mata pelajaran fisika pokok bahasan arus listrik. Dalam proses pengembangan yang dilakukan, peneliti melakukan perbaikan sesuai saran dari validator (ahli media dan ahli materi). Perbaikan tersebut meliputi: (1) Pembenahan teknis tata kalimat. (2) pembenahan kualitas video yang terlalu panjang. (3) Pembenahan urutan bahasan materi. (4) Penambahan animasi dalam multimedia yang dikembangkan. Sedangkan hasil analisis angket yang diberikan kepada ahli media menunjukkan 82,50% dan ahli materi 80%.   Multimedia yang dikembangkan juga terbukti menarik dan bermanfaat. Hal ini ditunjukan oleh hasil analisis angket siswa 86,67% untuk uji coba individual, 83,25% untuk uji coba lapangan, selain itu kemanfaatan multimedia ini juga diperkuat oleh tes hasil belajar siswa yang menunjukkan nilai rata-rata siswa sebesar 97 dari skor maksimal 100. Berdasarkan hasil penelitian ini dapat disarankan kepada pihak sekolah agar mendorong pelaksanaan pembelajaran dengan memanfaatkan multimedia pada mata pelajaran yang lainnya karena multimedia sangat berguna untuk memaksimalkan pembelajaran di kelas.

Penerapan model Explicit Instuction untuk meningkatkan kualitasa pembelajaran IPA siswa kelas IV A Sdn Lesanpuro 3 Kota Malang / Ayuk Susilaning Stiyas

 

Kata Kunci: Model Explicit Instruction, Pembelajaran IPA. Pembelajaran IPA menekankan pada pemberian pengalaman langsung kepada siswa. Berdasarkan hasil observasi pembelajaran IPA di SDN Lesanpuro 3 Kota Malang, pembelajaran kurang melibatkan siswa secara langsung. Guru mengajar dengan metode ceramah dan juga demonstrasi namun hanya dilakukan oleh guru. Siswa hanya mengamati, mendengarkan penjelasan guru, mencatat, kemudian mengerjakan LKS. Hal ini membuat pembelajaran kurang bermakna bagi siswa, sehingga dari segi proses dan hasil masih belum maksimal. Penelitian ini bertujuan: (1) mendeskripsikan penerapan model Explicit Instruction dalam pembelajaran IPA pada siswa kelas IVA SDN Lesanpuro 3 Kota Malang, (2) mendeskripsikan aktivitas siswa kelas IVA SDN Lesanpuro 3 Kota Malang pada pembelajaran IPA selama diterapkan model Explicit Instruction, (3) mendeskripsikan hasil belajar siswa kelas IVA SDN Lesanpuro 3 Kota Malang pada pembelajaran IPA setelah diterapkan model Explicit Instruction. Subyek penelitian ini adalah siswa kelas IVA SDN Lesanpuro 3 Kota Malang tahun ajaran 2011/2012 dengan jumlah 35 siswa. Penelitian ini menggunakan rancangan Penelitian Tindakan Kelas (PTK), dengan model siklus yang dikembangkan oleh Kemmis dan Mc Taggart yang meliputi empat tahapan yaitu: planning (rencana), action (tindakan), observation (pengamatan), dan reflection (refleksi). Pengumpulan data menggunakan teknik observasi, dokumentasi, pemberian tugas mandiri, dan catatan lapangan. Hasil penelitian mencerminkan bahwa penerapan model Explicit Instruction pada siswa kelas IVA SDN Lesanpuro 3 Kota Malang dapat berhasil dengan baik. Hal ini terbukti dengan tercapainya keberhasilan penerapan model Explicit Instruction pada siklus I mencapai 87,5%, dan meningkat menjadi 94,65% pada siklus II. Selain itu, aktivitas siswa juga mengalami peningkatan setelah diterapkan model Explicit Instruction. Pada siklus I nilai rata-rata aktivitas siswa mencapai 70,5 dan menjadi 78,5 pada siklus II. Sedangkan hasil belajar siswa pada siklus I memperoleh nilai rata-rata 69,7 dengan ketuntasan belajar siswa mencapai 50%, dan menjadi 77,96 dengan ketuntasan belajar siswa mencapai 81,5% pada siklus II. Berdasarkan data tersebut, dapat disimpulkan bahwa penerapan model Explicit Instruction dapat meningkatkan kualitas pembelajaran IPA siswa kelas IVA SDN Lesanpuro 3 Kota Malang. Pada penelitian ini, disarankan agar guru mempunyai cara untuk memusatkan perhatian siswa terutama setelah kegiatan pelatihan, mengorganisasikan waktu lebih baik lagi serta terus melatih, memotivasi siswa agar mau menanggapi umpan balik yang diberikan, serta menyesuaikan materi yang akan diajarkan.

Pengembangan bahan ajar kimia berbasis learning cycle 5E pada materi laju reaksi untuk kelas XI kompetensi keahlian kimia analisis di SMK Negeri VII / Arum Setyaningsih

 

Kata Kunci: Bahan Ajar, Model Learning Cycle 5E, Laju Reaksi SMKN 7 Malang merupakan SMK di kota Malang yang memiliki jurusan kompetensi keahlian kimia analisis. Berdasarkan hasil wawancara dengan guru kimia, dalam pelaksanaan proses belajar mengajar yang berlangsung di kelas XI SMK Negeri 7 Malang Kompetensi Keahlian Kimia Analisis mengalami kendala, yakni rendahnya tingkat pemahaman siswa terhadap materi laju reaksi, yakni 86% siswa yang belum mencapai nilai SKM. Oleh sebab itu, guru kimia menyatakan perlu adanya pengembangan bahan ajar dan variasi model pembelajaran. Hal ini diperkuat dengan kajian teoritis dan faktual yakni model pembelajaran Learning Cycle 5E dirasa tepat digunakan dalam pengorganisasian materi laju reaksi dalam pengembangan bahan ajar kimia di SMKN 7 Malang berupa buku ajar dan RPP. Tujuan dari pengembangan bahan ajar kimia pada materi laju reaksi adalah mengembangkan dan mengetahui kelayakan bahan ajar kimia pada materi laju reaksi berbasis Learning Cycle 5E untuk kelas XI Kompetensi Keahlian Analis Kimia di SMKN 7 Malang. Peneliti mengadopsi metodologi penelitian dan pengembangan yang dikemukakan oleh Thiagarajan yakni model 4-D (four-D) yang meliputi tahap define, design , develop dan desiminate . Dalam hal ini peneliti menggunakan tahapan penelitian dan pengembangan hingga pada tahap ketiga. Hasil pengembangan produk dilakukan uji coba produk untuk mengetahui kelayakan dan setelah direvisi dilakukan crosscheck kepada guru untuk mengetahui kesesuaian produk. Uji coba produk yang dilakukan meliputi validasi produk oleh dosen, guru dan uji terbatas oleh siswa kelas XI melalui instrumen penelitian yang berupa lembar validasi, dan soal uji kompetensi. Hasil analisis data produk hasil pengembangan bahan ajar laju reaksi menyatakan, buku ajar yang dikembangkan dinyatakan sangat valid dengan tingkat validitas total 3,9 oleh validator dosen dan dinyatakan valid dengan tingkat validasi 3,2 oleh validator guru sehingga buku ajar dapat digunakan. RPP yang dikembangkan dinyatakan valid dengan tingkat validitas 3 sehingga RPP dapat digunakan.Seluruh soal pilihan ganda dan esai yang tertulis dalam uji kompetensi pada buku ajar telah diuji validitas, realibilitas, tingkat kesukaran dan daya beda dinyatakan valid sehingga dapat digunakan. Hasil analisis data dan crosscheck kepada guru kimia dapat disimpulkan bahwa bahan ajar yang dikembangkan layak dan baik untuk digunakan.

Implementasi pembelajaran tematik kelas 1 semester 2 di SDN Percobaan 01 Malang / Hermin Tri Wahyuni

 

Kata Kunci: Implementasi, Pembelajaran Tematik, SDN Percobaan 01 Malang. Berdasarkan hasil observasi dan wawancara di SDN Percobaan 01 Malang menunjukkan bahwa di sekolah tersebut telah melaksanakan pembelajaran tematik di kelas rendah yaitu kelas 1 sampai 3. Seperti yang telah diketahui, tematik merupakan pembelajaran untuk anak kelas rendah di sekolah dasar dan bagian dari KTSP yang sedang dikembangkan pada saat ini. Tematik merupakan salah satu bentuk pendekatan dari pembelajaran terpadu yang menjadi hal baru bagi guru karena pembelajaran berdasarkan pada satu tema tertentu. Dalam pelaksanaan pembelajaran tematik di sekolah, masih banyak ditemukan kekurangan dan kendala. Penelitian ini bertujuan untuk: (1) mengetahui pelaksanaan pembelajaran tematik di SDN Percobaan 01 Malang, (2) faktor pendukung pelaksanaan pembelajaran tematik di SDN Percobaan 01 Malang, (3) faktor penghambat pelaksanaan pembelajaran tematik di SDN Percobaan 01 Malang, dan (4) upaya untuk mengatasi hambatan pelaksanaan pembelajaran tematik di SDN Percobaan 01 Malang. Jenis penelitian yang digunakan adalah studi kasus. Kegiatan penelitian dilaksanakan dengan melakukan pengamatan langsung pelaksanaan pembelajaran tematik di kelas, pencarian data dengan melakukan wawancara, memberikan angket kepada guru, pengumpulan dokumen untuk mengetahui kelemahan pelaksanaan pembelajaran tematik. Hasil penelitian menunjukkan bahwa pelaksanaan pembelajaran tematik di SDN Percobaan 01 sudah baik dan mencakup semua konsep pembelajaran tematik, mulai dari persiapan pelaksanaan pembelajaran, pelaksanaan pembelajaran dan evaluasi yang dilakukan guru. Fakor pendukung yang dikemukakan ditinjau dari beberapa hal yaitu dukungan dari: (1) sekolah, (2) guru, (3) siswa, dan (4) lingkungan sekitar sekolah. faktor penghambat yang ditemukan adalah kesulitan guru dalam : (1) Mencari kaitan antara mata pelajaran satu dengan yang lain dalam satu tema, (2) Merancang pembelajaran yang padu. Upaya yang dilakukan guru untuk mengatasi hambatan yang ditemukan adalah (1) Menggambarkan terlebih dahulu jaringan tema, sehingga akan mudah dalam mencari kaitannya, (2) Membuat skenario pembelajaran yang disesuaikan dengan jaringan tema dan kaitan antar mata pelajaran yang telah ditemukan untuk menciptakan pembelajaran yang padu, (3) Diskusi dengan guru lain di dalam KKG atau dengan teman sejawat yaitu guru kelas 1B. Beberapa saran yang dapat disampaikan yaitu : (1) Hasil penelitian ini dapat menjadi bahan identifikasi untuk meningkatkan kualitas pembelajaran tematik di SDN Percobaan 01 Malang, (2) Hasil penelitian ini dapat dijadikan masukan untuk meningkatkan kualitas dalam melaksanakan pembelajaran oleh guru.

Studi perbandingan penggunaan dekak-dekak dengan penggunaan potongan batang lidi terhadap hasil belajar matematika siswa kelas 1 SDN Gadang IV Kota Malang / Lintang Fajar Kusuma Wardani

 

Kata Kunci: dekak-dekak, potongan batang lidi, hasil belajar, penjumlahan dua bilangan, siswa SD Pada tahapan perkembangan kognitif, siswa sekolah dasar sudah bisa berpikir logis tentang berbagai hal, termasuk hal yang agak rumit, tetapi dengan syarat bahwa hal-hal tersebut disajikan secara konkret. Media merupakan alat yang mampu menyampaikan pesan dari guru kepada siswa. Berdasarkan hasil observasi serta wawancara dengan guru kelas yang dilakukan oleh peneliti di kelas 1 SDN Gadang 4 Kecamatan Sukun, Kota Malang terdapat beberapa permasalahan yaitu siswa sering mengalami kekeliruan dalam menuliskan urutan bilangan saat menggunakan cara bersusun pendek. Siswa mengalami kesulitan dalam menentukan dimanakah letak satuan dan puluhan. Rancangan yang digunakan dalam penelitian ini yaitu penelitian komparatif. Populasi dalam penelitian ini yaitu seluruh siswa kelas V SDN Gadang 4 Kota Malang. Sampel penelitian yaitu kelas 1A sebagai kelas eksperimen 1 dan kelas 1B sebagai kelas eksperimen 2. Langkah-langkah penelitian ini antara lain yaitu: (1) pemberian pre-test, (2) pemberian perlakuan media dekak-dekak untuk kelas 1A dan pemberian perlakuan batang lidi untuk kelas 1B, (3) pemberian post-test. Analisis data yang digunakan meliputi uji normalitas, uji homogenitas, dan uji hipotesis. Hasil penelitian menunjukkan rata-rata pre-test kelas eksperimen 2 yaitu 55 dan kelas eksperimen 1 yaitu 60. Pada pemberian post-test rata-rata kelas kelas eksperimen 2 yaitu 60 sedangkan kelas eksperimen 1 yaitu 66. Berdasarkan hasil uji homogenitas data kelas eksperimen 2 dan kelas eksperimen 1 mempunyai varians hasil belajar (post-test) yang homogen karena nilai probabilitas 0,936 > 0,05 dan F levene Statistic (hitung) 0,006 < Ftabel (4,027). Hasil uji normalitas hasil belajar (post-test) menunjukkan bahwa kelas kontrol dan kelas eksperimen berdistribusi normal. Kelas kontrol 0,137 > 0,05 sedangkan kelas eksperimen 0,147 > 0,05. Hasil uji hipotesis menunjukkan nilai signikansi 0,032 < 0,05 pada taraf signifikansi 0,05. Selain itu juga diperoleh nilai thitung > ttabel (2,218 > 2,009). Berdasarkan hasil penelitian yang dilakukan, dapat disimpulkan bahwa ada perbedaan yang signifikan antara hasil belajar siswa yang menggunakan media dekak-dekak dengan batang lidi. Saran yang diberikan peneliti yaitu (1) bagi guru hendaknya menggunakan media pembelajaran yang lebih bervariatif untuk meningkatkan semangan belajar siswa. (2) bagi sekolah hendaknya media pembelajaran yang ada disekitar siswa dapat dijadikan sebagai referensi dan penunjang dalam pembelajaran untuk meningkatkan mutu pendidikan.

Penerapan metode demonstrasi dalam pembelajaran menggambar tehnik membatik untuk meningkatkan kemampuan seni anak kelompok B RA Nurul Huda Cemandi Kersikan Bangil / Nur Laila

 

Keyword : Demonstration Metod, Drawing of Batik, Technique, Art Ability of Child Group B Ability at child of Group B is 49 % from the ability of child is wanted. Children interest less in the drawing activity, because in draw studying of batik technique, children just are given model without have guidance, so children draw just do it, without valve of art. Based on the experience, so the observer choose the right activity solve the art less by implementation of demonstration method in draw studying of batik technique. This experiment have purpose to make description demonstration method in the draw studying of batik technique to increase children art ability in Group B RA Nurul Huda. The method that used is research of class action, the experiment by two cycle, each cycle are planning stage, action stage, observation stage and reflection stage. The subject are 17 children in Group B RA Nurul Huda. The instrument used are observation and documentation, the analisys technique used is descriptif. The result of this experiment show that the art abiltity of child in pre cycle is 49 % increase become 63 % in cycle I and icrease become 87 % in cycle II. Based on the result of experiment can summed up that implementation demonstration method in the draw studying of child Group B RA Nurul Huda. Based on the experience, child can make expretion by drawing. Some suggested to the teacher it will good to use demonstration method in the draw studying of batik technique to increase the art ability.

Pengaruh strategi pembelajaran kewirausahaan, sosek orang tua, sikap kewirausahaan, minat kewirausahaan terhadap kesiapan kerja mandiri mahasiswa PPS di Kota Malang / Sebastianus Gudat

 

Kata Kunci: Pengaruh Strategi Pembelajaran Kewirausahaan, Latar Belakang Sosial Ekonomi Orang Tua, Sikap Kewirausahaan Mahasiswa, Minat Kewirausahaan Mahasiswa, dan Kesiapan Kerja Mandiri Mahasiswa. Banyak faktor yang berpengaruh terhadap kesiapan kerja mandiri mahasiswa dalam memasuki persaingan dunia kerja. Untuk tercapainya kesiapan kerja mandiri mahasiswa yang optimal, diperlukan adanya dukungan: kualitas pembelajaran kewirausahaan, latar belakang sosial ekonomi orang tua, sikap kewirausahaan mahasiswa, minat kewirausahaan mahasiswa. Beberapa masalah yang teridentifikasi di lapangan yakni masih belum tertatanya strategi pembelajaran kewirausahaan yang baik, latar belakang sosial ekonomi orang tua yang kurang mendukung dalam berwirausaha, kurangnya sikap dan minat kewirausahaan mahasiswa. Tujuan penelitian ini adalah untuk menjelaskan pengaruh strategi pembelajaran kewirausahaan, latar belakang sosial ekonomi orang tua, sikap kewirausahaan mahasiswa, minat kewirausahaan mahasiswa dengan kesiapan kerja mandiri mahasiswa PTS di Kota Malang. Penelitian ini menggunakan pendekatan kuantitatif dengan rancangan deskriptif korelasional. Penelitian ini mengambil sampel sebanyak 8 PTS di Malang dengan total 105 responden. Pengumpulan data dilakukan dengan menggunakan kuisioner, observasi, wawancara dan dokumentasi, serta teknik analisis data yang digunakan adalah Structural Equation Modelling (SEM). Hasil penelitian menunjukkan bahwa, 1) Strategi pembelajaran kewirausahaan berpengaruh signifikan terhadap sikap kewirausahaan mahasiswa. Koefisien jalur pengaruh langsung kedua variabel adalah 0,463. Maknanya adalah strategi pembelajaran kewirausahaan yang semakin baik akan dapat meningkatkan sikap kewirausahaan mahasiswa, 2) Strategi pembelajaran kewirausahaan tidak berpengaruh signifikan terhadap minat kewirausahaan mahasiswa. Meskipun tidak berpengaruh secara signifikan antara kedua variabel tersebut, apabila indikator strategi pembelajaran kewirausahaan tersebut diperbaiki dan ditingkatkan, maka akan meningkat pula minat kewirausahaan mahasiswa, 3) Latar belakang sosial ekonomi orang tua tidak berpengaruh signifikan terhadap sikap kewirausahaan mahasiswa. Meskipun tidak berpengaruh secara signifikan antara kedua variabel tersebut, apabila indikator latar belakang sosial ekonomi orang tua tersebut semakin baik, maka akan semakin baik pula terhadap sikap kewirausahaan mahasiswa, 4) Latar belakang sosial ekonomi orang berpengaruh signifikan terhadap minat kewirausahaan mahasiswa. Koefisien jalur pengaruh langsung kedua variabel adalah 0,546. Maknanya adalah latar belakang sosial ekonomi orang yang semakin baik akan akan dapat membantu terhadap minat kewirausahaan mahasiswa, 5) Sikap kewirausahaan mahasiswa berpengaruh signifikan terhadap kesiapan kerja mandiri mahasiswa. Koefisien jalur pengaruh langsung kedua variabel adalah 2,655. Maknanya adalah sikap kewirausahaan mahasiswa yang semakin baik akan memberikan peningkatan dukungan moril pada kesiapan kerja mandiri mahasiswa, dan 6) Minat kewirausahaan mahasiswa berpengaruh signifikan terhadap kesiapan kerja mandiri mahasiswa. Koefisien jalur pengaruh langsung kedua variabel adalah 0,493. Maknanya adalah minat kewirausahaan mahasiswa yang semakin meningkat dan baik akan memberikan peningkatan pada kesiapan kerja mandiri mahasiswa Berdasarkan penelitian tersebut, maka disarankan; 1) Melakukan perbaikan dan penataan urutan penyajian isi mata kuliah kewirausahaan, 2) Peningkatan dan perbaikan media pembelajaran kewirausahaan, 3) Penataan penjadwalan penggunaan strategi pembelajaran kewirausahaan, 4) Peningkatan kemajuan belajar mahasiswa, 5) Peran serta aktif orang tua (tanpa membedakan latar belakang sosial ekonomi yang dimiliki) dalam memberi dukungan dan memotivasi anak didiknya dalam rangka menumbuhkembangkan sikap kewirausahaan mahasiswa dan minat kewirausahaan mahasiswa, 6) Menciptakan keberanian mencoba berwirausaha dan perencanaan yang baik untuk berwirausaha, dan 7) Peningkatan pengetahuan kewirausahaan mahasiswa, melalui; a) pengetahuan kewirausahaan selama di bangku kuliah, b) fasilitas sarana dan prasarana yang cukup memadai selama mengikuti perkuliahan di kampus, c) memiliki pengetahuan dan pengalaman untuk mengatasi kegagalan dalam berwirausaha, d) memiliki pengetahuan manajemen sumber daya manusia yang memadai untuk berwirausaha, e) memiliki pengetahuan manajemen keuangan yang memadai untuk berwirausaha, dan f) mengetahui cara terbaik untuk memulai usaha mandiri.

Penerapan metode pemberian tugas untuk meningkatkan kemampuan seni menggambar anak kelompok A di TK Aba I Gondang Legi Beji Pasuruan / Eni Triana

 

Kata kunci : metode pemberian tugas, kemampuan seni. Pembelajaran menggambar di bidang seni menggambar sangat penting untuk meningkatkan kemampuan seni dan perasaan anak melalui garis-garis, namun keberhasilan pembelajaran seni menggambar anak di TK ABA I Gondanglegi Beji Pasuruan masih rendah. Berdasarkan pengamatan dari 17 peserta didik yang ada di TK ditemukan bahwa 12 anak yang belum mampu menggambar sehingga masih mendapat bintang 1 dan 2 . Penelitian ini bertujuan untuk: (1) mendeskripsikan penerapan metode pemberian tugas untuk meningkatkan kemampuan seni menggambar anak kelompok A, di TK ABA I Gondanglegi Beji Pasuruan, (2) mendeskripsikan peningkatan kemampuan seni menggambar anak kelompok A di TK ABA I Gondanglegi Kecamatan Beji Pasuruan. Rancangan penelitian yang digunakan adalah rancangan penelitian tindakan kelas dengan proses siklus dari setiap tahapan : perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian ini menggunakan metode pemberian tugas melalui menggambar rumah untuk meningkatkan kemampuan seni anak kelompok A TK ABA I, sedangkan yang menjadi subyek penelitian adalah anak didik kelompok A dengan jumlah 17 anak dan 2 orang kolabolator (teman sejawat). Hasil penelitian menunjukan kemampuan seni anak dalam penerapan metode pemberian tugas pada pratindakan meningkat dari 50 % pada siklus 1 kemampuan seni anak mencapai 62 % meningkat menjadi 81% pada siklus ke2 peninggkatan kemampuan seni menggambar anak ditandai dengan perolehan rata–rata pada siklus 1 12% dan siklus ke II 19 %. Berdasarkan hasil penelitian dapat disimpulkan bahwa penerapan pemberian tugas dalam kemampuan seni menggambar anak dapat ditandai dengan meninggkatnya kemampuan seni dalam memahami penjelasan guru, minat kemandirian, imajinasi, kreatifitas, komposisi dan mengerakkan jari tanganya. Disarankan kepada pendidik PAUD pembelajaran menggambar untuk meningkatkan kemampuan seni anak TK.

Penerapan permainan ular tangga untuk meningkatkan kemampuan berbicara anak kelompok A di TK Ummatul Wahidah Gempeng Bangil / Lilik Mas'udah

 

Kata kunci: Permainan ular tangga, kemampuan berbicara anak. Penelitian ini berlatar belakang pada kurangnya kemampuan berbicara anak, hal ini disebabkan karena perkembangan anak yang kurang optimal, selain hal tersebut guru dalam menstimulasi berbagai perkembangan anak cara guru cenderung konvensional dimana pembelajaran masih berpusat pada guru. Penelitian ini bertujuan untuk mengembangkan kemampuan berbicara anak dengan menggunakan media permainan ular tangga. Dalam penelitian ini bertujuan sebagai berikut : (1) Mendeskripsikan penerapan permainan ular tangga yang dapat meningkatkan kemampuan berbicara anak Kelompok A di TK. Ummatul Wahidah Gempeng Bangil, (2) Mendeskripsikan peningkatan pembelajaran dengan penerapan permainan ular tangga untuk meningkatkan kemampuan berbicara anak Kelompok A di TK Ummatul Wahidah. Penelitian yang digunakan adalah penelitian tindakan kelas yang terdiri dari dua siklus, masing-masing siklus terdiri dari tahap perencanaan, pelaksanaan tindakan, observasi dan refleksi. Subyek penelitian yang digunakan sejumlah 20 anak dan melibatkan satu guru kolabolator, tempat penelitian di TK Ummatul Wahidah. Teknik pengumpulan data yang dilakukan melalui tehnik observasi terhadap proses pembelajaran kemampuan berbicara. Tehnik analisis data yang digunakan untuk menguji hipotesis tindakan yaitu secara deskriptif baik secara kualitatif maupun kuantitatif dengan ketuntasan belajar minimal secara individu dan klasikal. Hasil penelitian sebagai berikut: kemampuan berbicara pada pra tindakan diperoleh rata-rata 68%. Pada siklus I dilakukan sebanyak 2 kali pertemuan pada 3 dan 4 April 2012 pada pertemuan 1 dan pertemuan 2 diperoleh rata-rata 79% dengan kategori B. Pada siklus II dilakukan 2 kali pertemuan yaitu pada tanggal 18 dan 19 April 2012 diperoleh rata-rata 89% terdapat kenaikan skor sebesar 10%. Berdasarkan hasil penelitian dan pembahasan dapat disimpulkan bahwa media permainan ular tangga dapat diterapkan untuk mengembangkan kemampuan berbicara: (1) Berbicara dengan teman sebaya tentang rencana dalam bermain (2) menjawab pertanyaan tentang keterangan atau informasi secara sederhana (3) menyebutkan posisi keterangan tempat misal : diluar, didalam, diatas, dll (4) Indikator menjawab pertanyaan tentang keterangan tempat, misal : di dalam, di luar, di atas, dll.Bagi guru TK dalam pembelajaran kemampuan berbicara anak disarankan agar guru memberikan pembelajaran yang menerapkan permainan ular tangga.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 |