Pengaruh kecerdasan intelektual, motivasi belajar, dan persepsi siswa tentang kopmpetensi guru IPS terhadap prestasi belajar siswa kelas VII pada mata pelajaran IPS terpadu di SMPN 18 Kota Malang / Rosyida

 

Kata kunci: kecerdasan intelektual, motivasi belajar, persepsi siswa tentang kompetensi guru IPS, prestasi belajar siswa. Prestasi belajar adalah salah satu dari sekian alat ukur untuk mengukur dan mengetahui tingkat pemahaman siswa atas materi pelajaran yang diberikan oleh guru maupun yang ia pelajari sendiri dengan kata lain merupakan hasil dari apa yang telah dikerjakan. Lazimnya ditunjukkan dengan nilai tes atau angka yang di-berikan oleh guru. Banyak faktor yang mempengaruhi tingkat prestasi belajar siswa, salah satunya yaitu tingkat kecerdasan intelektual siswa. Disamping itu, berdasarkan hasil pengamatan peneliti pada siswa kelas VII SMPN 18 kota Malang, masih ada faktor lain yaitu motivasi belajar dan persepsi siswa tentang kompetensi guru yang dapat mempengaruhi prestasi belajar siswa. Tujuan penelitian ini adalah untuk mengetahui dan menjelaskan pengaruh kecerdasan intelektual, motivasi belajar, dan persepsi siswa tentang kompetensi guru IPS terhadap prestasi belajar siswa kelas VII pada mata pelajaran IPS ter-padu di SMPN 18 kota malang baik secara parsial maupun simultan. Penelitian ini menggunakan metode penelitian kuantitatif dengan rancang-an penelitian berupa explanatory research. Variabel-variabel bebas dalam peneli-tian ini adalah kecerdasan intelektual, motivasi belajar, dan persepsi siswa tentang kompetensi guru IPS sedangkan variabel terikatnya adalah prestasi belajar siswa pada mata pelajaran IPS terpadu. Penelitian ini dilaksanakan di SMPN 18 kota Malang pada bulan februari sampai bulan april tahun 2012. Subyek penelitian ini adalah siswa kelas VII khususnya kelas A, B, dan C yang berjumlah 126 siswa. Untuk mengetahui total sampel penelitian ini menggunakan rumus solvin sehing-ga diketahui total sampelnya adalah 96 siswa dan untuk teknik pengambilan sam-pelnya menggunakan proportional random sampling. Sedangkan data penelitian dalam penelitian ini diperoleh dengan menggunakan instrumen penelitian berupa dokumentasi sekolah dan closed questioner yang menggunakan skala likert deng-an lima alternatif jawaban. Untuk mengetahui tercapai atau tidaknya tujuan pene-litian ini dilakukan analisis regresi dengan regresi linear berganda. Berdasarkan hasil analisis regresi linear berganda dalam penelitian ini di-peroleh nilai R Squre sebesar 0.773 yang berarti 77.3 % variabel terikat yaitu prestasi belajar siswa pada mata pelajaran IPS terpadu dapat dijelaskan oleh tiga variabel bebas yaitu kecerdasan intelektual, motivasi belajar, dan persepsi siswa tentang kompetensi guru IPS. Disamping itu, juga diperoleh persamaan regresi linear berganda, yaitu: Y = 18,961 + 0,099 X1 + 0,550 X2 + 0,288 X3 yang berarti bahwa jika tidak ada variabel bebas kecerdasan intelektual (X1), motivasi belajar (X2), dan persepsi siswa tentang kompetensi guru IPS (X3), maka prestasi belajar siswa (Y) adalah 18,961. Dari persamaan tersebut, juga diketahui bahwa motivasi

Pemetaan resistivitas dengan metode geolistrik untuk mengindentifikasi intrusi air sepanjang bantaran sungai di Desa Glanggang, Pakisaji, Malang / Evi Nurul Azizah

 

Kata kunci: Geolistrik, Wenner, Res2Dinv, Intrusi Air. Air bawah tanah merupakan sumberdaya alam terbarukan yang memiliki peranan penting bagi kehidupan masyarakat. Dengan pertumbuhan penduduk yang sangat pesat menyebabkan eksploitasi air bawah tanah meningkat dengan pesat. Fenomena ini menyebabkan dampak negatif terhadap kuantitas maupun kualitas air bawah tanah salah satunya adalah intrusi air sungai yang tercampur dengan polutan sampah. Dampak negatifnya dapat berupa amblesan. Salah satu metode geofisika yang dapat digunakan dalam penelitian potensi tanah ambles adalah metode geolistrik tahanan jenis atau metode resistivitas. Resistivitymeter OYO McOHM Vertical Sounding dan Lateral Mapping atau yang biasa disebut dengan teknik pengambilan data 2D (dua dimensi). Penelitian geolistrik di Desa Glanggang, Kecamatan Pakisaji, Kabupataen Malang. Kemiringan tanah di sekitar sungai rata-rata 30 derajat.Tujuannya adalah menginterpretasi informasi lapisan bawah permukaan tanah pada areal yang diteliti. Interpretasi dan analisis datanya menggunakan software Res2Dinv. Berdasarkan hasil analisis dan hasil interpretasi maka lintasan yang sejajar dengan sungai diduga bahwa berpotensi ambles. Hal ini disebabkan dari jenis tanah bagian atas yaitu lapisan alluvium yang memiliki nilai resistivitas 93,8-636 Ohm-meter dikedalaman sekitar 1-7,41 meter yang terletak antara bentangan 6-90 meter dapat memberikan tekanan pada lapisan lempungan yang berada pada kedalaman sekitar 5,10-9,95 meter yang terletak antara bentangan 20-68 meter. Lintasan yang sejajar dengan sungai ini tanahnya sudah terintrusi air yang telah bercampur dengan rembesan polutan sampah, sehingga nilai resistivitasnya sangat rendah. Jika ini terjadi terus menerus, maka dapat menyebabkan kaulitas air tanahnya akan semakin buruk dan dapat juga mengakibatkan penyakit apabila dikonsumsi. Sedangkan pada lintasan yang tegak lurus dengan sungai ini berada di pemukiman warga. Karena sebagian besar jenis lapisan tanahnya mempunyai nilai resistivitas yang rendah, sehingga dapat disimpulkan tanahnya sudah terintrusi air yang berpolutan.

Pengaruh minat membaca dan kebiasaan belajar terhadap prestasi belajar siswa kelas X pada mata pelajaran menerapkan konsep dasar akuntansi di SMK Negeri Pasirian / Mukhaimin Risa Safarisma

 

Kata Kunci: minat membaca, kebiasaan belajar, prestasi belajar. Minat membaca generasi muda sekarang ini semakin menurun. Padahal dengan minat membaca yang baik siswa akan berhasil dalam prestasi belajar. Selain siswa harus mempunyai minat membaca yang baik, siswa juga harus mempunyai kebiasaan belajar yang baik pula. Kebanyakan siswa sekarang ini memiliki kebiasaan belajar yang kurang baik. Padahal efektivitas belajar tergantung pada kebiasaan belajar yang baik dan juga minat membaca siswa. Apabila minat membaca dan kebiasaan belajar siswa baik maka prestasi belajar siswa juga akan baik. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui pengaruh langsung maupun tidak langsung antara minat membaca dan kebiasaan belajar terhadap prestasi belajar siswa. Penelitian ini merupakan penelitian eksplanatif dengan menggunakan analisis regresi. Teknik pengambilan sampel pada penelitian ini adalah random sampling, populasi penelitian ini adalah siswa kelas X Program Keahlian Akuntansi di SMK Negeri Pasirian dengan jumlah siswa 117, sehingga sampel yang digunakan adalah 91 orang. Data diperoleh dengan menyebarkan angket dan dokumentasi nilai rapor semester ganjil. Variabel bebas dalam penelitian ini adalah minat membaca (X1) dan kebiasaan belajar (X2) dan variabel terikatnya yaitu prestasi belajar siswa pada mata pelajaran menerapkan konsep dasar akuntansi (Y). Hasil penelitian ini menunjukkan bahwa (1) terdapat pengaruh antara minat membaca terhadap prestasi belajar siswa pada mata pelajaran menerapkan konsep dasar akuntansi, (2) terdapat pengaruh kebiasaan belajar terhadap prestasi belajar siswa, (3) secara simultan variabel minat membaca dan kebiasaan belajar berpengaruh terhadap prestasi belajar siswa kelas X Akuntansi. Berdasarkan hasil penelitian tersebut disarankan agar 1) orang tua dan guru sebaiknya terus memberikan dorongan kepada siswa untuk terus meningkatkan minat membaca dan memperhatikan kebiasaan belajar, 2) guru harus menanamkan minat membaca dan kebiasaan belajar yang baik dalam proses belajar mengajar, 3) siswa harus benar-benar meningkatkan minat membacanya dan memperhatikan kebiasaan belajarnya agar tercapai kesuksesan dalam belajar.

Hubungan kemampuan siswa dalam pemenggalan kata dengan kemampuan menulis karangan deskripsi di kelas V SDN Polowijen 2 Kota Malang / Rahayuningsih

 

Kata kunci: Kemampuan siswa, Memenggal kata, Karangan Deskripsi. Dalam pembelajaran Bahasa Indonesia di sekolah dasar, khususnya materi pemenggalan kata, masih banyak ditemukan kesalahan penulisan, terutama pada kata-kata dasar. Hasil observasi yang dilakukan oleh peneliti di SDN Polowijen 2 Malang banyak ditemukan kesalahan pemenggalan kata pada saat siswa diberi tugas menulis karangan. Tujuan penelitian ini adalah untuk mengetahui (1) hubungan kemampuan siswa dalam memenggal kata (2) kemampuan siswa dalam menulis karangan deskripsi (3) ada atau tidaknya hubungan antara kemampuan siswa dalam memenggal dengan kemampuan menulis karangan deskripsi di kelas V SDN Polowijen 2 Kota Malang. Penelitian yang di lakukan di SDN Polowijen 2 ini ditinjau dari sifatnya adalah penelitian korelasional. Penelitian korelasi adalah suatu penelitian yang melibatkan tindakan pengumpulan data guna menentukan, apakah ada hubungan dan tingkat hubungan antara dua variabel atau lebih. Adanya hubungan dan tingkat variabel ini penting, karena dengan mengetahui tingkat hubungan yang ada, peneliti akan dapat mengembangkannya sesuai dengan tujuan penelitian. Jumlah populasi yang diambil peneliti adalah 30 siswa kelas V SDN Polowijen 2 Malang. Kemampuan siswa memenggal kata dalam mengarang deskripsi tergolong kategori cukup. Hasil analisis penulis ditemukan bahwa hanya ada 6 siswa yang tidak melakukan kesalahan dalam pemenggalan kata dengan kata lain tidak terdapat kesalahan, kemudian 7 siswa melakukan kesalahan pemenggalan kata kurang dari 3, dan yang paling signifikan adalah 15 siswa yang melakukan kesalahan pemenggalan kata kurang dari 5. Dari keseluruhan siswa hanya ada 2 siswa yang melakukan kesalahan pemenggalan kata lebih dari 5. Dari penelitian tersebut dapat penulis jabarkan siswa yang mampu memenggal kata secara sempurna hanya ada 6 siswa atau sekitar 20%, 7 siswa hanya melakukan kesalahan kurang dari 3 atau sekitar 23%, 2 siswa yang belum mampu memenggal kata atau sekitar 6,7%, dan yang paling tinggi adalah 50% atau 15 siswa yang melakukan kesalahan antara 3 sampai 5 dalam memenggal kata. Pada variabel berikutnya yaitu pada variabel X (kemampuan mengarang deskripsi) ternyata hampir 53% siswa dapat menuliskan karangan deskripsi namun kurang sesuai dengan deskriptor yang ada. 16,7% atau 5 siswa mampu menyelesaikan karangan deskripsinya sesuai dengan tepat. Dan sisanya 9 siswa atau 30% yang belum mampu mendeskripsikan dalam bentuk karangan. Namun setelah dilakukan uji korelasional product moment didapatkan keputusan tidak terdapat hubungan yang signifikan antara kemampuan siswa dalam memenggal kata dengan kemampuan menulis karangan deskripsi siswa kelas V SDN Polowijen 2 Kecamatan Blimbing Kota Malang. Penelitian ini masih sangat terbatas sekali sehingga perlu adanya penelitian lanjutan yaitu berupa penelitian kualitatif karena dianggap penelitian seperti ini perlu intensitas yang tinggi untuk mengamati subjek penelitian secara kontinyu dan berkelanjutan dan hasil penelitian yang disertai wawancara.

Analisis sektor potensial terhadap pertumbuhan ekonomi di Kabupaten Tulungagung (Kajian sektor basis ekonomi) / Wigih Bratanata

 

Kata Kunci: Sektor Potensial, Pertumbuhan Ekonomi, Sektor Basis Ekonomi. Sektor ekonomi potensial merupakan sektor ekonomi yang harus dikembangkan di setiap daerah. Salah satu tolok ukur dari pelaksanaan pembangunan ekonomi daerah yaitu adanya pertumbuhan ekonomi di suatu daerah. Penelitian ini merupakan salah satu upaya untuk mengetahui potensi-potensi daerah yang berpengaruh besar terhadap pertumbuhan ekonomi di wilayah Kabupaten Tulungagung selama kurun waktu 2006 sampai dengan tahun 2010, dan untuk mengetahui seberapa besar sumbangan kontribusi sektoral terhadap pertumbuhan ekonomi di Kabupaten Tulungagung. Data tersebut berupa data sekunder yang diperoleh dari BPS Kabupaten Tulungagung yang terdiri dari data Produk Domestik Regional Bruto (PDRB) Kabupaten Tulungagung dan PDRB Propinsi Jawa Timur. Dalam skripsi ini digunakan model analisis sektor basis dan sektor non basis ekonomi yang dapat di interpretasikan melalui metode analisis Location Quotient (LQ) yang dilengkapi dengan analisis Shift Share, dan tipologi sektoral yang berguna untuk mengetahui sektor-sektor unggulan yang ada di Kabupaten Tulungagung. Berdasarkan hasil penelitian dengan menggunakan metode Location Quotient, sektor yang memiliki indeks LQ lebih besar dari satu dan merupakan sektor basis ekonomi yang berpotensi untuk dikembangkan di Kabupaten Tulungagung adalah (1) sektor pertanian dengan LQ rata-rata sebesar 1.25, (2) sektor perdagangan, hotel dan restoran dengan LQ rata-rata sebesar 1.03, kemudian (3) sektor keuangan, persewaan, dan jasa perusahaan memiliki LQ rata-rata sebesar 2.02 dan adapaun sektor basis yang ke (4) yaitu sektor jasa-jasa yang memiliki LQ rata-rata sebesar 1.23. Hasil metode analisis Shift Share menggunakan komponen pertumbuhan differential (D) menunjukkan terdapat 4 sektor dengan rata-rata D positif, yaitu (1) sektor industri pengolahan, (2) sektor listrik, gas dan air, (3) sektor bangunan dan kontruksi, dan yang ke (4) yaitu sektor angkutan dan komunikasi. sektor industri pengolahan dengan nilai rata-rata (D) sebesar 22682,73. sektor listrik, gas dan air dengan nilai rata-rata sebesar 1129,79. sektor bangunan dan kontruksi dengan nilai rata-rata sebesar 669,65. sektor angkutan dan komunikasi dengan nilai rata-rata sebesar 3223,39. hal tersebut mengindikasikan bahwa ke empat sektor tersebut tumbuh lebih cepat dibandingkan sektor ekonomi yang sama dengan Propinsi Jawa Timur sehingga ke 4 sektor tersebut memiliki daya saing tinggi dan berpotensi untuk dikembangkan untuk memacu pertumbuhan ekonomi di Kabupaten Tulungagung, sedangkan komponen pertumbuhan proportional (P) menunjukkan bahwa terdapat 5 sektor yang memiliki nilai rata-rata positif yaitu (1) sektor pertambangan penggalian, (2) sektor listrik, gas dan air, (3) sektor perdagangan, hotel, dan restaurant, (4) sektor angkutan dan komunikasi, (5) sektor keuangan dan jasa perusahaan.

Peningkatan teknik passing bawah bolavoli menggunakan metode Part and Whole pada siswa kelas VIIB SMPK Mater Dei Probolinggo / Teguh Cahyono

 

Kata kunci: perbaikan pembelajaran, passing bawah bolavoli, part and whole Berdasarkan silabus, kompetensi dasar yang disajikan pada pembelajaran pendidikan jasmani, olahraga, dan kesehatan di SMPK Mater Dei Probolinggo, pada kelas VII semester gasal tahun ajaran 2011/2012, meliputi: (1) start jongkok, (2) lari jarak pendek 100 m, (3) passing bawah bolavoli, (4) passing atas bolavoli, (5) PPPK, (6) senam lantai guling depan, (7) passing bola basket, (8) lay up bola basket. Saat pembelajaran passing bawah bolavoli pada tanggal 4 Oktober 2011 peneliti melakukan observasi di kelas VIIB SMPK Mater Dei dan memperoleh data: (1) guru menggunakan metode practice style dalam pembelajaran teknik dasar passing bawah bolavoli, (2) 16 siswa masih menggenggamkan jari-jari kedua tangannya, (3) 13 siswa berporos pada siku saat melakukan passing bawah, (4) 20 siswa posisi kaki lurus dengan badan yang masih tegak saat melakukan passing bawah bolavoli, (5) 11 siswa masih salah dalam perkenaan bola pada genggaman tangan atau jari tangan, (6) 14 siswa merasa kesakitan pada pergelangan tangan saat melakukan passing bawah. Dari hasil tersebut dapat diidentifikasi permasalahan sebagai berikut: guru menggunakan pendekatan practice style dalam pembelajaran teknik dasar passing bawah bolavoli sehingga pengguasaan teknik siswa tidak baik dan siswa belum bisa melakukan teknik dasar passing bawah bolavoli dengan benar. Peningkatan teknik dilakukan melalui Penelitian Tindakan Kelas (PTK) model penelitian dari Kemmis & Taggart yang setiap siklus terdiri dari: (1) perencanaan, (2) tindakan, (3) observasi, dan (4) refleksi. Secara kolaborasi rencana perbaikan dilakukan dengan menerapkan part and whole. Metode part and whole merupakan metode pembelajaran yang dilakukan secara bertahap, dari pengenalan/pembelajaran teknik bagian hingga gabungan dari keseluruhan teknik bagian yang merupakan teknik gerakan yang utuh (Winarno:1994). Tujuan penelitian ini adalah untuk meningkatkan teknik passing bawah bolavoli dengan menerapkan metode part and whole pada siswa VIIB SMPK Mater Dei Probolinggo. Kesimpulan yang dapat diambil dalam penelitian ini dapat dilihat dari hasil observasi pada siklus I rata-rata sebesar 70,3% dengan taraf keberhasilan dalam kategori cukup dan pada siklus II sebesar 91,7% dengan taraf keberhasilan dalam kategori baik, sehingga dapat diketahui pada siklus I ke siklus II mengalami peningkatan sebesar 21,4% setelah penggunaan metode part and whole. Dengan demikian dapat disimpulkan bahwa metode part and whole dapat meningkatkan teknik passing bawah bolavoli siswa VIIB SMPK Mater Dei Probolinggo.

Optimasi sintesis mbiodiesel dari minyak jarak pagar (Jatropha curcas L) dengan katalis heterogen CaO dan MgO melalui reaksi transesterifikasi menggunakan gelombang mikro / Rosi Mayang sari

 

Kata kunci: biodiesel, minyak jarak pagar, katalis heterogen, gelombang mikro. Pembuatan biodiesel dari minyak nabati menggunakan katalis heterogen umumnya dilakukan melalui proses transesterifikasi secara konvensional. Reaksi transesterifikasi secara konvensional memiliki kelemahan yaitu diperlukan waktu reaksi yang relatif lama. Untuk mengatasi hal tersebut, digunakan gelombang mikro yang memiliki kemampuan untuk mempercepat waktu reaksi transesterifikasi pada sintesis biodiesel. Tujuan dari penelitian adalah (1) mengetahui kondisi optimum (konsentrasi katalis CaO dan MgO serta waktu) sintesis biodiesel melalui reaksi transesterifikasi menggunakan gelombang mikro berdasarkan rendemen biodiesel yang dihasilkan, (2) mengetahui kandungan senyawa biodiesel hasil sintesis, dan (3) mengetahui karakter biodiesel hasil sintesis meliputi, uji KLT, uji indeks bias, uji massa jenis, uji viskositas dan uji angka asam. Penelitian ini merupakan penelitian eksperimental laboratoris, dilaksanakan di Laboratorium penelitian Jurusan Kimia, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang, dan Laboratorium Kimia Organik, Universitas Brawijaya. Sampel minyak jarak pagar diperoleh dari balai penelitian tanaman serat di Karang Ploso Malang. Waktu penelitian dimulai dari bulan Januari sampai dengan Mei 2012. Ada 5 tahapan dalam penelitian, yaitu (1) penentuan angka asam minyak jarak pagar, (2) proses esterifikasi, (3) preparasi katalis CaO dan MgO, (4) optimasi sintesis biodiesel melalui reaksi transesterifikasi pada beberapa variasi konsentrasi katalis (5; 7,5; 10)% w/w minyak, waktu (5; 7,5; 10; 12,5; 15) menit, (5) identifikasi dan karakterisasi biodiesel hasil sintesis meliputi, uji KLT, analisis GC-MS, uji indeks bias, uji massa jenis, uji viskositas dan uji angka asam. Hasil penelitian menunjukkan bahwa (1) kondisi optimum sintesis biodiesel dari minyak jarak pagar melalui reaksi transesterifikasi menggunakan gelombang mikro menghasilkan rendemen 92,39% ± 0,04, dengan konsentrasi katalis CaO dan MgO 7,5% dan waktu transesterifikasi 10 menit, (2) identifikasi senyawa yang terkandung dalam biodiesel menggunakan GC-MS menunjukkan bahwa biodiesel mengandung senyawa metil palmitoleat (2,40%), metil palmitat (21,20%), metil oleat (62,40%), dan metil stearat (14,00%), (6) uji KLT menunjukkan nilai Rf yang berbeda antara minyak jarak pagar dan biodiesel hasil sintesis. Nilai indeks bias biodiesel yaitu 1,46445, massa jenis 0,888 g/mL, viskositas 4,23 cSt dan angka asam 0,58 mg KOH/g biodiesel.

Makna simbolik ragam gerak dalam pertunjukan "Reog Bulkiyo" di Desa Kemloko Nglegok Kabupaten Blitar / Novia Listiana Dewi

 

Kata kunci: makna simbolik, ragam gerak, Reog Bulkiyo, Blitar Ragam gerak yang terdapat di dalam pertunjukan Reog Bulkiyo berbeda dengan gerak yang terdapat pada pertunjukan reog pada umumnya di daerah lain, seperti reog kendang Tulungagung atau reog Ponorogo. Gerak tariannya sejak dulu terdiri empat jenis yaitu, lincak gagak, rubuh-rubuh gedhang, untir-untir, dan perang. Gerakannya relatif sederhana dan terdiri dari gerakan-gerakan seperti tangan, tolehan kepala, serta perpindahan langkah kaki. Namun di dalam ragam geraknya tersebut terdapat keunikan-keunikan yang tidak ditemui pada pertunjukan lainnya. Oleh karena itu masalah yang diambil adalah asal-usul pertunjukan Reog, tata urutan ragam gerak, makna simbolik ragam gerak dalam pertunjukan Reog Bulkiyo di Desa Kemloko, Nglegok Kabupaten Blitar. Adapun tujuan penelitian ini adalah untuk mendeskripsikan beberapa hal, yaitu: asal-usul pertunjukan Reog Bulkiyo, tata urutan ragam gerak, makna simbolik ragam gerak yang terdapat dalam pertunjukan Reog Bulkiyo di Desa Kemloko, Nglegok Kabupaten Blitar. Penelitian ini menggunakan rancangan kualitatif dengan metode penelitian deskriptif. Subjek dalam penelitian ini adalah Supangi (pimpinan pertunjukan Reog Bulkiyo), Eko Maji (prajurit pembawa pecer), dan Santoso (pembawa rontek). Lokasi penelitian berada di desa Kemloko, Nglegok Kabupaten Blitar. Prosedur pengumpulan data dilakukan dengan observasi (pengamatan), wawancara, dan dokumentasi. Adapun analisis yang digunakan dalam penelitian ini adalah analisis interaktif dari Miles dan Huberman. Untuk mengecek keabsahan data dilakukan dengan perpanjangan pengamatan peneliti, ketekunan/keajegan pengamatan peneliti, dan triangulasi. Hasil penelitian ini menunjukkan bahwa: (1) pertunjukan Reog Bulkiyo merupakan pertunjukan yang diadopsi dari tafsir ambiya yang menceritakan tentang peperangan kaum Islam dan kaum Kafir, (2) tata urutan ragam gerak pertunjukan Reog Bulkiyo meliputi: gerak hormat, aba-aba dan iring-iring prajurit, lincak gagak, langkah seoran, gagahan ndhondhok/ngasah gaman, nantang, hormat kedua, rubuh-rubuh gedhang, untir-untir, singget, solah, bacokan, nggorok. (3) ragam gerak yang memiliki makna antara lain: gerak hormat melambangkan memantapkan diri dan kesiapan mental, aba-aba prajurit, melambangkan memantapkan kesiapan fisik, iring-iring prajurit melambangkan kesiapan seorang prajurit mengikuti atasannya, lincak gagak melambangkan kelincahan dan kegagahan seorang prajurit, langkah seoran melambangkan uji coba terhadap ketajaman dan kesaktian berang, nantang melambangkan sikap sombong diri atas kelebihan yang dimiliki dan merendahkan orang lain, rubuh-rubuh gedhang melambangkan hidup manusia ibaratnya seperti pohon pisang akan mati dan muncul tunas/generasi muda dan hanya tunduk/takut kepada Allah, untir-untir melambangkan kewaspadaan agar terlindung dari segala macam cobaan, singget melambangkan hanya memohon dan meminta perlindungan hanya kepada Allah SWT, ngasah gaman melambangkan kepintaran seseorang apabila tidak diasah secara terus menrus akan semakin tumpul, solah melambangkan pencarian jati diri, bacokan melambangkan mengadu kekuatan dengan berangnya masing-masing. Berdasarkan hasil penelitian ini, penulis menyarankan kepada semua pihak terutama generasi muda untuk mempelajari makna simbolik ragam gerak pertunjukan Reog Bulkiyo yang bisa menjadi pedoman dalam menjalankan kehidupan ini agar bisa lebih baik.

Sistesis metil ester dari minyak sawit menggunakan katalis heterogen CaO dan Mgo dengan reaksi transesterifikasi / Mega Aminingtyas Pambayun

 

Kata Kunci: sintesis, metil ester, minyak sawit, katalis, transesterifikasi. Sumber energi fosil merupakan sumber daya energi yang tidak dapat diperbaharui. Biodiesel merupakan salah satu bahan bakar terbarukan bersumber dari minyak nabati. Cara untuk memproduksi biodiesel adalah dengan transesterifikasi asam lemak yang terkandung dalam minyak nabati. Reaksi transesterifikasi berlangsung lambat sehingga diperlukan katalis untuk mempercepat reaksi. Katalis yang telah umum digunakan untuk memproduksi biodiesel adalah katalis homogen. Namun katalis ini sulit dalam pemisahan antara metil ester dengan katalis sehingga diperlukan alternatif pengganti katalis homogen yaitu katalis heterogen. Katalis heterogen mudah dalam memisahkan hasil sintesis dengan katalis, oleh karena itu diperlukan penelitian tentang sintesis metil ester dari minyak sawit menggunakan katalis heterogen melalui reaksi transesterifikasi. Penelitian ini bertujuan untuk mengetahui (1) kondisi optimum sintesis metil ester dari minyak sawit dengan reaksi transesterifikasi dan (2) karakter metil ester yang dihasilkan dan potensinya sebagai biodiesel. Penelitian ini dilakukan dengan metode eksperimen laboratorium. Variabel yang digunakan dalam penelitian ini yaitu: (1) variabel bebas: konsentrasi katalis (5%, 7%, 10% b/b), waktu reaksi (1,5, 2, 2,5 jam), (2) variabel kontrol: suhu reaksi (65°C), pengadukan 300 rpm, perbandingan molar metanol: minyak (15:1), (3) variabel terikat: rendemen metil ester hasil sintesis. Penelitian dilakukan melalui tiga tahap, yaitu: (1) sintesis metil ester (biodiesel) melalui reaksi transesterifikasi menggunakan katalis CaO-MgO; (2) identifikasi komponen metil ester yang dihasilkan dengan GC-MS. (3) karakterisasi metil ester untuk menentukan bilangan asam, viskositas, massa jenis dan indeks bias. Hasil penelitian menunjukkan bahwa (1) kondisi optimum sintesis metil ester dari minyak sawit adalah 1,5 jam, konsentrasi katalis CaO-MgO 7% b/b, menghasilkan rendemen 79,27%, (2) metil ester penyusunnya adalah metil miristat (3,5%), metil palmitat (35,28%), metil oleat (50,74%), metil stearat (8,7%), dan metil arakhidat (1,76%), dan (3) metil ester mempunyai massa jenis 0,855 g/ml, viskositas 5,7 cSt, bilangan asam 0,56 mg KOH/g, dan indeks bias 1,45652 serta berpotensi sebagai biodiesel

Penerapan model pembelajaran kooperatif Numbered Heads Together untuk meningkatkan minat dan hasil belajar biologi siswa kelas X-1 SMAN 1 Kademangan Blitar / Nur Wakhit Maratus Shgolikah

 

Kata kunci: Pembelajaran Kooperatif, Numbered Heads Together, Minat Belajar, Hasil Belajar. Berdasarkan hasil observasi awal dan wawancara kepada guru Biologi pada bulan September 2011 sampai Oktober 2011, diketahui bahwa minat dan hasil belajar siswa tergolong rendah. Rendahnya minat belajar siswa dapat diketahui dari sikap siswa saat mengikuti kegiatan pembelajaran berlangsung, yaitu siswa kurang memperhatikan penjelasan guru, siswa kurang aktif bertanya dan menjawab pertanyaan, kebanyakan siswa yang duduk di belakang asik melakukan aktivitas lain yang dianggap menarik untuk dilakukan, dan hanya siswa tertentu saja yang aktif pada waktu diskusi kelompok. Hasil belajar siswa yang rendah ditunjukkan pada nilai tes siswa yang berada di bawah Kriteria Ketuntasan Minimum (KKM) yaitu rerata nilai siswa 58,4 dan persentase ketuntasan belajar klasikal 41,9%. Alternatif untuk mengatasi masalah tersebut adalah dengan menggunakan Penerapan Model Pembelajaran Kooperatif Numbered Heads Together. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) dengan pendekatan kualitatif yang terdiri dari 2 siklus. Penelitian ini bertujuan untuk meningkatkan minat dan hasil belajar siswa pada pokok bahasan Protista dan Fungi. Data penelitian berupa minat belajar siswa yang diperoleh dari observasi selama kegiatan pembelajaran berlangsung yang diukur dengan menggunakan lembar observasi minat belajar dan data hasil belajar siswa diperoleh dari tes setiap akhir siklus. Hasil penelitian dapat disimpulkan bahwa Penerapan Pembelajaran Kooperatif Numbered Heads Together dapat meningkatkan minat dan hasil belajar siswa Biologi kelas X-1 SMAN 1 Kademangan Blitar. Hal ini ditandai dengan minat belajar siswa sebesar 56,8% pada siklus I dan meningkat menjadi 78,1% pada siklus II. Berdasarkan data tersebut, menunjukkan bahwa NHT dapat meningkatkan persentase ketuntasan minat belajar siswa sebesar 21,3%. Sedangkan hasil belajar siswa pada siklus I sebesar 64,5% dan pada siklus II sebesar 80,6%. Berdasarkan data tersebut, menunjukkan bahwa NHT dapat meningkatkan persentase ketuntasan hasil kognitif siswa sebesar 16,1%.

Manajemen Lesson Study Berbasis Sekolah (LSBS) (Studi multi situs di SMA Laboratorium UM dan SMA Negeri 1 Grati Pasuruan) / Eny Wahyu Suryanti

 

Kata kunci: manajemen, lesson study berbasis sekolah Lesson Study Berbasis Sekolah (LSBS) adalah salah satu model pembinaan profesi pendidik melalui pengkajian pembelajaran secara kolaboratif dan berkelanjutan berlandaskan pada prinsip-prinsip kolegalitas dan mutual learning untuk membangun komunitas belajar yang mencakup semua mata pelajaran dan melibatkan semua guru di sekolah. Dalam penyelenggaraannya, tidak terlepas dari sebuah manajemen. Manajemen lesson study berbasis sekolah merupakan proses kegiatan pengelolaan lesson study meliputi perencanaan, pelaksanaan, dan pengevaluasian. Dengan demikian, LSBS dapat terlaksana dan tujuanya tercapai yaitu peningkatan profesionalisme guru dan kualitas pembelajaran. Tujuan utama penelitian ini untuk mendeskripsikan secara mendalam manajemen lesson study berbasis sekolah, yang meliputi perencanaan penyelenggaraan lesson study berbasis sekolah (LSBS), implementasi lesson study berbasis sekolah (LSBS), dan evaluasi penyelenggaraan lesson study berbasis sekolah (LSBS). Pendekatan yang digunakan dalam penelitian adalah pendekatan kualitatif dengan rancangan studi multisitus. Lokasi penelitian adalah SMA Laboratorium UM dan SMA Negeri 1 Grati Pasuruan. Teknik pengumpulan data dengan wawancara mendalam, observasi peran serta, dan dokumentasi. Analisis data dalam situs meliputi; reduksi data, penyajian data, dan penarikan kesimpulan/verifikasi, sedangkan analisis data lintas situs dengan menggunakan metode induksi analitik yang dimodifikasi. Keabsahan data dengan teknik credibility, dependability, dan conformability. Berdasarkan proses pengumpulan data dan analisis data diperoleh hasil penelitian sebagai berikut: perencanaan penyelenggaraan LSBS disusun melalui proses sebagai berikut: pembentukan tim LSBS, perumusan dan penetapan program kerja tim LSBS, dilanjutkan penyusunan jadwal pelaksanaan LSBS. Implementasi LSBS meliputi kegiatan sebagai berikut: LSBS dilaksanakan oleh semua guru bidang studi dan kepala sekolah dengan prinsip kolegialitas, kolaboratif, saling belajar (mutual learning), dan berkelanjutan. Pelaksanaan LSBS meliputi tiga tahapan yaitu plan, do, dan see dengan adanya dukungan fasilitas belajar dari sekolah. Pengembangan kegiatan LSBS melalui kegiatan workshop LS, seminar LS, PTK tentang LS, dan pemakalah LS. Hasil dari pelaksanaan LSBS adalah peningkatan profesionalisme guru dan kualitas pembelajaran. Evaluasi penyelengaraan LSBS dilaksanakan berdasarkan kumpulan hasil refleksi setiap open class oleh kepala sekolah, ketua tim LSBS, beserta anggotanya, para guru, dan dosen pendamping. Prosedur pelaporan hasil evaluasi secara lisan pada setiap bulan dan akhir semester, selanjutnya pelaporan secara tertulis berupa dokumen laporan pelaksanaan LSBS pada setiap akhir tahun ajaran. Hasil evaluasi dijadikan feedback perencanaan penyelenggaraan LSBS pada tahun berikutnya. Berdasarkan hasil penelitian di atas, maka saran yang dapat diajukan adalah bagi Dinas Pendidikan Kota Malang dan Kabupaten Pasuruan, diharapkan konsistensi dalam memberikan dukungan penyelanggaraan LSBS di masing-masing sekolah baik secara material maupun finansial, dan dapat mensosialisasikan penyelenggaraan LSBS pada seluruh sekolah sebagai bentuk pembinaan guru dan supervisi pendidikan. Bagi SMA Laboratorium UM dan SMA Negeri 1 Grati Pasuruan yang telah eksis melaksanakan LSBS secara berkelanjutan, diharapkan agar terus mengembangkan model pelaksanaan LSBS dan kegiatan LSBS, serta meningkatkan motivasi untuk tetap ber-LS sebagai upaya peningkatkan profesionalisme guru dan kualitas pembelajaran. Bagi sekolah lain, diharapkan dapat mengkaji bagaimana manajemen penyelenggaraan LSBS, sehingga kepala sekolah mampu membina para guru dalam merencanakan penyelenggaraan LSBS, mengimplementasikan LSBS, dan mengevaluasi penyelenggaraan LSBS dengan konsisten di sekolah masing-masing. Bagi peneliti lain, diharapkan mampu mengkaji tentang LSBS dari variabel yang lain sebagai upaya pengembangan hasil penelitian.

Analisis kemampuan pemecahan masalah matematika berdasarkan langkah-langkah Polya pada siswa kelas X SMAN 6 Mataram ditinjau dari gaya kognitif siswa / Pujilestari

 

Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Sri Mulyati, M.Pd., (II) Dr. Hery Susanto, M. Si. Kata Kunci: Pemecahan masalah matematika, langkah-langkah Polya, gaya kognitif. Penelitian ini dilatar belakangi oleh adanya perbedaan antara Kurikulum KTSP 2006 dengan fakta yang terjadi dilapangan. Menurut kurikulum matematika menjelaska bahwa penyelesaian masalah betul-betul harus dicapai, sedangkan fakta dilapangan adalah siswa tidak diajarkan pemecahan masalah melainkan melatih siswa untuk menjawab soal, sehingga penguasaan dan pemahaman siswa terabaikan. Penggunaan model pemecahan masalah dari polya dikarenakan beberapa penelitian menunjukkan bahwa pembelajaran lebih efektif dibandingkan dengan model yang lain. Dalam pemahaman suatu masalah juga dipengaruhi oleh karakteristik siswa yang berbeda-beda yaitu gaya kognitif. Tujuan penelitian ini adalah: untuk mendeskripsikan kemampuan pemecahan masalah matematika berdasarkan langkah-langkah Polya untuk siswa kelas X SMA Negeri 6 Mataram ditinjau dari gaya kognitif siswa. Pendekatan yang digunakan dalam penelitian ini adalah deskriptif kualitatif yang berupaya untuk mendeskripsikan teori pemecahan masalah siswa berdasarkan langkah-langkah Polya ditinjau dari gaya kognitif siswa. Subjek penelitian adalah siswa kelas X SMA Negeri 6 Mataram. Subjek penelitian berjumlah 4 siswa yang memiliki gaya kognitif berbeda. Data penelitian berupa data tertulis dan lisan. Data tertulis diperoleh melalui hasil tes tertulis dan data lisan diperoleh dari wawancara yang dilakukan peneliti terhadap subjek penelitian. Hasil penelitian menunjukkan bahwa siswa dengan gaya kognitif field dependence: dalam memahami masalah, dapat menentukan apa yang diketahui dan apa yang ditanyakan; dalam membuat rencana pemecahan masalah, tidak dapat menentukan keterkaitan antara yang diketahui dan yang ditanyakan serta belum dapat menggunakan informasi yang ada untuk merencanakan suatu cara pemecahan; dalam menyelesaikan pemecahan masalah, belum dapat menggunakan langkah secara benar serta menjawab dengan tepat; dalam memeriksa kembali jawaban, belum dapat menggunakan kembali informasi yang ia peroleh untuk menyusun rencana baru yang berbeda dari yang sebelumnya. Sedangkan siswa dengan gaya kognitif field independence: dalam memahami masalah, dapat menentukan apa yang diketahui dan apa yang ditanyakan; dalam membuat rencana pemecahan masalah, dapat menentukan keterkaitan antara yang diketahui dan yang ditanyakan, dapat menentukan informasi lain yang tidak diketahui pada soal untuk merencanakan penyelesaian serta dapat merencanakan suatu pemecahan masalah; dalam menyelesaikan pemecahan masalah, dapat menggunakan langkah-langkah secara benar serta terampil dalam menjawab soal; dalam memeriksa kembali jawaban, untuk subjek pertama (FIP) dapat menggunakan informasi yang ada untuk merencanakan dan mengerjakan pemecahan masalah dengan cara yang berbeda serta dapat mengaitkan cara penyelesaian yang digunakan untuk diterapkan pada permasalahan lain sedangkan untuk subjek kedua (FIL) belum mampu menggunakan informasi yang ada untuk merencanakan dan mengerjakan pemecahan masalah dengan cara yang berbeda serta belum mampu mengaitkan cara penyelesaian yang digunakan untuk diterapkan pada permasalahan lain. Adapun persamaan dari gaya kognitif field dependence dan field independence terdapat pada poin memahami masalah yaitu keempat subjek (FDL, FDP, FIL, FIP) sudah dapat menuliskan apa yang diketahui dan apa yang ditanyakan pada soal baik menggunakan bahasa sendiri maupun menggunakan bahasa yang terdapat pada soal. Perbedaannya terdapat pada poin penyusunan rencana penyelesaian, melaksanakan rencana penyelesaian dan memeriksa kembali solusi yang diperoleh. Siswa dengan gaya kognitif field dependence kurang mampu dalam menganalisis pola menjadi bagian-bagian yang berbeda. Sebaliknya individu dengan gaya kognitif field independence lebih menunjukkan bagian-bagian terpisah dari pola menyeluruh dan mampu menganalisa pola kedalam komponen-komponennya.

Pengembangan bahan ajar biologi kelas XI semester ganjil berbasis konstruktivisme model Learning Cycle untuk Rintisan Sekolah Bertaraf Internasional (RSBI) / Ainun Asmawati

 

Kata Kunci : pengembangan, bahan ajar, RSBI, learning cycle Rintisan Sekolah Bertaraf Internasional (RSBI) merupakan salah satu kebijakan pemerintah untuk meningkatkan kualitas sumber daya manusia Indonesia di era globalisasi. Sekolah RSBI berupaya untuk menggunakan bahasa Inggris sebagai bahasa pengantar, sehingga dalam proses pembelajaran di kelas diperlukan bahan ajar yang mendukung. Bahan ajar yang dikembangkan berupa buku yang dapat dijadikan acuan baik oleh guru maupun siswa dalam kegiatan belajar mengajar. Tujuan dari penelitian ini adalah merancang dan mengembangkan bahan ajar Biologi kelas XI semester ganjil berbasis konstruktivisme model learning cycle untuk RSBI dari aspek materi (isi), sajian (tampilan) dan bahasa (keterbacaan). Jenis penelitian ini adalah penelitian pengembangan. Bahan ajar dikembangkan menggunakan model 4-D (four D model) yang disarankan oleh Sivasailam Thiagarajan, Dorothy S. Semmel, dan Melvyn I. Semmel (1974). dengan prosedur penelitian meliputi tahap Define, Designe, dan Develop, dan Dessiminate. Validator ahli bahan ajar terdiri dari tiga orang dosen Universitas Negeri Malang, dan dua orang guru SMA Negeri 1 Malang. Validator keterbacaan pada uji kelompok kecil terdiri dari 10 orang siswa kelas XI IPA SMA Negeri 1 Malang. Data yang diperoleh dalam penelitian meliputi (1) data kuantitatif berupa skor angket penilaian dari validator ahli, dan (2) data kualitatif berupa komentar dan saran dari validator ahli dan siswa. Hasil pengembangan berupa bahan ajar Biologi hasil validasi materi, tampilan, dan bahasa terdiri dari bagian pendahuluan, isi, dan penutup. Pada bagian pendahuluan terdiri dari halaman sampul, kata pengantar, pengantar bagi pengguna bahan ajar, petunjuk untuk guru, petunjuk untuk siswa, dan daftar isi. Pada bagian isi terdapat lima chapter dengan materi pokok, (1) The Cell, (2) Tissue and Organ of Plant, (3) Tissue, Organ, and Organ System in Animal, (4) Movement System in Human, dan (5) Cyrculatory System. Setiap chapter meliputi tahap learning cycle yaitu engagement, exploration, explanation, elaboration dan evaluation. Pada bagian penutup terdiri dari glosarium, daftar rujukan dan indeks. Hasil penilaian validator materi sebesar 66,70% yang berarti valid, hasil penilaian validator tampilan sebesar 76,17% yang berarti valid dan hasil penilaian validator bahasa sebesar 72,38 yang berarti valid. Sedangkan hasil uji keterbacaan oleh siswa juga diperoleh hasil yang valid, artinya siswa tidak mengalami kesulitan dalam membaca bahan ajar, sehingga bahan ajar yang dikembangkan dapat digunakan dalam pembelajaran Biologi di kelas IPA RSBI.

Pengaruh perubahan Current Ratio, perubahan Deb to Equity Ratio dan perubahan Net Profit Margin terhadap perubahan sisa hasil usaha pada koperasi karyawan di Mojokerto tahun 2006-2010 / Ferry Diansyah

 

Kata Kunci : Perubahan Current Ratio, Perubahan Debt to Equity Ratio, Perubahan Net Profit Margin, Perubahan Sisa Hasil Usaha Perubahan current ratio merupakan perubahan setiap periode tahun selisih antara aktiva lancar yang dimiliki koperasi dengan hutang lancar, Perubahan debt to equity ratio merupakan perubahan setiap periode tahun selisih antara total hutang yang dimiliki koperasi dengan total modal sendiri sedangkan Perubahan net profit margin merupakan perubahan setiap periode tahun selisih antara laba bersih yang dimiliki koperasi dengan pendapatan/penjualan. Dari ketiga ratio keuangan yang merupakan indicator dari kinerja keuangan koperasi selama kurun waktu tertentu. Dari ratio itu dapat mempengaruhi perubahan sisa hasil usaha yang merupakan selisih antara pendapatan dengan biaya-biaya yang dikeluarkan. Koperasi karyawan merupakan koperasi yang didirikan oleh instansi/swasta yang digunakan untuk kesejahteraan anggota koperasi/karyawan yang bekerja di instansi tersebut. Penelitian ini dilakukan untuk mengetahui pengaruh perubahan current ratio, perubahan debt to equity ratio dan perubahan net profit margin terhadap perubahan sisa hasil usaha pada koperasi karyawan di Mojokerto tahun 2006-2010. Penelitian ini termasuk penelitian asosiatif. Populasi penelitian ini adalah 38 koperasi karyawan yang ada di Mojokerto dari tahun 2006 sampai 2010. Pengambilan sampel dalam penelitian ini menggunakan purposive sampling sehingga sampel seluruhnya berjumlah 6 perusahaan. Penelitian ini menggunakan data sekunder yang diperoleh dari dinas koperasi dan koperasi yang setempat dianalisis menggunakan regresi linier berganda. Hasil analisis menunjukkan bahwa perubahan current ratio dan perubahan debt to equity ratio tidak berpengaruh signifikan terhadap perubahan sisa hasil usaha dan perubahan net profit margin berpengaruh signifikan terhadap perubahan sisa hasil usaha pada koperasi karyawan di Mojokerto tahun 2006 sampai 2010. Current ratio dan debt to equity ratio menjadi suatu tolak ukur bagi kreditor untuk menyalurkan dananya. Hal itu akan berdampak pada tingkat perputaran unit usaha koperasi serta produktifitas dalam menghasilkan sisa hasil usaha. Net profit margin menjadi tolak ukur struktur biaya dan laba yang dimiliki koperasi. Biaya yang dikeluarkan suatu unit usaha menjadi efisien dalam menghasilkan laba/sisa hasil usaha unit koperasi. Berdasarkan hasil tersebut, disarankan kepada anggota koperasi agar berpartisipasi aktif dalam koperasi untuk meningkatkan sisa hasil usaha koperasi baik dalam pengelolaan maupun pengembangan unit usaha. Berkembang tidaknya koperasi sangat bergantung pada pengelolaan yang baik oleh pengurus serta anggota koperasi dalam menjalankan unit usahanya.

Pengembangan media pembelajaran akuntansi berbasis Powerpoint pada pokok bahasan proses entry jurnal untuk siswa kelas X jurusan akuntansi di SMKN 1 Boyolangu / Tri Yuliana

 

Kata kunci: Pengembangan Media PembelajaranAkuntansi, PowerPoint, Proses Entry Jurnal. Berdasarkanobservasi yang dilakukanolehpeneliti di SMK Negeri 1 Boyolangu, khususnyapadamatapelajaranakuntansiterdapatbeberapamasalah yang berkaitandengan proses pembelajaran. Masalahtersebutdiantaranya, pembelajaranakuntansi yang masihmenggunakanmetodeceramahataubersifatsatuarah, dalamhalini guru lebihdominandansiswamendengarkan.Selainitupenggunaan media jugasangatkurang, halinimengakibatkanminatbelajarsiswajugamengalamipenurunan yang padaakhirnyaakanmempengaruhikualitasbelajar. Melihatpermasalahan yangada, makapengembangan media sebagai media pembelajarandalam proses belajarmengajarsangatdiperlukan. Media pembelajaran yang dikembangkanmencakupbeberapakomponenyaituteks, gambar, suara, dan video denganmateri proses entry jurnal. Program media pembelajaraninidirancangdenganbantuan program PowerPoint dandigabungdengansoftware Wondersare Quiz Creator dan Windows Movie Maker. Penelitianinitermasukdalampenelitianpengembangan.Penelitimenggunakan model pengembangan Borg and Gall yang telahdisesuaikan.Teknikpengumpulan data dalampenelitianinimenggunakanangkettertutup, danuntukmengukurefektifitaspenggunaan media pembelajaranmenggunakanselisihantaranilaipretestdannilaiposttest (gainscore). Data kuantitatifdariangketdianalisisdenganmenggunakanteknikanalisisdeskriptifpersentaseuntukmenentukankelayakan media pembelajarandan data selisihantaranilai pretest dannilaiposttest (gainscore)dianalisisdenganmenggunakanujistatistikt-test Independent Sampleuntukmenentukanpengaruhdaripenggunaan media pembelajaranberbasisPowerPointterhadappeningkatanhasilbelajarsiswa. Data yang diperolehdarihasilvalidasikeseluruhansebesar 88,89%, iniberarti media pembelajarantersebutlayakdigunakan. Sedangkanhasilujihipotesisdenganmenggunakanujistatistikt-test Independent Samplediperolehprobabilitas 0,005 < 0,05 artinyaterdapatperbedaanantarahasilbelajarsiswa yang diajardenganmenggunakan media pembelajaranberbasisPowerPointdengankelas yang diajartanpamenggunakan media. Sehinggadapatdisimpulkan, bahwa media pembelajaranberbasisPowerPointinilayakdigunakandanefektifsebagai media pembelajaranakuntansi. Berdasarkanhasilpenelitianinidisarankankepada guru khususnya,untukmemanfaatkan media pembelajarandalam proses pembelajaransaranadanprasarana di kelashendaknyamemadaiuntukmenunjangpemanfaatansecara optimal.

Pengaruh penerapan problem based learning melalui strategi belajar preview, question, read, reflect, recite, and review terhadap kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif siswa kelas VII SMPN 18 Balikpapan / Nur Hasanah

 

Kata Kunci: PBL-PQ4R, Kemampuan Berpikir Kritis, Hasil Belajar Kognitif, Hasil Belajar Afektif. Pembelajaran biologi saat ini masih cenderung berpusat pada guru (teacher centered). Guru belum sepenuhnya memberdayakan potensi peserta didik dengan pembelajaran yang berpusat pada siswa (student centered). Akibatnya peserta didik kurang didorong untuk mengembangkan kemampuan berpikirnya, sehingga berdampak pada kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif. Banyak cara atau strategi pembelajaran yang dapat diterapkan untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa. Cara yang dimaksud adalah penerapan Problem Based Learning (PBL) melalui strategi belajar Preview, Question, Read, Reflect, Recite. and Review (PQ4R) dimana siswa belajar bagaimana menggunakan proses interaktif untuk menilai apa yang mereka ketahui, mengidentifikasi apa yang mereka ingin ketahui, mengumpulkan informasi dan secara kolaborasi mengevaluasi hipotesisnya berdasarkan data yang mereka kumpulkan melalui strategi membaca PQ4R. Integrasi kedua model pembelajaran tersebut memiliki keunggulan dalam meningkatkan pemahaman dan aktifitas siswa serta kemampuan berpikir kritis dan hasil belajar siswa. Penelitian ini bertujuan untuk: (1) mendeskripsikan keterlaksanaan penerapan PBL melalui strategi belajar PQ4R dalam pembelajaran, (2) mengetahui ada tidaknya pengaruh penerapan PBL melalui strategi belajar PQ4R terhadap kemampuan berpikir kritis siswa, (3) mengetahui ada tidaknya pengaruh penerapan PBL melalui strategi belajar PQ4R terhadap hasil belajar kognitif siswa, dan (4) mengetahui ada tidaknya pengaruh pengaruh penerapan PBL melalui strategi belajar PQ4R terhadap hasil belajar afektif siswa. Penelitian ini adalah penelitian kuasi eksperimen dengan rancangan “Pretest-Postest Non Equivalent Control Group Design” yang terdiri atas 1 variabel bebas dan 3 variabel terikat. Variabel bebas adalah strategi pembelajaran meliputi penerapan PBL melalui strategi belajar PQ4R dan konvensional. Variabel terikat yaitu kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif. Penelitian ini dilakukan di SMPN 18 Balikpapan semester genap tahun ajaran 2011/2012 yang berjumlah 85 siswa sebagai sampel penelitian. Sampel penelitian ini terbagi dalam 2 kelas, yakni kelas PBL-PQ4R, dan konvensional. Pengumpulan data penelitian dilakukan dengan tes tertulis untuk mengukur kemampuan berpikir kritis, tes tertulis untuk mengukur hasil belajar kognitif dan angket skala sikap untuk mengukur hasil belajar afektif. Data di analisis menggunakan statistik anakova dengan bantuan program Statistical Program for Social Science (SPSS) 18.0 for Windows. Hasil penelitian ini menunjukkan bahwa: (1) keterlaksanaan penerapan PBL melalui strategi belajar PQ4R berlangsung baik, (2) terdapat pengaruh penerapan PBL melalui strategi belajar PQ4R, terhadap kemampuan berpikir kritis dan hasil belajar kognitif siswa. Hasil uji lanjut menunjukan bahwa nilai kemampuan berpikir kritis siswa dengan penerapan PBL melalui strategi belajar PQ4R memiliki nilai rata-rata terkoreksi lebih tinggi yakni 71,229 dibanding nilai kemampuan berpikir kritis siswa dengan metode konvensional yakni 39,765. Rata-rata nilai kemampuan berpikir siswa dengan penerapan PBL melalui strategi belajar PQ4R meningkat sebesar 131% dari nilai pretes-postes sebesar 31,70 menjadi 73,23. Nilai hasil belajar kognitif memiliki nilai rata-rata terkoreksi lebih tinggi yakni 75,917 dibanding nilai hasil belajar kognitif siswa dengan metode konvensional yakni 49,506. Rata-rata nilai hasil belajar kognitif siswa dengan penerapan PBL melalui strategi belajar PQ4R meningkat sebesar 63,52% dari nilai pretes-postes sebesar 46,28 menjadi 75,68. (2) tidak terdapat perbedaan yang nyata antara penerapan PBL melalui strategi belajar PQ4R dan strategi konvensional terhadap hasil belajar afektif siswa. Nilai rata-rata terkoreksi hasil belajar afektif siswa dengan penerapan PBL melalui strategi belajar PQ4R yakni 85,464 dan nilai rata-rata hasil belajar afektif siswa dengan metode konvensional yakni 84.407. Kesimpulan penelitian ini adalah: (1) keterlaksanaan penerapan PBL melalui strategi belajar PQ4R berlangsung baik, (2) penerapan PBL melalui strategi belajar PQ4R berpengaruh signifikan terhadap kemampuan berpikir kritis dan hasil belajar kognitif serta hasil belajar afektif siswa. (3) tidak terdapat perbedaan yang nyata antara penerapan PBL melalui strategi belajar PQ4R dengan strategi konvensional terhadap hasil belajar afektif siswa, kedua strategi berpengaruh terhadap peningkatan hasil belajar afektif siswa kelas VII di SMPN 18 Balikpapan. Maka dapat disarankan kepada tenaga pendidik lainya untuk menggunakan penerapan PBL melalui strategi belajar PQ4R dalam membelajarkan siswa karena strategi pembelajaran tersebut terbukti mampu meningkatkan kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif siswa.

Pengembangan bahan ajar praktikum elektronika digital berbasis strategi Training Within Industry (TWI) di SMK / Ineke Farid Baroroh

 

Kata Kunci:bahan ajar, praktikum elektronika digital, training within industry SMK sebagai sekolah yang didesain untuk mencetak lulusan yang siap kerja tentu tidak terlepas dari pembelajaran praktik dalam proses pembelajaran-nya. Dari hasil observasi pada SMK 1 Kediri dan SMK 2 Pasuruan terdapat dua masalah dalam pembelajaran praktik yaitu (1) masih terbatasnya bahan ajar pem-belajaran praktik yang inovatif, dan (2) model mengajar praktik dengan ceramah masih menjadi kebiasaan sebagian guru. Untuk memecahkan kondisi pembelajar-an tersebut perlu dikembangkan bahan ajar praktik yang inovatif dan penerapan metode pembelajaran Training Within Industry (TWI) sebagai solusi. Adapun prosedur penelitian dan pengembangannya adalah menemukan potensi&masalah, mengumpulkan data awal, analisis data awal, pembuatan desain produk, validasi desain oleh ahli materi, media, dan bahasa, revisi desain, uji coba produk oleh siswa SMK dan guru praktik, dan revisi produk. Jenis data yang di-peroleh dari validasi dan uji coba produk berupa data kualitatif dan kuantitatif. Data kualitatif didapat dari saran subjek uji, dan data kuantitatif adalah skor yang didapatkan dari hasil validasi dan uji coba. Bahan ajar yang dikembangkan berupa multimedia pembelajaran, modul praktikum pegangan guru, dan modul praktikum pegangan siswa. Produk berisi pokok bahasan gerbang logika dasar terdiri dari materi tentang gerbang logika AND, OR, NOT, NAND, NOR, XOR, XNOR, FLIP-FLOP, dan COUNTER. Materi-materi tersebut ditampilkan sesuai tahapan strategi TWI dengan harapan dapat meningkatkan keterampilan/kemampuan psikomotorik maupun kognitif siswa tentang gerbang logika dasar. Untuk modul praktikum pegangan guru, hasil validasi ahli media, ahli materi, dan ahli bahasa memiliki tingkat validitas 91%, 89%, dan 75%, sedangkan hasil uji coba media memiliki tingkat validitas 89%. Untuk modul praktikum pegangan siswa, hasil validasi ahli media, ahli materi, dan ahli bahasa memiliki tingkat validitas 93%, 92%, dan 75%, sedangkan hasil uji coba media memiliki tingkat validitas 80%. Untuk multimedia pembelajaran, hasil validasi ahli media memiliki tingkat validitas 89%, hasil validasi ahli materi memiliki tingkat validitas 91%, hasil validasi ahli bahasa memiliki tingkat validitas 75%, hasil uji coba media dengan subjek coba guru memiliki tingkat validitas 98% , sedangkan hasil uji coba media dengan subjek coba siswa memiliki tingkat validitas 80% sehingga berdasarkan kriteria validitas produk dapat disimpulkan bahwa media pembelajaran tersebut valid/tidak revisi dan tidak dilakukan uji coba ulang dari audiens. Produk yang dikembangkan masih sebatas diujicobakan dan belum di-terapkan pada pembelajaran. Untuk mengetahui efektifitas produk secara nyata, perlu dilakukan penerapan pada pembelajaran praktik di suatu kelas. Dengan membandingkan capaian kelas yang menerapkan produk dan kelas yang tidak me-nerapkan produk akan bisa diketahu efektifitas dari produk itu sendiri. iv

A study on the implementation of an english syllabus ang lesson plan in SMAN 3 Malang / Nina Amalia Nurichsania

 

Keywords: the implementation, an English syllabus, an English lesson plan This study was intended to describe and analyze how one of English teachers in SMAN 3 Malang implements an English syllabus and lesson plan. This study was a descriptive qualitative research and employed a case study and a content analysis as the inquiry approaches. The study was conducted in SMAN 3 Malang. The data were obtained from an English teacher coded as Teacher 1 (T1). The researcher then crosschecked the data gathered with the results of the interview with the Vice Principal for Curriculum Affairs, the Coordinator of English subject, and two other English teachers coded as Teacher 2 (T2) and Teacher 3 (T3). To collect all data and information, the research was helped by interview guide and evaluation sheets for syllabi and lesson plans. Based on the findings, the research concluded that T1 did not implement and develop her English syllabus and lesson plan in accordance with SBI regulation ruled by the Ministry of Education and Culture so did English teachers in SMAN 3 Malang. It could hereafter be seen upon descriptions as follows. Firstly, English teachers did not make curriculum mapping with SBI standards. Secondly, English was taught in two distinct curricula. Finally, it resulted in nonexistent of curriculum document with SBI standards and the implementation of curriculum document based on KTSP regulation. Furthermore, after analyzing T1’s syllabus and lesson plan, it was also found out that her syllabus and lesson plan have not satisfied all criteria in developing syllabi and lesson plans based on KTSP yet. From the evaluation sheet for syllabi, scores of each variable in T1’s syllabus were syllabus identity: 4, SK/KD: 3, indicators: 2, learning materials: 1, learning activities: 2, assessment: 2, learning resources: 1, and learning media: 0. In conclusion, the total score was 15. Henceforth, T1’s syllabus was categorized as fair. Further, based on the analysis of the evaluation sheet for lesson plans, T1’s lesson plan was categorized as good since the total score was 31. The descriptions of the score of each variable were lesson plan identity: 4, SK/KD: 4, indicators: 2, learning objectives: 3, learning materials: 0, learning resources: 4, instructional media: 4, clarity of teaching learning process syntax: 2, detail description of teaching learning process syntax: 3, the appropriateness between learning method and learning objectives: 1, and assessment: 4. Based on the aforementioned evidences, the researcher provides some recommendations. For English teachers, they should more actively search the information of how to implement a required syllabus and lesson plan with SBI standards. For the Principal of SMAN 3 Malang and the Vice Principal for Curriculum Affairs, they should build an academic forum to socialize and guide all English teachers to implement syllabi and lesson plans with SBI standards. At last, the local Ministry of Education and Culture should give more attention and supervision for the implementation of RSBI in Malang.

Improving the reading comprehension skills of the eleventh graders of MA Nurul Jadid Paiton Probolinggo through PQRST strategy / Andri Indah Haeriyanto

 

Key words: improving, reading comprehension, PQRST strategy Based on the finding of the conducted preliminary study, the teaching of reading in MA Nurul Jadid Paiton Probolinggo did not facilitate students to be skillful in reading yet. The students’ reading ability is poor. Therefore, this research is designed to improve the students’ reading comprehension through the use of PQRST (Preview, Question, Read, Self-recite/Summarize, and Test) strategy. The PQRST activity follows the procedure of preview, question, read, sel-recite/summarize, and test. The research employed a collaborative classroom action research design in which the researcher and the collaborative teacher worked together in preparing a suitable procedure of PQRST strategy, designing the lesson plan, determining the criteria of success, implementing the action, observing and doing reflections. The subjects of this research were 32 eleventh graders of MA Nurul Jadid Paiton Probolinggo, East Java in the academic year 2010/2011. This research was conducted in 2 cycles, each of which comprised two meetings. The data of this research were obtained through (1) observation sheet; to obtain information about teacher’s and the students’ activities and performance during the implementation of the PQRST strategy, (2) field notes; to note the data beyond the coverage of the observation sheet, and (3) test; to identify whether or not the students make progress in reading comprehension. The results show that the implementation of PQRST strategy in the teaching-learning of reading comprehension can improve the students’ comprehension skill. It can be identified that after the implementation of the action there was an improvement on the number of students who got the score of greater or equal to 75. In Cycle 1, 18 students out of 32 students or 56.25% had fulfilled the criteria of success. In Cycle 2, 26 out of 32 students or 81.25% got the score of greater or equal to 75. The steps of PQRST strategy includes preview; identify what they will read about and listing the difficult words used in the text, question; to understand or to catch the idea of the prepared questions, read; the teacher read the text clearly then asking some students to re-read the text, to clarify the difficult words and to discuss the words the students have listed, to guide and to assign the students to read the text to answer the prepared questions. Self-recite/Summarize; the students share the result of their work to the class and give comments and responses on the volunteers’ report, and Test; the students sat on a test to know their understanding. Based on the findings, it is suggested that teachers use PQRST strategy as one alternative in the teaching of reading comprehension in the classroom. For other researchers, the finding can be used as a reference in conducting other research in similar field.

Cara belajar santri putri dalam memahami materi pelajaran PKn di Pondok Pesantren Al-Munir Kalianget Situbondo / Hidayati

 

Kata kunci: Cara Belajar, Pondok Pesantren, Pelajaran PKn. Sebagai lembaga pendidikan, pesantren diharapkan mampu memfasilitasi komunitas belajar dalam hal ini santri yang mengenyam atau menuntut ilmu, baik ilmu yang bersifat duniawi maupun ukhrowi dalam konteks Indonesia. Semua lembaga pendidikan termasuk pesantren harus memiliki cara belajar tersendiri yang tidak bisa dipisahkan dengan kehidupan yang dimiliki oleh santri putri. Kinerja belajar santri putri seharusnya mencerminkan cara belajar yang bisa mendukung bagi tercapainya tuntutan dalam menuntut ilmu termasuk juga tuntutan untuk memiliki pemahaman terhadap materi pelajaran PKn. Penelitian ini bertujuan untuk mengetahui cara belajar santri putri dalam memahami materi pelajaran PKn di pondok pesantren Al-munir Kalianget Situbondo. Secara khusus penelitian ini bertujuan untuk mengetahui (1) Bagaimana cara belajar santri putri dalam memahami materi pelajaran PKn di pondok pesantren Al-munir, (2) Apa faktor pendukung dan kesulitan yang dihadapi oleh santri putri dalam memahami materi pelajaran PKn di pondok pesantren Al-munir. Pendekatan yang digunakan dalam penelitian mengenai cara belajar santri putri dalam memahami materi pelajaran PKn adalah pendekatan kuantitatif deskriptif. Teknik penelitian ini dengan menggunakan cluster random dengan persentase tiap tingkatan SMP dan SMA diambil secara acak dengan jumlah populasi 100 santri dengan sampel 78 santri putri. Berdasarkan angket mengenai cara belajar santri putri dalam memahami materi pelajaran PKn menunjukkan bahwa santri putri cara belajarnya bermacam-macam, ada cara belajar auditory, visual, reading, dan kinesthetic, tetapi mayoritas santri putri cara belajarnya visual. Karena masing-masing santri putri memiliki karakter dan kebiasaan yang berbeda-beda dalam memahami materi pelajaran PKn. Sedangkan faktor pendukung santri putri dalam memahami materi pelajaran PKn adalah didukung oleh faktor kemampuan guru dalam mengajar yaitu sebanyak 41% atau 32 santri, dan kesulitan yang dihadapi oleh santri putri adalah mayoritas disebabkan oleh faktor materi kurikulum yaitu sebanyak 59% atau 46 santri.

Meningkatkan keaktifan siswa dalam pembelajaran tolak peluru menggunakan pendekatan bermain pada siswa kelas VI SDN Lumbangrejo 1 Kecamatan Prigen Kabupaten Pasuruan / Dwi Susanto

 

Kata kunci: Metode bermain, siswa aktif, pembelajaran tolak peluru Tolak peluru merupakan salah satu cabang atletik yang diajarkan di sekolah dasar. Berdasarkan hasil observasi awal yang dilakukan diperoleh informasi bahwa masih banyak siswa yang tidak aktif dalam pembelajaran. Pembelajaran pendidikan jasmani dan kesehatan di SDN Lumbangrejo I Kecamatan Prigen Kabupaten Pasuruan masih sering menggunakan metode ceramah untuk menyampaikan materi dan modelling untuk memberikan contoh kepada siswa. Peneliti menyadari adanya perbedaan tingkat pemahaman dan tingkat penerapan informasi pada setiap siswa yang nantinya akan mempengaruhi hasil belajar siswa. Oleh karena itu, dalam penelitian ini diterapkan pembelajaran dengan menggunakan metode bermain. Salah satu ciri pembelajaran dengan menggunakan metode bermain adalah siswa senang dan banyak bergerak. Dengan proses pembelajaran tersebut siswa diharapkan dapat lebih aktif dalam pembelajaran tolak peluru sehingga hasil belajar meningkat. Penelitian ini bertujuan untuk mengetahui peningkatan hasil belajar siswa dalam pembelajaran tolak peluru kelas VI SDN Lumbangrejo I Kecamatan Prigen Kabupaten Pasuruan menggunakan metode bermain. Rancangan penelitian ini menggunakan Penelitian Tindakan Kelas (PTK), dengan 4 tahap yang terdiri dari perencanaan tindakan, pelaksanaan tindakan, observasi, dan refleksi yang dilakukan secara kolaborasi antara peneliti, ahli pembelajaran Pendidikan Jasmani, guru Pendidikan Jasmani lain dan siswa. Hasil penelitian menunjukkan bahwa persentase keaktifan dari 20 siswa terdapat 20% atau 4 siswa yang tidak antusias, 15% atau 3 siswa yang tidak senang, siswa tidak bersungguh-sungguh 5% atau 1 siswa. Secara umum keaktifan siswa dalam pembelajaran tolak peluru pada siklus 1 meningkat pada sikus 2, dan dari data di atas maka pembelajaran dikatakan sukses karena ketuntasan minimal yang dibuat sekolah adalah 70% . Oleh karena itu, dapat disimpulkan bahwa metode bermain dan variasi pembelajaran yang diberikan oleh guru dalam penelitian ini dapat meningkatkan keaktifan siswa dalam pembelajaran tolak peluru kelas VI SDN Lumbangrejo I Kecamatan Prigen Kabupaten Pasuruan.

Pengaruh persepsi atmosfer toko terhadap keputusan konsumen membeli pakaian (Studi kasus pada Toko Apolo Jln. Cokro Aminoto 22 Blitar) / Ageng Satriyono

 

Kata Kunci: atmosfer toko, keputusan pembelian Meningkatnya kebutuhan konsumen mengakibatkan semakin pesatnya persaingan usaha untuk menyediakan kebutuhan tersebut. Dalam usaha bisnis bertujuan awal untuk mencapai keuntungan. Kondisi ini menuntut para pelaku usaha bisnis untuk tetap bertahan hidup dan menjaga eksistensi diantara berberapa pesaing yang ada. Misalnya pada usaha retail, menghadapi tantangan bagaimana cara memikat konsumen sehingga loyalitas konsumen dapat tercapai. Oleh karena itu, maka setiap pelaku usaha bisnis retail harus mempunyai strategi yang tepat. Desain atmosfer toko, merupakan salah satu strategi yang berdampak terhadap minat keputusan konsumen untuk membeli. Toko Apolo no.22 Blitar tentunya memiliki strategi yang beda dibanding dengan toko pesaing terkait pengaturan atmosfer toko. Penelitian ini bertujuan untuk mengetahui pengaruh persepsi atmosfer toko terhadap keputusan konsumen membeli pakaian. Penelitian ini termasuk dalam jenis penelitian deskriptif dan asosiatif yang bersifat korelasional. Populasi dalam penelitian ini adalah seluruh pengunjung dari toko apolo 22 Blitar. Teknik pengambilan sampel dengan random sampling. Pengujian hipotesis dilakukan dengan menggunakan teknik analisis regresi berganda. Dari hasil penelitian, diperoleh kesimpulan bahwa hasil analisis deskriptif dapat diketahui deskripsi atmosfer toko Apolo 22 Blitar, dirasakan kurang baik oleh konsumen dan perlu adanya perbaikan. Sedangkan berdasarkan pengaruh atmosfer toko baik secara parsial maupun simultan terhadap keputusan konsumen membeli pakaian, diperoleh kesimpulan bahwa: 1) lay out berpengaruh positif dan signifikan terhadap keputusan konsumen membeli pakaian; 2) aroma berpengaruh positif dan signifikan terhadap keputusan konsumen membeli pakaian; 3) sajian musik berpengaruh positif dan signifikan terhadap keputusan konsumen membeli pakaian; 4) tata warna berpengaruh positif dan signifikan terhadap keputusan konsumen membeli pakaian; 5) tata cahaya berpengaruh positif dan signifikan terhadap keputusan konsumen membeli pakaian; dan 6) display berpengaruh positif dan signifikan terhadap keputusan konsumen membeli pakaian. Berdasarkan beberapa kesimpulan diatas, maka saran yang dapat peneliti berikan untuk toko Apolo harus meningkatkan atmosfer toko agar lebih baik lagi. Sedangkan untuk penelitian yang sejenis yang akan datang disarankan untuk menambah variabel bebas selain lay out, aroma, sajian musik, tata warna, tata cahaya, dan display, serta variabel terikat keputusan konsumen Sehingga hasil penelitian nantinya akan berbeda dan hal ini dapat dijadikan pembanding sekaligus melengkapi penelitian ini.

Pengaruh metode pembelajaran (STAD VS Presentasi) dan Lokus kendali terhadap hasil belajar (Keefektifan dan daya tarik pembelajaran) mahasiswa pada mata kuliah metode penelitian di Jurusan Pendidikan Olahraga FIK Unesa / Miftah Faris Prima Putra

 

Kata Kunci: metode pembelajaran, lokus kendali, dan hasil belajar Mata kuliah metode penelitian merupakan mata kuliah pendukung utama bagi mahasiswa dalam melakukan penelitian. Bila dalam mata kuliah tersebut mahasiswa belum mampu memahami prosedur pelaksanaan penelitian, dapat diasumsikan mereka akan mengalami kesulitan dalam menyelesaikan tugas melakukan penelitian. Apabila hal tersebut terjadi, besar kemungkinan kululusan S1 yang waktu normalnya dapat ditempuh delapan semester maka akan terhambat. Nilai rata-rata UAS mata kuliah metode penelitian adalah 61,4 atau C. Hasil belajar yang kurang baik tersebut merupakan masalah yang perlu dicari penyelesaiannya agar tujuan pembelajaran bisa tercapai. Penelitian ini bertujuan untuk menguji pengaruh metode pembelajaran (STAD dan presentasi) dan lokus kendali (internal dan eksternal) terhadap hasil belajar (keefektifan dan daya tarik pembelajaran). Dengan demikian, tujuan penelitian ini adalah untuk mengetahui pengaruh utama (main effect) dan pengaruh interaksi (interaction effect) variabel metode pembelajaran dan lokus kendali terhadap hasil belajar. Rancangan penelitian ini menggunakan kuasi eksperimen nonequivalent pretests-postest control group design dengan desain faktorial 2 x 2. Subyek penelitiannya adalah mahasiswa angkatan 2009 Jurusan Pendidikan Olahraga FIK UNESA, yang berjumah lima kelas. Teknik pengambilan subyek penelitian dilakukan dengan cara purposive random sampling. Dua kelas yang terpilih adalah kelas B dengan jumlah 34 mahasiswa dan D dengan jumlah 30 mahasiswa. Kelas B diajar dengan metode presentasi, sedangkan kelas D diajar dengan metode STAD. Data orientasi lokus kendali diambil dengan instrumen lokus kendali yang dikembangkan oleh Rotter (1966) dan telah digunakan oleh Degeng dan Pali (2001) dalam penelitiannya, data kecermatan penguasaan atau unjuk kerja diambil dengan instrumen keefektifan pembelajaran yang dikembangkan sendiri oleh peneliti, sedangkan data kemenarikan pembelajaran diambil dengan instrumen daya tarik pembelajaran yang dikembangkan dan digunakan oleh Degeng dan Pali (2001). Untuk mengetahui gambaran penyebaran data penelitian digunakan analisis deskriptif. Sedangan untuk mengetahui perbedaan dan interaksi antar variabel digunakan analisis manova. Semua pengujian hipotesis dalam penelitian tersebut dilakukan dengan alpha (α) 5% atau 0,05. Sesuai dengan hipotesis yang diajukan, pengujian hipotesis menemukan (1) nilai F 1,941 dan nilai Sig. 0,169 sehingga nilai Sig. > α atau 0,169 > 0,05. Dengan hasil tersebut hipotesis Ho diterima, artinya tidak terdapat perbedaan keefektifan pembelajaran pada mata kuliah metode penelitian antara kelompok mahasiswa yang belajar melalui metode pembelajaran STAD dengan kelompok mahasiswa yang belajar melalui metode pembelajaran presentasi. Ini terjadi pada kondisi orientasi lokus kendali internal maupun eksternal, (2) nilai F 23,697 dan nilai Sig. 0,000 sehingga nilai Sig. < α atau 0,000 < 0,05. Dengan hasil tersebut hipotesis Ho ditolak, artinya terdapat perbedaan daya tarik pembelajaran pada mata kuliah metode penelitian antara kelompok mahasiswa yang belajar melalui metode pembelajaran STAD dengan kelompok mahasiswa yang belajar melalui metode pembelajaran presentasi. Ini terjadi pada kondisi orientasi lokus kendali internal maupun eksternal, (3) nilai F 0,543 dan nilai Sig. 0,464 sehingga nilai Sig. > α atau 0,464 > 0,05. Dengan hasil tersebut hipotesis Ho diterima, artinya tidak terdapat perbedaan keefektifan pembelajaran pada mata kuliah metode penelitian antara kelompok mahasiswa yang berorientasi lokus kendali internal dengan kelompok mahasiswa yang berorientasi lokus kendali eksternal. Ini terjadi pada kelas STAD maupun kelas presentasi, (4) nilai F 0,129 dan nilai Sig. 0,720 sehingga nilai Sig. > α atau 0.720 > 0,05. Dengan hasil tersebut hipotesis Ho diterima, artinya tidak terdapat perbedaan daya tarik pembelajaran pada mata kuliah metode penelitian antara kelompok mahasiswa yang berorientasi lokus kendali internal dengan kelompok mahasiswa yang berorientasi lokus kendali eksternal. Ini terjadi pada kelas STAD maupun kelas presentasi (5) nilai F 0,228 dan nilai Sig. 0,635 sehingga nilai Sig. > α atau 0.635 > 0,05. Dengan hasil tersebut hipotesis Ho diterima, artinya tidak terdapat interaksi antara metode pembelajaran dan orientasi lokus kendali terhadap keefektifan pembelajaran, (6) nilai F 0,020 dan nilai Sig. 0,888 sehingga nilai Sig. > α atau 0,888 > 0,05. Dengan hasil tersebut hipotesis Ho diterima, artinya tidak terdapat interaksi antara metode pembelajaran dan orientasi lokus kendali terhadap daya tarik pembelajaran. Berdasarkan hasil penelitian tersebut dapat dikemukakan saran-saran yang terkait dengan pemanfaatan hasil penelitian dan penelitian lebih lanjut sebagai berikut: (1) menerapkan metode pembelajaran kooperatif seperti STAD dalam mata kuliah metode penelitian di Jurusan Pendidikan Olahraga FIK UNESA, (2) penelitian lanjutan hendaknya diarahkan dengan menambahkan variabel terikat yaitu variabel efisiensi pembelajaran, (3) penelitian lanjutan hendaknya menggunakan kelas atau kelompok yang jumlah orientasi lokus kendalinya setara antara orientasi lokus kendali internal dengan orientasi lokus kendali eksternal.

Pengaruh cara, kebiasaan, dan gaya belajar terhadap hasil belajar siswa pada mata pelajaran ekonomi siswa kelas XI IPS di SMA Negeri 1 Kepanjen / Nurul Laily Hidayati

 

Kata Kunci: cara belajar, kebiasaan belajar, gaya belajar, dan hasil belajar. Cara belajar siswa merupakan kegiatan yang dilakukan oleh siswa pada situasi belajar tertentu, dimana kegiatan-kegiatan tersebut mencerminkan usaha belajar yang dilakukan oleh siswa. Kebiasaan belajar dapat diartikan suatu bentuk perilaku yang dilakukan secara terus-menerus oleh individu untuk mendapatkan sesuatu hal yang baru baik berupa pengetahuan, ketrampilan maupun sikap dan nilai positif. Gaya belajar merupakan cara yang digunakan secara terus menerus oleh siswa dalam menerima, mengatur, dan mengolah informasi. Hasil belajar merupakan gambaran kemampuan siswa dalam memenuhi suatu tahapan pencapaian pengalaman belajar dalam satu kompetensi dasar. Penelitian ini merupakan penelitian deskriptif korelasional. Populasinya adalah siswa kelas XI IPS di SMA Negeri 1 Kepanjen yang berjumlah 83 siswa, dalam penelitian ini diambil sampel sebanyak 69 siswa berdasarkan rumus Slovin dengan menggunakan teknik proportional random sampling. Variabel dalam penelitian ini antara lain: cara belajar (X1), kebiasaan belajar (X2), gaya belajar (X3), dan hasil belajar pada mata pelajaran ekonomi (Y). Hasil penelitian ini menunjukkan bahwa (1) Pengaruh cara belajar siswa (X1) terhadap hasil belajar pada mata pelajaran ekonomi (Y) diperoleh nilai signifikansi sebesar 0,000 < α = 0,05 berarti cara belajar siswa berpengaruh terhadap hasil belajar siswa. (2) Pengaruh kebiasaan belajar siswa (X2) terhadap hasil belajar (Y) diperoleh nilai signifikansi sebesar 0,001 < α = 0,05 berarti kebiasaan belajar siswa berpengaruh terhadap hasil belajar siswa. (3) Pengaruh gaya belajar siswa (X3) terhadap hasil belajar (Y) diperoleh nilai signifikansi 0,000 < α = 0,05 berarti gaya belaajr siswa berpengaruh terhadap hasil belajar siswa. (4) Pengaruh cara (X1) , kebiasaan (X2) , dan gaya belajar siswa (X3) terhadap hasil belajar siswa pada mata pelajaran ekonomi (Y) diperoleh nilai signifikansi melalui uji simultan (uji F) sebesar 0,000 < α = 0,05, hal ini berarati cara, kebiasaan, dan gaya belajar siswa berpengaruh signifikan terhadap hasil belajar siswa pada mata pelajaran ekonomi kelas XI IPS di SMA Negeri 1 Kepanjen. Saran yang diajukan adalah (1) bagi guru ekonomi hendaknya menggunakan media tulisan atau power poin karena kebanyakan siswa memiliki gaya belajar visual (2) Bagi sekolah hendaknya mengelola dan memanfaatkan dengan baik komputer dan LCD yang ada di dalam kelas (3) Bagi peneliti selanjutnya diharapkan dapat memperluas subvariabel dari cara belajar seperti faktor-faktor yang mempengaruhi cara belajar siswa serta kebiasaan baik dan buruk siswa dalam proses pembelajaran.

Pengembangan perangkat pembelajaran inkuiri melalui kegiatan lesson study dan pengaruh emplementasinya terhadap hasil belajar IPA Biologi dan keterampilan berpikir kritis siswa berkemampuan akdemik berbeda di SMP Negeri Kota Mataram / Agus Ramdani

 

Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Prof. Dra. Herawati Susilo, M.Sc., Ph.D., (II) Prof. Dr. H. Muslimin Ibrahim, M.Pd., dan (III) Dr. Ibrohim, M.Si. Kata kunci: perangkat pembelajaran inkuiri, lesson study, hasil belajar IPA Biologi, keterampilan berpikir kritis, kemampuan akademik. Penelitian ini dilatarbelakangi oleh: (1) adanya tantangan dalam mempersiapkan peserta didik berkualitas dengan karakteristik di antaranya memiliki kecakapan berpikir kritis; (2) adanya perubahan paradigma pendidikan yang diarahkan pada pengembangan kompetensi siswa dalam melakukan tugas-tugas akademik berdasarkan standar tertentu; (3) adanya reorientasi tujuan pelajaran IPA di SMP yang menekankan pada inkuiri ilmiah untuk menumbuhkan kemampuan berpikir, bersikap, dan bertindak ilmiah serta berkomunikasi; (4) adanya gambaran tentang upaya pemberdayaan keterampilan berpikir kritis melalui pembelajaran IPA Biologi belum dilakukan secara terencana (by design) di sekolah; (5) adanya berbagai upaya untuk meningkatkan kemampuan guru yang di antaranya melalui kegiatan lesson study; (6) adanya fakta bahwa peserta didik telah dikelompokkan atau mengelompok secara alami berdasarkan kemampuan akademik; dan (7) perlunya menemukan strategi pembelajaran yang sesuai pada tingkat kemampuan akademik yang berbeda. Bertitik tolak dari latar belakang tersebut dirumuskan masalah utama penelitian ini, yaitu: (1) bagaimana pola pengembangan perangkat pembelajaran inkuiri melalui kegiatan lesson study? (2) adakah perbedaan hasil belajar IPA Biologi dan keterampilan berpikir kritis antara siswa yang mengikuti pembelajaran dengan strategi inkuiri level 1, inkuiri level 2, inkuiri level 3 dan strategi konvensional? (3) adakah perbedaan hasil belajar IPA Biologi dan keterampilan berpikir kritis antara siswa berkemampuan akademik atas dan bawah setelah mengikuti pembelajaran dengan strategi inkuiri level 1, level 2, level 3, dan strategi konvensional? (4) adakah pengaruh interaksi antara strategi pembelajaran (inkuiri level 1, inkuiri level 2, inkuiri level 3, dan konvensional) dan kemampuan akademik siswa (atas dan bawah) terhadap hasil belajar IPA Biologi dan keterampilan berpikir kritis siswa? Penelitian dilakukan dalam dua tahapan yakni: (1) penelitian pengembangan untuk menghasilkan perangkat pembelajaran inkuiri; dan (2) penelitian eksperimen untuk mengungkap ada tidaknya pengaruh variabel bebas (strategi pembelajaran) dan variabel moderator (kemampuan akademik siswa) terhadap variabel terikat (hasil belajar IPA Biologi dan keterampilan berpikir kritis siswa). Penelitian pengembangan perangkat pembelajaran mengacu pada prosedur model pengembangan 4-D (Define, Design, Develop, dan Disseminate) dengan mengintegrasikan kegiatan lesson study di dalam tahapannya. Pada tahapan pengembangan (develop) dari prosedur model pengembangan 4-D, dilakukan kegiatan lesson study yang diawali dengan tahapan plan (perencanaan), yaitu peneliti bersama dengan guru mitra secara kolaboratif mengembangkan perangkat pembelajaran. Selanjutnya, tahapan do (pelaksanaan) dan see (refleksi) dilaksanakan di kelas-kelas setelah keseluruhan perangkat pembelajaran tersedia. Dalam penelitian ini, tahapan ke-empat dari prosedur model pengembangan 4-D (tahap disseminate) belum dapat dilaksanakan. Penelitian eksperimen dilakukan pada semester gasal tahun ajaran 2011/2012. Populasi penelitian adalah seluruh siswa kelas VIII pada 23 SMP N di Kota Mataram. Teknik yang digunakan dalam penarikan sampel penelitian adalah stratified random sampling. Penarikan sampel penelitian diawali dengan menentukan kriteria sekolah berdasarkan nilai UASBN input siswa pada saat jenjang SD. Pada masing-masing kelas yang telah terpilih secara random (8 kelas), selanjutnya ditentukan masing-masing 25 siswa berkemampuan akademik atas atau bawah berdasarkan nilai UASBN yang dimilikinya. Jumlah sampel secara keseluruhan dalam penelitian ini adalah 200 orang siswa. Empat macam perlakuan yang diberikan adalah implementasi strategi pembelajaran inkuiri level 1, level 2, level 3, dan konvensional pada masing-masing kelas. Data dianalisis dengan Anakova pada taraf signifikansi 5%. Dari penelitian pengembangan diperoleh pengalaman berharga dalam mengembangkan perangkat pembelajaran dengan mengintegrasikan kegiatan lesson study, yaitu dihasilkannya perangkat pembelajaran yang optimal dalam membelajarkan siswa berinkuiri, meningkatnya motivasi guru dalam melakukan pembelajaran, dan pada akhirnya ditemukan adanya peningkatan hasil belajar dan keterampilan berpikir kritis siswa setelah proses pembelajaran. Dari penelitian eksperimen diperoleh hasil bahwa: (1) ada perbedaan hasil belajar IPA Biologi dan keterampilan berpikir kritis antara siswa yang mengikuti pembelajaran dengan strategi inkuiri level 1, inkuiri level 2, inkuiri level 3 dan strategi konvensional, (2) ada perbedaan hasil belajar IPA Biologi dan keterampilan berpikir kritis antara siswa berkemampuan akademik atas dan bawah setelah mengikuti pembelajaran dengan strategi inkuiri level 1, level 2, level 3, dan strategi konvensional, dan (3) ada pengaruh interaksi antara strategi pembelajaran dan kemampuan akademik siswa terhadap hasil belajar IPA Biologi dan keterampilan berpikir kritis siswa. Kesimpulan yang dapat diambil dari hasil penelitian ini adalah perangkat pembelajaran inkuiri dalam berbagai level dapat diterapkan dalam pembelajaran IPA Biologi SMP dan berpotensi untuk meningkatkan hasil belajar dan keterampilan berpikir kritis siswa. Pemilihan level tertentu dalam strategi pembelajaran inkuiri hendaknya memperhatikan kondisi kemampuan akademik siswa serta sarana pendukung yang tersedia. Berdasarkan hasil penelitian ini maka disarankan kepada guru-guru IPA Biologi SMP di kota Mataram khususnya, untuk selalu berusaha semaksimal mungkin menerapkan strategi pembelajaran ini sehingga hasil belajar dan keterampilan berpikir kritis siswa dapat terus ditingkatkan. Untuk menghasilkan perangkat pembelajaran yang bermutu dan dapat diimplementasikan dengan baik di kelas dipandang perlu ada proses pengkondisian dan pembiasaan kepada guru. Kegiatan lesson study yang dilakukan secara kolaboratif dapat digunakan sebagai salah satu cara yang efektif untuk memenuhi proses dimaksud.

Pengaruh status sosial ekonomi orang tua, hasil belajar mata pelajaran ekonomi dan persepsi lingkungan sosial, teman terhadap rasionalitas ekonomi siswa kelas XI IPS di SMAK Frateran Malang / Rossa Reina Inggita

 

Kata Kunci : Status Sosial Ekonomi Orang Tua, Hasil Belajar Mata Pelajaran Ekonomi, Persepsi Lingkungan Sosial Teman Sebaya, Rasionalitas Ekonomi. Status sosial ekonomi orang tua menentukan tingkat keragaman pengalaman dalam kehidupan ekonomi siswa dan mencerminkan aplikasi dalam kehidupan sosial. Sebagai bukti pemahaman akan pengetahuan ekonomi melalui pembelajaran Mata Pelajaran Ekonomi di sekolah, siswa memiliki kecakapan di bidang ekonomi, dan siswa mampu menjadi pelaku ekonomi yang rasional. Persepsi teman sebaya terhadap lingkungan sosial dengan berbagai pengalaman yang diperoleh dari lingkungan keluarga masing-masing dapat mempengaruhi perilaku konsumtif mereka.. Faktor yang terpenting dalam mempengaruhi perilaku konsumtif diantara teman sebaya adalah lingkungan status sosial ekonomi orangtua. Mengingat begitu kompleksnya hubungan antara status sosial ekonomi, hasil belajar mata pelajaran ekonomi dan persepsi lingkungan sosial teman sebaya mempengaruhi perilaku rasional ekonomi, maka perlu diadakan penelitian dengan judul tentang “Pengaruh Status Sosial Ekonomi Orang Tua, Hasil Belajar Mata Pelajaran Ekonomi, Persepsi Lingkungan Sosial Teman Sebaya, terhadap Rasionalitas Ekonomi’. Permasalahan dalam judul skripsi ini merupakan tujuan dalam penelitan yaitu : Untuk membuktikan apakah status sosial orang tua m hasil belajar mata pelajaran ekonomi dan persepsi lingkungan sosial teman sebaya berpengaruh secara signifikan terhadap Rasionalitas Ekonomi siswa kelas XI SMAK Frateran Malang baik secara partial maupun simultan. Populasi dalam penelitian adalah siswa kelas XI SMAK Frateran Tahun Pelajaran 2011-2012 jurusan Ilmu Sosial sebanyak 112 orang. Penentuan jumlah sampel dengan menggunaan teknik random sampling, dan jumlah sampel yang diambil adalah 33% dari 112 orang siswa. Sehingga jumlah sampel yang digunakan dalam penelitian ini adalah sebanyak 37 siswa. Hasil penelitian dapat disimpulkan bahwa Status Sosial Ekonomi Orang Tua (X1) mempunyai nilai signifikan sebesar 0,040 < 0,05; Hasil Belajar Mata Pelajaran Ekonomi (X2) mempunyai nilai signifikan sebesar 0,025 < 0,05; dan Persepsi Lingkungan Sosial Teman Sebaya (X3) mempunyai nilai signifikan sebesar 0,019 < 0,05. Dari ketiga variabel memiliki nilai signifikan kurang dari 0,05 berarti ketiga variabel tersebut (status sosial ekonomi oran tua(X1), hasil belajar mata pelajaran ekonomi (X2) dan Persepsi Lingkungan Sosial Teman Sebaya (X3) ) secara parsial berpengaruh terhadap Rasionalitas Ekonomi. Sehingga Ha yang berbunyi “Ada pengaruh yang signifikan antara Status Sosial Ekonomi Orang Tua, Hasil Belajar Mata Pelajaran Sekonomi dan Persepsi Lingkungan Sosial Teman Sebaya secara parsial berpengaruh terhadap Rasionalitas Ekonomi diterima. Secara simultan hasil analisis data tersebut menunjukkan bahwa Fhitung > Ftabel (1,938 > 1,69), dengan tingkat signifikan sebesar 0,022 < 0,05; sehingga dapat disimpulkan bahwa Ho ditolak dan Ha diterima. Artinya secara simultan Status Sosial Ekonomi, Hasil Belajar Mata Pelajaran Ekonomi, dan Persepsi Lingkungan Sosial Teman Sebaya berpengaruh terhadap Rasionalitas Ekonomi (Y). Sehingga Ha yang berbunyi “Ada pengaruh yang signifikan antara Status Sosial Ekonomi ; Hasil Belajar Mata Pelajaran Ekonomi dan Persepsi Lingkungan Sosial Teman Sebaya terhadap Rasionalitas Ekonomi (Y) secara simultan terhadap Rasionalitas Ekonomi diterima.

Studi terhadap minat belajar ekonomi di SMA Negeri 2 Batu / Dwi Yanuarindah Putri

 

Kata Kunci: Minat Belajar Siswa. Minat merupakan sumber motivasi yang mendorong seseorang untuk melakukan sesuatu yang ingin dilakukan ketika seseorang diberikan kebebasan untuk memilih. Minat belajar siswa pada mata pelajaran ekonomi merupakan suatu kecenderungan siswa untuk selalu meningat dan memperhatikan materi yang sedang diajarkan. Kegiatan belajar mengajar akan mudah diikuti apabila seorang siswa memiliki dorongan dari dalam dirinya yaitu minat terhadap mata pelajaran tertentu begitu juga terhadap mata pelajaran ekonomi. Penelitian ini bertujuan guna mengetahui keadaan minat belajar siswa pada mata pelajaran ekonomi pada siswa kelas XI IPS di SMA Negeri 2 Batu. Informan atau responden dalam penelitian ini yaitu beberapa siswa kelas XI IPS, peneliti mengambil delapan informan dan satu guru ekonomi kelas XI. Metode penelitian yang digunakan adalah penelitian kualitatif dengan pendekatan studi kasus. Pengumpulan data yang dilakukan dengan teknik observasi, wawancara, dan dokumentasi. Teknik analisis yang digunakan adalah menggunakan metode deskriptif kualitatif yang bersifat induktif. Dari penelitian ini didapatkan bahwa minat belajar siswa kelas XI pada mata pelajaran ekonomi tergolong rendah. Hal tersebut terlihat pada sikap siswa pada saat siswa mengikuti kegiatan belajar mengajar di dalam kelas. Seringkali siswa bersikap tidak peduli pada guru dan materi yang sedang diajarkan. Kesadaran siswa akan tujuan dan manfaat yang diperoleh dalam mempelajari ekonomi masih belum mereka pahami. Didapatkan pula faktor-faktor yang mempengaruhi minat belajar siswa pada materi ekonomi dikarenakan beberapa faktor antara lain: hal yang timbul dari siswa itu sendiri yaitu berupa kurangnya motivasi dalam diri siswa dan belum memahami tujuan dan manfaat mempelajari ekonomi. Berdasarkan hasil penelitian ini maka saran yang diberikan adalah: (1) bagi guru yaitu guru sebaiknya memberikan pemahaman kepada siswa mengenai tujuan dan manfaat mempelajari ekonomi dan bisa menjadi seorang guru yang menyampaikan materi dengan metode yang lebih menarik kemudian (2) bagi siswa yaitu siswa seharusnya mengubah sikap dan pola pikir terhadap mata pelajaran ekonomi. Tanpa adanya usaha dari siswa untuk mengubah maka usaha yang dilakukan oleh guru juga akan kurang maksimal, siswa bisa lebih bersikap aktif saat pembelajaran berlangsung, dan siswa juga bisa memberika masukan pada guru mengenai metode pembelajaran yang diinginkan siswa sehingga guru bisa menyesuaikan dengan siswa dan siswa juga akan lebih berminat ketika mengikuti proses belajar mengajar ketika guru menyampaikan materi dengan metode yang diinginkan oleh siswa.

Telaah rencana pelaksanaan pembelajaran guru biologi SMA Negeri 1 Pagak dalam implementasi kurikulum tingkst satuan pendidikan berdasarkan standar proses / Sri Wahyuni

 

Kata Kunci : Rencana Pelaksanaan Pembelajaran, guru Biologi SMA, Kurikulum Tingkat Satuan Pendidikan, standar proses Kemampuan seorang guru tidak hanya pandai dalam menyampaikan materi saja, akan tetapi keterampilan dalam membuat perangkat pembelajaran juga sangat dibutuhkan, khususnya RPP karena RPP merupakan sarana dan prasarana yang memudahkan bagi seorang guru dalam melakukan pembelajaran di kelas. Dalam pengembangan RPP, pemerintah menyusun standar proses yang berisi aturan-aturan untuk dijadikan pedoman oleh guru. Berdasarkan hasil observasi dan wawancara dengan guru Biologi di SMA Negeri 1 Pagak sudah membuat perangkat pembelajaran seperti silabus dan RPP, hanya saja perlu ditelaah apakah RPP yang dibuat tersebut sudah mengikuti aturan RPP yang terdapat dalam standar proses. Penelitian ini bertujuan untuk mengetahui kesesuaian komponen dan isi RPP guru Biologi SMA Negeri 1 Pagak dalam implementasi KTSP berdasarkan standar proses. Jenis penelitian yang digunakan adalah penelitian deskriptif (analisis dokumen) dengan pendekatan kualitatif. Penelitian ini dilakukan di SMA Negeri 1 Pagak. Pengambilan data dilakukan dengan cara teknik sampling yaitu simple random sampling melalui pengundian. Subjek penelitian adalah dokumen Rencana Pelaksanaan Pembelajaran kelas X, XI, dan XII yang dibuat oleh guru Biologi SMA Negeri 1 Pagak. Sampel yang digunakan yaitu 50% dari jumlah populasi RPP dari setiap kelas dengan rincian RPP kelas X berjumlah 7, RPP kelas XI berjumlah 7, dan RPP kelas XII berjumlah 8. Instrumen dalam penelitian yang digunakan adalah Rubrik Penilaian Rencana Pelaksanaan Pembelajaran. Analisis data dilakukan dengan menggunakan kriteria penilaian kesesuaian persentase hasil analisis. Berdasarkan data, hasil penemuan, dan pembahasan maka diperoleh dua kesimpulan dari hasil penelitian yaitu (1) hasil telaah komponen-komponen Rencana Pelaksanaan Pembelajaran guru Biologi SMA Negeri 1 Pagak berdasarkan standar proses tergolong sangat baik dan (2) hasil telaah isi Rencana Pelaksanaan Pembelajaran guru Biologi SMA Negeri 1 Pagak berdasarkan standar proses masih tergolong kurang baik.

Konflik politik dan sosial dalam novel De Wints karya Afifah Afra (sebuah tinjauan sosiologi sastra) / Sri Wahyuti

 

Kata Kunci: konflik, konflik politik dan sosial, sastra, masyarakat, kekuasaan, pabrik gula De Wints. Konflik merupakan pertentangan atau perbedaan antara dua orang atau kelompok. Konflik politik terbentuk karena adanya penguasa politik. Kekuasaan politik mempunyai ciri masyarakat secara keseluruhan sebagai objeknya. Konflik merupakan bagian dari kehidupan sosial, konflik sosial dilatarbelakangi oleh perbedaan ciri-ciri yang dibawa individu dalam suatu interaksi. De Wints adalah novel yang memadukan tema perlawanan dan percintaan. Tema perlawanan yang dimaksud adalah perlawanan yang dilakukan pribumi terhadap Belanda yang sewenang-wenang dalam menjalankan roda perekonomian sebuah pabrik gula di Colomadu. Judul novel De Wints yang dipilih oleh Afifah Afra (penulis) adalah nama sebuah pabrik gula yang menjadi poros cerita dalam novel ini. Penelitian ini dimaksudkan untuk mendeskripsikan konflik politik dan konflik sosial yang terjadi dalam masyarakat pada novel De Wints. Konflik politik yang terjadi meliputi perebutan kekuasaan, kapitalisme, dan motif ekonomi. Sedangkan konflik sosial meliputi permintaan kenaikan harga sewa tanah oleh pribumi dan perbedaan kelas sosial yang terjadi dalam masyarakat. Metode yang digunakan dalam penelitian ini adalah metode kualitatif yang bersifat deskriptif. Data yang dihasilkan berupa kata-kata dalam bentuk kutipan-kutipan. Data diperoleh dari paparan teks dalam novel De Wints yang menjelaskan konflik politik dan sosial dalam bentuk dialog, monolog, dan narasi. Sebagai instrumen pembantu pengumpulan data, dibuat tabel kodifikasi data sebagai cara untuk mempermudah analisis data. Pendekatan sosiologi sastra yang difokuskan pada sosiologi karya dimanfaatkan untuk membantu menafsirkan makna yang terdapat dalam novel dan memahami latar sosial kehidupan dalam novel. Hasil yang diperoleh dari penelitian ini adalah deskripsi konflik politik yang terjadi dalam novel De Wints. Konflik tersebut meliputi perebutan kekuasaan antara pihak Belanda dan kaum pribumi dalam menjalankan perekonomian terutama di pabrik gula, kapitalisme yaitu kepemilikan modal, dan motif ekonomi yang menjadi dorongan terjadinya konflik politik. Selain itu konflik sosial yang berupa permintaan kenaikan sewa tanah oleh para pribumi yang tanahnya disewa oleh pihak pabrik (didominasi orang Belanda) dan perbedaan kelas sosial masyarakat baik antara pribumi dengan Belanda maupun antarpribumi itu sendiri. Hasil penelitian dapat disarankan kepada beberapa pihak, yaitu (1) bagi peneliti lanjutan agar dapat menggali lebih dalam makna yang tersirat dalam novel De Wints melalui pendekatan yang berbeda dan (2) bagi pembaca agar dapat memanfaatkan hasil penelitian untuk menghayati lebih dalam konflik yang terjadi dalam interaksi kehidupan masyarakat.

Penerapan permainan kartu kata bergambar untuk meningkatkan kemampuan membaca permulaan anak kelompok B di TK KHA Wahid Hasyim Dermo Kecamatan Bangil Kabupaten Pasuruan / Dewi Atikah

 

Kata kunci: Penerapan Permainan Kartu Kata Bergambar, Membaca Permulaan, Kemampuan membaca bagi anak usia saat ini sudah menjadi kebutuhan dan tuntutan berbagai pihak baik orang tua maupun sekolah dasar. Oleh kerena itu sejak TK kegiatan membaca permulaan sudah dilaksanakan hanya saja kegiatannya bermain sambil belajar yang digunakan cenderung konvensional. Hal ini terjadi di TK KHA Wahid Hasyim. Sehingga sering kali menimbulkan rasa bosan pada anak, semangat belajar kurang bagus, dan hasilnya kurang memuaskan. Tujuan penelitian ini adalah untuk: 1) Untuk mendeskripsikan penerapan permainan kartu kata bergambar dalam meningkatkan kemampuan membaca permulaan anak, 2) Untuk mendeskripsikan peningkatan kemampuan membaca permulaan dengan menggunakan permainan kartu kata bergambar pada anak. Metode penelitian yang digunakan dalam penelitian ini adalah deskriptif kualitatif dan kuantitatif berbentuk tindakan kelas dan dirancang dalam 2 siklus. Masing-masing siklus terdiri dari 4 tahapan, yaitu perencanaan (planning), pelaksanaan tindakan (action), pengamatan (observation), dan refleksi (reflection). Subyek penelitian adalah anak kelompok B TK KHA Wahid Hasyim Dermo Kecamatan Bangil Kabupaten Pasuruan yang berjumlah 20 anak. Metode pengumpulan data diperoleh melalui lembar observasi aktivitas anak selama proses pembelajaran, wawancara tentang kesan-kesan anak, dokumentasi berupa foto selama pembelajaran Hasil analisis penelitian kemampuan membaca permulaan pada pra tindakan diperoleh 39%. Pada siklus I dilakukan sebanyak 2 kali pertemuan 29 Maret 2012 sampai 14 April 2012 pada pertemuan I dan pertemuan II diperoleh rata-rata 65% dengan katagori B, dan pada siklus II dilakukan yaitu pada tanggal 16 April 2012 diperoleh rata-rata 89% terdapat kenaikan skor sebesar 24%. Berdasarkan hasil penelitian dapat disimpulkan bahwa permainan kartu kata bergambar dapat digunakan untuk meningkatkan kemampuan membaca permulaan. Bagi guru TK disarankan agar pembelajaran lebih menyenangkan, tidak membosankan dan menarik minat anak, maka disarankan menggunakan permainan kartu kata bergambar.

Perilaku kestabilan sistem persamaan lorenz / Aldila Sakinah Putri

 

Kata kunci: Metode Linierisasi, Metode Lyapunov Kedua, Kestabilan Sistem, Persamaan Lorenz, Titik Kesetimbangan, Bifurkasi Hopf Skripsi ini membahas tentang bagaimana menentukan kestabilan dan potret fase dari sistem persamaan Lorenz yang termasuk dalam sistem tak linier tiga dimensi yang mempunyai tiga parameter. Metode yang digunakan untuk menganalisa kestabilan suatu sistem persamaan diferensial tak linier adalah melalui kestabilan lokal dengan menggunakan metode linierisasi dan melalui kestabilan global dengan menggunakan metode Lyapunov kedua. Kestabilan lokal pada sistem persamaan Lorenz berubah-ubah sesuai dengan parameter yang diberikan. Sedangkan kestabilan global sistem persamaan Lorenz belum dapat ditentukan kestabilannya. Jika solusi kestabilan global tidak berada pada sepanjang waktu t , maka ada solusi terbatas r sedemikian sehingga x(t)  untuk tr, pada kestabilan lokal sistem persamaan. Jadi perilaku kestabilan sistem persamaan Lorenz pada kestabilan global didasarkan pada kestabilan lokal dengan parameter r tertentu.

Pengembangan e-Module dengan model Learning Cycle 5E pada materi pokok larutan elektrolit dan non elektrolit untuk SMA kelas X semester genap / Elcha Bagus Narendra Putra

 

Kata Kunci: Pengembangan bahan ajar, e-module, larutan elektrolit dan non elektrolit, learning cycle 5E Pembelajaran kimia yang terjadi di sekolah memiliki aspek pembelajaran mikroskopis yang bersifat abstrak seperti pada materi pokok larutan elektrolit dan non elektrolit. Dalam mempelajari materi tersebut diperlukan bantuan media atau bahan ajar yang dapat memudahkan siswa mengkonstruksi konsep yang bersifat abstrak. Sejauh ini bahan ajar yang digunakan siswa masih cenderung bersifat deskriptif dan informatif. Berdasarkan masalah tersebut, tujuan dilakukannya penelitian ini adalah untuk mengembangkan dan mengetahui kelayakan bahan ajar e-module yang dapat memudahkan siswa memahami konsep, khususnya konsep yang bersifat abstrak. Model pengembangan yang digunakan adalah adaptasi dari model pengem-bangan Dick and Carey. Model tersebut dipilih, karena memiliki prosedur yang sederhana dan menitikberatkan pada pembuatan media dalam pendidikan formal. Instrumen yang digunakan dalam penelitian ini adalah jenis angket terbuka untuk menilai RPP dan bahan ajar e-module. Subjek uji coba yang digunakan terdiri atas ahli media dan materi (terdiri atas 1 dosen dan 3 guru) dan 36 siswa pada kelas XI-B1-IPA di SMA Negeri 2 Malang. Hasil penelititan berupa paket e-module dalam bentuk CD (compact disk) yang berisi silabus, RPP, dan program e-module. Program e-module terdiri dari empat bagian utama, yaitu (1) bagian pengantar yang berisi teks, gambar, dan animasi penghias; (2) bagian pendahuluan, berisi teks tentang garis besar isi program e-module yang disajikan dengan menarik; (3) bagian materi yang berisi teks, kolom jawaban, gambar, animasi makroskopis dan mikroskopis serta laboratorium virtual; (4) bagian penilaian yang berupa soal-soal yang disertai dengan gambar dan diakhir bagian penilaian terdapat pesan sebagai feedback. Hasil analisis data terhadap bahan ajar e-module dari ahli media dan materi, diperoleh persentase kelayakan sebesar 93%, sedangkan analisis data dari siswa, diperoleh persentase kelayakan sebesar 82%. Dengan demikian, bahan ajar e-module dinyatakan valid atau layak digunakan dalam proses pembelajaran.

Pengaruh strategi scaffolding-kooperatif dan pengetahuan awal terhadap prestasi belajar dan sikap pada mata pelajaran fisika dasar / Supriyono Koes H.

 

Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. I Wayan Ardhana, M.A., (II) Prof. Dr. Punaji Setyosari, M.Pd, M.Ed., (III) Prof. Dr. M. Dimyati. Kata kunci: scaffolding, kooperatif, prestasi belajar, sikap, fisika dasar Dua puluh tahun terakhir, popularitas cara memfasilitasi belajar melalui metode sosial telah tumbuh luar biasa. Metode semacam ini dikembangkan berdasarkan teori belajar konstruktivist sosial. Strategi scaffolding-kooperatif yang merupakan salah satu strategi pendampingan kognitif menggunakan model magang untuk mendukung belajar dalam ranah kognitif. Strategi scaffolding-kooperatif merupakan strategi pembelajaran yang berupaya meningkatkan belajar melalui interaksi sosial dengan melibatkan negosiasi isi, pemahaman, dan kebutuhan pebelajar. Penelitian ini bermaksud untuk mengkaji seberapa jauh kesesuaian strategi pembelajaran ini untuk perkuliahan Fisika Dasar di perguruan tinggi. Tujuan utama penelitian ini adalah untuk mengkaji pengaruh strategi scaffolding-kooperatif dan pengetahuan awal terhadap prestasi belajar dan sikap pada matakuliah fisika dasar. Strategi scaffolding-kooperatif yang diterapkan dalam penelitian ini terdiri atas empat tahap, dengan urutan: tahap presentasi, tahap studi kelompok, tahap pengetesan, dan tahap penghargaan. Penelitian ini merupakan penelitian eksperimen kuasi, dengan rancangan faktorial. Subjek penelitian adalah mahasiswa fisika dasar Jurusan Fisika UM, yang terdiri dari enam kelas pada tahun akademik 2011/2012. Sampel penelitian berjumlah 117 mahasiswa yang berasal dari tiga kelas yang diambil secara acak dengan teknik cluster random sampling. Instrumen yang digunakan dalam penelitian ini adalah Tes Pengetahuan Awal, Tes Prestasi Belajar yang berbentuk pilihan ganda dan uraian, serta Skala Sikap pada Matakuliah Fisika Dasar. Data yang dikumpulkan diolah secara statistik inferensial dengan menggunakan teknik manova dua jalur 2x3. Hasil penelitian menunjukkan bahwa: 1) Ada perbedaan prestasi belajar fisika antara mahasiswa yang diajar dengan strategi S-K, S-L, dan L; 2) Ada perbedaan prestasi belajar fisika antara mahasiswa dengan pengetahuan awal tinggi dan rendah; 3) Tidak ada pengaruh interaksi antara strategi S-K, S-L, dan L dan pengetahuan awal fisika mahasiswa terhadap prestasi belajar; 4) Ada perbedaan sikap pada matakuliah fisika dasar antara mahasiswa yang diajar dengan strategi S-K, S-L, dan L; 5) Ada perbedaan sikap pada matakuliah fisika dasar antara mahasiswa dengan pengetahuan awal tinggi dan rendah; 6) Tidak ada pengaruh interaksi antara strategi S-K, S-L, dan L dan pengetahuan awal fisika mahasiswa terhadap sikap pada matakuliah fisika dasar. Strategi scaffolding-kooperatif memfasilitasi mahasiswa dalam kelompok berinteraksi dengan sebayanya melalui dialog sehingga mahasiswa membangun pengetahuan bersama melalui proses bantuan scaffolding oleh teman sebaya. Cara semacam ini dapat membantu mahasiswa untuk menghubungkan pengetahuan baru dengan pengetahuan awalnya sehingga menjadikan mahasiswa lebih memahami materi perkuliahan. Strategi scaffolding-kooperatif juga membangun kerjasama antar anggota kelompok dan perasaan terbantu melalui pembelajaran. Mahasiswa memperoleh pengalaman personal langsung yang berulang-ulang mengesankan. Keadaan semacam ini berpengaruh terhadap sikap mahasiswa pada matakuliah fisika dasar. Selain itu, pengetahuan awal secara langsung memfasilitasi proses belajar, secara tidak langsung mengoptimalkan kejelasan materi ajar dan penggunaan waktu belajar sehingga dapat mengarah pada hasil belajar lebih baik. Beberapa saran dikemukakan berkenaan dengan hasil penelitian ini. Pertama, para dosen matakuliah Fisika Dasar disarankan untuk menggunakan strategi pembelajaran scaffolding-kooperatif atau strategi scaffolding-langsung karena tebukti kedua strategi pembelajaran tersebut memberikan prestasi belajar dan sikap pada matakuliah fisika dasar yang lebih baik dibandingkan strategi pembelajaran langsung. Kedua, pembelajaran matakuliah Fisika Dasar hendaknya tidak dilakukan dengan pola pembelajaran langsung saja, melainkan dengan pola-pola pembelajaran yang memungkinkan mahasiswa memperoleh bantuan dan bekerjasama untuk mencapai prestasi belajar yang lebih tinggi. Ketiga, Jurusan Fisika hendaknya melakukan pengukuran pengetahuan awal terhadap mahasiswa baru sehingga dapat diketahui karakteristik mereka. Dengan mengetahui tingkat pengetahuan awal mahasiswa, strategi pembelajaran yang tepat, yaitu strategi pembelajaran yang efektif untuk meningkatkan prestasi belajarnya dapat dipilih. Keempat, disarankan untuk melakukan penelitian lanjutan terkait dengan penggunaan scaffold tertulis dalam model pembelajaran hibrid.

Peningkatan efektivitas pembelajaran teknik dasar passing bawah bola voli melalui pengajaran remidial pada siswa kelas VI SDN Gejugjati I Kecamatan Lekok Kabupaten Pasuruan / Fika Yoga Pamungkas

 

Kata kunci: remidial, efektivitas, KKM dan teknik dasar passing bawah bolavoli Permainan bolavoli merupakan bagian dari mata pelajaran Pendidikan Jasmani Olahraga dan Kesehatan yang diberlakukan di SD. Berdasarkan observasi yang dilakukan peneliti dengan teman kolaborasi saat pembelajaran teknik dasar passing bawah bolavoli yang dilakukan terhadap siswa kelas VI di SDN Gejugjati I Kecamatan Lekok Kabupaten Pasuruan, hasil teknik dasar passing bawah bolavoli kurang memenuhi KKM di sekolah tersebut. Tujuan penelitian ini adalah untuk memperbaiki dan meningngkatkan efektivitas pembelajaran teknik dasar passing bawah bolavoli melalui pengajaran remidial dengan pendekatan metode perbagian (part-whole). Metode yang digunakan dalam penelitian ini adalah deskriptif kualitatif sedangkan rencana yang digunakan dalam penelitian ini adalah penelitian tindakan kelas (PTK) dengan tahapan observasi awal, siklus I, siklus II. Instrumen penelitian adalah peneliti sendiri, sedangkan siswa kelas VI sebagai subyek penelitian. Waktu penelitian adalah Oktober-Desember 2011. Dari hasil penelitian pada siklus I skor efektivitas pada indikator kerjasama 70,59% degan kategori cukup baik meningkat menjadi 91,18% dengan kategori baik dan tanggungjawab 73,53% dengan kategori cukup baik meningkat menjadi 94,12% baik pada siklus II, serta pada ranah psikomotor pada siklus I yang tuntas dalam pembelajaran passing bawah bolavoli sebanyak 26 siswa atau 76,47% meningkat menjadi 32 siswa atau 94,12% pada siklus II. Kesimpulan Penelitian Tindakan Kelas pembelajaran remidial melalui metode perbagian (part-whole) yang diberikan oleh guru dapat meningkatkan efektifvitas pada proses pembelajaran dan gerakan teknik dasar passing bawah bolavoli. Keberhasilan tersebut karena penerapan metode perbagian (part-whole) hasil penilaian teknik dasar passing bawah bolavoli sebelum dan sesudah dilakukan PTK di atas dapat di lihat bahwa adanya peningkatan jumlah siswa yang nilainya melampaui KKM yang semula belum memenuhi KKM yang diberlakukan di sekolah tersebut serta meningkatnya efektivitas pembelajaran passing bawal bolavoli. Saran dari penelitian ini adalah guru Dikjasorkes diharapkan lebih kreatif dan bervariasi lagi dalam proses pembelajaran sehingga siswa merasa senang dan rasa percaya diri. Dengan demikian proses pembelajaran dapat tercapai. Penagajaran remidial melalui metode perbagian (part-whole) ini hendaknya dikembangkan pada pembelajaran dan pada cabang olahraga yang lain sebagai upaya peningkatan kualitas pembelajaran pendidikan jasmani.

Penerapan metode pembelajaran simulasi dan teknik Mind mapping untuk meningkatkan hasil belajar siswa kelas VIII pada mata pelajaran IPS ekonomi di SMP Negeri 2 Malang / Manggi Parama Santati

 

Kata Kunci: Metode Simulasi, Teknik Mind Mapping, Hasil belajar Pendidikan merupakan bagian yang tak terpisahkan dari kehidupan manusia dan juga merupakan kunci dalam keberhasilan pembangunan. Sekolah sebagai salah satu lembaga pendidikan diharapkan mampu menerapkan strategi belajar yang baik bagi siswanya dalam rangka menciptakan sumber daya manusia yang berkualitas dan berprestasi. Dengan penerapan strategi yang baik dan tepat sasaran belajar bagi siswa diharapkan akan meningkatkan prestasi dan kualitas belajar yang baik. Upaya peningkatan kualitas pendidikan tidak dapat berhasil dengan maksimal tanpa didukung oleh adanya peningkatan kualitas pembelajaran. Dalam proses pembelajaran, guru sebagai fasilitator harus mampu memilih dan menentukan pendekatan, metode, dan model pembelajaran yang tepat dengan pokok bahasan yang akan dipelajari, sehingga proses pembelajaran dapat berjalan secara efektif dan tujuan pembelajaran berhasil dicapai. Pembelajaran kooperatif metode simulasi dan teknik peta pikiran atau mind mapping adalah metode mengajar yang menitikberatkan pada aktivitas siswa dalam belajar. Melalui metode simulasi dan teknik pembelajaran mind mapping ini diharapkan dapat membuat suasana kegiatan belajar mengajar di kelas menjadi lebih menyenangkan dan tidak membosankan sehingga siswa (secara tidak langsung) dapat meningkatkan kemampuan akademiknya. Selain itu, metode simulasi dan teknik mind mapping merupakan metode pembelajaran yang baru dan belum banyak yang menerapkan dalam proses belajar mengajar. Jenis penelitian yang digunakan dalam penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang terdiri dari dua siklus. Masing-masing siklus terdiri dari empat tahap yaitu perencanaan, pelaksanaan, pengamatan, dan refleksi. Tindakan yang diberikan pada Siklus I dan II sesuai dengan Rencana Pembelajaran (RPP) dengan metode simulasi dan teknik mind mapping. Mata Pelajaran yang digunakan pada penelitian ini adalah IPS Ekonomi untuk kelas VIII tahun pelajaran 2011/2012, yaitu terfokus pada kompetensi dasar ”Ketenagakerjaan”. Untuk mengetahui ketepatan guru dalam menerapkan pembelajaran kooperatif metode simulasi dan teknik mind mapping maka dilakukan observasi dengan menggunakan instrumen pengamatan aktivitas guru dalam pembelajaran. Sedangkan untuk mengetahui peningkatan hasil belajar ditinjau dari aspek kognitif, melalui perhitungan nilai pre-test dan post-test pada siklus I dan siklus II, serta aspek afektif yang dilakukan melalui lembar pengamatan aktivitas siswa dalam pembelajaran menggunakan metode simulasi dan teknik mind mapping. Penelitian tindakan kelas ini dilaksanakan di SMP Negeri 2 Malang yang berlokasi di Jalan Prof. Mokh. Yamin No. 60 Malang, pada tanggal 4 Februari sampai 9 April 2012. Siswa yang menjadi subjek penelitian ini adalah siswa kelas VIII-I tahun pelajaran 2011/2012 yang berjumlah 27 siswa. Teknik pengumpulan data yang digunakan adalah observasi, wawancara, catatan lapangan, tes, dan dokumentasi. Teknik analisis data yang digunakan adalah analisis data pada penelitian dilakukan dengan data reduction (reduksi data), display (penyajian data), dan conclution drawing/verification. Kesimpulan berdasarkan hasil penelitian adalah sebagai berikut: (1) Penerapan metode pembelajaran simulasi dan teknik mind mapping pada mata pelajaran IPS Ekonomi di SMP Negeri 2 malang sudah baik, ha ini dapat dilihat dari persentse keberhasilan tindakan dari siklus I ke siklus II mengalami peningkatan. (2) Penerapan metode pembelajaran simulasi dan teknik mind mapping terbukti dapat meningkatkan hasil belajar. Hal tersebut dapat diketahui bahwa hasil belajar siswa, baik dari aspek kognitif dan afektif terjadi peningkatan dari siklus I ke siklus II, dimana ketuntasan belajar klasikal baru tercapai pada siklus II. Sedangkan saran yang diajukan sebagai berikut: (1) Bagi guru mata pelajaran IPS Ekonomi dapat menggunakan metode dan teknik pembelajaran ini pada pokok bahasan yang dapat disimulasikan agar siswa lebih mudah mengingat dan mengaplikasikan materi tersebut serta dapat menghindari kebosanan. (2) Sekolah diharapkan menyediakan peralatan yang diperlukan untuk menunjang proses pembelajaran khusunya pada pelaksanaan kegiatan simulasi maupun dalam pembuatan mind mapping. (3) Bagi peneliti berikutnya, penelitian ini dapat dikembangkan untuk materi selain pokok bahasan ketenagakerjaan pada mata pelajaran IPS Ekonomi dan dapat dikembangkan untuk sekolah-sekolah lain.

Penerapan pembelajaran dengan media buku ajar untuk menin gkatkan hasil belajar siswa pada mata pelajaran ekonomi kelas X-5 SMAN ! Sooko Mojokerto semester genap tahun pelajaran 2011/2012 / Prisma Intaniyah

 

Kata Kunci : Media Buku Ajar, Ekonomi, Hasil Belajar Pembaharuan di bidang pendidikan ini sebenarnya dimulai dari perubahan behaviorisme (aliran pendidikan) yang diwujudkan dengan pembelajaran yang bersifat teacher centered (berpusat pada guru) dengan pandangan konstruktivisme. Berkaitan dengan perubahan paradigma guru dalam proses belajar mengajar guru perlu menerapkan pembelajaran inovatif yang mampu dan memperkaya pengalaman belajar sehingga aktivitas siswa dalam belajar akan meningkat, akhirnya dapat meningkatkan hasil belajar siswa, khususnya dalam pembelajaran ekonomi. Buku ajar yaitu buku teks yang digunakan sebagai rujukan standard pada mata pelajaran tertentu yang disusun sistematis dan sederhana disertai petunjuk pembelajaran. Isi buku ajar yang disampaikan dalam bentuk ide, fakta, data, dan makna secara tertulis. Penelitian ini dilakukan di SMA Negeri 1 Sooko Mojokerto. Dengan mengambil tindakan pada satu kelas yakni kelas X-5 dengan jumlah 33 siswa yang terdiri dari 19 perempuan dan 14 laki- laki. Jenis penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK). Penelitian tindakan kelas ini bertujuan untuk meningkatkan dan memperbaiki kualitas pembelajaran. Subjek penelitian adalah siswa kelas X-5 SMAN 1 Sooko Mojokerto semester genap tahun ajaran 2011/2012 pada materi indeks harga dan inflasi. Penelitian dilaksanakan selama bulan Februari sampai Maret 2012. Instrumen penelitian berupa lembar observasi afektif siswa, lembar observasi aktivitas guru, pre tes dan pos tes, lembar wawancara guru, lembar catatan lapangan dan dokumentasi. Analisis hasil penelitian dideskripsikan menggunakan teknik persentase. Hasil penelitian ini menunjukkan bahwa hasil belajar siswa kelas X-5 pada siklus ke II mengalami peningkatan yang signifikan pada aspek belajar kognitif dan aspek afektif dengan kelas yang menggunakan pembelajaran konvensional. Hasil belajar siswa X-5 meningkat mencapai skor klasikal kelas yakni 85% dengan nilai SKBM adalah 75 untuk nilai mata pelajaran ekonomi. Berdasarkan hasil penelitian ini, dapat disarankan agar dalam mengajar guru hendaknya menggunakan modul, untuk meningkatkan hasil belajar siswa yang tinggi sehingga modul yang dipelajari dapat diselesaikan tepat waktu, dan bagi peneliti lain disarankan untuk melakukan penelitian tentang penggunaan media buku ajar pada materi lain dan diharapkan hasil penelitian ini bisa dijadikan sebagai dasar pengembangan media buku ajar sesuai dengan mata pelajaran yang diberikan di sekolah.

Pengaruh penerapan model pembelajaran Student Team Achievement Division (STAD) terhadap hasil belajar geografi di SMA Negeri 1 Purwosari / Wahyu Adi Utomo

 

Kata kunci: Model Pembelajaran STAD, hasil belajar. Pembelajaran merupakan proses transfer ilmu kepada siswa. Seiring dengan perkembangan jaman, pembelajaran bermakna menjadi tuntutan bagi setiap guru dalam proses pembelajaran di kelas. Pembelajaran yang bermakna adalah pembelajaran yang mengaitkan informasi-informasi baru dengan pembelajaran. Salah satu cara untuk membuat pembelajaran dalam kelas bermakna adalah dengan penerapan model STAD. Model pembelajaran ini mempunyai karakteristik yaitu pengelompokan siswa berdasarkan prinsip heterogenitas baik dari segi kemampuan akademik, jenis kelamin, maupun ras. Penelitian ini bertujuan untuk mengetahui pengaruh model pembelajaran Student Team Achievement Division (STAD) terhadap hasil belajar Geografi siswa kelas XI Ilmu Sosial SMA Negeri 1 Purwosari. Penelitian ini termasuk jenis penelitian eksperimen semu (Quasi Eksperiment) dengan mengambil subjek penelitian dua kelas yaitu kelas XI Ilmu Sosial 1 sebagai kelas eksperimen dan kelas XI Ilmu Sosial 3 sebagai kelas kontrol. Instrumen penelitian berupa tes berbentuk uraian untuk prates dan pascates. Teknik analisis yang digunakan adalah uji t tidak berpasangan (Independent Samples t Test) yang dapat diselesaikan dengan bantuan SPSS 12.00 for Windows. Dari hasil uji t didapatkan nilai probabilitas sebesar 0,000 yang berarti bahwa Ho ditolak, berdasarkan hasil tersebut dapat disimpulkan bahwa terdapat pengaruh penerapan model STAD terhadap hasil belajar geografi siswa kelas XI Ilmu Sosial. Hasil penelitian menunjukkan bahwa model pembelajaran STAD lebih efektif daripada metode konvensional, kondisi ini dapat dilihat dari rata-rata kedua kelas yang berbeda. Kelas eksperimen mempunyai rata-rata kelas lebih tinggi yaitu 54,02 sedangkan kelas kontrol sebesar 32,15. Disarankan bagi guru Geografi untuk menggunakan model pembelajaran STAD sebagai variasi model pembelajaran karena dapat meningkatkan hasil belajar siswa. Bagi sekolah disarankan untuk memberikan informas, pengarahan dan fasilitas kepada guru untuk menerapkan model pembelajaran STAD. Bagi peneliti selanjutnya disarankan untuk menambahkan variabel keaktifan, minat, dan motifasi pada penelitian.

Perbedaan kualitas air tanah berdasarkan formasi geologi di Kecamatan Besuki Kabupaten Tulungagung / Evi Fitriana

 

Kata kunci: kualitas air tanah, formasi geologi, persepsi masyarakat Air tanah pada umumnya memiliki kualitas yang baik, sehingga air tanah memiliki peranan penting bagi manusia, yaitu sebagai pemenuhan kebutuhan akan air minum maupun kebutuhan dalam rumah tangga lainnya. Namun adanya proses geomorfologi dan geologi akan mempengaruhi agihan serta kualitas air tanah. Permasalahan air tanah di Kecamatan Besuki menjadi salah satu permasalahan utama bagi pemerintah dan penduduk dalam hal terbatasnya kualitas. Dalam hal kualitas, pada air tanah di beberapa daerah banyak terdapat endapan yang menempel pada segala bentuk perkakas penyimpanan air, selain itu air tanah pada sumber mata air seperti sumur terasa agak asin dan keruh. Kecamatan Besuki memiliki lima formasi geologi, yaitu Endapan Alluvial, Formasi Campurdarat, Formasi Mandalika, Batuan Terobosan Andesit dan Formasi Nampol. Adanya perbedaan formasi geologi menyebabkan perbedaan kualitas air tanah. Masyarakat yang tinggal di Endapan Alluvial mengeluh karena air tanah setiap hari dikonsumsi keruh, sedangkan di daerah Formasi Nampol mengeluh karena air berasa payau, daerah ini merupakan daerah paling dekat dengan pantai. Penelitian ini bertujuan untuk (1) menganalisis perbedaan kualitas air tanah berdasarkan formasi geologi; (2) membandingkan kualitas air tanah pada masing-masing formasi geologi berdasarkan persyaratan kualitas air minum Golongan A menurut PERMENKES RI No.492/MENKES/PER/ IV/2010; (3) Menganalisis persepsi masyarakat terhadap kualitas air tanah yang ada pada masing-masing formasi geologi di Kecamatan Besuki Kabupaten Tulungagung. Metode yang digunakan dalam penelitian ini adalah metode survey. Jenis penelitian adalah kuantitatif, Analisis data penelitian ini menggunakan analisis uji beda T-test one sampel untuk menganalisis kualitas air pada masing-masing formasi geologi, dan untuk membandingkan kualitas air dengan standar baku mutu air minum menggunakan analisis deskriptif komparatif. Sedangkan untuk analisis data tentang persepsi masyarakat menggunakan analisis deskriptif komparatif. Hasil penelitian menunjukkan bahwa terdapat perbedaan kualitas kimia air tanah pada masing-masing formasi geologi di Kecamatan Besuki, dikarenakan adanya dan pengaruh pelarutan batuan induk. Dari seluruh sampel air tanah, terdapat satu sampel yang memenuhi kriteria standar baku mutu air minum golongan A, sedangkan sampel air yang lain tergolong dalam kriteria air minum Golongan B, sehingga masuk dalam kategori aman untuk dikonsumsi dengan syarat harus melakukan pengolahan sebelum dikonsumsi. Persepsi masyarakat terhadap kualitas air tanah pada masing-masing formasi geologi berbeda.

Pengembangan media pembelajaran akuntansi berbasis multimedia dalam materi laporan keuangan perusahaan jasa di SMA Negeri 2 Blitar / Primasa Minerva Nagari

 

Kata kunci: Media pembelajaran, Laporan keuangan Media pembelajaran digunakan untuk meningkatkan pembelajaran dalam kelas. Siswa belajar dengan senang sehingga dapat mengetahui, dan memahami ilmu yang ditransformasikan oleh guru. Penggunaan media yang variatif akan meningkatkan motivasi pembelajaran dan akan meningkatkan hasil pembelajaran siswa. Materi laporan keuangan perusahaan jasa merupakan materi yang harus dikuasai siswa baik konsep maupun praktek penyusunan atau sistematika. Materi tersebut dianggap sulit oleh siswa sehingga memerlukan media pendukung untuk mengatasi masalah tersebut. Peralatan multimedia yang lengkap di sekolah, harus dimanfaatkan sebaik mungkin. Dengan demikian, pengembangan ini mengangkat judul Pengembangan Media Pembelajaran Akuntansi Berbasis Multimedia Dalam Materi Laporan Keuangan Perusahaan Jasa di SMA Negeri 2 Blitar. Tujuan pengembangan ini adalah menghasilkan produk berupa media pembelajaran akuntansi berbasis multimedia dalam materi laporan keuangan perusahaan jasa, yang telah melalui proses validasi sehingga dinyatakan layak sebagai alternatif multimedia pembelajaran yang mandiri. Jenis penelitian ini merupakan penelitian pengembangan dengan model Dick and Carey. Tahapan yang digunakan meliputi1) analisis situasi awal, 2) pengembangan rancangan produk, 3) membuat produk, 4) uji validitas, 5) revisi produk I, 6) uji kelayakan, 7) revisi produk II, dan 8) produk akhir. Validasi media audiovisual dilakukan oleh tiga subyek yaitu ahli materi, ahli media dan pengguna (siswa). Hasil validasi oleh ahli materi, ahli media dan pengguna (siswa) secara keseluruhan memperoleh rata-rata 93,25% . Hal ini menunjukkan media pembelajaran akuntansi berbasis multimedia yang dikembangkan layak digunakan dalam pembelajaran akuntansi. Hasil tersebut juga didukung rata-rata gain score kelas eksperimen 33,33 lebih tinggi daripada kelas kontrol 3,48. Hasil analisis uji T-test independent sample memperoleh nilai 0,000 lebih kecil daripada 0,05. Berdasarkan hasil validasi dan uji T-test independent sample bahwa media pembelajaran akuntansi berbasis multimedia yang dikembangkan layak digunakan dan dapat meningkatkan hasil belajar siswa. Berdasarkan hasil penelitian ini disarankan kepada guru khususnya,untuk memanfaatkan media pembelajaran berbasis multimedia dalam proses pembelajaran. Sarana dan prasarana di kelas hendaknya memadai untuk menunjang proses pemanfaatan media secara optimal. Lebih jauh, agar dapat dikembangkan media pembelajaran akuntansi berbasis multimedia pada materi lain dan inovasi baru, agar dapat meningkatkan pembelajaran.

Pengaruh self-efficacy dan motivasi belajar terhadap hasil belajar dengan kemandirian belajar sebagai variabel intervening pada mahasiswa S1 Pendidikan Akuntansi angkatan 2009 Fakultas Ekonomi Universitas Negeri Malang / Ade Fatichah Nur

 

Kata Kunci: Self-Efficacy, Motivasi Belajar, Kemandirian Belajar, Hasil Belajar Tujuan Pendidikan nasional bukan sekedar membentuk peserta didik yang berilmu, tetapi juga mandiri dalam belajar. Menurut ahli pendidikan, kemandirian belajar hanya ditujukan kepada orang dewasa (andragogi). Pendidikan di perguruan tinggi bagi mahasiswa tergolong dalam pendidikan andragogi, dimana pendidikan di perguruan tinggi terdapat tuntutan kompetensi bagi mahasiswa bukan hanya dalam tataran teoritis, tetapi juga skill praktis yang terkonsep secara teoritis. Karena kemandirian berasal dari kata dasar “diri”, maka yang diduga kuat mempengaruhinya adalah Self-Efficacy dan Motivasi Belajar yang ada dalam diri mahasiswa masing-masing. Jika Self-Efficacy dan Motivasi Belajar mahasiswa baik, maka dapat meningkatkan Kemandirian Belajar dan secara tidak langsung mampu meningkatkan Hasil Belajar mahasiswa. Penelitian ini bertujuan untuk mengetahui pengaruh langsung dan tidak langsung antara Self-Efficacy dan Motivasi Belajar terhadap Hasil Belajar dengan Kemandirian Belajar sebagai variabel intervening pada mahasiswa S1 Pendidikan Akuntansi Angkatan 2009 FE UM. Penelitian ini merupakan penelitian kausal komparatif menggunakan analisis jalur (path analysis). Populasi penelitian ini adalah mahasiswa S1 Pendidikan Akuntansi Angkatan 2009 FE UM berjumlah 85 mahasiswa, dengan sampel 65 mahasiswa. Data diperoleh dengan menyebarkan angket dan dokumentasi berupa nilai Indeks Prestasi mahasiswa semester gasal tahun ajaran 2011/2012. Hasil penelitian menunjukkan bahwa: 1) terdapat pengaruh langsung Self-Efficacy terhadap Kemandirian Belajar, 2) terdapat pengaruh langsung Motivasi Belajar terhadap Kemandirian Belajar, 3) terdapat pengaruh langsung Kemandirian Belajar terhadap Hasil Belajar, 4) terdapat pengaruh tidak langsung Self-Efficacy terhadap Hasil Belajar melalui Kemandirian Belajar, dan 5) terdapat pengaruh tidak langsung Motivasi Belajar terhadap Hasil Belajar melalui Kemandirian Belajar. Berdasarkan penelitian tersebut disarankan agar (a) pendidik (dosen) mampu menumbuhkan Self-Efficacy dan Motivasi Belajar secara ekstrinsik yang dimiliki mahasiswa untuk menumbuhkan Kemandirian Belajar (b) mahasiswa terus memupuk Self-Efficacy dan Motivasi Belajar yang dimiliki, serta menyediakan hal-hal yang menunjang belajar, karena baik Self-Efficacy, Motivasi Belajar, dan Kemandirian Belajar berpengaruh terhadap Hasil Belajar.

Hubungan antara kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA dengan minat melanjutkan pendidikan ke Fakultas Ekonomi di perguruan tinggi (Studi kasus pada kelas XII IPS SMA Negeri 3 Kota Probolinggo) / Fidyah Jayatri

 

Kata Kunci: sosial ekonomi, prestasi akademik, minat melanjutkan pendidikan Kondisi sosial ekonomi merupakan suatu kondisi keluarga banyak menentukan perkembangan dan pendidikan anak karena kebutuhan belajar anak memang memerlukan dana. Prestasi akademik mata pelajaran ekonomi SMA merupakan pencapaian hasil belajar siswa setelah melakukan usaha belajar. Jadi ketika ketika kondisi sosial ekonomi keluarga siswa semakin mendukung pemenuhan kebutuhan belajar siswa, maka pencapaian prestasi akademik siswa diharapkan dapat maksimal sehingga akan memunculkan minat siswa untuk dapat melanjutkan pendidikannya ke jenjang yang lebih tinggi. Penelitian ini bertujuan mengetahui hubungan secara parsial dan simultan variabel kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA dengan minat siswa kelas XII IPS SMA Negeri 3 Probolinggo untuk melanjutkan pendidikan ke Perguruaan Tinggi. Populasi dalam penelitian ini yaitu siswa kelas XII IPS SMA Negeri 3 Probolinggo dengan sampel 52 siswa dari tiga kelas tersebut sebagai responden. Metode penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Pengumpulan data dilakukan dengan teknik angket,dokumentasi dan wawancara. Teknik analisis yang digunakan adalah analisis korelasi ganda. Dengan menggunakan analisis korelasi melalui SPSS 17.0 diperoleh hasil thitung > ttabel untuk tiap-tiap variabel yaitu 4,450 > 2,021 untuk variabel kondisi sosial ekonomi dan 5,117 > 2,012 untuk variabel prestasi akademik mata pelajaran ekonomi SMA. Dari hasil analisis diketahui pula bahwa sekitar 71,4 % minat melanjutkan pendidikan ke jurusan ekonomi di Perguruan Tinggi berhubungan dengan kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA. Sehingga dapat disimpulkan bahwa terdapat hubungan yang signifikan secara parsial dan simultan variabel kondisi sosial ekonomi keluarga dan prestasi akademik mata pelajaran ekonomi SMA dengan minat siswa SMA Negeri 3 Probolinggo untuk melanjutkan pendidikan ke jurusan ekonomi di Perguruan Tinggi. Berdasarkan hasil penelitian ini maka disarankan (1) bagi guru untuk memberi gambaran kepada siswa mengenai pentingnya meraih keinginan yang baik bagi siswa demi masa depannya. (2) bagi siswa diharapkan terus belajar dengan baik serta tetap menjaga harapan yang sesuai minatnya dengan baik agar dapat mencapai cita – cita yang diharapkan. (3) Penelitian selanjutnya yang melakukan penelitian dengan topik sama diharapkan dapat mengambil populasi lebih besar dan dapat dilakukan di tempat/jenjang pendidikan yang berbeda.

Upaya meningkatkan efektivitas pembelajaran guling depan melalui metode Pakem untuk siswa kelas VI SDN Gejugjati I Kecamatan Lekok Kabupaten Pasuruan / Endang Purwaningsih

 

Kata kunci: efektivitas, senam lantai guling depan dan PAKEM Guling depan merupakan bagian dari mata pelajaran Pendidikan Jasmani Olahraga dan Rekreasi yang diberlakukan di Sekolah Dasar. Berdasarkan observasi yang dilakukan peneliti dengan teman sejawat saat pembelajaran senam lantai guling depan yang dilakukan terhadap siswa kelas VI SDN Gejugjati I Kecamatan Lekok Kabupaten Pasuruan, terdapat siswa yang belum berhasil melakukan guling depan. Hal itu tentunya menuntut pembelajaran lebih ditingkatkan, untuk memenuhi hasil belajar lebih baik dilakukan pembelajaran melalui metode PAKEM. Tujuan penelitian ini adalah untuk mengetahui peningkatan efektivitas pembelajaran guling depan melalui metode PAKEM. Metode yang digunakan dalam penelitian ini adalah deskriptif kualitatif dan kuantitatif sedangkan rencana yang digunakan dalam penelitian ini adalah penelitian tindakan kelas (classroom action research) dengan tahapan observasi, siklus 1, dan siklus 2. Instrumen penelitian adalah peneliti sendiri, sedangkan siswa kelas VI sebagai subjek penelitian. Pelaksanaan Penelitian Tindakan Kelas (PTK) pada pembelajaran guling depan melalui metode PAKEM siswa kelas VI SDN Gejugjati I Kecamatan Lekok Kabupaten Pasuruan tahun ajaran 2011/2012 semester ganjil dengan jumlah siswa 34 dapat meningkatkan efektivitas siswa dalam pembelajaran guling depan melalui metode PAKEM, berdasarkan observasi siklus I efektivitas pada indikatar keaktifan, prakarsa dan senang siswa dalam pembelajaran guling depan didapatkan skor rata-rata 72,55% dengan taraf keberhasilan cukup baik dan pada siklus II skor efektivitas meningkat menjadi 93,63% dengan taraf keberhasilan baik. Kesimpulan Penelitian Tindakan Kelas ini dengan upaya meningkatkan efektivitas pembelajaran guling depan melalui metode PAKEM yang dilakukan oleh guru dapat meningkatkan hasil belajar guling depan di SD tersebut. Hal itu bisa di lihat peningkatan persentase siswa yang tuntas belajar secara individu dan secara klasikal dari sebelum dan sesudah dilakukan PTK. Saran dari penelitian ini adalah guru pendidikan jasmani menggunakan metode PAKEM dalam proses pembelajaran sehingga siswa merasa senang dan rasa percaya. Dengan demikian proses pembelajaran dapat tercapai.

Analisis perkembangan retribusi daerah di Kabupaten Lamongan tahun anggaran 2005-2010 (Data Triwulanan) / Pratiwi Yuniar Primastuti

 

Kata kunci: otonomi daerah, PAD, retribusi. Berdasarkan prinsip otonomi daerah yang nyata dan bertanggungjawab, penyelenggaraan pemerintahan dan pembangunan secara bertahap akan lebih dilimpahkan kepada pemerintah daerah. Dengan adanya pelimpahan tersebut menyebabkan daerah mempunyai kewajiban untuk lebih mengembangkan dan meningkatkan sumberdaya yang cukup potensial bagi setiap daerah. Salah satu sumber dari pendapatan daerah adalah Pendapatan Asli Daerah (PAD). PAD terdiri dari pajak daerah, retribusi daerah, hasil perusahaan daerah, dan lain-lain usaha yang sah. Dari sumber-sumber penerimaan daerah tersebut, salah satu sumberdaya yang perlu dikembangkan adalah penerimaan retribusi daerah khususnya di Kabupaten Lamongan. Penelitian ini dilakukan di Dinas Pendapatan, Pengelolaan Keuangan dan Aset Kabupaten Lamongan. Penelitian yang dilakukan bertujuan untuk mengetahui seberapa besar kontribusi retribusi daerah terhadap PAD, seberapa besar tingkat dan kecenderungaan efektivitas retribusi daerah, seberapa besar tingkat elastisitas retribusi terhadap perubahan PAD, bagaimana prospek realisasi penerimaan retribusi daerah pada tahun yang akan datang dengan menggunakan analisa trend, dan sumber retribusi apa yang berkontribusi maksimal untuk PAD. Penelitian dilakukan di Kabupaten Lamongan menggunakan data penerimaan retribusi daerah dan penerimaan PAD dari tahun anggaran 2005-2010 secara triwulanan. Hasil analisis yang dilakukan menunjukkan kontribusi retribusi daerah Kabupaten Lamongan terhadap PAD pada periode 2005-2010 mengalami penurunan sebesar 18,77% dari 31,60% pada triwulan I tahun 2005 menjadi 12,83% pada triwulan IV tahun 2010. Efektifitas pengelolaan retribusi terhadap PAD dari tahun anggaran 2005-2010 bisa dikatakan belum efektif karena target yang ditetapkan belum dapat selalu tercapai dan TPTnya kebanyakan kurang dari 100%. Meskipun nilai TPT belum mencapai target yang ditetapkan namun nilai TPT melebihi target pada triwulan IV setiap akhir tahun. Elastisitas retribusi terhadap PAD di Kabupaten Lamongan selama tahun anggaran 2005-2010 menunjukkan koefisien elastisitas rata-ratanya 1,042% yang berarti retribusi daerah bersifat elastis karena penerimaan retribusi daerah relatif peka terhadap PAD. Analisis trend retribusi terhadap PAD untuk masa yang akan datang yaitu pada tahun 2011 sampai 2015 cenderung mengalami peningkatan. Terbukti dari perhitungan dan analisis trend retribusi pada lima tahun kedepan diprediksi meningkat. Sumber penerimaan retribusi yang berkontribusi maksimal untuk PAD Kabupaten Lamongan adalah retribusi pelayanan kesehatan (RSUD).

Hubungan wawasan dunia kerja dan kompetensi akademik dengan kesiapan memasuki dunia kerja padxa siswa kelas XII Program Stusi Elektronika SMK di Malang / Habibi

 

Kata Kunci: Wawasan Dunia Kerja, Kompetensi Akademik, Kesiapan Memasuki Dunia Kerja, Siswa Kelas XII, Program Studi Elektronika. Dunia kerja merupakan tujuan akhir yang ingin diraih oleh setiap lulusan, termasuk lulusan SMK program studi elektronika. Karena pendidikan kejuruan merupakan pendidikan menengah yang mempersiapkan siswanya untuk bekerja dalam bidang tertentu. Namun pada kenyataannya 50 persen lebih lulusan SMK belum mendapatkan pekerjaan sesuai bidang keahliannya. Hal ini dikarenakan siswa tidak mengetahui kompetensi yang dibutuhkan dunia kerja. Oleh karena itu, sebelum lulus siswa harus memiliki wawasan dunia kerja dan kompetensi akademik yang tinggi untuk memasuki dunia kerja. Dengan demikian siswa dapat memiliki kesiapan yang matang untuk memasuki dunia kerja. Tujuan dalam penelitian ini adalah untuk: (1) Mendeskripsikan tingkat wawasan dunia kerja (X1); (2) Mendeskripsikan tingkat kompetensi akademik (X2); (3) Mendeskripsikan tingkat Kesiapan memasuki dunia kerja (Y); (4) Mendeskripsikan signifikansi hubungan X1 dengan Y; (5) Mendeskripsikan signifikansi hubungan X2 dengan Y; dan (6) Mendeskripsikan signifikansi hubungan X1 dan X2 dengan Y. Metode yang digunakan dalam penelitian ini adalah deskriptif korelasional. Metode sampling yang dipakai adalah proporsional random sampling dengan responden 155 siswa. Analisis diperoleh dengan menggunakan teknik regresi linear ganda, yaitu untuk mengetahui besarnya hubungan X1 dan X2 secara bersama- sama dengan Y. Analisis data dilakukan dengan bantuan program SPSS for windows release 16. Hasil penelitian adalah sebagai berikut: (1) Tingkat X1 dalam kategori tinggi yaitu sebanyak 82 responden (53%); (2) Tingkat X2 dalam kategori tinggi yaitu sebanyak 152 responden (98%); (3) Tingkat Y dalam kategori sangat tinggi yaitu sebanyak 75 responden (48%). Nilai koefisien parsial antara X1 dengan Y yaitu Ry1 sebesar 0,686. Nilai koefisien korelasi parsial antara X2 dengan Y yaitu Ry2 sebesar 0,293. Besarnya nilai koefisien korelasi ganda 2 prediktor antara X1 dan X2 dengan Y yaitu R sebesar 0,695. Kesimpulan penelitian ini adalah sebagai berikut: (1) X1 berada dalam kategori tinggi, X2 berada dalam kategori tinggi, dan Y berada dalam kategori sangat tinggi; (2) Ada hubungan positif antara X1 dengan Y dengan sig. = 0,00 < 0,05; (3) Ada hubungan positif antara X2 dengan Y dengan sig. = 0,00 < 0,05; (4) Ada hubungan positif dan signifikan antara X1 dan X2 dengan Y dengan sig. = 0,00 < 0,05. Variabel wawasan dunia kerja dan kompetensi akademik memberikan sumbangan efektif terhadap kesiapan memasuki dunia kerja sebesar masingmasing 46,34% dan 2,06% dengan total sumbangan 48,40%. Sedangkan 51,60% disebabkan variabel lain yang tidak diteliti dalam penelitian.

Using SQ3R to improve reading ability of the second semester students of PGMI Departement of STAI Diponegoro Tulungagung / Luluk Anjarwati

 

, State University of Malang, Graduate Program in English Education. Advisors: (I) Dr. Suharmanto Ruslan, M.Pd. (II) Prof. H. Ali Saukah, M.A., Ph.D. Key words: SQ3R, Improving, Reading Ability, PGMI, A Private Islamic College (STAI) Diponegoro Tulungagung. The objective of the study was to describe how to use SQ3R strategy in improving the second semester students' reading comprehension of Islamic Elementary Teacher Education (PGMI). Based on the problem found in preliminary study that students got difficulty to identify the unfamiliar words, explicit main idea and supporting details, identify the explicit information. Then SQ3R applied to overcome the problems. SQ3R stands for Survey, Question, Read, Recite, and Review. The method of the research is Classroom Action Research (CAR) study involves the students of the second semester of Teacher Education for Islamic Elementary School (PGMI) in reading comprehension that consisted 22 students. The criteria of success was students could achieve gain equal or more to 15 point of 70% of all students. The result of the study noted that reading comprehension test in cycle I, the students' score who achieved the gain was 31.81%. While in cycle II the students' score who achieved the gain was 86.36%. Then the researcher determined to stop the cycle. Since the result met the criteria of success. The result of implementing the SQ3R strategy, in survey step; students can identify the unfamiliar words. Students can identify explicit information in question steps; in reading, recite and review steps students can identify explicit main idea and supporting details. From the steps it can be concluded that the strategy of SQ3R is very effective for teaching reading comprehension in tertiary level of second semester students at Islamic Studies Elementary Teacher Education (PGMI) if it follows several procedures: (1) activate student’s background knowledge before reading, (2) providing some pictures or real objects as the instructional media, (3) finding the meaning of the unfamiliar words, (4) formulating list of questions as the prediction, (5)reading the introductory and concluding paragraph, (6) answering the previously formulated questions, (7) keeping the information in the long term memory, (8) recalling the keeping information, (9) presenting reports by using own sentences, (10) doing verification about the report by reading the text, (11) writing the verification result. For further researchers, it is expected to have such a modified strategy in different field not only language skill but also in science or social study.  

Pengembangan e-Module dengan model pembelajaran Learning Cycle 5E pada pokok bahasan senyawa alkana. alkena, dan alkuna untuk SMA kelas X/2 / Lilik faridah

 

Kata Kunci: e-Module, Learning Cycle 5E, Alkana, Alkena, Alkuna. Perkembangan ICT telah berpengaruh terhadap bidang pendidikan, terutama dalam pembuatan suatu bahan ajar untuk siswa. Saat ini siswa membutuhkan suatu bahan ajar yang lebih interaktif yang dapat mendukung proses pembelajaran siswa yang mempunyai karakteristik berbeda-beda. Berbagai macam bahan ajar telah banyak dikembangkan, salah satunya modul cetak yang dapat digunakan siswa untuk belajar secara mandiri. Namun siswa memerlukan bahan ajar yang lebih inovatif untuk menunjang proses belajarnya. Salah satu bahan ajar alternative adalah e-Module yang mempunyai tampilan menarik dan merupakan pengembangan dari bahan ajar cetak seperti modul yang sudah ada. Maka dari itu dikembangkan e-Module pembelajaran kimia pokok bahasan senyawa alkana, alkena, dan alkuna. e-Module yang dikembangkan dikhususkan pada pokok bahasan tersebut karena materinya yang cukup banyak sehingga diperlukan suatu bahan ajar yang dapat mendukung proses belajar siswa secara sistematis berdasarkan Learning Cycle 5E. Penelitian dan pengembangan ini bertujuan untuk menghasilkan suatu bahan ajar berupa e-Module dan mengetahui tingkat kelayakannya untuk digunakan dalam proses pembelajaran. Penelitian dan pengembangan ini menggunakan model pengembangan yang diadaptasi dari Dick & Carey dalam Sadiman (2009) yang terdiri dari 8 tahap, antara lain: (1) identifikasi kebutuhan; (2) perumusan tujuan; (3) perumusan butir-butir materi; (4) perumusan alat pengukur keberhasilan; (5) penulisan naskah media; (6) validasi; (7) revisi; dan (8) produksi. Teknik analisis data hasil validasi media e-module yang digunakan adalah validasi individu dan validasi kelompok terdiri dari penilaian angket dengan daftar check list untuk data kuantitatif dan saran beserta kritik untuk data kualitatif. Hasil penelitian menunjukkan bahwa: (1) silabus dan RPP yang dikembangkan layak digunakan dengan hasil validasi akhir sebesar 93%; dan (2) bahan ajar e-Module senyawa alkana, alkena, dan alkuna dengan model pembelajaran LC 5E memperoleh hasil validasi akhir sebesar 91% dari ahli media dan ahli materi serta 78% dari pengguna. Dari hasil tersebut dapat dinyatakan bahwa RPP dan e-Module senyawa alkana, alkena, dan alkuan yang dikembangkan dengan model pembelajaran LC 5E telah layak digunakan dalam proses pembelajaran dan telah sesuai dengan langkah-langkah pembelajaran LC 5E.

Improving the reading comprehension ability of the second year students of MA Al Khoiriyah Putukrejo Gondanglegi through Teams-GFames-Tournament strategy / Mulyono

 

. Program Pascasarjana pada Pendidikan Bahasa Inggris, Universitas Negeri Malang. Pembimbing: (I) Dr. Johannes A. Prayogo, M.Pd., M.Ed. (II) Drs. Fachrurrazy M.A., Ph.D Kata kunci: strategi TGT, peningkatan, kemampuan membaca Membaca sangat penting dalam kehidupan sehari-hari, oleh karena itu membaca sangat penting untuk dipelajari. Bagi siswa membaca diperlukan sebagai alat untuk mempelajari berbagai macam ilmu pengetahuan. Sehingga keberhasilan didalam membaca sangat penting bagi siswa. Sehubungan dengan pentingnya membaca bagi siswa, di Indonesia keterampilan membaca diajarkan ditingkat SD sampai perguruan tinggi. Bagaimanapun, hasil penelitian pendahuluan yang dilakukan di MA Al Khoiriyah Putukrejo Gondanglegi menunjukkan bahwa kemampuan membaca pemahaman siswa belum memadai, terbukti prestasi mereka masih relatif rendah dan belum memenuhi standar ketuntasan belajar minimal. Oleh karena itu penelitian tindakan kelas ini dilaksanakan sebagai salah satu solusi untuk mengatasi kesulitan yang dihadapi siswa dalam membaca pemahaman. Dengan alasan tersebut, maka TGT diterapkan pada pembelajaran membaca pemahaman untuk meningkatkan membaca pemahaman siswa dalam teks naratif dan report. Penelitian ini dirancang untuk penelitian tindakan kelas secara kolaborasi yang melibatkan peneliti dan guru kelas yang berkolaborasi merancang rencana pembelajaran, mengimplementasikan rencana tindakan, melakukan pengamatan, dan melakukan analisis dan refleksi. Dalam melakukan penelitian ini, peneliti bertindak sebagai praktisi dan guru kelas berperan sebagai pengamat. Subyek dalam penelitian ini adalah siswa kelas sebelas MA Al Khoiriyah Putukrejo Gondanglegi Jurusan IPA tahun pelajaran 2010/2011 yang berjumlah 25 orang. Penelitian ini dilaksanakan dalam 2 siklus yang berdasarkan prosedur penelitian tindakan kelas yang meliputi tahap perencanaan, implementasi, observasi, analisis dan refleksi. Setiap siklus dilaksanakan dalam tiga pertemuan. Data penelitian dikumpulkan dengan menggunakan instrumen penelitian yang berupa ceklist pengamatan, pedoman wawancara, catatan lapangan, dan tes membaca pemahaman. Penelitian ini menunjukkan prosedur yang terbaik untuk menerapkan strategi TGT dalam pembelajaran membaca pemahaman adalah dibagi menjadi tiga tahap. Tahap yang pertama, pendahuluan; a) membagi siswa menjadi beberapa tim yang terdiri atasa 4 atau lima siswa di setiap tim, b) mempertunjukkan gambar kepada para siswa dan menanyakan beberapa pertanyaan yang berhubungan dengan gambar secara lisan, c) meminta para siswa untuk memprediksi topic yang akan dibahas, d) meminta para siswa untuk menyebutkan kata-kata yang mungkin banyak digunakan dan menuliskanya di papan tulis. Tahap yang kedua, kegiatan inti; a) meminta para siswa untuk membaca teks dalam hati, b) meminta para siswa untuk mendiskusikan isi dari teks dan menjawab pertanyakan dengan tim mereka, c) meminta tim untuk mempresentasikan jawaban mereka pada tim yang lain, d) meminta tim yang lain untuk memberi komentar kepada tim yang mempresentasikan jawabanya, e) meminta para siswa untuk membentuk tim turnamen, f) menjelaskan aturan turnamen, g) meminta tim untuk mendiskusikan materi untuk turnamen, h) meminta tim kumpul ke meja turnamen, i) memonitoring pelaksanaan turnamen . Tahap yang ketiga kegiatan akhir; a) mengevaluasi dan menghitung hasil dari turnamen, b) mengumumkan tim terbaik dari turnamen, c) memberi penghargaan kepada pemenang, d) membuat kesimpulan dan menutup kelas. Selanjutnya hasil penelitian ini menunjukkan bahwa strategi TGT telah meningkatkan kemampuan membaca pemahaman siswa. Peningkatan tersebut dapat dilihat dari nilai membaca siswa yang telah memenuhi standar ketuntasan belajar minimal. Adapun rata-rata nilai yang diperoleh siswa dari tiga kali tes adalah 51,6 diperoleh dari pre-tes, 57,8 dari tes 1 dan 69,2dari nilai tes 2. Dengan kata lain siswa yang terkategori sukses dalam pre-test sebanyak 16% atau 9 orang, 36% atau 14 dalam test 1, dan 76% atau 19 orang pada test 2. Disamping dapat meningkatkan kemampuan membaca pemahaman strategi ini juga bisa meningkatkan partisipasi dan keaktifan siswa dalam proses pembelajaran membaca pemahaman hal ini dapat dilihat dari hasil observasi proses pembelajaran membaca pemahaman (Appendix 3e) dan hasil angket respon terhadap pembelajaran menggunakan strategi TGT (Appendix 6b) Berdasarkan hasil penelitian di atas, beberapa saran ditujukan untuk guru bahasa Inggris, kepala sekolah dan peneliti yang akan datang. Bagi guru bahasa Inggris yang mempunyai masalah serupa diharapkan mereka dapat mengimplementasikan strategi TGT sebagai salah satu alternatif untuk meningkatkan kemampuan membaca pemahaman siswa. Kepada kepala sekolah hasil penelitian ini diharapkan bisa memberikan kontribusi terhadap pengembangan dalam proses belajar mengajar. Kepada peneliti yang akan datang, mereka dianjurkan untuk membuat kajian penelitian serupa secara mendalam di tingkat pendidikan yang berbeda dengan tempat, subyek penelitan, dan jenis teks yang berbeda untuk mengetahui apakah strategi TGT juga efektif untuk meningkatkan prestasi membaca siswa.

Optimasi waktu inkubasi dan jumlah ampas tebu pada hidrilisis ampas tebu secara enzimatis menggunakan ekstrak kasar sistem selulase Basillus circulans / M. Dicky Erya

 

Kata Kunci: optimasi, hidrolisis, ampas tebu, selulase, Bacillus circulans. Ampas tebu merupakan lignoselulosa yang terdiri dari dari 37% selulosa, 28% hemiselulosa, dan 21% lignin. Selulosa dalam ampas tebu dapat didegradasi menjadi glukosa melalui hidrolisis secara enzimatis menggunakan ekstrak kasar sistem selulase yang dihasilkan Bacillus circulans. Faktor-faktor yang mempengaruhi hidrolisis secara enzimatis antara lain waktu inkubasi dan jumlah ampas tebu. Optimasi pada tahap tersebut dilakukan untuk meningkatkan persen sakarifikasi yang dihasilkan. Tujuan penelitian ini untuk mengetahui waktu inkubasi dan jumlah ampas tebu optimum pada hidrolisis ampas tebu secara enzimatis menggunakan ekstrak kasar sistem selulase Bacillus circulans. Penelitian ini bersifat deskriptif yang dilakukan secara eksperimental di Laboratorium Kimia FMIPA UM. Tahapan penelitian ini adalah: (1) produksi ekstrak kasar selulase dari Bacillus circulans, (2) preparasi ampas tebu untuk memperoleh ampas tebu yang hydrolyzable, (3) penentuan waktu inkubasi optimum hidrolisis ampas tebu secara enzimatis menggunakan ekstrak kasar sistem selulase Bacillus circulans, (4) penentuan jumlah ampas tebu optimum tahap hidrolisis ampas tebu secara enzimatis menggunakan ekstrak kasar sistem selulase Bacillus circulans. Penentuan waktu inkubasi optimum dilakukan antara 0-96 jam dengan interval 2 jam. Penentuan jumlah ampas tebu dilakukan dengan variasi massa 10, 15, 20, 30, 50, 70, 100, 200, 300 dan 500 gram. Penentuan kadar glukosa hasil hidrolisis menggunakan metode Somogyi-nelson. Hasil penelitian menunjukkan bahwa waktu inkubasi optimum pada hidrolisis ampas tebu secara enzimatis menggunakan ekstrak kasar sistem selulase Bacillus circulans adalah 12 jam dengan persen sakarifikasi sebesar 2,13% dan 2,02%. Jumlah ampas tebu optimum adalah 50 gram yang menghasilkan glukosa sebesar 1663,27 mg dan persen sakarifikasi sebesar 3,33%.

Penerapan analisis konjoin (Conjoint Analysis) dalam pengembangan produk baru untuk sabun mandi padat (studi kasus pada mahasiswa Jurusan Matematika Universitas Negeri Malang) / Lisa Dewi Priyanti

 

Kata Kunci: analisis konjoin, atribut-atribut beserta levelnya yang mempengaruhi preferensi mahasiswa Jurusan Matematika dalam pemilihan produk sabun mandi padat, Regresi Peubah Dummy Sabun mandi adalah salah satu produk bisnis yang sangat menguntungkan karena sabun mandi merupakan kebutuhan pokok masyarakat. Untuk itu perlu dilakukan inovasi baik dalam hal promosi, reformasi produk maupun merek. Untuk menghadapi masalah tersebut, salah satu cara yang bisa dilakukan adalah membuat suatu pengembangan produk baru. Produk baru ini merupakan hasil pengembangan produk yang mengalami modifikasi inovasi, baik kecil maupun besar (produk yang belum pernah dijual oleh orang lain). Pada penelitian ini digunakan metode analisis konjoin untuk mengetahui atribut-atribut beserta levelnya dari sabun mandi padat yang paling sesuai dengan keinginan para konsumen khususnya mahasiwa Jurusan Matematika Fakultas MIPA Universitas Negeri Malang. Atribut yang digunakan dalam penelitian ini diantaranya meliputi manfaat , ukuran, aroma, warna dan harga. Untuk atribut manfaat terdiri dari kecantikan dan kesehatan, untuk atribut ukuran meliputi 70 gram, 90 gram, dan 120 gram, umtuk atribut aroma meliputi aroma buah, aroma bunga, dan aroma parfum, untuk atribut warna meliputi putih, muda, dan gelap, untuk atribut harga meliputi <2500, 2500 sampai 3500, dan >3500. Dalam tahapan analisis konjoin ini menggunakan regresi peubah dummy untuk mencari koefisien parthworth yang digunakan untuk mencari nilai utility level dari masing-masing atribut sabun mandi padat. Variabel respon dari kasus ini berupa nilai rata-rata preferensi 100 responden dengan variabel prediktornya yaitu level-level dari atribut sabun mandi padat yang sudah diubah ke bentuk variabel dummy diantaranya meliputi manfaat kecantikan (X1), ukuran 70 gram (X2), ukuran 90 gram (X3), aroma buah (X4), aroma bunga (X5), warna putih (X6), warna muda (X7), harga <2500,- (X8), dan harga 2500,- sampai 3500,- (X9). Dengan terbentuknya model regresi peubah dummy, diperoleh produk baru sabun mandi padat dari preferensi responden mahasiswa Jurusan Matematika melalui perhitungan koefisien parthworth yaitu sabun mandi padat kesehatan dengan nilai utiliti sebesar 0,078, ukuran 120 gram dengan nilai utiliti sebesar 0,1497, aroma bunga dengan nilai utiliti sebesar 0,0467, warna muda dengan nilai utiliti sebesar 0,0587, dan harga antara Rp2500,- sampai Rp3500,- dengan nilai utiliti sebesar 0,1947.

Analisis buku teks IPA kelas IV sekolah dasar se-Kecamatan Pandaan Kabupaten Pasuruan / Wiwin Fidiyawati

 

Kata Kunci: Analisis, Buku Teks, IPA SD Buku teks yang relevan diperlukan untuk pembelajaran dan merupakan sarana untuk menjamin keterlaksanaan kurikulum yang dirancang. Dari segi isinya, buku teks yang beredar masih memiliki kekurangan termasuk dalam buku teks IPA. Hal tersebut dapat mempengaruhi guru maupun peserta didik sebagai pengguna buku. Meskipun sudah melalui proses revisi, namun masih ditemukan beberapa buku teks IPA yang isi materinya kurang sesuai dengan kurikulum, terdapat konsep yang kurang tepat. Menggunakan gambar ilustrasi yang kurang jelas dari segi ukuran yang terlalu kecil, gambar tidak berwarna, dan tidak sesuai dengan materi. Soal evaluasi pada buku pun kurang bervariasi. Penelitian ini bertujuan untuk mendeskripsikan kesesuaian materi pada buku teks dengan kurikulum yang berlaku (KTSP), ketepatan konsep, kesesuaian gambar ilustrasi, serta soal evaluasi pada buku teks IPA. Penelitian dilakukan pada buku teks IPA kelas IV dengan pengarang dan penerbit yang berbeda yang digunakan di SD/MI Kecamatan Pandaan Kabupaten Pasuruan. Penelitian ini menggunakan jenis penelitian deskriptif kualitatif yang merupakan metode penelitian yang berusaha menggambarkan dan menginterpretasi objek sesuai dengan apa adanya. Analisis data dianalisis secara deskriptif. Untuk kesesuaian materi dengan kurikulum, ketepatan konsep, kesesuaian gambar ilustrasi dengan materi, serta soal evaluasi akan dianalisis secara deskriptif kualitatif dengan persentase. Hasil penelitian menunjukkan bahwa kesesuaian isi materi dengan kurikulum pada buku sebagian kecil tergolong tinggi kesesuaiannya dengan kurikulum, sedangkan sebagian besar buku tergolong cukup kesesuaiannya dengan kurikulum. Ketepatan konsep pada buku sangat kecil sekali yang tergolong cukup dengan konsep yang sebenarnya dan sebagian besar buku memiliki ketepatan konsep yang tinggi. Kesesuaian gambar ilustrasi dengan materi pada buku seluruhnya telah sesuai dengan materi. Pada kelima buku soal evaluasi pada aspek kognitif seluruhnya tergolong tinggi dan tidak terdapat aspek afektif dan aspek psikomotor. Berdasarkan hasil penelitian, disarankan bagi guru dan peserta didik untuk lebih cermat dalam memilih buku sumber yang sesuai dengan karakter penggunanya, serta tidak hanya menggunakan satu buku dalam pembelajaran.

Pengaruh pemanfaatan perpustakaan sekolah dan minat baca terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang / Kurnia Puspitasari

 

Kata Kunci : pemanfaatan perpustakaan sekolah, minat baca, hasil belajar Perpustakaan sekolah merupakan bagian penting dari komponen pendidikan yang tidak dapat dipisahkan keberadaannya dari lingkungan sekolah. Keberadaan perpustakaan sekolah merupakan salah satu sumber belajar yang memberikan sumbangan yang sangat berharga dalam upaya meningkatkan aktivitas siswa serta meningkatkan kualitas pendidikan dan pengajaran. Melalui penyediaan perpustakaan, siswa dapat berinteraksi dan terlibat langsung baik secara fisik maupun mental dalam proses belajar. Selain itu, keberadaan perpustakaan sekolah menjadi sarana penunjang untuk meningkatkan minat baca, kegemaran membaca, kebiasaan membaca, dan budaya membaca siswa yang pada akhirnya dapat meningkatkan hasil belajarnya. Penelitian ini bertujuan untuk menjelaskan: (1) pengaruh pemanfaatan perpustakaan sekolah terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang. (2) pengaruh minat baca terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang. (3) pengaruh pemanfaatan perpustakaan sekolah dan minat baca terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang. Jenis penelitian ini adalah penelitian populasi sehingga subjek penelitian ini adalah seluruh siswa kelas XI IPS di SMA Negeri 4 Malang yang berjumlah 71 siswa. Metode yang digunakan dalam penelitian ini adalah metode kuantitatif. Data dianalisis dengan analisis statistik deskriptif, analisis statistik inferensial dengan analisis regresi linear berganda, uji asumsi klasik, dan uji hipotesis dengan uji t dan uji F dengan bantuan komputer program SPSS 16.0 for Windows. Berdasarkan hasil analisis data menunjukkan secara parsial pemanfaatan perpustakaan sekolah berpengaruh positif dan signifikan terhadap hasil belajar dengan nilai sig. t sebesar (0,000) < α (0,05) dan t hitung (4,503) > t tabel (1,668), analisis pengaruh minat baca terhadap hasil belajar secara parsial berpengaruh positif dan signifikan terhadap hasil belajar siswa dengan nilai sig. t sebesar (0,001) < α (0,05) dan t hitung (3,653) > t tabel (1,668). Sedangkan secara simultan pengaruh pemanfaatan perpustakaan sekolah dan minat baca berpengaruh positif dan signifikan terhadap hasil belajar siswa dengan nilai sig. F sebesar (0,000) < α (0,05) dan F hitung (21,222) > F tabel (3,132). Selain itu, dari hasil analisis regresi besar R Square adalah 0,384. Berdasarkan hasil analisis dapat di simpulkan bahwa: (1) Ada pengaruh positif dan signifikan pemanfaatan perpustakaan sekolah terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang. (2) Ada pengaruh positif dan signifikan minat baca terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang. (3) Ada pengaruh positif dan signifikan pemanfaatan perpustakaan sekolah dan minat baca terhadap hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang, variabel-variabel tersebut secara bersama-sama mempengaruhi hasil belajar siswa kelas XI IPS pada mata pelajaran ekonomi di SMA Negeri 4 Malang. Saran yang dapat diajukan dari penelitian ini adalah: (1) bagi sekolah, diharapkan pihak sekolah memperluas atau menambah lagi gedung perpustakaan melalui kerjasama dengan orang tua murid sehingga gedung perpustakaan dapat ideal dengan jumlah siswa di SMA Negeri 4 Malang. (2) bagi guru bidang studi khususnya bidang studi ekonomi diharapkan mengadakan proses belajar yang melibatkan perpustakaan sekolah dengan menugaskan siswa berkunjung ke perpustakaan, menugaskan siswa untuk menjawab soal-soal materi mata pelajaran Ekonomi yang bersumber dari buku-buku paket Ekonomi yang ada di perpustakaan, dan menugaskan siswa untuk mencari informasi tambahan di perpustakaan terkait dengan mata pelajaran Ekonomi untuk memperkaya pengetahuan. (3) bagi guru pustakawan, diharapkan memperbanyak koleksi bahan pustaka yang beragam khususnya yang berkaitan dengan mata pelajaran Ekonomi yang disesuaikan dengan kebutuhan, menyelenggarakan pameran buku di sekolah, memperpanjang jam buka perpustakaan, dan mengadakan bimbingan membaca. (4) Bagi orang tua, diharapkan menyediakan bahan bacaan yang beragam dan bermanfaat di rumah, meluangkan waktunya untuk membaca buku atau menemani putra-putrinya membaca buku, memberikan pengertian kepada putra-putrinya untuk rajin belajar dan mengerjakan tugas sekolah. (5) bagi siswa, diharapkan siswa dapat memanfaatkan fasilitas perpustakaan sekolah yang sudah tersedia seperti melakukan kegiatan berkunjung ke perpustakaan, membaca bahan pustaka, meminjam bahan pustaka di perpustakaan, mengerjakan tugas, dan mencari informasi. (6) bagi peneliti selanjutnya, hendaknya meneliti variabel lain yang mempengaruhi pemanfaatan perpustakaan sekolah dan minat baca. Selain itu, apabila peneliti selanjutnya ingin meneliti hal yang sama diharapkan dapat menyempurnakan dan menambahkan hal-hal yang masih kurang dari penelitian ini dengan cara menambahkan kajian teori, sub variabel dan indikator.

Pengembangan Buku Latihan Siklus Akuntansi Perusahaan Jasa (BLSAPJ) model praktikum bagi siswa jurusan IPS kelas XI SMA Negeri8 2 Sumbawa Besar / Ansari

 

Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (1) Dr. Sunaryanto, M.Ed., (II) Prof. Dr. Bambang Sugeng, MA.MM.Ak Kata kunci: Pengembangan, Buku Latihan Siklus Akuntansi Perusahaan Jasa (BLSAPJ), Model Praktikum. Menyusun ilustrasi data tentang materi soal transaksi perusahaan jasa untuk dua priode pembukuan, dalam sebuah buku latihan akuntansi dengan model praktikum sangat dibutuhkan oleh siswa sebagai sarana dalam memfasilitasi kesenjangan antara materi yang diperoleh dengan pengalaman sosial yang diperoleh sehari-hari. Mengingat pentingnya pemenuhan kebutuhan belajar sesuai dengan karakteristik siswa, maka perlu disusun suatu Buku Latihan Siklus Akuntansi Perusahaan Jasa (BLSAPJ) yang valid, praktis dan efektif bagi siswa kelas XI IPS di SMA Negeri 2 Sumbawa Besar. Tujuan dari penelitian ini adalah menghasil sebuah prototipe bahan ajar berupa Buku Latihan Siklus Akuntansi Perusahaan Jasa (BLSAPJ) yang valid, praktis dan efektif bagi siswa kelas XI IPS di SMA Negeri 2 Sumbawa Besar. Model yang digunakan dalam pengembangan perangakat pembelajaran ini adalah Model Thiagarajan Semmel and Semmel, yang lebih dikenal dengan model 4-D (Four-D), yang terdiri dari: (1) Tahap Define (pendefinisian), (2) Tahap Design (perancangan), (3) Tahap Develop (pengembangan) dan (4) Tahap Disseminate (penyebaran). Hasil validasi dua validator terhadap BLSAPJ untuk siswa dan pegangan guru rata-rata 89% (sangat valid). Demikian juga dengan hasil validasi terhadap pedoman BLSAPJ untuk siswa dan pegangan guru 91% (sangat valid). Selanjutnya hasil uji perorangan (keterbacaan) terhadap BLSAPJ menunjukkan 80% mudah dipahami. Kemudian uji kelompok kecil tentang keterlaksanaan 1 dan 2, respon siswa terhadap BLSPJ menunjukkan 88%, uji keterlaksanaan rata-rata 89%, termasuk dalam kreteria sangat praktis untuk dilaksanakan. Hasil penilaian pre-test dan pos-test menujukkan perubahan yang signifikan dimana rata-rata nilai pre-test 74 dan rata-rata nilai pos-test 85 atau mengalami kenaikkan nilai rata-rata 14%. Nilai rata-rata pos-test 85 berada diatas KKM yang ditetapkan, artinya penggunaan BLSAPJ dikatakan efektif, dapat meningkatkan hasil belajar siswa. Kelebihan dari buku latihan adalah disusun secara sistimatis sesuai karakteristik siswa, dilengkapi petunjuk praktis sehingga memudahkan guru mengelaborasikan materi yang disampaikan. Adapun kelemahan dari buku latihan yang dikembangkan adalah pembahasan teori tidak dilakukan secara mendalam sehingga masih memerlukan kajian referensi lain untuk memperluas pemahaman siswa.

Analisis pengaruh Dana Pihak Ketiga (DPK), tingkat penawaran kredit, tingkat suku bunga SBI, Non Performing Loan (NPL) terhadap fungsi intermediasi (studi kasus pada bank Mandiri periode 2009-2011) / Riris Purnawati

 

Kata kunci: DPK, Tingkat Penawaran kredit, tingkat suku bunga SBI, NPL, LDR. Bank mempunyai peranan strategis di dalam mendorong pertumbuhan ekonomi di suatu negara. Mengingat begitu penting peranan lembaga perbankan, maka sudah selayaknya jika lembaga perbankan dituntut untuk dapat menjalankan fungsinya dengan baik. Fungsi utama perbankan adalah Fungsi Intermediasi. Didalam menjalankan fungsi intermediasi bank selalu mengalami peningkatan dan penurunan, mencermati kondisi seperti ini diperlukan suatu penelitian terhadap faktor - faktor yang mempengaruhi fungsi intermediasi perbankan. Penelitian ini dilakukan untuk mengetahui faktor – faktor yang mempengaruhi fungsi intermediasi pada Bank Mandiri tbk. Variabel yang digunakan yaitu variabel bebas yang terdiri dari Dana Pihak Ketiga, tingkat penawaran kredit, tingkat suku bunga SBI, Non Performing Loan dan variabel terikat yang berupa Loan to Deposit Ratio. Data yang digunakan adalah data sekunder, berupa laporan keuangan yang dipublikasikan oleh Perpustakaan Bank Indonesia kota Malang dan berupa laporan keuangan yang dipublikasikan oleh Bank Indonesia selama kurun waktu 2009 hingga 2011. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi berganda dengan program SPSS 17.00 for windows, karena peneliti bertujuan untuk mengetahui dan menganalisis pengaruh masing-masing variabel bebas terhadap variabel terikat, baik secara parsial maupun simultan. Berdasarkan hasil penelitian bahwa secara parsial DPK berpengaruh signifikan dan negatif terhadap LDR, Tingkat Penawaran Kredit berpengaruh signifikan dan positif terhadap LDR. Tingkat suku bunga SBI tidak berpengaruh signifikan dan positif terhadap LDR, NPL tidak berpengaruh signifikan dan negatif terhadap LDR. Secara simultan DPK, Tingkat Penawaran Kredit, Tingkat Suku Bunga dan NPL berpengaruh bersama-sama secara signifikan terhadap LDR. Dari hasil analisis juga dapat dilihat variabel dominan yang mempengaruhi fungsi intermediasi perbankan, yaitu variabel Tingkat Penawaran Kredit.

Pengembangan media pembelajaran CD interaktif berbasis Adobe Director pada pokok bahasan basan usaha dan perusahaan untuk kelas VII SMP Laboratoriumk UM Kota Malang / Tiara Anggia Dewi

 

Kata kunci : CD interaktif, adobe director, badan usaha Salah satu prinsip pelaksanaan dari KTSP adalah kurikulum dilaksanakan dengan menggunakan pendekatan multistrategi dan multimedia, sumber belajar dan teknologi yang memadai dan memanfaatkan lingkungan sekitar sebagai sumber belajar (Mulyasa, 2006:248). Pembahasan materi tentang badan usaha dan perusahaan akan lebih bermakna bagi siswa apabila dikaitkan langsung dengan konteks kehidupan nyata. Salah satu alternatif dalam memperlancar proses pengajaran adalah dengan pemanfaatan teknologi informasi dan komunikasi yang salah satunya adalah CD interaktif. Tujuan penelitian ini adalah untuk (1) Melakukan analisis kebutuhan media pembelajaran CD interaktif, (2) Mengembangkan media pembelajaran CD interaktif, (3) Melakukan validasi terhadap media pembelajaran CD interaktif, (4) Melakukan uji coba media pembelajaran CD interaktif, (5) Menghasilkan media pembelajaran CD interaktif. Jenis penelitian ini adalah penelitian pengembangan produk yang berupa media pembelajaran dan diujicobakan kepada siswa SMP Laboratorium UM Kota Malang. Model yang digunakan dalam pengembangan media pembelajaran ini adalah model prosedural karena bersifat deskriptif, yaitu menggariskan langkah-langkah yang harus diikuti untuk menghasilkan produk. Media pembelajaran yang telah dihasilkan divalidasi oleh ahli media, materi dan telah diujicobakan pada siswa kelas VII D SMP Laboratorium UM Kota Malang. Media ini mencapai tingkat kelayakan sebesar 96.67 % dari ahli materi, 85.00 % dari ahli media, dan dari uji coba pada siswa kelas VII D sebesar 89.21%. Berdasarkan hasil tersebut disimpulkan bahwa media pembelajaran CD interaktif berbasis Adobe Director layak digunakan dalam pembelajaran ekonomi kelas VII SMP. Adapun saran yang dapat dikemukakan penulis adalah sebagai berikut: (1) Guru sebagai fasilitator hendaknya memberikan informasi terlebih dahulu kepada siswa tentang media pembelajaran ekonomi ini untuk mengurangi hambatan-hambatan operasional, (2) Media pembelajaran ini hanya terbatas pada pokok bahasan badan usaha dan perusahaan untuk siswa kelas VII, diharapkan dapat dikembangkan media pembelajaran serupa pada pokok bahasan lainnya, (3) Untuk penelitian dan pengembangan media pembelajaran selanjutnya, sebaiknya peneliti dan pengembang menerapkan media pembelajarannya ke dalam penelitian tindakan kelas (PTK), agar dapat diketahui efektifitas media pembelajaran untuk meningkatkan hasil belajar siswa

Pengaruh minat belajar dan persepsi siswa pada keterampilan guru dalam mengelola kelas dan pemanfaatan media pembelajaran oleh guru terhadap hasil belajar matapelajaran ekonomi di kelas X SMA Negeri 5 Kota Malang / Dessy Puspitaningrum

 

Kata Kunci: Minat Belajar dan Persepsi Siswa, Keterampilan Guru dalam Mengelola Kelas, Pemanfaatan Media Pembelajaran oleh Guru, Hasil Belajar Pendidikan merupakan aktivitas sadar dan sengaja yang diarahkan untuk membawa peserta didik mencapai tujuan. Agar dapat mencapai tujuan yang efektif dan efisien dalam penyelenggaraan program pendidikan, maka diperlukan evaluasi. Bagi siswa, evaluasi diberikan terhadap hasil belajar mereka. Adapun hasil belajar siswa menurut para ahli secara umum dipengaruhi oleh beberapa faktor yaitu faktor intern meliputi faktor kesehatan, psikologis (intelegensi, perhatian, minat, bakat) dan kelelahan, serta faktor eksternal yaitu faktor keluarga, sekolah, dan masyarakat. Dalam penelitian ini faktor yang diteliti adalah faktor psikologis yang berfokus pada minat belajar, dan faktor sekolah yang meliputi keterampilan guru dalam mengelola kelas dan pemanfaatan media pembelajaran oleh guru. Tujuan dari permasalahan penelitian ini yaitu untuk mengetahui (1) Apakah ada pengaruh yang signifikan antara minat belajar terhadap hasil belajar siswa pada matapelajaran ekonomi, (2) Apakah ada pengaruh yang signifikan antara persepsi siswa pada keterampilan guru dalam mengelola kelas terhadap hasil belajar siswa pada matapelajaran ekonomi, (3) Apakah ada pengaruh yang signifikan antara persepsi siswa pada pemanfaatan media pembelajaran oleh guru terhadap hasil belajar siswa pada matapelajaran ekonomi, (4) Apakah ada pengaruh yang signifikan secara bersama-sama antara minat belajar, persepsi siswa tentang keterampilan guru dalam mengelola kelas dan persepsi siswa pemanfaatan media pembelajaran oleh guru terhadap hasil belajar siswa pada matapelajaran ekonomi. Jenis penelitian yang digunakan adalah penelitian kuantitatif dengan teknis analisis regresi linear berganda. Populasi dalam penelitian ini adalah seluruh siswa reguler kelas X SMA Negeri 5 Kota Malang tahun ajaran 2011/2012 yang berjumlah 318 siswa. Pengambilan sampel dalam penelitian ini berdasarkan rumus Slovin dengan menggunakan teknik “proportional random sampling”, dan diperoleh 76 responden. Berdasarkan hasil analisis data, diperoleh empat kesimpulan hasil penelitian yaitu (1) terdapat pengaruh yang signifikan antara minat belajar siswa terhadap hasil belajar siswa,(2) terdapat pengaruh yang signifikan antara persepsi siswa pada keterampilan guru dalam mengelola kelas terhadap hasil belajar siswa,(3) terdapat pengaruh yang signifikan antara persepsi siswa pada pemanfaatan media pembelajaran oleh guru terhadap hasil belajar siswa,(4) terdapat pengaruh yang signifikan secara bersama-sama antara minat belajar, persepsi siswa pada keterampilan guru dalam mengelola kelas dan persepsi siswa pada pemanfaatan media pembelajaran oleh guru terhadap hasil belajar siswa. Adapun saran yang ditujukan kepada guru matapelajaran ekonomi dalam rangka meningkatkan hasil belajar siswa yaitu guru hendaknya harus lebih senantiasa memberikan rangsangan kepada siswa dalam meningkatkan minat belajar siswa terhadap matapelajaran ekonomi, dan senantiasa meningkatan keterampilan dalam mengelola kelas serta penggunaan berbagai macam media pembelajaran sesuai dengan kebutuhan dan kondisi siswa.

Pengaruh kualitas produk dan media iklan televisi terhadap keputusan membeli (Studi pada pengguna dan pemilik sepeda motor Honda di Desa Rejoso, Kec. Binangun Kab. Blitar) / Diana Nofitasari

 

Kata Kunci: Kualitas Produk, Media Iklan Televisi, Keputusan Pembelian Di Era Modernisasi seperti saat ini, seorang pelaku bisnis dalam suatu perusahaan dituntut untuk lebih sigap menghadapi persaingan usaha yang semakin ketat. Mereka harus bisa memanfaatkan sumber dayanya secara optimal seperti berusaha menciptakan suatu produk yang dapat menarik minat konsumen dan mempengaruhi persepsi konsumen untuk melakukan pembelian akan produk yang ditawarkan melalui kegiatan promosi khususnya melalui media iklan televisi. Masalah yang dibahas dalam penelitian ini yaitu: (1) pengaruh kualitas produk terhadap keputusan pembelian sepeda motor Honda Di Desa Rejoso, Kec. Binangun, Kab. Blitar. (2) pengaruh media iklan televise terhadap keputusan pembelian sepeda motor Honda Di Desa Rejoso, Kec. Binangun, Kab. Blitar. Populasi penelitian ini adalah penduduk di Desa Rejoso, Kec. Binangun, Kab. Blitar yang menggunakan dan memiliki sepeda motor Honda dengan sampel sebanyak 110 responden. Metode penelitian yang digunakan adalah penelitian deskriptif kuantitatif. Pengumpulan data dilakukan dengan teknik angket/ kuesioner dan teknik analisis yang digunakan adalah analisis regresi. Hasil penelitian ini menunjukkan bahwa: (1) Terdapat pengaruh secara positif dan signifikan kualitas produk terhadap keputusan pembelian sepeda Motor Honda Di Desa Rejoso Kec. Binangun, Kab. Blitar. Hal ini menunjukkan bahwa penduduk di Desa Rejoso, Kec. Binangun, Kab. Blitar mempunyai ketertarikan atau minat untuk membeli produk sepeda motor honda karena merasa puas dengan kualitas produk yang ditawarkan. (2) Terdapat pengaruh secara positif dan signifikan media iklan televisi terhadap keputusan pembelian sepeda Motor Honda Di Desa Rejoso, Kec. Binangun, Kab. Blitar. Hal ini menunjukkan bahwa penduduk di Desa Rejoso, Kec. Binangun, Kab. Blitar mempunyai ketertarikan atau minat untuk membeli produk sepeda motor honda selain melihat kualitas produknya juga dari tayangan iklan di televisi karena spesifikasi produk yang ditayangkan sesuai dengan kenyataan. Berdasarkan dari penelitian ini maka saran yang diberikan: (1) Bagi konsumen agar lebih teliti dalam melakukan pembelian supaya mencapai kepuasan setelah melakukan pembelian atas produk yang diinginkan seperti melihat kualitas akan produk tersebut. (2) Bagi peneliti selanjutnya yang akan mengadakan penelitian sejenis, disarankan variabel yang ingin diteliti lebih diperluas, sehingga dapat mengungkapkan lebih banyak permasalahan dan memberikan hasil dari temuan penelitian yang lebih berarti dan bermanfaat bagi banyak pihak. Selain itu peneliti lain diharapkan juga menggunakan literatur yang lebih banyak dan up to date

Penerapan permainan kotak misteri untuk meningkatkan kemampuan kognitif anak dalam memahami konsep bilangan di kelompok B TK Negeri Pembina Kota Batu / Meika Lidia Sari Fatmawati

 

Kata kunci: Permainan Kotak Misteri, Kemampuan Kognitif Penelitian ini berlatar belakang pada kemampuan kognitif dalam memahami konsep bilangan kelompok B di TK Negeri Pembina Kota Batu. Dari hasil pra tindakan diketahui bahwa terdapat 4 anak mengalami kurang teliti saat mengerjakan tugas, 5 anak mengalami kurang konsentrasi dalam mengerjakan tugas, dan 7 anak kurang mampu dalam konsep bilangan. Dalam pembelajaran guru cenderung menggunakan metode tanya jawab, pemberian tugas, sehingga anak mudah bosan, konsentrasi hilang, serta kurang menarik minat anak. Berdasarkan uraian tersebut penelitian ini dilakukan dengan menerapakan permainan kotak misteri untuk meningkatan kemampuan kognitif anak dalam memahami konsep bilangan. Rumusan masalah dalam penelitian sebagai berikut: 1) Bagaimana penerapan permainan kotak misteri untuk meningkatkan kemampuan kognitif anak dalam memahami konsep bilangan di kelompok B TK Negeri Pembina Kota Batu, dan 2) Apakah terdapat peningkatan kemampuan kognitif dalam konsep bilangan melalui permainan kotak misteri kelompok B TK Negeri Pembina Kota Batu. Jenis penelitian ini menggunakan model Penelitian Tindakan Kelas (PTK), yang terdiri dari dua siklus, yaitu siklus I dan siklus II masing-masing siklus meliputi: perencanaan, pelaksanaan, observasi, refleksi. Dengan subjek penelitian anak kelompok B TK Negeri Pembina Kota Batu, dengan jumlah 23 anak, terdiri dari 9 anak perempuan dan 14 anak laki-laki. Instrumen penelitian yang digunakan lembar observasi dan dokumentasi. Analisis data yang digunakan secara deskriptif kualitatif. Hasil penelitian ini menunjukkan bahwa penerapan permainan kotak misteri dapat meningkatkan kemampuan kognitif anak dalam memahami konsep bilangan. Hal ini ditunjukkan pada pra tindakan skor prosentase 56%, siklus 1 dengan mencapai skor 66,5%. Siklus II mencapai skor 81%. Peningkatan dari pada pra tindakan, siklus I dan siklus II mencapai 25%. Berdasarkan hasil penelitian dapat disimpulkan bahwa dengan penerapan permainan kotak misteri anak kelompok B TK Negeri Pembina dapat meningkatkan kemampuan kognitif anak dalam memahami konsep bilangan. Saran 1) Bagi guru PAUD dapat menerapkan permainan kotak misteri untuk meningkatkan kemampuan kognitif anak. 2) Bagi Lembaga PAUD disarankan untuk memanfaatkan kegiatan bermain dengan penerapan permainan kotak misteri dalam kegiatan pembelajaran. 3) Bagi Peneliti Lanjutan lebih menyempurnakan permaianan kotak misteri lebih inovasi baik cara bermain, aturan permainan.

Analisis faktor-faktor yang mempengaruhi produktivitas tenaga kerja wanita pada perusahaan rokok PT. Cakra Guna Cipta Kecamatan Pakisaji, Kabupaten Malang / Mayang Sekarini

 

Kata Kunci : Jumlah tanggungan keluarga, lama bekerja, persepsi tenaga kerja atas motivasi, produkktivitas, tenaga kerja wanita. Kabupaten Malang yang memiliki komposisi penduduk berjenis kelamin wanita yang hampir mendekati jumlah penduduk laki-laki merupakan aset pembangunan daerah yang harus diperhitungkan, karena dengan memanfaatkan potensi sumber daya manusia yang ada diharapkan dapat menciptakan sumber daya yang berkualitas dan memiliki daya saing. Adanya kesempatan kerja dan peluang yang diberikan kepada wanita dalam pembangunan bertujuan untuk mengembangkan kemampuan dan keterampilan yang dimiliki dengan tidak mengabaikan peran serta wanita sebagai seorang istri dan ibu. Penelitian ini bertujuan untuk menganalisis faktor-faktor yang mempengaruhi produktivitas tenaga kerja wanita dengan studi kasus pada perusahaan rokok PT. Cakra Guna Cipta, Kecamatan Pakisaji. Pemilihan studi kasus ini berdasarkan pada pertimbangan bahwa industri rokok mampu menyerap lebih banyak tenaga kerja terutama wanita. Dalam hal ini penting bagi perusahaan untuk memperhatikan produktivitas tenaga kerja wanita dalam bekerja sehingga tujuan perusahaan dapat tercapai. Sedangkan produktivitas bagi tenaga kerja sendiri akan berdampak pada peningkatan motivasi dalam bekerja sehingga akan berpengaruh terhadap hasil produksi dan akan meningkatkan kesejahteraan hidupnya. Diduga bahwa variabel yang mempengaruhi produktivitas tenaga kerja wanita pada perusahaan rokok PT. Cakra Guna Cipta adalah jumlah tanggungan keluarga, lama bekerja dan persepsi tenaga kerja atas motivasi. Metode yang digunakan adalah regresi linier berganda dengan menggunakan SPSS 17. Dalam penelitian ini menggunakan deskriptif kuantitatif. Data yang digunakan dalam penelitian ini adalah data primer dan data sekunder. Data primer diperoleh dari hasil pengisian angket yang diisi oleh tenaga kerja wanita bagian pelintingan. Sedangkan data sekunder dipilih sebagai penunjang bagi tercapainya tujuan penulisan ini. Adapun populasi dari penelitian ini adalah seluruh tenaga kerja wanita bagian pelintingan sebanyak 323 orang. Sedangkan sampel yang diambil menggunakan teknik simple random sampling yaitu sebanyak 179 orang. Dalam penelitian ini instrumen yang digunakan adalah angket dan dokumentasi. Dari hasil analisis linier berganda menunjukkan bahwa t hitung pada variabel jumlah tanggungan keluarga sebesar 5,278. Dengan signifikansi 0,000 maka t hitung > t tabel (5,278 > 1,645) dan besarnya probabilitas (sig) 0,000 < 0,05. Sehingga Ho ditolak dan koefisien regresi signifikan. Sedangkan t hitung pada variabel lama bekerja sebesar -4,402 Dengan signifikansi 0,00 maka t hitung < t tabel (-4,402 < 1,645) dan besarnya probabilitas (sig) 0,00 < 0,05. Sehingga Ho diterima dan koefisien regresi signifikan. Sedangkan t hitung pada variabel persepsi tenaga kerja atas motivasi sebesar 8,334. Dengan signifikansi 0,00 maka t hitung > t tabel (8,334 > 1,645) dan besarnya probabilitas (sig) 0,00 < 0,05. Sehingga Ho ditolak dan koefisien regresi signifikan. Dari data ANOVA diketahui bahwa Fhitung yaitu 86,643, sehingga Fhitung>Ftable (86,643 > 2,706) dan probabilitas signifikan adalah 0,000 karena signifikannya jauh lebih kecil dari 0,05 maka Ho ditolak dan Ha diterima dan dapat dikatakan bahwa jumlah tanggungan keluarga, lama bekerja dan persepsi tenaga kerja atas motivasi secara bersama-sama berpengaruh terhadap produktivitas tenaga kerja wanita. Faktor paling dominan mempengaruhi produktivitas tenaga kerja wanita yaitu persepsi tenaga kerja atas motivasi sebesar 45,9%. Selain itu dari uji parameter yang ditemukan bahwa persamaan regresi ini tidak mengalami gejala multikolinearitas, heterokedastisitas dan normalitas maka asumsi regresi linier klasik sudah terpenuhi. Berdasarkan hasil yang diperoleh dalam penelitian ini, maka disarankan agar pimpinan pabrik rokok PT. Cakra Guna Cipta hendaknya memperhatikan peningkatan kesejahteraan tenaga kerja wanita dengan memberikan jaminan sosial, pemberian insentif sesuai dengan kemampuan perusahaan. Selain itu hendaknya perusahaan memperhatikan faktor usia muda dalam menerima tenaga kerja baru dan memberikan penghargaan bagi tenaga kerja yang sudah lama bekerja di perusahaan agar motivasi dan produktivitas diharapkan meningkat. Di samping itu, perusahaan tetap mempertahankan penciptaan suasana kerja yang harmonis dan nyaman dengan cara menjalin komunikasi yang baik di dalam lingkungan kerja maupun di luar lingkungan kerja.

Pengaruh tayangan iklan Aqua di televisi terhadap citra merek (Studi pada mahasiswa kelas penjualan Fakultas Ekonomi Universitas Negeri Malang) / Robbah Fatawi

 

Kata kunci : Iklan, Citra Merek Dalam mengembangkan bisnis, produsen berusaha untuk menguasai pasar dan memenangkan persaingan. Hal ini terjadi pada berbagai sektor bisnis, termasuk bisnis air minum dalam kemasan. Dimana saat ini banyak bermunculan air minum dalam kemasan dengan berbagai merek. Tiap produsen berusaha menonjolkan keunggulan masing-masing dan menciptakan strategi pemasaran yang sesuai. Hal ini bisa dilakukan dengan periklanan. Periklanan adalah merupakan salah satu kegiatan untuk menyampaikan informasi atau pesan tentang Aqua kepada konsumen yang perlu memperhatikan: isi pesan, struktur pesan, format pesan, dan sumber pesan. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh tayangan iklan Aqua terhadap citra merek, baik secara parsial maupun simultan. Penelitian ini bersifat deskriptif korelasional yaitu pengaruh penayangan iklan Aqua terhadap citra merek. Populasi yang diambil adalah mahasiswa kelas penjualan fakultas ekonomi universitas negiri malang yang berjumlah 46 orang. Data diperoleh melalui responden menggunakan kuesioner/angket tertutup dan diukur menggunakan skala Likert 1-5. Sedangkan analisis data menggunakan regresi linier berganda untuk mengetahui pengaruh periklanan yang meliputi isi pesan, struktur pesan, format pesan, dan sumber pesan terhadap citra merek baik secara parsial maupun simultan. Hasil penelitian ini adalah sebagai berikut: (1) Terdapat pengaruh signifikan periklanan yang terdiri dari isi pesan, struktur pesan, format pesan secara parsial terhadap citra merek Aqua. (2) Tidak terdapat pengaruh signifikan variabel sumber pesan secara parsial terhadap terhadap citra merek Aqua. (3) Tidak terdapat pengaruh signifikan periklanan yang terdiri dari isi pesan, struktur pesan, format pesan, sumber pesan secara simultan terhadap terhadap citra merek Aqua Selanjutnya saran-saran yang dapat peneliti berikan adalah: (1) Bagi pt golden missisipi selaku pembuat produk Aqua agar lebih memperhatikan sumber pesan. (2) Bagi peneliti selanjutnya diharapkan untuk menggunakan variabel bebas di luar variabel isi pesan, struktur pesan, format pesan, dan sumber pesan yang berhubungan dengan citra merek.

Manajemen pengembangan kurikulum muatan lokal pada sekolah menengah pertama (Studi multikasus di SMPN 2 Sumberpucung dan SMPN 1 Turen) / Aning Indriasari

 

Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. H. Kusmintardjo, M.Pd., (II) Dr. H. Imron Arifin, M.Pd. Kata kunci: manajemen pengembangan kurikulum, kurikulum muatan lokal, sekolah menengah pertama. Undang-Undang Republik Indonesia Nomor 32 tahun 2004 tentang Pemerintahan Daerah telah memberikan wewenang seluas-luasnya kepada daerah untuk mengatur rumah tangganya, termasuk dalam bidang pendidikan. Hal ini memberikan peluang kepada pihak daerah untuk merumuskan dan menetapkan kurikulum yang sesuai dengan ciri khas daerah yang bersangkutan, baik segi kultural, sosial maupun ekonomi. Dalam upaya mewujudkan dan mengembangkan sumber daya manusia Indonesia yang berkualitas dan relevan dengan lingkungan sosial budaya, sosial ekonomi dan IPTEK, maka sekolah perlu merumuskan kurikulum lokal namun berwawasan global yang diharapkan memiliki modal keterampilan dasar yang relevan dengan potensi daerah dengan teknologi global. Manajemen Pengembangan Kurikulum Muatan Lokal merupakan hal yang berbeda dengan kurikulum nasional, sebab isi dan medianya dirumuskan oleh sekolah yang bersangkutan. Tujuan penelitian ini untuk mendeskripsikan perencanaan, implementasi dan evaluasi kurikulum muatan lokal di SMP Negeri 2 Sumberpucung dan SMP Negeri 1 Turen. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif dan menggunakan rancangan studi multisitus dengan metode induksi analitik yang di modifikasi. Teknik pengumpulan data yang digunakan adalah : (1) wawancara, (2) observasi partisipan, dan (3) studi dokumentasi. Analisis data yang dilakukan didalam penelitian ini, meliputi: (1) analisis data dalam situs, (2) analisis data lintas situs. Keabsahannya diperiksa dengan pengecekan melalui: kredibilitas, dependabilitas, dan konfirmabilitas dengan menggunakan triangulasi dari segi sumber dan metode. Berdasarkan hasil analisis data dapat diperoleh temuan-temuan sebagai berikut. Temuan pertama Perencanaan kurikulum muatan lokal : (a) SMP Negeri 2 Sumberpucung dan SMP Negeri 1 Turen, mempunyai landasan umum perencanaan kurikulum muatan lokal yang sama, (b) Yang membedakan dalam landasan perencanaan kurikulum muatan lokal ke dua sekolah ini terletak pada Visi, Misi dan Tujuan sekolah, (c) Alasan yang mendasari kurikulum muatan lokal kedua SMP ini juga berbeda. (d) Proses perencanaan kurikulum di SMP Negeri 2 Sumberpucung dan SMP Negeri 1 Turen, pengembangan mata pelajaran muatan lokal sepenuhnya ditangani oleh sekolah dan Komite Sekolah, sedangkan Guru mengembangkan kurikulum muatan lokal tersebut dalam MGMPS. Temuan kedua Implementasi kurikulum muatan lokal: (a) SMP Negeri 2 Sumberpucung dan SMP Negeri 1 Turen, dalam mengembangkan silabus dan RPP muatan lokal Bahasa Jawa dilakukan dalam forum Musyawarah Guru Mata Pelajaran (MGMP) Bahasa Jawa Kabupaten Malang. Sedangkan untuk silabus dan RPP muatan lokal lainnya, dikembangkan dalam forum MGMPS, (b) Kegiatan pembelajaran mengikuti langkah-langkah sebagai berikut : 1) Kegiatan awal, 2) Kegiatan inti, dan 3) Penutup. Temuan ketiga Evaluasi kurikulum muatan lokal: (a) SMP Negeri 2 Sumberpucung dan SMP Negeri 1 Turen sudah melakukan ke dua tahap evaluasi, yaitu evaluasi proses dan evaluasi hasil, (b) Silabus dikaji dan dikembangkan secara berkelanjutan dengan memperhatikan masukan hasil evaluasi rencana pembelajaran, evaluasi proses (pelaksanaan pembelajaran), dan evaluasi hasil belajar. Berdasarkan hasil temuan-temuan penelitian, maka disarankan kepada: (1) guru pelaksana muatan lokal SMP, agar senantiasa kreatif dan inovatif dalam mengembangkan kurikulum muatan lokal, sehingga benar-benar dapat memberikan bekal pengetahuan, keterampilan dan perilaku kepada peserta didik agar mereka memiliki wawasan yang mantap tentang keadaan lingkungan dan kebutuhan masyarakat sesuai dengan nilai-nilai/aturan yang berlaku di daerahnya dan mendukung kelangsungan pembangunan daerah serta pembangunan nasional, (2) Kepala Sekolah, diharapkan dapat memberikan kesempatan dan dorongan kepada guru-guru untuk dapat meningkatkan kompetensi dan profesionalisasinya, hal ini akan berimplikasi terhadap tugasnya yang pada gilirannya akan meningkatkan kualitas output dari lembaga pendidikan yang bersangkutan, (3) Pengawas Sekolah, agar hasil evaluasi benar-benar dapat memberikan kontribusi terhadap perbaikan (revisi) dan peningkatan pada program pembelajaran berikutnya, maka diperlukan peningkatan pelaksanaan supervisi sekolah. Selain itu, perlu adanya persamaan persepsi tentang manfaat dari supervisi kolegial dalam rangka meningkatkan kompetensi dan profesionalisasi mengajar, (4) Dinas Pendidikan dan Kebudayaan Kabupaten Malang, dalam rangka otonomi daerah dan persaingan di era globalisasi dewasa ini, maka seyogyanya potensi daerah digali dan dijadikan sebagai modal dasar dalam menghadapi persaingan tersebut dengan mengintensipkan Manajemen Pengembangan Kurikulum yang berorentasi pada potensi daerah, baik potensi alam, sosial budaya maupun sosial ekonomi, (5) Dinas Pendidikan dan Kebudayaan Propinsi Jawa Timur, agar berperan aktif dalam pembinaan terhadap manajemen pengembangan kurikulum muatan lokal pada Sekolah Menengah Pertama (SMP), (6) pihak pengembangan ilmu manajemen pendidikan dapat memanfaatkan hasil penelitian sebagai bahan informasi awal dan referensi terutama bagi yang ingin meneliti kasus-kasus sejenis, (7) peneliti-peneliti selanjutnya agar melakukan penelitian lebih lanjut untuk mengungkapkan lebih dalam lagi mengenai manajemen pengembangan kurikulum muatan lokal dari medan fokus yang berbeda.

Penerapan kolaborasi model pembelajaran Inquiry dan Student Teams Achievement Divisions (STAD) untuk peningkatan hasil belajar siswa pada mata pelajaran bekerja sama dengan kolega dan pelanggan (Studi pada siswa tingkat X Jurusan Administrasi Perkantoran 2 SMK Negeri 1

 

Kata Kunci:Model Pembelajaran Inquiry, Model Pembelajaran Student Teams Achievement Divisions(STAD), Hasil belajar siswa. Salah satu model pembelajarankolaboratif yang dapatmembantumeningkatkankemampuansiswadalam proses belajaradalahkolaborasi model pembelajaran Inquiry danmodel pembelajaranStudent Teams Achievement Divisions (STAD). Pemilihankolaborasi model pembelajaranInquiry dan model pembelajaranStudent Teams Achievement Divisions(STAD) sebagai focus penelitianini, disebabkanmodel pembelajarankolaborasiinidapatmempermudahsiswamemahamimateri yang diajarkanmelaluifaktanyata yang adadalamkehidupansehari-hari, meningkatkanprestasibelajarsiswamelalui system gotong-royong(salingmembantu).Suasanabelajarkontekstualsertasuasanabelajarkooperatifmenghasilkanhasilbelajar yang lebihbaik,pemahamanmaterilebihcepat, mudahmengingat,hubungan yang lebihpositif, danpenyesuaianpsikologis yang lebihbaik. Tujuanpenelitianadalahuntukmengetahuipenerapan, hasilbelajarsiswa, hambatandansolusi, danresponsiswaterhadappenerapankolaborasi model pembelajaranlnquirydan model pembelajaranStudent Teams Achievement Divisions (STAD) padasiswakelas X APk 2 di SMK Negeri 1 Malang. Subyekpenelitianadalahsiswakelas X APk 2 di SMK Negeri 1 Malangdenganjumlah39siswa.Jenispenelitianiniadalahpenelitiankualitatif, yang dirancangdengandesainPenelitianTindakanKelas (PTK).Data penelitiandikumpulkanmelalui; 1) observasi, 2) tes, 3) angket, 4) catatanlapangan, 5) dokumentasi, dan 6) wawancara. Jenis penelitian ini merupakan penelitian tindakan kelas yang dilaksanakan dengan 2 siklus. Setiap siklus mencakup 4 tahap kegiatan yaitu; 1) perencanaan, 2) pelaksanaan tindakan, 3) pengamatan, dan 4) refleksi. Analisis data dalam penelitian ini dilakukan secara deskriptif. Hasil penelitian ini menunjukkan bahwa; 1) Peningkatan aktivitasjumlahsiswabertanyasebesar8,9% darisemula66,7% menjadi75,6%, 2) Setelahadanyapenerapankolaborasi model pembelajaraninihasilbelajarsiswamengalamipeningkatan yangdapatterlihatdarinilai rata-rata kelassebesar77,5menjadi86,5, 3) Hambatan yang dihadapipenelitidalampenelitianpenerapankolaborasi model pembelajaranadalahsiswamengalamikesulitanuntukmenemukanfaktanyata yang terkaitdenganmateri yang dijarkan,kolaborasi model PembelajaranInquirydanStudent Teams Achievement Divisionsbelumpernahadasebelumnya, alokasiwaktu yang digunakankurangefektifterutamapadapelaksanaanpembelajaranSiklus I yaitupadapembentukankelompokdanpelaksanaandiskusikelompok, siswakurangmemahamipelaksanaandiskusi yang baik, Siswakurangberaniuntukmengemukakanpendapatdalamdiskusikelas, dan 4) Responpostifsiswaterhadappenerapankolaborasi model pembelajaranini. Saran bagi peneliti selanjutnya hendaknya menerapkan model pembelajaran kolaboratif yang lebih bervariasi dan dapat lebih mengembangkan dan mengimplementasikan kolaborasi model pembelajaran inquiry dan Student Teams Achievement Divisions pada mata pelajaran lain yang relevan. Bagi sekolah, diharapkan dapat mengimplementasikan model pembelajaran yang tepat, dan sesuai dengan masing-masing karakteristik mata pelajaran.

Studpedia sebagai media alternatif PAIKEM untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran Teknologi Informasi dan Komunikasi (TIK) di SMA Negeri 2 Malang / Dewi Fartimah

 

Kata Kunci: Studpedia, PAIKEM, aktivitas belajar, hasil belajar, TIK. Studpedia merupakan website pembelajaran yang mengintegrasikan PAIKEM (Pembelajaran Aktif, Inovatif, Kreatif, Efektif, dan Menyenangkan). Studpedia dengan konsep yang sedemikian rupa, muncul atas dasar sebuah fakta tentang rendahnya akti-vitas belajar siswa di berbagai sekolah, salah satunya adalah SMA Negeri 2 Malang. Sekolah ini memiliki potensi yang besar untuk dikembangkannya website pembelajaran, karena memiliki infrastruktur berupa wifi/hotspot, komputer di laboratorium dan multi-media yang bisa diakses di luar jam pelajaran, serta komputer di aula dan perpustakaan yang bisa diakses kapan pun selama jam sekolah berlangsung. Selain itu, sebesar 70,3% siswa memiliki laptop. Akan tetapi, hasil observasi awal menunjukkan bahwa sebesar 83,8% siswa menyatakan tidak ada tugas yang mengharuskan mereka untuk akses inter-net. Padahal, 78,4% siswa menyatakan butuh website pembelajaran untuk menunjang pembelajaran mereka. Penelitian dan pengembangan ini dilaksanakan dengan tujuan untuk mengem-bangkan Studpedia sebagai website PAIKEM serta mengetahui kelayakan Studpedia sebagai media pembelajaran TIK. Kelayakan tersebut tidak hanya dilihat dari segi vali-ditas Studpedia sebagai media pembelajaran secara teknis, namun juga dilihat dari ke-layakan implementasinya pada pembelajaran. Kelayakan secara implementasi dilihat dari kemampuan Studpedia meningkatkan aktivitas dan hasil belajar TIK siswa. Penelitian dan pengembangan ini menggunakan rancangan penelitian dan pe-ngembangan Sugiyono (2009) yang dilengkapi dengan metode waterfall. Pengumpulan data dilakukan dengan metode angket, observasi, wawancara, dan dokumentasi. Hasil akhir dari penelitian dan pengembangan ini berupa Studpedia yang memiliki fitur ma-teri, upload file, membuat artikel, dan diskusi. Berdasarkan hasil analisis data tersebut, diperoleh tiga simpulan hasil penelitian. Pertama, Studpedia layak digunakan sebagai media pembelajaran TIK di SMA Negeri 2 Malang, serta tidak perlu adanya revisi. Berdasarkan hasil uji validitas dan uji coba, di-peroleh hasil akhir sebesar 93,33% untuk ahli media, 95,83% untuk ahli materi, 98,21% untuk guru TIK, dan 83,52% untuk uji coba siswa. Dari keempat data tersebut, didapatkan persentase rata-rata validitas Studpedia sebesar 92,72%. Kedua, penggunaan Studpedia pada pembelajaran TIK mampu meningkatkan aktivitas belajar siswa, karena aktivitas belajar yang tidak relevan dapat berkurang dan aktivitas belajar yang relevan dapat meningkat (script video). Selain itu, persentase rata-rata aktivitas belajar siswa meningkat dari 22% menjadi 30%. Ketiga, penggunaan Studpedia pada pembelajaran TIK mampu meningkatkan hasil belajar siswa. Hal ini ditunjukkan pencapaian rata-rata indeks gain sebesar 0,36 atau masuk dalam kategori peningkatan yang sedang. Untuk pengembangan selanjutnya, dibutuhkan web server dengan bandwidth yang lebih luas dan diperlukan peran guru untuk memantau aktivitas belajar siswa pada Studpedia. Selain itu, untuk mendapatkan peningkatan aktivitas dan hasil belajar yang signifikan, perlu dilakukan penerapan Studpedia untuk beberapa kali pertemuan.

Pengaruh penerapan strategi pembelajaran berbasis proyek terhadap kemampuan metakogniotif, penguasaan konsep, dan retensi siswa kelas X di SMAN 7 dan SMAN Gondanglegi Malang / Mawarti Endah Pratiwi

 

Program Studi Pendidikan Biologi. Program Pasca Sarjana. Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. A.D. Corebima, M.Pd; (II) Prof. Dr. Hj. Siti Zubaidah, M.Pd Kata kunci: pembelajaran berbasis proyek, metakognitif, penguasaan konsep, retensi Pembelajaran IPA di Indonesia khususnya mata pelajaran Biologi saat ini diarahkan untuk mencari tahu dan melaksanakan suatu eksperimen sehingga dapat membantu peserta didik memperoleh pemahaman tentang dirinya sendiri dan alam sekitar. Kompetensi yang diharapkan dapat tercapai melalui pembelajaran ini adalah tercapainya kemampuan metakognitif siswa yaitu kesadaran siswa terhadap sesuatu yang dipikirkannya, tercapai peningkatan penguasaan konsep Biologi siswa serta peningkatan retensi siswa. Salah satu strategi pembelajaran yang diharapkan mampu meningkatkan tiga kemampuan tersebut adalah strategi pembelajaran berbasis proyek. Penelitian ini dilakukan untuk mengetahui pengaruh penerapan strategi pembelajaran berbasis proyek terhadap kemampuan metakognitif, penguasaan konsep serta retensi siswa. Penelitian dilakukan di SMA Negeri 7 Malang dan SMAN Gondanglegi Malang pada semester genap 2009/2010 dengan populasi penelitian adalah seluruh siswa kelas X SMA Negeri di Malang tahun ajaran 2009/2010. Sedangkan sampel penelitian ini adalah kelas siswa kelas X SMAN 7 dan SMAN Gondanglegi Malang masing-masing dalam 2 rombongan belajar. Rancangan penelitian ini menggunakan rancangan penelitian eksperimen semu (quasi experiment) dengan desain penelitian menggunakan non equivalent group design. Analisis yang digunakan adalah analisis anakova nonfaktorial. Hasil penelitian menunjukkan bahwa strategi pembelajaran berbasis proyek tidak memberikan pengaruh yang berbeda terhadap kemampuan metakognitif, penguasaan konsep, dan retensi jika dibandingkan dengan pembelajaran multistrategi yang diterapkan pada kelas kontrol. Peningkatan kemampuan metakognitif siswa pada kelas eksperimen adalah sebesar 3,2% sedangkan siswa pada kelas kontrol yang difasilitasi pembelajaran multistrategi mengalami peningkatan kemampuan metakognitif sebesar 5,5%. Penguasaan konsep siswa yang difasilitasi dengan strategi pembelajaran berbasis proyek meningkat sebesar 17,88%. Siswa yang difasilitasi dengan pembelajaran multistrategi peningkatan penguasaan konsepnya dibandingkan hasil pretes adalah 9,37%. Kenaikan retensi hasil belajar dibandingkan hasil postes pada siswa yang difasilitasi pembelajaran berbasis proyek adalah sebesar 10,63%. Pada siswa yang difasilitasi pembelajaran multistrategi pada kelas kontrol kenaikan retensinya dibandingkan hasil postes adalah sebesar 3,78%. Strategi pembelajaran berbasis proyek berdasarkan penelitian ini selain mampu meningkatkan retensi siswa, diduga mampu mengembangkan keterampilan proses sains siswa dan menumbuhkan rasa percaya diri serta sikap siswa terhadap lingkungan. Oleh karena itu perlu dilakukan penelitian lebih lanjut untuk mengetahui pengaruh strategi pembelajaran proyek terhadap kemampuan keterampilan proses dan sikap siswa terhadap lingkungan.

Pengaruh kualitas layanan terhadap kepuasan pelanggan (Studi pada pengunjung Taman Wisata Jawa Timur Park Batu) / Nur Alifatul CH.

 

Kata kunci: Kualitas Layanan, Kepuasan Pelanggan Kualitas Layanan pada suatu bisnis sangat penting untuk diperhatikan karena kualitas layanan yang baik akan mempengaruhi kepuasan pelanggan dan kinerja yang sesuai dengan harapan pelanggan akan mempengaruhi kepuasan pelanggan. Dengan menggunakan kualitas layanan yang baik, maka hal ini menunjukkan bahwa penyedia jasa mengutamakan keunggulan produk jasa yang merupakan ciri khas dari produk tersebut sehingga pada akhirnya bisa mencapai kepuasan pelanggan. Diperlukan adanya profesionalisme dalam mengelola yaitu dengan cara meningkatkan kualitas layanan karena kunci dari keberhasilan perusahaan yang bergerak dibidang jasa. Penelitian ini bertujuan (1) Deskripsi kualitas layanan, (2) Pengaruh kualitas layanan secara parsial dan simultan terhadap kepuasan pelanggan, (3) Variabel yang dominan mempengaruhi kepuasan palanggan. Variabel bebas penelitian ini adalah tangibles (X1), reliability (X2), responsiveness (X3), assurance (X4), emphaty (X5). Penelitian ini dilakukan selama bulan Februari-Maret 2012. Teknik pengambilan sampel dalam penelitian ini menggunakan Accidental sampling. Penyebaran kuesioner dilakukan terhadap 156 responden dari populasi sebanyak 135.611 pengunjung. Hasil tersebut dihitung dengan menggunakan rumus Isaac dan Michael. Teknik analisis data yang digunakan dalam penelitian ini adalah regresi berganda dengan menggunakan program SPSS For Windows seri 17.0. Hasil analisis menunjukkan bahwa: (1) variabel tangibles responden menjawab setuju pada kinerja sebesar 60.9%, (2) variabel reliability pada kinerja diketahui sebanyak 61,5% responden menjawab setuju pada kinerja, (3) variabel responsivenes diketahui sebanyak 61,6 % responden menjawab setuju pada kinerja, (4) Variabel assurance diketahui sebanyak 50% responden menjawab setuju pada kinerja, (5) Variabel emphaty diketahui sebanyak 64,1% responden menjawab setuju pada kinerja. Berdasarkan penelitian ini dapat disimpulkan bahwa: (1) Kualitas layanan yang terdiri dari tangibles, reliability, responsiveness, assurance, emphat, berpengaruh terhadap kepuasan Pelanggan Wisata Jawa Timur Park Batu. Pelanggan mempunyai persepsi yang baik karena sudah sesuai dengan harapan pelanggadari tangibles, reliability, responsiveness, assurance, emphat, terhadap kepuasan pelanggan Taman Wisata Jawa Timur Park Batu, (3) jika dibandingkan dengan variabel tangibles, responsiveness, assurance, emphat variabel reliability memiliki pengaruh dominan terhadap kepuasan pelanggan Taman Wisata Jawa Timur Park Batu. Saran yang dapat diberikan adalah: (1) Taman Wisata Jawa Timur Park Batu terus meningkatkan kualitas layanan dalam pelaksanaannya perlu ditingkatkan lagi, agar dapat beradaptasi dengan kebutuhan pelanggan, dengan begitu pelanggan akan mendapat layanan yang memuaskan sesuai dengan harapan pelanggan, (2) Sebaiknya Karyawan yang cepat dalam melayani pelanggan, serta sikap ramah yang selalu ditunjukkan oleh setiap karyawan menjadi indikator yang terus dilakukan, sehingga pengunjung akan merasa nyaman dalam berkunjung di Taman Wisata Jawa Timur Park Batu, maka disarankan bagi peneliti (3) Bagi peneliti selanjutnya disarankan untuk menambah jumlah variabel kualitas layanan: features, conformance to specification, dan yang lainya, yang dapat mempengaruhi kepuasan pelanggan selain variabel tangibles, reliability, responsiveness, assurance, emphaty yang diteliti pada penelitian ini, sehingga penelitian ini dapat lebih berkembang, (4) Bagi peneliti selanjutnya disarankan untuk mengambil populasi diluar objek wisata karena pengunjung Taman Wisata yang sedang melakukan kunjungan biasanya menginginkan liburan tanpa memikirkan apapun apalagi untuk mengisi kuesioner dari para mahasiswa yang sedang melakukan observasi, sehingga pengunjung biasanya untuk mengisi kuesioner tidak sesuai kebanyakan mengisi seenaknya tanpa memperhatikan isi kuesioner.

Pengaruh tingkat inflasi, tingkat suku bunga SBI, dan kurs rupiah terhadap return saham pada perusahaan yang listing di Jakarta Islamic Index (JII) tahun 2008-2010 / Herlinda Fransisca

 

Kata Kunci: tingkat inflasi, tingkat suku bunga SBI, kurs rupiah, return saham. Dalam mengambil keputusan untuk melakukan suatu investasi perlu diperhatikan dua hal yaitu return dan resiko investasi. Pada sekuritas-sekuritas yang memiliki return yang sama, para investor berusaha untuk mencari resiko terendah. Penelitian ini dilakukan untuk mengetahui pengaruh tingkat inflasi, tingkat suku bunga, dan kurs rupiah terhadap return saham pada perusahaan yang listing di Jakarta Islamic Index (JII) pada tahun 2008-2010. Penelitian ini menggunakan data sekunder yang diperoleh dari web Bank Indonesia, Bursa Efek Indonesia (BEI), dan Indonesia Capital Market Directory (ICMD) dengan periode waktu Januari 2008 sampai Desember 2010. Populasi dalam penelitian ini adalah seluruh perusahaan yang terdaftar di Jakarta Islamic Index pada tahun 2008-2010 yaitu sebanyak 30 perusahaan dan jumlah sampel yaitu sebanyak 10 perusahaan dengan melewati tahap purposive sampling. Teknik analisa yang dipakai dalam penelitian ini adalah regresi linear berganda untuk memperoleh gambaran menyeluruh tentang hubungan antara variabel bebas dengan variabel terikat. Hasil penelitian ini menunjukkan bahwa variabel tingkat inflasi tidak berpengaruh terhadap return saham. Di sisi lain, tingkat suku bunga SBI menunjukkan pengaruh yang negatif dan signifikan terhadap return saham, dan kurs rupiah menunjukkan hasil yang positif dan signifikan terhadap return saham. Untuk para investor hendaknya lebih memperhatikan lagi faktor makro ekonomi seperti tingkat inflasi, tingkat suku bunga, dan kurs rupiah sebelum berinvestasi. Hal ini karena dalam penelitian ini menunjukkan bahwa tingkat suku bunga dan fluktuasi kurs rupiah berpengaruh terhadap return saham yang akan diperoleh di masa mendatang. Untuk para peneliti selanjutnya disarankan agar dapat menambah variabel lain yang mungkin juga berpengaruh terhadap return saham seperti faktor fundamental yang terdiri dari tingkat profitabilitas, kapitalisasi pasar serta tingkat likuiditas perusahaan sebagai variabel bebas untuk mengukur return saham di Jakarta Islamic Index.

Pengaruh budaya organisasi terhadap kinerja karyawan (Studi kasus di PT Telekomunikasi Indonesia Tbk Area Malang) / Deas Muhammad

 

Kata Kunci: Budaya Organisasi, Kinerja, PT Telkom Sumber daya manusia merupakan aset terpenting organisasi karena perannya sebagai pelaksana kebijakan dan kegiatan operasional organisasi. Tanpa sumber daya manusia yang berkinerja optimum, sumber daya organisasi yang ada tidak bisa memberikan hasil yang optimum. Banyak faktor yang mempengaruhi kinerja karyawan, salah satunya adalah budaya organisasi. Penelitian ini bertujuan untuk mengetahui pengaruh budaya organisasi terhadap kinerja pegawai. Budaya organisasi sebagai variabel bebas meliputi inovasi dan keberanian mengambil resiko, perhatian pada detil, berorientasi pada hasil, berorientasi pada manusia, berorientasi pada tim, agresivitas, dan stabilitas. Sedangkan kinerja pegawai sebagai variabel terikat. Penelitian ini menggunakan metode penelitian asosiatif. Data diperoleh dengan menyebarkan kuesioner, wawancara dan dokumentasi. Instrumen penelitian ini menggunakan skala likert. Populasi dalam penelitian ini adalah semua pegawai PT Telkom Indonesia Tbk Area Malang yang berjumlah 125 pegawai. Sedangkan pengambilan sampel berjumlah 95 pegawai. Teknik sampling yang digunakan dalam penelitian ini adalah proportionate random sampling. Analisis data dilakukan dengan menggunakan analisis regresi linier berganda dengan bantuan SPSS 17.0 for windows. Setelah melalui proses pengolahan data analisis linier berganda, hasil penelitian menunjukkan: (1) inovasi dan toleransi menunjukkan tingkat signifikansi 0,758 yang berarti tidak signifikan mempengaruhi kinerja, (2) perhatian pada detil menunjukkan tingkat signifikansi 0,024 yang berarti signifikan mempengaruhi kinerja, (3) orientasi hasil menunjukkan signifikansi 0,876 yang berarti tidak signifikan mempengaruhi kinerja, (4) orientasi pada manusia menunjukkan signifikansi 0,016 yang berarti signifikan mempengaruhi kinerja, (5) orientasi pada tim menunjukkan signifikansi 0,018 yang berarti signifikan mempengaruhi kinerja, (6) agresivitas menunjukkan signifikansi 0,038 yang berarti signifikan mempengaruhi kinerja, (7) Stabilitas menunjukkan signifikansi 0,000 yang berarti signifikan mempengaruhi kinerja. Untuk uji F didapatkan nilai Fhitung sebesar 30,537 dengan signifikansi 0,000. Hasil penelitian ini menyimpulkan bahwa: (1) Terdapat pengaruh yang positif dan tidak signifikan antara inovasi dan keberanian mengambil resiko terhadap kinerja pegawai PT Telkom Indonesia Area Malang. (2) Terdapat pengaruh yang positif dan signifikan antara perhatian pada detil terhadap kinerja pegawai PT Telkom Indonesia Area Malang. (3) Terdapat pengaruh yang negatif dan tidak signifikan antara berorientasi pada hasil terhadap kinerja pegawai PT Telkom Indonesia Area Malang.(4) Terdapat pengaruh yang positif dan signifikan antara berorientasi pada manusia terhadap kinerja pegawai PT Telkom Indonesia Area Malang. (5) Terdapat pengaruh yang positif dan signifikan antara berorientasi pada tim terhadap kinerja pegawai PT Telkom Indonesia Area Malang. (6) Terdapat pengaruh yang positif dan signifikan antara agresifitas terhadap kinerja pegawai PT Telkom Indonesia Area Malang. (7) Terdapat pengaruh yang positif dan signifikan antara stabilitas terhadap kinerja pegawai PT Telkom Indonesia Area Malang. (8) Terdapat pengaruh yang positif dan signifikan antara budaya organisasi terhadap kinerja pegawai PT Telkom Indonesia Area Malang. Saran yang dapat peneliti berikan bagi PT Telkom Indonesia Tbk Area Malang adalah: (1) Hendaknya PT Telkom Indonesia Tbk area Malang memberikan pelatihan pada pegawai yang sudah lama bekerja untuk meningkatkan kompetensinya. (2) PT Telkom Indonesia Tbk Area Malang hendaknya merekrut pegawai yang berpendidikan lebih tinggi agar bisa berkinerja lebih baik. Sedangkan bagi peneliti selanjutnya agar meneliti tentang variabel inovasi dan keberanian mengambil resiko, serta meneliti variabel berorientasi pada hasil agar menemukan jawaban yang lebih jelas mengenai kedua variabel tersebut.

Potensi getah jarak pagar (Jatropha curcas) terhadap proses penyembuhan luka pada mencit (Mus musculus) galur Balb C sebagai sumber belajar mata kuliah fisiologi hewan di perguruan tinggi / Bevo Wahono

 

Program Studi Pendidikan Biologi, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Umie Lestari, M.Si dan (II) Dr. H. Abdul Gofur, M.Si. Kata Kunci: jarak pagar, proses penyembuhan luka Masyarakat menggunakan obat herbal sebagai salah satu pilihan dalam pengobatan. Salah satu tanaman yang sering digunakan masyarakat untuk pengobatan adalah jarak pagar. Jarak pagar mengandung tannin, flavonoid, saponin, curcacyline, cyclic octapeptide dan curcain. Zat-zat ini secara sinergis dapat mempengaruhi proses penyembuhan luka pada kulit. Penelitian ini bertujuan untuk: 1) menguji potensi getah jarak pagar terhadap proses penyembuhan luka pada mencit (Mus musculus), 2) memanfaatkan hasil penelitian potensi getah jarak pagar terhadap proses penyembuhan luka pada mencit (Mus musculus) sebagai sumber belajar berkarakter pada mata kuliah fisiologi hewan. Penelitian ini menggunakan pendekatan kuantitatif eksperimental, rancangannya mengikuti rancangan acak kelompok. Variabel bebasnya adalah konsentrasi getah jarak pagar 0%, 50%, 75% ,100% dan lama hari pengamatan hari ke-4 dan hari ke-7. Variabel terikatnya adalah jumlah sel fibroblast, neokapilerisasi, dan re-epitelisasi. Data jumlah sel fibroblas, neokapilerisasi dan re-epitelisasi yang didapat, dianalisis menggunakan Analisis Varians Dua Jalur (Two Way ANOVA) dengan tingkat signifikan 5%. Apabila terdapat perbedaan, dilakukan uji lanjut dengan uji Least Significant Difference (LSD) dengan taraf signifikan 5%. Hasil penelitian menunjukan bahwa ada potensi getah jarak pagar terhadap proses penyembuhan luka pada mencit. Getah jarak pagar dengan konsentrasi 50%, 75% dan 100% berpengaruh signifikan terhadap jumlah sel fibroblas pada pengamatan hari ke-4 dan hari ke-7, re-epitelisasi terhadap waktu pengamatan hari ke-4 dan ke-7, namun tidak berpengaruh signifikan terhadap re-epiteliasi pada masing-masing kelompok perlakuan dan neokapilerisasi pada pengamatan hari ke-4 dan ke-7 pada masing-masing kelompok perlakuan. Berdasarkan hasil penelitian ini dan kajian pustaka yang relevan, disusun sebuah bahan ajar yang berupa modul berkarakter bagi mahasiswa pada mata kuliah Fisiologi Hewan pokok bahasan sistem integumen.

Manajemen kelas inklusi: Studi multikasus pada TK Roudhotul Hikmah dan SD Islam Sabilillah di Kabupaten Jombang / Nawaafila

 

Kata kunci: manajemen kelas, sekolah inklusi. Manajemen kelas inklusi merupakan suatu proses kegiatan perencanaan, pelaksanaan, dan evaluasi yang dilakukan oleh guru agar dapat menjaga suasana kelas agar kondusif sehingga tujuan pembelajaran di kelas inklusi tercapai. Di kabupaten Jombang, jumlah sekolah inklusi masih terbatas. Namun, Lembaga Pendidikan Roudhotul Hikmah merupakan satu-satunya lembaga pendidikan yang membuka kelas inklusi mulai dari TK hingga SD. Berdasarkan hal tersebut, maka dilakukan suatu penelitian untuk mempelajarai manajemen kelas inklusi di TK Roudhotul Hikmah dan SDI Sabilillah, dengan fokus serta tujuan penelitian diantaranya tentang (1) perencanaan; (2) pelaksanaan; (3) evaluasi/penilaian; (4) faktor pendukung dan penghambat dalam pelaksanaan kelas inklusi. Penelitian ini dilakukan dengan pendekatan kualitatif eksplanatoris, yaitu suatu metode penelitian yang tidak menguji hipotesis melainkan memaparkan dan mengelola data. Jenis penelitian ini adalah multikasus karena terdapat dua kasus pada dua objek penelitian, yaitu TK Roudhotul Hikmah dan SDI Sabilillah di Kabupaten Jombang. Dalam penelitian ini, peneliti sendiri yang berperan sebagai instrumen kunci, dengan subjek penelitian adalah kepala sekolah, guru/terapis, dan prompter di TK Roudhotul Hikmah dan SDI Sabilillah. Sumber data yang digunakan dalam penelitian ini adalah informasi yang disampaikan oleh subjek penelitian, dan dokumen yang berkaitan dengan manajemen kelas inklusi. Data yang diperoleh dianalisis selama pengumpulan data dan setelah pengumpulan data. Untuk mengumpulkan data yang relevan guna menjawab fokus penelitian, skripsi ini menggunakan beberapa teknik pengumpulan data, seperti wawancara, observasi, dan studi dokumentasi. Tahap analisis data dengan cara memilah-milah data, pada setiap data yang didapat langsung diolah. Penggunaan triangulasi data dengan menggunakan tahapan: (1) mengajukan berbagai macam variasi pertanyaan, (2) mengeceknya dengan berbagai sumber data, (3) memanfaatkan berbagai metode agar pengecekan kepercayaan data dapat dilakukan. Hasil penelitian menunjukkan bahwa manajemen kelas inklusi di TK Roudhotul Hikmah dan SDI Sabilillah, meliputi tahapan-tahapan yaitu perencanaan, pelaksanaan, dan penilaian, serta faktor pendukung dan penghambat dalam manajemen kelas inklusi. Perencanaan kelas inklusi dilakukan oleh guru kelas. Perencanaan yang dilakukan di TK Roudhotul Hikmah sebelum mengelola kelas yakni menyiapkan LKH, menyiapkan media pembelajaran, dan mengkondisikan peserta didik. Sedangkan perencanaan kelas inklusi di SDI Sabilillah meliputi persiapan media dan mengkondisikan peserta didik. Di TK Roudhotul Hikmah, pelaksanaan kelas meliputi, (1) menerapkan model kelas inklusi berupa kelas khusus penuh, (2) kelas inklusi memiliki dua ruangan kelas, yakni kelas besar (gazebo) dan kelas kecil ( 2 x 2 m) untuk satu peserta didik dan satu terapis, (3) menggunakan metode pengajaran ABA (Applied Behavior Analysis) secara one on one (individual), (4) setiap peserta didik memiliki kepribadian unik sehingga guru harus memahami karakteristik masing-masing peserta didik, (5) bertujuan untuk memanamkan kemandirian, konsentrasi, dan kepatuhan peserta didik, (6) sosialisasi di kelas regular setiap satu minggu sekali untuk melatih peserta didik memahami lingkungannya, (7) kegiatan pembelajaran setiap hari senin s.d. jumat, kegiatan pembelajaran di kelas meliputi kegiatan awal, inti, dan penutup. Sedangkan pelaksanaan kelas inklusi di SD Sabilillah meliputi, (1) menerapkan model kelas inklusi penuh, di mana peserta didik berkebutuhan khusus melaksanakan kegiatan pembelajaran bersama denga peserta didik lainnya (normal) sepanjang hari di kelas reguler dengan menggunakan kurikulum yang sama, (2) kelas inklusi hanya memiliki satu ruangan saja, di kelas 1 dan 4, (3) menggunakan metode pengajaran secara klasikal, kelompok, dan individual sesuai dengan materi yang diajarkan, (4) setiap peserta didik memiliki kepribadian unik, (5) bertujuan mengajarkan peserta didik dalam memahami materi yang disampaikan secara lisan, tulis, dan praktik, (6) sosialisasi dilakukan setiap hari, (7) Kegiatan pembelajaran setiap hari senin s.d. sabtu, kegiatan pembelajari diawali dengan salam dan doa bersama, begitu juga pada kegiatan penutup. Penelitian tentang manajemen kelas inklusi yang dilakukan oleh pengelola TK Roudhotul Hikmah dan SDI Sabilillah menghasilkan temuan-temuan penelitian yang dibahas dengan cara membandingkan informasi yang diperoleh dari kedua objek penelitian tersebut, sehingga dapat disimpulan bahwa terdapat persamaan yaitu dalam: (1) berada pada satu naungan yayasan yang sama; (2) penyiapan media dan materi; (3) menggunakan metode penyampaian materi disesuaikan dengan kondisi peserta didik; (4) faktor penghambat dan kesulitan dalam mengkondisikan kelas; (5) penilaian pada proses dan hasil akhir. Sedangkan perbedaannya meliputi beberapa aspek, yaitu (1) model kelas; (2) model pembelajaran; (3) fokus materi; (4) karakteristik peserta didik; (5) model penilaian. Berdasarkan hasil penelitian ini, dapat disarankan bagi (1) pengelola TK dan SDI Roudhotul Hikmah Roudhotul hikmah agar terus melakukan perbaikan dan penyempurnaan dalam menyelenggarakan pendidikan inklusi; (2) Ketua Jurusan Administrasi Pendidikan agar turut serta mengkaji segala permasalahan pendidikan inklusi untuk memperkaya khasanah ilmu dan sebagai wujud pendalaman ilmu Manajemen Pendidikan; (3) Kepala Dinas Pendidikan Kabupaten Jombang agar melaksanakan pelatihan-pelatihan yang diberikan kepada kepala sekolah dan guru sekolah inklusi untuk meningkatkan kemapuan dan keterampilan secara administrasi dan kemampuan dalam mengelola kelas inklusi; (4) peneliti lain agar melakukan penelitian lanjutan misalnya Kepemimpinan Kepala Sekolah Inklusi atau Manajemen Kurikulum Inklusi.

Keefektifan model pembelajaran Learning Cycle 5-E dibandingkan model pembelajaran Ekspositori pada materi pokok asam, basa, dan garam untuk meningkatkan hasil belajar dan minat belajar siswa kelas VII SMP Negeri 20 Malang / Wiwik Widiawati

 

Kata Kunci: Keefektifan, Learning Cycle 5-E, Ekspositori, Materi pokok: asam, basa, dan garam, Hasil belajar dan minat belajar Sejak diberlakukannya kurikulum KBK hingga kurikulum KTSP, dalam pembelajaran IPA SMP dimasukkan beberapa pokok bahasan yang berkaitan dengan kimia sebagai bahan ajar. Untuk itu perlu diterapkan model pembelajaran yang bersifat konstruktivistik yang sesuai dengan landasan utama kurikulum KTSP, salah satunya adalah model Learning Cycle 5-E. Berdasarkan hasil wawancara dengan salah satu guru IPA kelas VII SMP Negeri 20 Malang mengemukakan bahwa guru yang mengajar mata pelajaran IPA-Kimia kelas VII adalah guru IPA-Fisika, sehingga guru belum maksimal dalam memberikan materi. Kriteria ketuntasan minimal mata pelajaran IPA di SMP Negeri 20 Malang adalah 72. Berdasarkan hasil observasi, diperoleh data ulangan harian materi asam, basa, dan garam pada tahun pelajaran 2010/2011 dengan nilai < 72 mencapai 39,7% siswa belum tuntas belajar. Sebagai upaya meningkatkan hasil belajar, model Learning Cycle 5-E perlu digunakan sebagai alternatif dalam proses pembelajaran karena kegiatan pembelajarannya dapat membuat siswa aktif belajar sesuai dengan prinsip teori belajar konstruktivistik. Tujuan penelitian ini adalah untuk mengetahui keterlaksanaan model pembelajaran Learning Cycle 5-E serta untuk mengetahui keefektifan penerapan model Learning Cycle 5-E dibandingkan dengan model Ekspositori pada hasil belajar dan minat belajar siswa pada materi pokok asam, basa, dan garam di SMP Negeri 20 Malang. Rancangan yang digunakan dalam penelitian ini adalah rancangan penelitian eksperimental semu dan rancangan deskriptif kuantitatif. Populasi dalam penelitian ini adalah seluruh siswa kelas VII SMP Negeri 20 Malang. Sampel adalah kelas VII-D sebagai kelas kontrol dan VII-E sebagai kelas eksperimen yang diambil secara acak kelompok melalui undian kelas. Instrumen penelitian terdiri dari instrumen perlakuan yang berupa silabus, RPP, handout, dan LKS, sedangkan instrumen pengukuran terdiri dari soal tes, lembar pengamatan, dan angket. Analisis data hasil penelitian adalah analisis deskriptif kuantitatif untuk data hasil belajar kognitif, afektif, psikomotor, dan minat belajar siswa. Sedangkan analisis statistik terdiri dari uji normalitas, uji homogenitas, dan uji t dua pihak untuk menguji perbedaan nilai ulangan harian materi asam, basa, dan garam. Berdasarkan analisis data tersebut, diperoleh hasil penelitian sebagai berikut. Pertama, keterlaksanaan model pembelajaran Learning Cycle 5-E pada materi pokok asam, basa, dan garam di SMP Negeri 20 Malang telah berlangsung dengan baik sesuai RPP. Hal ini dibuktikan dari persentase keterlaksanaan are taught by Learning Cycle 5-E with student that are taught by Expository model at acid, base, and salt materials at Junior High School of State 20 Malang. The student cognitive results that are taught by Learning Cycle 5-E have mark average of 62,8 higher than by expository model that have mark average of 54,1. The cognitive learning results of student process that are taught by Learning Cycle 5-E have mark average of 78,6 higher than Expository that have mark average of 72,6. The affective learning results of students that are taught by Learning Cycle 5-E have mark average of 92,8 higher than by Expository of 85,5. The psychomotor learning results of student that are taught by Learning Cycle 5-E have mark average of 84,9 higher than Expository of 81,0. Third, the student interest that are taught by Learning Cycle 5-E better than by Expository. It can be seen from the learning interest average with Learning Cycle 5-E of 51,5 that is higher than by Expository of 46,3. Based on the results, the conclusion is the implementation of Learning Cycle 5-E has higher effectiveness than Expository. It is proven by the learning results average of cognitive, affective, psychomotor, and learning interest of student that are taught by Learning Cycle 5-E than by Expository model. The suggestion is, the Learning Cycle 5-E should be used for learning of chemistry at Junior High School that has similar characteristic with acid, base, and salt materials and implementing the model should regulate the learning time proportionally suitable with the learning materials.

Pengaruh model pembelajaran kooperatif Numbered Heads Together terhadap keterampilan metakognitif dan hasil belajar kognitif biologi siswa kelas XI SMA Negeri 1 Ngoro Mojokerto / Bea Hana Siswati

 

Kata Kunci: Numbered Heads Together, metakognitif, hasil belajar. Kegiatan pembelajaran di sekolah merupakan kegiatan utama dalam proses pendidikan yang pada umumnya bertujuan membawa anak didik menuju pada keadaan yang lebih baik. Keaktifan siswa dalam belajar merupakan salah satu faktor yang mempengaruhi keberhasilan dalam belajar, oleh karena itu dalam mengembangkan keaktifan siswa diperlukan model pembelajaran yang dapat mendorong siswa untuk aktif selama proses pembelajaran. Permasalahan tersebut dapat diatasi dengan menerapkan model pembelajaran numbered heads together (NHT). Model NHT berpotensi untuk mengembangkan keterampilan metakognitif dan hasil belajar kognitif siswa karena dengan menggunakan model pembelajaran NHT siswa menjadi siap dalam pembelajaran dan dapat melakukan diskusi dengan sungguh-sungguh. Tujuan penelitian ini ialah: 1) mengetahui pengaruh penerapan model pembelajaran NHT terhadap ketrampilan metakognitif siswa kelas XI SMAN 1 Ngoro Mojokerto, 2) mengetahui pengaruh penerapan model pembelajaran NHT terhadap hasil belajar kognitif siswa kelas XI SMAN 1 Ngoro Mojokerto. Rancangan penelitian yang digunakan ialah quasi eksperimen dengan Pretest-Postest Nonequivalent Control Group Design. Variabel bebas adalah model pembelajaran (numbered heads together) dan model pembelajaran multistrategi. Variabel terikat adalah keterampilan metakognitif dan hasil belajar kognitif. Populasi penelitian ialah seluruh siswa kelas XI SMAN 1 Ngoro Mojokerto. Sampel penelitian adalah siswa kelas XI-IA1 sebagai kelas kontrol dan XI-IA2 sebagai kelas perlakuan. Keterampilan metakognitif diukur menggunakan rubrik metakognitif. Hasil belajar diukur dengan menggunakan tes essay. Instrumen tes terlebih dahulu diuji validitas dan reliabilitas. Data diambil pada saat pretes dan postes. Uji hipotesis menggunakan anakova dengan taraf signifikansi 0,05 (P < 0,05). Sebelum uji anakova, dilakukan uji normalitas data dengan uji kormogolov-smirnov dan uji homogenitas data dengan levene tes. Hasil penelitian menunjukkan: 1) Model pembelajaran berpengaruh terhadap keterampilan metakognitif, 2) Model pembelajaran berpengaruh terhadap hasil belajar kognitif. Model pembelajaran NHT terbukti dapat meningkatkan proses dan hasil belajar, dan disarankan bagi guru untuk mencoba mengimplementasikan model pembelajaran NHT dalam pembelajaran Biologi.

Pengaruh model pembelajaran Think Pair Share dipadu dengan Talking Stick terhadap keterampilan metakognitif dan hasil belajar kognitif biologi siswa kelas VIII SMP Negeri 2 Pakis / Nur Alfi Laili

 

Kata Kunci: think pair share, talking stick, keterampilan metakognitif, dan hasil belajar kognitif. Sistem pembelajaran yang masih didominasi penyampaian materi oleh guru menyebabkan siswa tidak mampu membangun dan menemukan sendiri pengetahuannya sehingga mengakibatkan siswa hanya menghafal konsep-konsep yang diberikan oleh guru. Pengetahuan yang bersifat hafalan akan berdampak buruk terhadap keterampilan metakognitif siswa. Rendahnya keterampilan metakognisi siswa berkorelasi dengan rendahnya hasil belajar kognitif. Permasalahan tersebut dapat diatasi dengan menerapkan model pembelajaran think pair share (TPS) dipadu dengan talking stick (TS). Model TPS menekankan pada tanggung jawab kelompok sedangkan model TS menekankan pada tanggung jawab individu. Dengan demikian kombinasi TPS-TS dapat menjadi model pembelajaran yang berpotensi untuk meningkatkan keberhasilan belajar siswa, termasuk dalam aspek keterampilan metakognitif dan hasil belajar kognitif siswa. Tujuan penelitian ini ialah: 1) Mengetahui perbedaan keterampilan metakognitif siswa kelas VIII SMP yang dibelajarkan dengan model gabungan TPS-TS dan yang dibelajarkan dengan model konvensional dan 2) Mengetahui perbedaan hasil belajar kognitif siswa kelas VIII SMP yang dibelajarkan dengan model gabungan TPS-TS dan yang dibelajarkan dengan model konvensional. Rancangan penelitian yang digunakan ialah quasi eksperiment dengan Pretest-Postest Nonequivalent Control Group Design. Variabel bebas adalah model pembelajaran (TPS-TS dan pembelajaran konvensional). Variabel terikat adalah keterampilan metakognitif dan hasil belajar kognitif. Populasi penelitian ialah seluruh siswa kelas VIII SMPN 2 Pakis. Sampel penelitian adalah siswa kelas VIII-B sebagai kelas perlakuan dan VIII-C sebagai kelas kontrol. Keterampilan metakognitif diukur dengan menggunakan panduan rubrik keterampilan metakognitif yang terintegrasi dengan tes essay. Hasil belajar kognitif diukur dengan menggunakan tes essay. Instrumen tes terlebih dahulu diuji validitas dan reliabilitas. Data diambil pada saat pretes dan postes. Uji hipotesis menggunakan anakova dengan taraf signifikansi 0,05 (P < 0,05). Sebelum uji anakova, dilakukan uji prasyarat, yaitu normalitas data dengan uji kormogolov-smirnov dan uji homogenitas data dengan levene tes. Hasil penelitian menunjukkan: 1) Model pembelajaran berpengaruh terhadap keterampilan metakognitif dan 2) Model pembelajaran berpengaruh terhadap hasil belajar kognitif. Model gabungan think pair share-talking stick terbukti dapat meningkatkan keterampilan metakognitif dan hasil belajar kognitif siswa, dan disarankan bagi guru untuk mencoba mengimplementasikan model gabungan think pair share-talking stick dalam pembelajaran Biologi.

Hubungan antara etos kerja dalam PPL, prestasi PPL dan pola asuh orang ntua terhadap pemilihan karir bidang keguruan bagi mahasiswa PTI angkatan 2008 Jurusan Teknik Elektro Universitas Negeri Malang / Davin Setiya Budi

 

Kata Kunci: etos kerja dalam PPL, prestasi PPL, pola asuh orang tua, pemilihan karir bidang keguruan, mahasiswa PTI TE UM Salah satu kompetensi lulusan yang dihasilkan oleh program studi PTI TE UM adalah kompetensi keguruan yang memprioritaskan untuk mencetak tenaga pendidik. Perlu adanya kepastian apakah mahasiswa lulusan PTI akan memilih karir menjadi seorang guru atau memilih karir non keguruan sehingga dapat diketahui bagaimana kualitas alumni yang dihasilkan oleh prodi PTI. Berkaitan dengan itu maka dilakukan penelitian dengan tujuan untuk mendeskripsikan tentang tingkat etos kerja dalam PPL, tingkat prestasi PPL, jenis pola asuh orang tua, tingkat keberminatan pemilihan karir bidang keguruan, dan hubungan antara etos kerja dalam PPL dengan pemilihan karir bidang keguruan, hubungan antara prestasi PPL dengan pemilihan karir bidang keguruan, hubungan antara pola asuh orang tua dengan pemilihan karir bidang keguruan, serta hubungan secara simultan antara etos kerja dalam PPL, prestasi PPL, pola asuh orang tua, terhadap pemilihan karir bidang keguruan mahasiswa PTI 2008 TE UM. Metode yang dipilih pada penelitian ini adalah metode kuantitatif dengan rancangan penelitian deskriptif korelasional yang terdiri dari variabel etos kerja dalam PPL, prestasi PPL, pola asuh orang tua, dan pemilihan karir bidang keguruan. Pengumpulan data dilakukan dengan menggunakan angket dan dokumentasi. Kegiatan analisis data dimulai dari tahap penelaahan data, tahap klasifikasi data, dan tahap pengujian data. Berdasarkan hasil analisis data tersebut, diperoleh lima simpulan hasil penelitian sebagai berikut. Pertama, etos kerja dalam PPL yang dilakukan mahasiswa dalam kategori tinggi (40,24%). Prestasi PPL mahasiswa dalam kategori sangat tinggi (89,02%). Pola asuh orang tua mahasiswa menerapkan pola asuh tipe demokratis (41%). Pemilihan karir bidang keguruan mahasiswa cenderung dalam kategori berminat untuk menjadi guru (50%). Kedua, terdapat hubungan yang signifikan antara etos kerja dalam PPL terhadap pemilihan karir bidang keguruan dengan besar korelasi parsial 0,562. Ketiga, tidak terdapat hubungan yang signifikan antara prestasi PPL terhadap pemilihan karir bidang keguruan dengan besar korelasi parsial -0,105. Hal ini dapat disebabkan nilai PPL mahasiswa yang cenderung baik karena kurang obyektifitasnya guru pamong dalam memberikan nilai PPL, sehingga varian nilainya rendah. Keempat, terdapat hubungan yang signifikan antara pola asuh orang tua terhadap pemilihan karir bidang keguruan dengan besar korelasi parsial 0,517. Kelima, terdapat hubungan secara simultan antara etos kerja dalam PPL, prestasi PPL, dan pola asuh orang tua terhadap pemilihan karir bidang keguruan dengan besar korelasi ganda 3 prediktor (R) yaitu 0,705.

Pengaruh Kualitas Aktiva Produktif (KAP), Return on Asset (ROA), dan Financing to Debt Ratio (FRD) terhadap tingkat bagi hasil pihak ketiga pada perbankan Syariah di Indonesia periode 2008-2010 / Aditya Rachman Dwiatmaja

 

Kata kunci: Kualitas Aktiva Produktif (KAP), Return On Assets (ROA), Financing to Deposit Ratio (FDR), Bagi Hasil Pihak Ketiga Semakin banyaknya bank umum yang membuka unit syariah untuk melayani kebutuhan masyarakat Indonesia yang beragama Islam berdampak pada perkembangan perbankan syariah. Prinsip syariah mengharamkan sistem bunga dan digantikan dengan bagi hasil. Sistem bagi hasil merupakan sistem di mana dilakukan perjanjian dalam melakukan kegiatan usaha. Di dalam usaha tersebut diperjanjikan adanya pembagian hasil atas keuntungan yang akan didapat. Penelitian ini bertujuan untuk mengetahui pengaruh kualitas aktiva produktif, return on asset dan financing to deposit ratio terhadap bagi hasil pihak ketiga perbankan syariah di Indonesia, baik secara parsial maupun secara simultan. Penelitian ini menggunakan teknik purposive sampling dan diperoleh 3 sampel. Sampel yang digunakan dalam penelitian ini adalah laporan keuangan triwulanan PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mega Indonesia dan PT Bank Syariah Mandiri tahun 2008-2010. Jenis data yang digunakan adalah kuantitatif dan merupakan data sekunder yang diperoleh dari PT Bank Muamalat Indonesia Tbk, PT Bank Syariah Mega Indonesia dan PT Bank Syariah Mandiri tahun 2008-2010. Metode analisis yang digunakan dalam penelitian ini yaitu menggunakan analisis regresi berganda melalui pengujian SPSS dengan mempertimbangkan uji asumsi klasik. Hasil penelitian menunjukkan secara parsial KAP dan ROA berpengaruh signifikan terhadap bagi hasil pihak ketiga dengan tingkat signifikansi sebesar 0,000. FDR tidak berpengaruh terhadap bagi hasil pihak ketiga dengan tingkat signifikansi 0,076. Secara simultan terdapat pengaruh signifikan variabel KAP, ROA dan FDR terhadap bagi hasil pihak ketiga dengan tingkat signifikansi 0,000. Saran yang diberikan adalah : (1) untuk penelitian selanjutnya diharapkan untuk menambah sampel, atau memperluas sampel penelitian dengan meneliti Unit Usaha Syariah atau Bank Pembiayaan Rakyat Syariah, (2) melakukan penelitian kembali dengan melakukan penelitian menggunakan data rasio keuangan tahunan supaya hasilnya lebih akurat, (3) menambah variabel penelitian seperti GWM, BOPO, CAR, ROE, dan variabel lain yang mempengaruhi bagi hasil pihak ketiga.

Penerapan pendekatan kontekstual dengan bantuan bahan manipulasi untuk memahamkan siswa kelas VII-A pada materi perbandingan di SMP Negeri 1 Ploso Jombang / Titin Agistina

 

Kata Kunci: bahan manipulasi, pemahaman, pendekatan kontekstual Berdasarkan observasi awal dan dialog yang dilakukan peneliti di kelas VII-A SMP Negeri 1 Ploso Jombang diketahui bahwa kebanyakan siswa belum mampu menerapkan rumus dalam soal, 6 siswa belum bisa mengubah pecahan ke bentuk desimal, 25% siswa memberikan langkah yang tidak logis pada jawaban mereka, dan beberapa siswa masih salah dalam mengerjakan perhitungan aljabar. Penelitian ini bertujuan untuk mendeskripsikan langkah-langkah penerapan pendekatan kontekstual berbantuan bahan manipulasi pada materi perbandingan dan untuk mengetahui apakah penerapan pendekatan kontekstual berbantuan bahan manipulasi dapat memahamkan siswa kelas VII-A pada materi perbandingan di SMP Negeri 1 Ploso. Penelitian ini merupakan penelitian tindakan kelas yang dilaksanakan di SMP Negeri 1 Ploso dengan subyek siswa kelas VII-A yang terdiri dari 36 siswa. Data diperoleh dari nilai hasil tes pada akhir siklus, pengkajian hasil tes, hasil observasi aktivitas guru dan siswa, hasil wawancara dan catatan lapangan. Kriteria keberhasilan penelitian ini adalah jika 80 % siswa tidak melakukan kesalahan konsep sejak awal penyelesaian, presentase banyaknya siswa berkategori tuntas belajar minimal 85% dari banyaknya siswa satu kelas dengan kriteria tuntas belajar apabila nilai tes 70 dan hasil observasi aktivasi guru dan siswa minimal 75%. Hasil penelitian pada siklus I menunjukkan bahwa ketuntasan belajar sebesar 75% dan terdapat 20 siswa yang melakukan kesalahan konsep pada materi skala serta presentase rata-rata aktivitas siswa siklus I adalah 81,2%. Pada siklus II persentase ketuntasan belajar siswa mencapai 86,1% dari banyaknya siswa dalam kelas dan terdapat 13,88% siswa masih belum memahami materi proporsi. Hasil observasi aktivitas guru dan siswa selama pembelajaran siklus II termasuk dalam kategori “Sangat Baik” Berdasarkan hasil penelitian tersebut maka dapat disimpulkan bahwa penerapan pendekatan kontekstual berbantuan bahan manipulasi pada materi perbandingan dapat memahamkan siswa kelas VII-A di SMP Negeri 1 Ploso Jombang. i

Pengembangan perangkat kurikulum terpadu mata pelajaran IPA kelas VIII di MTs Negeri Batu / Khoridah Sativa

 

Kata Kunci : perangkat kurikulum terpadu, IPA SMP, bahan kajian IPA IPA berkaitan dengan cara mencari tahu tentang alam secara sistematis se-hingga IPA bukan hanya penguasaan konsep-konsep atau prinsip-prinsip saja. Struktur IPA SMP/MTs berdasarkan Permendiknas nomor 22 tahun 2005 substan-sinya adalah materi IPA terpadu, sehingga kurikulum IPA di jenjang ini merupa-kan kurikulum terpadu yang tidak ada pemisahan anatara pembelajaran biologi, fi-sika, dan kimia. Pendekatan yang digunakan juga diusahakan bersifat integral. MTs Negeri Batu menjalankan KTSP sebagai kurikulum untuk mewujudkan visi dan misi MTs Negeri Batu. Khusus pada mata pelajaran IPA, MTs Negeri Batu belum menerapkan IPA terpadu. Pembelajaran IPA yang pernah diterapkan dinilai kurang efektif dan menurunnya hasil UAN. Hal ini disebabkan guru harus me-ngajar dua bidang sekaligus dimana guru hanya berlatar belakang disiplin ilmu tertentu, tidak adanya contoh silabus dan RPP terpadu yang representatif dan ku-rangnya pengetahuan guru mengenai model-model keterpaduan kurikulum. Pe-rangkat kurikulum terpadu yang dikembangkan terbatas pada silabus dan RPP ter-padu, untuk kelas VIII semester ganjil, untuk bahan kajian tertentu. Model-model kurikulum terpadu yang digunakan adalah model kurikulum terpadu miliki Robin Fogarty. Model keterpaduan ini berjumlah 10 namun hanya 3 model saja yang digunakan untuk mengembangkan silabus dan RPP terpadu de-ngan menyesuaikan bahan kajian yang ada pada semester ganjil tersebut. Model keterpaduan yang dikembangkan adalah model connected, nested dan shared. Ke-mudian dari model pemaduan tersebut dikembangkan perangkat kurikulum terpa-du, satu model pemaduan satu topik. Penelitian ini bertujuan untuk menghasilkan perangkat kurikulum terpadu berupa silabus dan RPP terpadu menggunakan model keterpaduan Fogarty. Pe-rangkat yang dikembangkan adalah silabus terpadu model connected, silabus ter-padu model nested, silabus terpadu model shared, RPP terpadu model conneted, RPP terpadu model nested, dan RPP terpadu model shared. Pengembangan pe-rangkat kurikulum terpadu menggunakan model penelitian dan pengembangan R&D Borg dan Gall yang telah disederhanakan dan dipadukan dengan alur pe-ngembangan kurikulum IPA SMP/MTs. Tahap-tahap penelitian dan pengemba-ngan yaitu (a) studi pendahuluan, (b) perancangan program, c) pengembangan program yang mencakup penyusunan silabus dan RPP terpadu, dan d) validasi program yang mencakup penilaian kelayakan produk, uji coba pelaksanaan RPP terpadu kelompok kecil, dan revisi produk. Validasi isi melibatkan dua orang do-sen jurusan Biologi FMIPA UM dan dua orang guru IPA MTs Negeri Batu se dangkan uji coba pelaksanaan RPP terpadu kelompok kecil dilakukan kepada 5 orang siswa kelas VIII MTs Negeri Batu. Data yang diperoleh berupa data kualitatif dan data kuantitatif. Data kuan-titatif diperoleh dari pengubahan skor kumulatif yang diperoleh dari validator ter-hadap masing-masing kisi angket menjadi data persentase serta hasil penilaian sis-wa, respon siswa, dan keterlaksanaan RPP terpadu pada uji coba kelompok kecil. Berdasarkan hasil validasi, masing-masing perangkat kurikulum memperoleh per-sentase kelayakan secara berturut-turut silabus terpadu model connected 85.05%, silabus terpadu model nested 84.38%, silabus terpadu model shared 84.6%, RPP terpadu model connected 90.73%, RPP terpadu model nested 91.35% dan RPP terpadu model shared 89.34%. Beberapa revisi dilakukan berdasarkan data kua-litatif berupa saran perbaikan. Pada akhir penelitian ini dihasilkan produk berupa silabus dan RPP terpadu sebagai perangkat kurikulum terpadu mata pelajaran IPA kelas VIII di MTs Negeri Batu yang dinyatakan layak dan dapat menjadi al-ternatif pembelajaran terpadu di MTs Negeri Batu

Sikap mahasiswa terhadap undang-undang akuntan publik pada optimisme dan perencanaan karir (Studi pada mahasiswa akuntansi Universitas Negeri Malang) / Nurdian Susilowati

 

Program Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Sunaryanto, M.Ed., (II) Dr. Tuhardjo, S.E, M.Si, Ak. Kata Kunci: Sikap, Undang-Undang Akuntan Publik, Optimisme, Motivasi Karir, Minat Karir, Pilihan Karir Profesi akuntan publik memiliki peranan yang besar dalam mendukung perekonomian nasional yang sehat dan efisien serta meningkatkan transparansi dan mutu informasi dalam bidang keuangan. Jumlah akuntan publik sampai dengan tahun 2011 adalah stagnan dan sedikit mahasiswa akuntansi yang tertarik menjadi akuntan publik. Oleh karena itu munculah UU akuntan publik yang mendapatkan reaksi pro dan kontra khususnya penjelasan pasal 6 ayat 1 huruf yang berbunyi “..Yang dapat mengikuti pendidikan profesi akuntan publik adalah seseorang yang memiliki pendidikan minimal sarjana strata 1 (S-1), diploma IV (D-IV), atau yang setara”. Tujuan penelitian ini adalah melalui fenomenologi akan mendeskripsikan sikap mahasiswa terhadap UU akuntan publik, optimisme, motivasi karir, minat karir, dan pilihan karir mahasiswa menjadi akuntan publik. Penelitian ini menggunakan pendekatan kualitatif yaitu fenomenologi. Sumber data utamanya adalah kata dan tindakan yang diperoleh melalui purposive sampling. Teknik pengumpulan data dalam penelitian ini adalah wawancara mendalam dan studi dokumentasi. Data penelitian dianalisis menggunakan analisis data Miles dan Humberman. Terdapat tiga jalur analisis yaitu reduksi, model data, dan verifikasi kesimpulan. Hasil penelitian menunjukan bahwa mahasiswa melakukan perencanaan karir sebelum menentukan pilihan karir. Sikap mahasiswa atas UU Akuntan Publik adalah keberatan, netral, dan mendukung. Artinya ada respon favourable dan unfavourable. Sikap tersebut memunculkan optimism, menentukan motivasi karir, minat karir, dan pilihan karir mahasiswa menjadi akuntan publik. Mahasiswa mempunyai ekspektasi menyeluruh bahwa akan ada lebih banyak hal yang baik daripada hal yang buruk terjadi pada masa yang akan datang. Good pay, status sosial akuntan publik dijunjung tinggi oleh masyarakat, dan pekerjaan yang penuh dengan tantangan merupakan faktor pembentuk motivasi karir. Optimisme menentukan minat karir mahasiswa menjadi akuntan publik. Pengetahuan, kecerdasan, peran orang tua, saudara, dan dosen merupakan aspek pembentuk minat karir mahasiswa. Optimisme mempengaruhi pilihan karir mahasiswa menjadi akuntan publik. Peran karir yang tersedia, pengalaman belajar, keyakinan diri, skill, dan ekspektasi akan hasil menentukan pilihan karir mahasiswa. Munculnya sikap positif dan negatif pada UU Akuntan Publik menentukan optimisme yang selanjutnya mempengaruhi motivasi karir dan minat karir mahasiswa dan kemudian sebagai penentu keputusan karir.

Pengaruh program kesejahteraan dan karakteristik pekerjaan terhadap kepuasan kerja menurut persepsi karyawanj PT PLN )Persero) Area Pelayanan dan Jaringan Malang / Isma Izzatullillah

 

Kata kunci: Program Kesejahteraan, Karakteristik Pekerjaan, dan Kepuasan Kerja Seiring terjadinya globalisasi yang terjadi semakin menambah ketatnya persaingan dalam dunia bisnis dan kondisi perekonomian. Hal ini memaksa hampir semua perusahaan untuk bekerja secara maksimal dalam memaksimalkan laba serta bersaing secara kompetitif dengan perusahaan lain salah satunya dengan pembangunan sumber daya manusia sebagai aset penting perusahaan. Setiap manusia yang bekerja tidak hanya cukup dipenuhi kebutuhannya dengan upah dan gaji namun dibutuhkan pemenuhan akan program kesejahteraan karyawan agar kepuasan kerja karyawan meningkat. Selain itu agar tercipta kepuasan kerja yang baik juga dibutuhkan pandangan yang baik akan karakteristik pekerjaannya karena semakin baik pandangan karyawan terhadap pekerjaannya akan membuat hasil pekerjaan yang dilakukan akan semakin maksimal dalam kaitannya mencapai tujuan perusahaan. Dengan tercapainya tujuan perusahaan dan tercukupinya kebutuhan karyawan akan program kesejahteraan karyawan, karakteristik pekerjaan dan kepuasan kerja maka akan tercipta kondisi serta suasana kerja yang kondusif dan mendukung pencapaian tujuan perusahaan. Penelitian ini bertujuan untuk mengetahui pengaruh program kesejahteraan karyawan, karakteristik pekerjaan dan kepuasan kerja karyawan PT PLN Area Pelayanan dan Jaringan Malang. Penelitian ini dilaksanakan di PT PLN APJ Malang pada bulan November sampai Desember 2011. Subjek dalam penelitian ini adalah karyawan PT PLN Area Pelayanan dan Jaringan Malang yang berjumlah 83 orang. Sedangkan sampelnya diambil sebanyak 68 orang dan teknik pengambilan sampel menggunakan proportional random sampling. Analisis data yang dipakai adalah menggunakan analisis regresi berganda untuk melihat pengaruh program kesejahteraan (X1), karakteristik pekerjaan (X2) terhadap variabel dependen kepuasan kerja (Y) secara parsial dengan uji asumsi klasik yaitu uji normalitas, uji multikolinieritas, dan uji heteroskedastisitas. Hasil penelitian ini untuk mengetahui (1)terdapat pengaruh positif signifikan variabel program kesejahteraan terhadap kepuasan kerja (2) terdapat pengaruh positif signifikan karakteristik pekerjaan terhadap kepuasan kerja. Berdasarkan penelitian ini dapat disarankan agar manajemen perusahaan melakukan evaluasi mengenai kebijakan pemberian program kesejahteraan agar lebih ditingkatkan lagi untuk menumbuhkan kepuasan kerja serta menunjang kinerja karyawan serta para pimpinan semakin memperhatikan karakteristik pekerjaan agar pekerjaan dibuat lebih bervariasi supaya tidak monoton dan membosankan karena dikhawatirkan bisa mengganggu pelayanan pelanggan.

Pengembangan paket pembelajaran budidaya tanaman karet untuk kelas X SPMA Negeri Provinsi Jambi / Suhardin

 

Progam Studi Teknologi Pembelajaran, Progam Pascasarjana Universitas Negeri Malang. Pembimbing : (1) Prof. Dr. I Nyoman Sudana Degeng, M.Pd,. (2) Dr. AJE Toenlioe , M.Pd Kata kunci : Paket Pembelajaran, Pengembangan, Budidaya Tanaman Karet. Teknologi pembelajaran memiliki tujuan utama untuk mengidentifikasi dan memecahkan masalah belajar. Pemecahan masalah belajar tersebut amat penting karena terkait dengan peningkatan kualitas pembelajaran, peningkatan ini dapat ditempuh dengan mengarahkan kegiatan pembelajaran pada tiga aspek penting yaitu keefektifan, efisien, dan daya tarik. Salah satu peran besar bidang teknologi pembelajaran adalah penyedian sumber-sumber belajar melalui kegiatan pengembangan (development). Sementara itu kondisi di lapangan, kususnya pada Sekolah Pertanian Menengah Atas (SPMA) Negeri Provinsi Jambi belum tersedia bahan ajar yang benar-benar dirancang untuk pembelajaran. Siswa SPMA Negeri Provinsi Jambi belum memiliki bahan ajar yang khusus terutama budidaya tanaman karet. Bahan pembelajar yang ada selama ini hanya berupa buku yang judulnya bermacam-macam. . Oleh karena itu, dirasakan perlu untuk mengembangkan paket pembelajaran yang terwujud dalam bentuk bahan ajar yang dilengkapi dengan panduan siswa dan panduan guru. Bahan pembelajaran yang dipilih dan dikembangkan dalam penelitan ini adalah untuk mata pelajaran ketrampilan dengan mengambil satu bahasan tentang budidaya tanaman karet. Hal tersebut sesuai dengan pelaksanaan progam pendidikan pertanian yang mengutamakan pembelajaran ketrampilan yang berorientasi agribisnis. Keterwakilan waktu dan tempat tertentu menjadi alasan dikembangkannya paket pembelajaran ini. Paket pembelajaran ini dalam pengembangannya menggunakan model Dick & Carey. Hasil dari evaluasi tahap pertama 87,58 %, evaluasi tahap kedua 98,46%,dan uji lapangan 99,44 %, dapat disimpulkan bahwa produk paket pembelajaran budidaya tanaman karet dianggap telah memenuhi syarat atau kriteria kelayakan melalui tahapan penyusunan, analisis, dan revisi produk.

Analisis sektopr-sektor ekonomi dalam rangka pengembangan kebijakan pembangunan ekonomi Kota Kediri / Rita Erika

 

Kata Kunci: Sektor Ekonomi, Pembangunan Ekonomi Dengan adanya otonomi daerah maka Pemerintah daerah dituntut untuk lebih kreatif dan inovatif dalam membuat perencanaan kebijakan. Untuk itu diperlukan pemilihan strategi yang tepat dalam mengembangkan sektor-sektor ekonomi yang berpotensi memiliki sektor unggulan, mengingat sektor unggulan memegang peranan penting sebagai penggerak utama pembangunan ekonomi di suatu daerah. Dengan begitu, salah satu cara pengembangan kebijakan pembangunan ekonomi daerah sesuai dengan potensi yang dimiliki daerah dapat dilakukan dengan menganalisis sektor-sektor ekonomi yang berpotensi menjadi unggulan. Penelitian ini bertujuan untuk mengetahui (1) sektor-sektor ekonomi yang berpotensi menjadi unggulan di Kota Kediri, (2) kesesuaian kebijakan pembangunan ekonomi Kota Kediri terhadap hasil analisis sektor yang menjadi unggulan. Penelitian ini menggunakan metode kuantitatif deskriptif. Subjek dalam penelitian ini adalah PDRB sektoral Kota Kediri dan Provinsi Jawa Timur yang dihitung berdasarkan atas dasar harga konstan tahun 2000 kurun waktu 2006-2010 dengan menggunakan metode dokumentasi, observasi, dan wawancara. Skripsi ini menggunakan alat analisis, yaitu analisis Location Quotient (LQ), Model Rasio Pertumbuhan (MRP) dan Klaassen Typology. Berdasarkan hasil analisis data, diperoleh dua simpulan hasil penelitian sebagai berikut. Pertama, Kota Kediri memiliki empat sektor yang menjadi unggulan yaitu sektor industri pengolahan, sektor keuangan, persewaan dan jasa perusahaan, sektor konstruksi; dan sektor jasa-jasa. Dimana keempat sektor tersebut di Kota Kediri mempunyai peluang untuk lebih dikembangkan sebagai sektor penentu prioritas dalam mengembangkan kebijakan pembangunan ekonomi. Kedua, kebijakan pembangunan ekonomi Kota Kediri yaitu yang tertuang dalam landasan pembangunan Tri Bina Kota Kediri belum sesuai dan masih terdapat perbedaan (gap) dengan hasil analisis keempat sektor yang menjadi unggulan tersebut. Dengan demikian, dalam menentukan prioritas kebijakan pembangunan ekonomi, harus mempertimbangkan sisi tingkat kebasisan dan laju pertumbuhan masing-masing sektor. Sehingga akan diperoleh kebijakan pembangunan yang sesuai dengan kondisi dan potensi tiap sektor.

The failure in traslating humor: A case study in the Indonesian translation of humor graphic novel the Diary of a Wimpy Kid / Rizky Lutviana

 

Keywords: humor, failure in translating humor, translation strategies Technically, translating humor is a big challenge for a translator. This is due to three reasons. Firstly, humor is intended to produce funny effect, which is quite difficult to render. Secondly, although the translators understand the humor they may not be able to bring the funny effect to the target text. Thirdly, humor and fun are subjective. Other people may consider a joke is funny but others do not. The case is the humor novel, The Diary of a Wimpy kid. This is a popular humor graphic novel that the translator creatively combines the humorous story with the amusing graphic cartoon. This novel gains success as well as its Indonesian translated version, Diary Si Bocah Tengil. Despite its success, some readers argue the intended funny effect is well presented. This study aims at pointing at the failure in the translation of humor novel as well as suggesting strategy for better translation. The researcher takes the first volume of the translated series of The Diary of a Wimpy Kid as the object of this study. The data are analyzed qualitatively. The data found are 56 items, covering the failure in the three broad categories of humor, linguistic humor (4 data), cultural humor (25 data), and universal humor (27 data). Based on the analysis, four points can be concluded. Firstly, on the linguistic humor, the translator fails to transfers its aesthetical aspects that make the humor live up. Secondly, in the cultural humor, the translator does not provide the adequate cultural background information so that the readers will understand the humor and does not reveal the atmosphere and the nuances of the story in the target text. Thirdly, in universal humor, there are two factors that make the humor fails to deliver in target text, (1) errors and inappropriateness and, (2) the application of inappropriate translation strategy. Fourthly, in translating the humorous cartoon, the translator does not consider the special aspects of it, such as space and visual. To improve the translator’s work, the researcher suggests the tree alternative solutions. Firstly, in translating linguistic humor, the researcher suggests the translator to apply the semantic translation strategy in which it requires the translator to preserve the beauty aspects of linguistic humor. Secondly, to reveal the cultural elements of the humor in cultural humor, the translator can used the semantic cultural equivalent translation strategy in which it preserves the nuances and atmosphere of humor. Thirdly, for universal humor, since this type of humor is not bound by any language features or cultural elements, it is suggested that the translator apply communicative translation strategy. This strategy enables the translator to choose any words and language style that express the humorous discourse as long as the intended funny effect is delivered and can be understood by most readers.

Pembuatan program manajemen logistik untuk pencatatan material dengan metode Average di bengkel Teknik Mesin FT UM / Hadi Purnomo, Valentine Malvistulloh

 

Kata Kunci: program, manajemen logistik, pencatatan, bengkel mesin Manajemen logistik merupakan bagian dari proses supply chain yang berfungsi untuk merencanakan, melaksanakan, dan mengendalikan keefisienan dan keefektifan penyimpanan dan aliran barang, pelayanan dan informasi terkait dari titik permulaan hingga titik konsumsi dalam tujuannya untuk memenuhi kebutuhan para pelanggan. Manajemen logistik yang baik sangat diperlukan di gudang untuk pengaturan aliran material yang ada di gudang agar tidak kekurangan maupun kelebihan material serta pengecekan material jika dilihat dari garis besar fungsi manajemen logistik. Bengkel Teknik Mesin Universitas Negeri Malang merupakan salah satu bengkel mesin yang mempunyai gudang untuk penyimpanan material praktik. Tapi dalam perencanaan dan pencatatan material masih belum teratur. Hal ini dikarenakan pencatatan material masih menggunakan pencatatan manual sehingga sulit melihat jumlah material yang habis dipakai dalam waktu periode tertentu untuk perencanaan pengadaan material berikutnya. Selain itu, dampak dari pencatatan yang belum teratur yaitu sulitnya melihat sisa material yang ada. Program manajemen logistik yang memanfaatkan software yang ada di komputer adalah salah satu pemecahan masalah yang dihadapi bengkel Teknik Mesin Universitas Negeri Malang untuk memudahkan pencatatan dan perencanaan material yang ada. Program manajemen logistik dibuat dari software Microsoft access dan memanfaatkan fasilitas yang ada didalamnya seperti: tabel, query, form, report, VB access, serta fasilitas lain. Program dibuat dengan metode pencatatan average. Setelah masuk ke program, pengoperasian program dapat dilakukan dengan memilih jenis material yang ada pada tampilan utama. Pilihan material yang disediakan yaitu (1) material baku dan (2) komponen standard . yang dimaksud material baku disini yaitu material yang masih membutuhkan pengerjaan lanjut seperti: besi poros, besi kotak, dan lain-lain. Sedangkan yang dimaksud komponen standard disini yaitu material yang sudah tidak membutuhkan pengerjaan seperti: mur, baut, bantalan, dan lain-lain. Jika sudah memilih material, selanjutnya memilih proses yang akan dilakukan. Proses tersebut adalah (1) input data, (2) persediaan barang, dan (3) laporan berdasarkan kode. Dalam fasilitas input data dapat dilihat tabel rincian material, fasilitas memasukkan data material masuk dan memasukkan data material keluar, serta melihat sisa persediaan. Persediaan barang digunakan untuk melakukan print out persediaan material yang tersisa di gudang. Laporan berdasarkan kode digunakan untuk melihat dan melakukan print out data material berdasarkan kode material yang dimasukkan. i

Analisis pemahaman konsep titrasi asam basa siswa kelas XI IPA semester II SMAN 5 Malang tahun pelajaran 2011/2012 / Dyna Rahmawati

 

Kata Kunci: pemahaman konsep, titrasi asam basa. Ilmu kimia merupakan cabang ilmu pengetahuan alam yang mempelajari sifat–sifat materi, struktur materi, perubahan materi, hukum–hukum dasar perubahannya, dan konsep–konsep dan teori–teori yang mengartikannya. Sebagian besar guru kimia menemukan bahwa konsep kimia sulit untuk dipahami dan masih dianggap sulit oleh sebagian besar siswa karena sebagian besar ilmu kimia bersifat abstrak, bersifat kompleks, dan banyak bagian konsep yang dihubungkan dengan konsep–konsep lain, salah satu contohnya adalah konsep titrasi asam. Kemampuan untuk memahami konsep titrasi asam basa sangat dipengaruhi oleh konsep–konsep pokok yang mendasarinya. Berdasarkan hal tersebut, penelitian bertujuan untuk mengidentifikasi: (1) tingkat pemahaman konsep siswa terhadap indikator titrasi asam basa, (2) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi asam kuat–basa kuat, (3) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi asam lemah–basa kuat, (4) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi basa lemah–asam kuat, (5) tingkat pemahaman konsep siswa terhadap perubahan pH selama titrasi asam lemah–basa lemah, dan (6) konsep titrasi asam basa yang sukar bagi siswa. Penelitian ini menggunakan rancangan penelitian deskriptif. Populasi penelitian adalah siswa kelas XI IPA SMAN 5 Malang tahun pelajaran 2011/2012, yang terdiri dari enam kelas yang kemampuannya homogen. Sampel penelitian adalah kelas XI IPA 4 dan XI IPA 6, sebanyak 68 siswa yang dipilih berdasarkan kelas yang terlebih dahulu diajarkan materi titrasi asam basa. Instrumen penelitian berupa tes objektif sebanyak 18 butir soal yang terdiri dari 10 soal berbahasa Inggris dan 8 soal berbahasa Indonesia dengan validitas isi sebesar 98,33% dan reliabilitas sebesar 0,67. Analisis data menggunakan teknik analisis statistik deskriptif. Hasil penelitian menunjukkan bahwa tingkat pemahaman konsep siswa terhadap: (1) indikator titrasi asam basa tergolong sedang (63,72%), (2) perubahan pH selama titrasi asam kuat–basa kuat tergolong rendah (40,81%), (3) perubahan pH selama titrasi asam lemah–basa kuat tergolong rendah (41,91%), (4) perubahan pH selama titrasi basa lemah–asam kuat tergolong rendah (38,23%), (5) perubahan pH selama titrasi asam lemah–basa lemah tergolong rendah (41,67%), dan (6) terdapat 8 sub konsep yang merupakan konsep titrasi asam basa yang sukar bagi siswa. Tingkat pemahaman konsep siswa tertinggi terdapat pada konsep indikator titrasi asam basa dan tingkat pemahaman konsep siswa terendah terdapat pada konsep perubahan pH selama titrasi basa lemah–asam kuat. Konsep yang paling sukar bagi siswa adalah perubahan pH selama titrasi asam lemah–basa kuat sebelum titik ekuivalen.

Perbedaan hasil belajar tekniki komputer dan jaringan melalui pemanduan model pembelajaran Problem Based Learning (PBL) dan Cooperative Tipe Teams Games Tournament (TGT) dengan Problem Based Learning (PBL) siswa kelas X SMK Negeri 2 Malang / Nur Chabibah Rahmawati

 

Kata Kunci : Problem Based Learning, Teams Games Tournament, Hasil Belajar, Teknik Komputer dan Jaringan. Pendidikan memegang peran penting dalam kehidupan suatu bangsa, salah satu faktor yang menentukan keberhasilan pembelajaran adalah model pembelajaran yang digunakan. Berdasarkan hasil observasi di SMK Negeri 2 Malang, model pembelajaran yang diterapkan oleh guru adalah pembelajaran berbasis masalah. Akan tetapi faktanya model pembelajaran ini tidak diterapkan secara tepat sesuai dengan langkah-langkahnya. Hal ini menyebabkan pembelajaran menjadi pasif, berpusat pada guru, dan berdampak pada hasil belajar siswa yang rendah. Salah satu alternatif untuk meningkatkan hasil belajar siswa yaitu dengan memadukan model pembelajaran Problem Based Learning (PBL) dan Teams Games Tournament (TGT). Penelitian ini bertujuan untuk mengetahui perbedaan hasil belajar siswa antara pemaduan model pembelajaran Problem Based Learning (PBL) dan Cooperative Tipe Teams Games Tournament (TGT) dengan yang menggunakan model pembelajaran Problem Based Learning (PBL). Penelitian ini dilakukan dengan menggunakan rancangan eksperimen semu (quosy experimental design). Variabel penelitian terdiri dari variabel bebas yaitu model pembelajaran, dan variabel terikat yaitu hasil belajar. Sampel penelitian yang digunakan dalam penelitian ini diambil secara teknik Purposive Sample (sampel bertujuan) teknik ini didasarkan karena adanya tujuan dan pertimbangan tertentu, yaitu kelas X TKJ 2 sebagai kelas eksperimen dan kelas X TKJ 1 sebagai kelas kontrol Instrumen yang digunakan yaitu instrumen perlakuan dan instrumen pengukuran. Hasil belajar siswa kelas kontrol dan kelas eksperimen diperoleh dari nilai kognitif, psikomotorik, afektif, dan nilai tugas. Hasil penelitian menunjukkan bahwa pada kelas eksperiemen memiliki rata-rata hasil belajar lebih tinggi daripada kelas kontrol yaitu 81,54 > 77,90. Hasil belajar antara kelas eksperimen dan kelas kontrol menunjukkan perbedaan yang signifikan yaitu dengan nilai Sig(p) 0,000 < 0,05 sehingga Ho ditolak, sehingga terdapat perbedaan hasil belajar yang signifikan antara kelas eksperimen yang diajar menggunakan pemaduan model pembelajaran Problem Based Learning (PBL) dan Cooperative Tipe Teams Games Tournament (TGT) dengan kelas kontrol yang diajar menggunakan model pembelajaran Problem Based Learning (PBL).

Pengembangan modul pembelajaran keliling dan luas daerah segi empat untuk kelas VII semester 2 bercirikan metode Discovery Learning / Aprilia Fitriani

 

Kata kunci: modul, discovery learning, segi empat Setiap anak memiliki kecepatan masing-masing dalam memahami materi. Untuk membuka kesempatan belajar menurut kecepatan masing-masing siswa, dibutuhkan bahan ajar yang salah satunya adalah modul. Modul merupakan suatu paket bahan ajar yang disusun secara sistematis dan memuat serangkaian aktivitas belajar mandiri agar siswa mampu mencapai tujuan pembelajaran yang telah diterapkan. Menurut beberapa penelitian, pembelajaran dengan modul menunjukkan hasil yang baik, siswa dapat belajar menurut kecepatan dan caranya masing-masing, serta menggunakan teknik yang berbeda-beda untuk memecahkan masalah, dan mereka akan lebih mudah dalam memahami materi. Modul merupakan salah satu bahan ajar tertulis yang membahas suatu topik atau pokok bahasan yang disusun dalam bentuk tertentu, serta terencana untuk keperluan belajar dan alat ukur kemampuan belajar. Dalam pembelajaran dengan modul, siswa diharapkan berperan lebih aktif. Salah satu metode pembelajaran yang dapat digunakan untuk mendukung keaktifan siswa adalah metode penemuan. Discovery learning merupakan suatu cara untuk menyampaikan ide atau gagasan melalui proses menemukan. Berdasarkan pada penelitian, dari berbagai cabang matematika, hasil pembelajaran geometri siswa masih rendah. Siswa mengalami kesulitan memahami konsep geometri, salah satunya konsep keliling dan luas segi empat. Hal ini membuat penulis tertarik untuk mengembangkan modul materi geometri, khususnya tentang keliling dan luas segi empat. Untuk memenuhi maksud ini penulis melakukan kegiatan pengembangan yang bertujuan untuk menghasilkan modul pembelajaran pokok bahasan keliling dan luas segi empat berdasarkan Kurikulum Tingkat Satuan Pendidikan yang merupakan materi siswa kelas VII semester 2. Modul pembelajaran yang dikembangkan telah diujicoba sebagai pijakan untuk melakukan revisi modul, penyempurnaan, dan peningkatan kualitas modul. Uji coba dilaksanakan dalam dua tahap. Uji coba modul tahap pertama yaitu validasi isi modul. Untuk memperoleh data pada validasi isi diperlukan penilaian dan tanggapan terhadap modul yang diperoleh dari angket yang telah diisi oleh validator yang melibatkan tiga orang subyek coba/validator, yaitu seorang dosen Matematika Universitas Negeri Malang dan dua orang guru matematika Sekolah Menengah Pertama. Uji coba modul tahap kedua melibatkan subyek coba yang terdiri dari tujuh orang siswa kelas VII semester 2. Hasil uji coba modul menunjukkan bahwa modul yang dikembangkan valid dengan rata-rata total penilaian 3,32. Walaupun sudah dinyatakan valid, revisi tetap dilakukan pada beberapa bagian yang ditunjukkan oleh validator. Karakteristik modul ini yaitu (1) memuat materi keliling dan luas segi empat, (2) ditujukan untuk siswa kelas VII, (3) kegiatan belajar disusun dengan metode discovery learning, (4) terdiri dari tiga modul kecil, (5) menuntun siswa untuk dapat menemukan sendiri, dan (6) valid, sehingga layak digunakan sebagai bahan ajar dalam pembelajaran. 

Meningkatkan keaktifan siswa dengan model pembelajaran terpadu Numbered Heads Together (NHT) dan Problem Based Learning (PBL) pada mata pelajaran Teknik Komputer dan Jaringan siswa kelas X SMKN 2 Malang /' Laila Nurwahyunita

 

Kata Kunci: Model Numbered Heads Together (NHT) dan Problem Based Learning (PBL), Keaktifan Belajar Siswa Kualitas pendidikan di Indonesia saat ini sangat memprihatinkan terlihat dengan adanya ketertinggalan di dalam mutu pendidikan dan hasil itu diperoleh setelah kita membandingkan dengan negara lain. Salah satu penyebab rendahnya kualitas pembelajaran di sekolah adalah proses pembelajaran di sekolah kurang maksimal dikarenakan model pembelajaran yang diterapkan di sekolah tidak sesuai dengan kondisi sekolah, karakter siswa, ataupun materi yang digunakan. Permasalahan itulah yang akhirnya menyebabkan keaktifan dan hasil belajar siswa rendah. Berdasarkan observasi awal dan wawancara yang dilakukan dengan guru dan siswa SMKN 02 Malang, diketahui bahwa sebagian besar proses pembelajarannya masih didominasi oleh guru sehingga siswa cenderung pasif. Hasil observasi menunjukkan bahwa dari 43 siswa secara klasikal nilai keaktifan siswa Kelas X TKJ 03 SMKN 02 Malang hanya 41, 84%. Penelitian ini adalah bertujuan untuk meningkatkan keaktifan siswa kelas X Teknik Komputer dan Jaringan pada pembelajaran Teknik Komputer dan Jaringan materi mendiagnosis Permasalahan Pengoperasian PC dan Peripheral dengan menggunakan model pembelajaran perpaduan Numbered Heads Together (NHT) dan Problem Based Learning (PBL). Penelitian ini merupakan Penelitian Tindakan Kelas yang terdiri dari tahap perencanaan, pelaksanaan, observasi, dan refleksi. Penelitian ini terdiri dari tiga siklus. Masing-masing siklus terdiri dari dua pertemuan. Instrumen yang digunakan yaitu lembar observasi keaktifan siswa dan soal tes evaluasi. Data yang diperoleh akan dibandingkan dari observasi awal, Siklus I, Siklus II, dan Siklus III. Hasil penelitian menunjukkan bahwa keaktifan belajar siswa meningkat dari siklus I ke siklus II ke siklus III. Keaktifan belajar siswa pada siklus I mencapai 58,51% sedangkan pada siklus II meningkat menjadi 67,85% dan sedangkan pada siklus III meningkat menjadi 79,51%. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa model pembelajaran perpaduan Numbered Heads Together (NHT) dan Problem Based Learning (PBL) dapat meningkatkan keaktifan siswa kelas X TKJ SMKN 02 Malang. Saran kepada guru TKJ di SMKN 02 Malang agar menggunakan model pembelajaran perpaduan Numbered Heads Together (NHT) dan Problem Based Learning (PBL) untuk mengatasi permasalahan yang berkaitan dengan keaktifan siswa serta hasil belajar siswa.

Pengaruh strategi pembelajaran peer mediated instruction and intervention tipe Classwidw Peer Tutoringt dan kemampuan akademik terhadap kemampuan berpikir kritis, hasil belajar kognitif, dan afektif IPA Biologi siswa kelas XI SMK Negeri I Bontang tahun pelajaran 2011/20

 

Program Studi Pendidikan Biologi, Program Pascasarjana, Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Hj. Mimien Henie Irawati, M.S., (II) Dr Hedi Sutomo, S.U Kata Kunci: Classwide Peer Tutoring kemampuan akademik, berpikir kritis, kognitif, dan afektif Pembelajaran IPA di SMKN 1 Bontang masih didominasi dengan strategi belajar konvensional yaitu metode belajar dengan ceramah. Hal ini berdampak terhadap kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif IPA yang cendrung masih rendah karna siswa belum terlatih menjadi pebelajar yang mandiri. Oleh karena itu diperlukan inovasi pembelajaran yang dapat memberdayakan kemampuan berpikir kritis yang berimplikasi terhadap hasil belajarnya. Inovasi pembelajaran PMII tipe CWPT dapat digunakan sebagai terobosan untuk mengembangkan kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar Afektif. Penelitian ini bertujuan untuk mengetahui pengaruh strategi pembelajaran PMII tipe CWPT dan kemampuan akademik terhadap kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif IPA Biologi Siswa Kelas XI di SMK Negeri I Bontang Tahun ajaran 2011/2012. Metode yang digunakan dalam penelitian ini adalah quasi eksperimen. Desain yang digunakan adalah rancangan pretest-posttest non eqivalen control group design. Populasi sebanyak 9 kelas yang berjumlah 290 siswa. Sampel dipilih 6 kelas dengan jumlah siswa sebanyak 64 siswa untuk kelompok eksperimen dan 60 siswa untuk kelompok kontrol. Pengumpulan data dilakukan dengan menggunakan tes uraian untuk mengukur kemampuan berpikir kritis, tes pilihan ganda untuk mengukur hasil belajar kognitif, dan tes sikap skala Likert untuk mengukur hasil belajar afektif. Data dianalisis secara deskriptif dan inferensial (statistik Anakova) dengan bantuan program software SPSS versi 16 for Windows, dilakukan dengan taraf signifikan 5%. Hasil penelitian menunjukkan: (1) Ada pengaruh strategi pembelajaran terhadap kemampuan berpikir kritis, hasil belajar kognitif dan hasil belajar afektif siswa. Hasil uji lanjut menunjukkan bahwa kemampuan berpikir kritis, hasil belajar kognitif dan hasil belajar afektif IPA Biologi siswa dengan strategi pembelajaran Peer Mediated Instruction and Intervention tipe Classwide Peer Tutoring memiliki nilai mean terkoreksi lebih tinggi masing-masing 13,83; 3,73; dan 2,50 dari rata-rata mean terkoreksi untuk kemampuan berpikir kritis, hasil belajar kognitif, dan hasil belajar afektif siswa dengan strategi konvensional; (2) Tidak ada pengaruh kemampuan akademik terhadap hasil belajar afektif IPA Biologi, tetapi berpengaruh terhadap kemampuan berpikir kritis, dan hasil belajar kognitif IPA Biologi. Perbedaan yang tidak signifikan terlihat pada hasil belajar afektif IPA Biologi siswa, rata-rata skor terkoreksi pada siswa berkemampuan akademik atas masing-masing 3,51 dan 8,45 lebih tinggi dibandingkan dengan siswa berkemampuan akademik rendah; (3) Tidak ada pengaruh interaksi antara strategi pembelajaran dengan kemampuan akademik terhadap kemampuan berpikir kritis, hasil berpikir kognitif dan hasil belajar afektif IPA Biologi siswa. Hasil penelitian menunjukkan bahwa terjadi peningkatan nilai kemampuan berpikir kritis, hasil berpikir kognitif, dan hasil belajar afektif siswa yang berkemampuan akademik atas maupun siswa yang berkemampuan akademik rendah. Berdasarkan hasil penelitian, disarankan guru menerapkan strategi PMII tipe CWPT agar dapat meningkatkan kemampuan berpikir kritis, hasil belajar kognitif, dan hasil afektif siswa, baik pada siswa berkemampuan akademik atas maupun pada siswa berkemampuan akademik bawah dan dapat diimplementasikan pada pokok bahasan yang lain. Kemampuan guru menggunakan berbagai macam strategi pembelajaran dapat mengurangi bahkan menghilangkan kejenuhan siswa dalam menerima pembelajaran. Bagi guru yang akan menerapkan strategi pembelajaran PMII tipe CWPT agar mempertimbangkan kesiapan siswa, kesiapan guru, dan ketersediaan sumber belajar.

Peningkatan kemampuan membaca cepat siswa kelas X program keahlian analis kimia SMK Negeri 1 Bontang melalui strategi P2KRKS / Marsani

 

, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (I) Dr. Imam Agus Basuki, M.Pd., (II) Dr. Nurhadi, M.Pd. Kata kunci: membaca cepat, Strategi P2KRKS. Membaca cepat merupakan salah satu keterampilan berbahasa yang perlu dikuasai untuk memahami isi bacaan secara cepat sehingga menjadi salah satu kegiatan penting dalam pembelajaran. Pembelajaran membaca cepat kelas X SMK bertujuan agar siswa mampu membaca teks bacaan dengan cepat dan memahami isi bacaan secara cepat dan tepat. Berdasarkan pengamatan awal pembelajaran membaca di kelas X SMK Negeri 1 Bontang belum optimal. Salah satu strategi pembelajaran membaca yang digunakan oleh guru belum berorientasi pada pembelajaran membaca cepat. Akibatnya, siswa kurang aktif, kurang kreatif, bahkan tidak tertarik pada pembelajaran membaca. Oleh karena itu, diperlukan strategi pembelajaran yang dapat meningkatkan kecepatan membaca siswa. Salah satu stategi yang dapat meningkatkan kecepatan efektif membaca siswa adalah Strategi P2KRKS. Strategi ini merupakan rangkaian latihan mempercepat gerak mata, memperluas jangkauan mata, mengurangi regresi, dan mengembangkan skemata. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan penelitian tindakan kelas. Data penelitian berupa hasil tes, hasil wawancara, hasil angket siswa, catatan lapangan, dokumentasi, dan observasi. Rancangan penelitian inidisusun dalam satuan siklus, terdiri atas persiapan tindakan, pelaksanaan tindakan, pengamatan, analisis, dan refleksi. Hasil refleksi pada setiap siklus sebagai perbaikan pada siklus berikutnya. Penelitian ini dilaksanakan dalam 2 siklus yang pada tahap pelaksanaanya berkalaborasi peneliti dengan pengamat (observer). Subjek penelitian ini adalah siswa kelas X Program Keahlian Analisis Kimia SMK Negeri 1 Bontang yang berjumlah 32 siswa.Instrumen yang digunakan berupa instrumen tes dan nontes. Data yang dikumpulkan dianalisis dengan teknik diskriptif kuantitatif dan teknik diskriptif kualitatif. Hasilpenelitianmenujukkan bahwa kecepatan membaca mengalami peningkatan seginifikan. Kecepatan membaca meliputi kecepatan membaca kata per menit dan kecepatan efektif membaca. Hasilstudipendahuluan menunjukkanbahwa rata-rata kecepatanmembacakata per menit adalah 183,8 kpmmeningkatmenjadi292,1kpm pada siklus 1 danmeningkatlagi menjadi 426,4kpm pada siklus 2. Selanjutnya, hasil kecepatan efektif membaca siswa pada hasil studi pendahuluan menunjukkan rata-rata 109,3 kpm meningkat menjadi 205,7 kpm pada siklus 1 dan mengalami peningkatan lagi menjadi 366,1 kpm pada siklus 2. Hasil pemahaman siswa terhadap isi bacaan mengalami peningkatan yang segnifikan. Studi pendahuluan menunjukkan rata-rata pemahaman isi bacaan adalah 59,4% meningkat menjadi 70% di siklus 1 dan terus meningkat menjadi 87,5% pada siklus 2.Selanjutnya, pada proses pembelajaran juga mengalami peningkatan, baik peningkatan hasil persentasemaupun peningkatan proses pembelajaran di kelas. Pada hasil persentase kecepatan membacaper menit daristudipendahuluankeSiklus 1 adalah58,9%, danpersentasehasil kecepatan membaca per menitdarisiklus 1 kesiklus 2 sebesar46%. Persentase hasil pemahamanisi bacaanpadastudipendahuluanadalah 59,4%, meningkatmenjadi70% pada siklus 1 danterus mengalami peningkatan menjadi 87,5% pada siklus 2. PersentasehasilkecepatanefektifmembacadaristudipendahuluankeSiklus 1 sebesar88,2% danpeningkatandariSiklus 1 kesiklus 2 sebesar78,1%. Selanjutnya, peningkatan proses pembelajaran membaca cepat, pada studipendahuluandiketahuibahwakeaktifansiswadalampembelajaranmasih kurangdan guru pun tidak menggunakanstrategiuntukmeningkatkankecepatanefektifmembaca. PadaSiklus 1 terjadipeningkatan proses dengan menggunakanSrategiP2KRKSdan media walaupun siswa masih melakukan penghambatan kecepatan membaca, tetapikeaktifansiswameningkat. PadaSiklus 2 terjadipeningkatanberupamodifikasilatihanuntuk lebih meningkatkan kecepatan membaca danpenggunaanalatbantumampumengurangikebiasaanpenghambatkecepatanmembacasiswa. Pembelajaran membaca cepat dengan Strategi P2KRKS menunjukkan hasil peningkatan. Peningkatan ini terjadi pada kecepatan efektif membaca, pemahaman siswa terhadap isi bacaan, dan peningkatan proses pembelajaran membaca cepat di kelas. Perencanaan pembelajaran membaca cepat dengan Strategi P2KRKS disusun secara baik dan cermat dan pelaksanaan pembelajarannya pun secara efektif dan efisien. Hasilnya, siswa lebih percaya diri ketika menjawab pertanyaan karena siswa sudah memahamai pola Strategi P2KRKS dengan mempercepat gerak mata, memperluas jangkauan pandangan mata, tidak terjadi regresi pada saat membaca, dan skemata siswa terus dikembangkan sehingga siswa dapat menyerap informasi bacaan secara otomatis, mempunyai pemetaan pikiran yang baik, serta secara tidak langsung siswa melakukan kegiatan membaca secara cepat dan baik. Pembelajaran dengan Strategi P2KRKS, guru telah berhasil memotivasi siswa untuk betul-betul ikut aktif mengikuti kegiatan pembelajaran membaca sehingga keterampilan membaca cepat siswa semakin meningkat, serta siswa selalu berusaha memperbaiki kesalahan membaca yang dilakukannya, bahkan siswa meminta untuk dilakukan lagi pembelajaran membaca cepat. Dengan demikian, Strategi P2KRKS menjadi salah satu alternatif yang tepat untuk mengatasi kesulitan membaca cepat. Saran untuk penelitian selanjutnya yaitu Strategi P2KRKSdiharapkandiujicobakan di jenjang lain. Ragam latihan bisa dimodifikasi asal sesuai dengan konsep Strategi P2KRKS. Teks yang digunakan untuk latihan lebih bervariasisesuaitingkatpemahamansiswa. JikaterjadikesulitandalammenerapkanStrategi P2KRKS, makalatihan-latihannyadapatdimodifikasisesuaiteorimembacacepat.

Pengaruh gaya kepemimpinan general manager terhadap semangat kerja karyawan (Studi pada Hotel Sahid Montana Malang) / Farida

 

Kata Kunci: Gaya Kepemimpinan Direktif, Gaya Kepemimpinan Suportif, Gaya Kepemimpinan Partisipatif, Semangat Kerja Hotel Sahid Montana Malang memerlukan General Manager yang efektif dan mampu mengkoordinasi sumber daya manusia yang dipimpinnya kearah tujuan yang diinginkan dengan menggunakan gaya kepemimpinan yang sesuai dengan situasi dan kondisi perusahaan. Semangat kerja karyawan akan muncul diantaranya dari adanya kepemimpinan yang diterapkan General Manager dalam suatu organisasi. Untuk itulah, suatu perusahaan dituntut untuk memiliki General Manager yang mampu menciptakan suasana dinamis serta mampu meningkatkan semangat kerja bawahannya. Penelitian ini bertujuan untuk mengetahui kondisi gaya kepemimpinan General Manager dan semangat kerja karyawan, mengetahui pengaruh positif yang signifikan gaya kepemimpinan direktif General Manager terhadap semangat kerja karyawan, mengetahui pengaruh positif yang signifikan gaya kepemimpinan suportif General Manager terhadap semangat kerja karyawan, mengetahui pengaruh positif yang signifikan gaya kepemimpinan partisipatif General Manager terhadap semangat kerja karyawan, mengetahui pengaruh positif yang signifikan gaya kepemimpinan General Manager (gaya kepemimpinan direktif, gaya kepemimpinan suportif, dan gaya kepemimpinan partisipatif) secara simultan terhadap semangat kerja karyawan, dan mengetahui pengaruh variabel gaya kepemimpinan General Manager yang dominan terhadap semangat kerja karyawan. Penelitian ini menerapkan penelitian deskriptif korelasional, dengan pendekatan kuantitatif. Sampel dalam penelitian ini sebanyak 50 karyawan. Instrumen yang digunakan dalam penelitian ini adalah angket. Dalam menganalisis digunakan teknik analisis deskriptif dan analisis data berupa uji validitas dan reliabilitas serta regresi berganda, juga dengan uji-uji statistik (uji t, uji F) dan uji asumsi klasik. Hasil penelitian ini adalah sebagai berikut (1) Berdasarkan hasil analisis regresi nilai thitung 2,593 dan nilai signifikansi t 0,013 < 0,05, maka Ha menunjukkan bahwa ada pengaruh positif yang signifikan gaya kepemimpinan direktif General Manager terhadap semangat kerja karyawan pada Hotel Sahid Montana Malang. (2) Berdasarkan hasil analisis regresi nilai thitung 3,285 dan nilai signifikansi t 0,002 < 0,05, maka Ha Ada pengaruh positif yang signifikan gaya kepemimpinan suportif General Manager terhadap semangat kerja karyawan pada Hotel Sahid Montana Malang. (3) Berdasarkan hasil analisis regresi nilai thitung 3,447 dan nilai signifikansi t 0,001 < 0,05, maka Ha Ada pengaruh positif yang signifikan gaya kepemimpinan partisipatif General Manager terhadap semangat kerja karyawan pada Hotel Sahid Montana Malang. (4) Berdasarkan hasil analisis regresi nilai Fhitung 12,514 dan nilai signifikansi F 0,000 < 0,05, maka Ha Ada pengaruh positif yang signifikan gaya kepemimpinan General Manager (gaya kepemimpinan direktif, gaya kepemimpinan suportif, dan gaya kepemimpinan partisipatif) secara simultan terhadap semangat kerja karyawan pada Hotel Sahid Montana Malang. Sehubungan dengan hal tersebut, maka disarankan sebaiknya General Manager mempertahankan gaya kepemimpinan partisipatif karena lebih cocok dan sesuai dengan keinginan karyawan, dan melakukan perbaikan terhadap gaya kepemimpinan direktif tentang penghargaan kepada karyawan dan pengawasan mengenai pelaksanaan tugas yang akan dikerjakan,Sedangkan untuk gaya kepemimpinan Supportif tentang suasana kerja, pengarahan karena suasana kerja memberikan pengaruh yang paling besar dalam meningkatkan semangat kerja karyawan.

Analisis kebijakan rekrutmen, seleksi dan penempatan karyawan Frontliner dalam rangka mendapatkan karyawan yang berkompeten (Studi pada Bank Rakyat Indonesia Kantor Wilayah Malang) / Siti Umairoh

 

Kata kunci: Rekrutmen, seleksi, frontliner, penugasan kerja, outsourcing Karyawan frontliner perbankan seperti teller, customer services, penerima telepon dan satpam memiliki peran penting bagi sistem layanan, karena mereka berinterkasi langsung dengan pelanggan. Bank Rakyat Indonesia sebagai micro banking terbesar di Indonesia memiliki perhatian yang besar terhadap kualitas layanan. Sehingga, Bank Rakyat Indonesia perlu untuk memiliki karyawan frontliner yang berkompeten, hal tersebut tidak terlepas dari kebijakan program rekrutmen dan seleksi yang diselenggarakan. Penelitian ini bertujuan untuk mengetahui (1) Bagaimana kebijakan rekrutmen dan seleksi karyawan frontliner yang ada di lingkungan Bank Rakyat Indonesia Kanwil Malang, (2) Efektifitas dari kebijakan rekrutmen dan seleksi karyawan frontliner pada lingkungan Bank Rakyat Indonesia Kanwil Malang, (3) Standar Kompetensi karyawan frontliner Bank Rakyat Indonesia Kanwil Malang, (4) Kebijakan penugasan kerja karyawan frontliner Bank Rakyat Indonesia Kanwil Malang dan efektifitasnya. Jenis penelitian yang digunakan adalah penelitian deskriptif kualitatif dengan pendekatan studi kasus. Teknik pengambilan datanya menggunakan key person yakni supervisor SDM khusus rekrutmen Bank Rakyat Indonesia Kanwil Malang melalui wawancara mendalam. Hasil temuan lapangan menyatakan bahwa dalam memenuhi kebutuhan tenaga kerja karyawan frontliner, Bank Rakyat Indonesia Kanwil Malang menggunakan jasa outsourcing, misalnya PT. Prima Karya Sarana Sejahtera dan PT. Mutual Plus. Namun tidak semua pelaksanaan rekrutmen dan seleksi dilaksanakan oleh vendor, mengingat tes performa dan wawancara akhir ditangani oleh pihak BRI Kanwil malang melalui tim seleksi. Akan tetapi juga ada kebijakan dimana BRI Kantor Cabang juga diperbolehkan untuk merekomendasikan nama untuk dijadikan karyawan frontliner melalui rekrutmen dan seleksi awal setelah mendapat izin dari BRI Kantor Wilayah. Sedangkan untuk mendapatkan karyawan frontliner yang berkompeten, Bank Rakyat Indonesia Kanwil Malang memiliki pedoman standar kompetensi, sedangkan penugasan kerjanya Bank Rakyat Indonesia memiliki kebijakan yang cukup fleksibel dengan memberikan penawaran terlebih dahulu. Berdasarkan hasil analisis dapat disimpulkan bahwa pelaksanaan kebijakan pemenuhan tenaga kerja karyawan frontliner melalui outsourcing telah dilaksanakan dengan baik sesuai dengan ketentuan perundangan yang ditetapkan, akan tetapi Bank Rakyat Indonesia perlu mengkaji ulang tentang posisi teller dalam outsourcing, mengingat teller termasuk dalam jenis pekerjaan yang beresiko tinggi dan secara teori teller merupakan salah satu kegiatan dalam cakupan core business yakni mengumpulkan dana dari masyarakat. Meskipun pada dasarnya teller bukanlah jenis pekerjaan yang terkait dalam pengambilan keputusan dan jenis pekerjaan penunjang.

Pengaruh laba bersih, total arus kas, dan kebijakan dividen terhadap harga saham (Studi pada perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia) / Dwiani Riastuti

 

Kata Kunci: Laba Bersih, Total Arus Kas, Dividen Kas, Harga Saham. Informasi dalam laporan keuangan yang sering dipakai investor untuk menentukan keputusan investasi adalah informasi laba bersih dari laporan laba rugi, laporan arus kas, dan kebijakan dividen. Ketiga variabel tersebut memberikan sinyal kepada investor tentang kondisi perusahaan. Investor menerima sinyal yang baik ketika laba bersih perusahaan meningkat begitu juga dengan arus kas. Selain itu, jika kebijakan perusahaan untuk membagikan dividen tinggi juga merupakan sinyal yang baik bagi investor. Kebijakan dividen perusahaan dalam penelitian ini diproksikan dalam dividen kas. Sinyal yang baik dari perusahaan akan direspon investor dengan baik, maksudnya investor tertarik melakukan investasi pada perusahaan yang bersangkutan dan akan meningkatkan harga saham. Tujuan yang terdapat dalam skripsi ini adalah untuk mengetahui pengaruh laba bersih, total arus kas, dan dividen kas terhadap harga saham. Data yang digunakan adalah data sekunder berupa laporan keuangan. Populasi dalam penelitian ini adalah perusahaan manufaktur yang terdaftar di BEI periode tahun 2008-2010 dengan teknik pengambilan sampel berupa purposive sampling. Hasil penelitian menunjukkan bahwa secara parsial laba bersih, total arus kas, dan dividen kas tidak berpengaruh terhadap harga saham. Hal ini membuktikan bahwa laba bersih, total arus kas, dan dividen kas bukan merupakan informasi yang relevan bagi investor dalam mengambil keputusan investasi. Saran yang diajukan kepada peneliti selanjutnya adalah agar menggunakan sampel yang lebih banyak, menambah variabel yang relevan, tidak hanya dari internal tetapi dari eksternal seperti inflasi, tingkat suku bunga, dan kondisi politik, serta memperpanjang periode pengamatan.

Hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa di Sekolah Menengah Atas (SMA) Negeri 2 Batu / Dwi Yogo Heri Pamuji Utomo

 

Kata Kunci: Ketersediaan sumber belajar, motivasi belajar siswa Keberadaan sumber belajar di lembaga pendidikan adalah suatu keharusan, karena pendidikan tidak mungkin dapat terselenggara dengan baik bilamana para tenaga kependidikan maupun peserta didik tidak ditunjang dengan sumber belajar yang diperlukan untuk menyelenggarakan kegiatan pembelajaran yang bersangkutan. Dengan tersedianya sumber belajar yang lengkap diharapkan dapat membantu meningkatkan efektifitas dan efisiensi proses belajar-mengajar, semakin lengkap dan beragamnya sumber belajar yang tersedia, semakin besar jumlah siswa yang dapat dilayani kebutuhannya serta memudahkan siswa dalam berinteraksi dengan sumber belajar yang sesuai dengan minat dan kemampuanya sehingga akan menimbulkan motivasi untuk belajar. Rumusan masalah dalam penelitian ini, yaitu: (1) Seberapa cukup tingkat ketersediaan sumber belajar di SMA Negeri 2 Batu, (2) Seberapa tinggi tingkat motivasi belajar siswa di SMA Negeri 2 Batu, (3) Seberapa besar tingkat hubungan ketersediaan sumber belajar dan motivasi belajar siswa di SMA Negeri 2 Batu. Tujuan penelitian ini, yaitu: (1) Untuk mengetahui kecukupan sumber belajar di SMA Negeri 2 Batu, (2) Untuk mengetahui tingkat motivasi belajar siswa di SMA Negeri 2 Batu, (3) Untuk mengetahui hubungan ketersediaan sumber belajar terhadap motivasi belajar siswa di SMA Negeri 2 Batu. Rancangan penelitian digunakan sebagai dasar dari suatu penelitian yang akan dilaksanakan. Berdasarkan permasalahan yang diteliti, maka penelitian ini termasuk ke dalam jenis penelitian descriptive correlational. Jenis penelitian ini digunakan karena penelitian ini bertujuan untuk menemukan ada-tidaknya hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa. Penelitian ini dilakukan di SMA Negeri 02 Batu dengan populasi berjumlah 666 siswa dengan jumlah sampel 249 siswa. Teknik pengambilan sampel yang digunakan dalam penelitian adalah proportional random sampling. Teknik pengumpulan data dalam penelitian menggunakan instrumen angket, teknik analisis data yang digunakan adalah analisis deskriptif dan analisis korelasi. Berdasarkan hasil penelitian dapat disimpulkan, bahwa (1) Kondisi ketersediaan sumber belajar di SMA Negeri 2 Batu termasuk dalam kualifikasi tersedia, (2) Tingkat motivasi belajar siswa SMA Negeri 2 Batu termasuk dalam kualifikasi Tinggi, (3) Adanya hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa di SMA Negeri 2 Batu. Berdasarkan kesimpulan, dapat disarankan kepada (1) Kepala Dinas Pendidikan Kota Batu, dengan adanya hubungan antara ketersediaan sumber belajar dan motivasi belajar, hendaknya Dinas Pendidikan kota Batu dengan adanya penelitian ini dapat digunakan sebagai tolak ukur ketersediaan sarana dan prasarana belajar yang ada di sekolah di Kota Batu agar lebih meningkatkan motivasi belajar siswa, (2) Kepala SMA Negeri 2 Batu, dengan adanya hubungan antara ketersediaan sumber belajar dan motivasi belajar siswa, hendaknya selalu berusaha untuk tetap memperhatikan dan meningkatkan ketersediaan sumber belajar, karena dengan tersedianya sumber belajar sekolah, maka akan meningkatkan motivasi belajar siswa, (3) Guru SMA Negeri 2 Batu, mengupayakan kegiatan pembelajaran yang memotivasi siswa agar memanfaatkan sumber belajar yang tersedia di sekolah maupun luar sekolah sehingga diharapkan dapat membantu secara optimal keberhasilan belajar siswa dalam melaksanakan pembelajaran, dan proses belajar-mengajar dapat berjalan dengan lancar dan tujuan pembelajaran yang ditetapkan sebelumnya dapat tercapai, (4) Siswa SMA Negeri 2 Batu, hendaknya dapat memanfaatkan semua sumber belajar yang tersedia dengan efektif dan efisien agar lebih termotivasi dalam membantu kegiatan belajarnya.

Penerapan pembelajaran Problem Based Instruction dengan teknik Two Stay Two Stray untuk meningkatkan kemampuan komunikasi dan prestasi belajar fisika siswa kelas VIIIC SMP Negeri 1 Talun Blitar / Ani Nur'aini

 

Kata Kunci: Pembelajaran Problem Based Instruction (PBI), Two Stay Two Stray (TSTS), Kemampuan komunikasi, prestasi belajar Salah satu tujuan mata pelajaran IPA jenjang SMP/MTs adalah melakukan inkuiri ilmiah untuk menumbuhkan kemampuan berkomunikasi. Dari hasil observasi awal di SMP Negeri 1Talun Blitar kemampuan komunikasi siswa kurang maksimal. Hal ini ditandai dengan kurangnya kemampuan siswa untuk mengungkapkan pendapat, membaca hasil pengamatan dan menyimpulkan pembelajaran. Hasil ulangan harian siswa menunjukkan nilai rata-rata kelas masih rendah. Hal ini menandai prestasi belajar siswa juga masih rendah. Penelitian ini bertujuan untuk meningkatkan kemampuan komunikasi dan prestasi belajar siswa melalui pembelajaran Problem Based Instruction (PBI) dengan teknik Two Stay Two Stray (TSTS). Data yang dikumpulkan adalah pelaksanaan pembelajaran PBI dengan teknik TSTS dan kemampuan komunikasi yang diukur menggunakan instrumen lembar observasi, serta prestasi belajar diukur dengan tes. Selain itu didukung dengan instrumen lain seperti wawancara, dokumentasi dan catatan lapangan. Rancangan penelitian yang digunakan adalah penelitian tindakan kelas (PTK). Melalui PTK ini dilaksanakan pembelajaran PBI dengan teknik TSTS. Dengan tahapan PBI yang dipadu dengan teknik TSTS, siswa dapat mengembangkan kemampuan komunikasi dalam kegiatan pembelajaran. Hal ini penting mengingat tidak semua siswa dapat mengembangkan kemampuan komunikasi yang merupakan aspek dari kecakapan hidup. Dalam penelitian ini, peneliti berkolaborasi dengan guru merencanakan tindakan pembelajaran yang berlangsung selama 2 siklus. Hasil penelitian menunjukan bahwa terjadi peningkatan kemampuan komunikasi dan prestasi siswa kelas VIII C SMP Negeri 1 Talun Blitar dari siklus 1 ke siklus 2. Yaitu ditunjukkan dari peningkatan pelaksanaan Pembelajaran PBI dengan teknik TSTS yakni 71,8% pada siklus 1 meningkat menjadi 85,6% pada siklus 2. Kemampuan komunikasi rata-rata siswa meningkat dari 58,2% pada siklus 1 menjadi 80,2% pada siklus 2. Prestasi belajar siswa juga mengalami peningkatan dilihat dari nilai rata-rata ujian siswa yang meningkat dari 72,4 pada siklus 1 dengan ketuntasan 66,7% menjadi 82,25 dengan ketuntasan belajar 87,5% pada siklus 2. Berdasarkan hasil penelitian dapat disimpulkan bahwa pembelajaran PBI dengan teknik TSTS dapat meningkatkan kemampuan komunikasi dan prestasi belajar siswa kelas VIII C SMP Negeri 1 Talun Kabupaten Blitar.

Pengaruh Cash, Insider Ownership, dan Long Term Liability terhadap Capital Expenditure (Studi empiris pada perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2008-2010) / Elia Triyunisanti

 

Kata kunci : cash, insider ownership, long term liability, capital expenditure, pecking order theory, agency theory. Capital expenditure adalah salah satu bagian dari investasi yang sangat penting dalam perusahaan. Capital expenditure biasanya dikaitkan dengan kinerja perusahaan, karena diharapkan semakin tinggi capital expenditure maka semakin baik pula kinerja keuangan perusahaan tersebut. Dana yang diperlukan untuk capital expenditure berasal dari berbagai sumber baik internal maupun eksternal. Alternatif pembiayaan internal adalah penggunaan saldo laba perusahaan dan penyusutan, sedangkan alternatif pembiayaan eksternal adalah melalui hutang dan melalui penerbitan saham. Penelitian ini merupakan jenis penelitian eksplanasi karena disesuaikan dengan rumusan hipotesis yang menduga bahwa cash, insider ownership, dan long term liability berpengaruh terhadap capital expenditure. Data yang digunakan dalam penelitian ini adalah data kuantitatif yang didapat dari data sekunder berupa jumlah ketersediaan kas, kepemilikan manajerial, hutang jangka panjang dan jumlah pengeluaran modal suatu perusahaan. Populasi dalam penelitian ini adalah seluruh perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2008-2010. Dari populasi tersebut kemudian digunakan metode purposive sampling agar kualifikasi sampel sesuai dengan kriteria yang dibutuhkan dalam penelitian. Hasilnya terdapat 54 perusahaan yang dijadikan sampel dalam penelitian ini. Penelitian ini menggunakan analisis regresi linier berganda dengan pengujian hipotesis secara parsial dan simultan. Hasil penelitian ini menunjukkan bahwa terdapat pengaruh antara variabel cash, insider ownership, dan long term liability terhadap capital expenditure, baik secara parsial maupun simultan. Hal ini berarti bahwa cash, insider ownership, dan long term liability memiliki pengaruh dalam pengambilan keputusan terkait capital expenditure pada perusahaan manufaktur yang listing di BEI periode 2008-2010. Berdasarkan hasil penelitian, disarankan agar penelitian selanjutnya menggunakan variabel lain yang dapat mempengaruhi capital expenditure, misalnya free cash flow dan saldo laba. Selain itu juga menggunakan data terbaru yaitu data pada tahun 2011 dan tahuntahun berikutnya. Dalam melakukan pengukuran capital expenditure hendaknya tidak hanya berdasarkan pada nilai buku aset tetap awal dan akhir periode tetapi juga memperhatikan ada tidaknya pelepasan aset tetap selama satu periode tersebut.

Bentuk penerapan pertanggungjawaban sosial perusahaan pada PT. PG Rajawali I Unit PG. Krebet Baru Bululawang Malang / Semi Rahayu

 

Kata Kunci: Tanggung Jawab Sosial Perusahaan (CSR), Bentuk penerapan tanggung jawab sosial perusahaan merupakan wujud peduli perusahaan terhadap lingkungan sosial perusahaan. lingkungan perusahaan adalah pihak terlibat atau terkena dampak secara langsung dari proses produksi perusahaan, sehingga perusahaan harus bertanggungjawab atas dampak yang telah ditimbulkan dari hasil produksinya. Penerapan tanggung jawab sosial perusahaan yang baik akan meningkatkan citra perusahaan menjadi lebih baik, dan sebagai wujud peduli perusahaan terhadap lingkungan. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui bentuk penerapan pertanggungjawaban sosial perusahaan pada PT. PG. Rajawali I Unit PG. Krebet Baru Bululawang Malang. Penelitian ini termasuk penelitian deskriptif analitif. Data penelitian yang diperoleh berupa penjelasan dari bentuk tanggung jawab sosial yang diterapkan atau dilakukan oleh perusahaan yang diperoleh dari wawancara dan observasi. Kegiatan analitis data yaitu dengan membandingkan antara teori dengan kenyataan faktual yang ada didalam perusahaan, selanjutnya dicari kelebihan dan kekurangan dari bentuk penerapan pertanggungjawaban sosial yang diterapkan oleh perusahaan. Hasil penelitian menunjukkan bentuk penerapan tanggung jawab sosial perusahaan sudah sesuai dengan ketentuan atau undang-undang yang berlaku. Hanya saja perusahaan belum menetapkan standar yang baku untuk proses pencatatan akuntansi tanggung jawab sosial dan pelaporan pertanggungjawaban sosial perusahaan. Perusahaan hanya menyediakan rincian anggaran biaya sosial setiap tahunnya yang kemudian pada akhir periode akan dibuat daftar pengeluaran untuk kegiatan-kegiatan sosial perusahaan sebagai realisasi dari anggaran biaya sosial perusahaan. Disarankan bagi perusahaan agar disusun pedoman atau peraturan mengenai pencatatan akuntansi pertanggungjawaban sosial perusahaan beserta bentuk laporan pertanggungjawaban sosial perusahaan yang dimulai dari dibentuknya dana awal sampai dengan dikeluarkan dana sosial tersebut oleh perusahaan, sehingga diperoleh laporan pertanggungjawaban sosial perusahaan tersendiri yang sesuai dengan standar yang berlaku secara transparan. Dengan adanya laporan tanggung jawab sosial perusahaan dapat meningkatkan citra perusahaan yang lebih baik.

Perancangan buku bergambar "Geng Ijo" tentang upaya pelestarian lingkungan di sekolah dasar dan media promosinya / Nur Farida Agustina

 

Kata kunci : perancangan, buku bergambar, lingkungan , anak, alam Lingkungan yang hijau merupakan aset bangsa dan juga sebagai aset negara yang tak ternilai harganya. Lingkungan yang hijau dan bersih dapat membuat alam terjaga kelestariannya. Namun, seiring perkembangan jaman dan teknologi yang pesat ini, banyak masyarakat yang masih belum paham pentingnya melestarikan lingkungan. Untuk itu pengenalan dan pemahaman tentang pelestarian lingkungan merupakan hal yang penting bagi masyarakat, tidak terkecuali anak-anak yang nanti akan menjadi generasi penerus di masa depan. Dengan mengenalkan cara melestarikan lingkungan sejak dini merupakan suatu tahap awal untuk membangkitkan kesadaran anak-anak. Pemahaman ini diharapkan akan membuat anak-anak bisa menerapkan teknik pelestarian lingkungan baik di sekolah dan sekitarnya. Untuk menjawab semua permasalahan di atas, maka diperlukan sebuah media yang ditujukan untuk anak-anak. Perancangan buku bergambar ini dibuat dengan tujuan agar anak-anak di Sekolah Dasar mendapatkan informasi tentang upaya pelestarian lingkungan di Sekolah. Selain itu juga bertujuan untuk membuat buku gambar dengan gaya visual yang menarik, sehingga menumbuhkan minat anak-anak untuk membaca. Perancangan ini menggunakan model perancangan prosedural yaitu model yang bersifat deskriptif, dan menggariskan langkah-langkah yang harus diikuti untuk menghasilkan produk. Metode Analisis yang digunakan adalah analisis deskriptif yang didasarkan pada penelitian deskriptif. Penelitian deskriptif adalah suatu bentuk penelitian yang ditujukan untuk mendeskripsikan fenomena-fenomena yang ada. Pengumpulan data dilakukan dengan teknik wawancara dan observasi. Berdasarkan hasil analisis tersebut, diperoleh kesimpulan bahwa anak-anak Sekolah Dasar sangat menyukai buku bergambar dengan tokoh kartun dan permainan visual didalamnya. Sebagian besar dari mereka mengetahui tentang pelestarian lingkungan akan tetapi banyak yang belum melakukan upaya pelestarian lingkungan di sekolahnya. Oleh karena itu, penulis membuat buku bergambar ini sebagai media penyampaian pesan. Buku ini dikemas dalam format warna full colour berisi 28 halaman, bahasa yang mudah dicerna dan gaya visual yang menarik. Disertai juga dengan media pendukung yaitu Pin, X-banner dan stiker.

Strtuctural ambiguity in the Jakarta Post newspaper's headsline news / Silvia Rindika Puspita Andarini

 

Key Words: structural ambiguity, headline news, Jakarta Post Human beings use language as an instrument to communicate with others. There are two types of language that they use, which are spoken language and written language. In written language, the written documents are used to deliver the messages to the readers. There are many sentences in written documents that are potentially structurally ambiguous so that the readers sometimes get confused in determining the meaning. Therefore, the writer conducts this study to investigate types of structurally ambiguous phrases that cause sentences in the Headline news of the Jakarta Post Newspaper become potentially structurally ambiguous and how those structurally ambiguous phrases are resolved. This research uses the qualitative-descriptive design since this research is conducted to describe the structurally ambiguous phrases. As her data, the writer collects the articles in the Headline news of the Jakarta Post newspaper for a month from October 1st, 2011 to October 31st, 2011. In analyzing the data, the writer uses tree diagram. Through the findings, the writer finds 19 phrases in 16 articles that cause the sentences are potentially structurally ambiguous. Out of those structural ambiguous sentences, there are two types of structurally ambiguous phrases that occur in the Headline news of the Jakarta Post newspaper, which are Noun Phrase (NP) and Prepositional Phrase (PP). The sentences in the Headlines of the Jakarta Post can be potentially structurally ambiguous if they are observed separately from the context. In order to understand the correct meaning of the structurally ambiguous phrases and sentences, we should put them into the context of the sentences. However, there are some ways that can be used to resolve the structurally ambiguous phrases and sentences. They are adding the hyphen (-) or the preposition (of) between the head and modifier, adding the word (which is) or (which are), and (who is) or (who are) to show about something that is being talked about, and placing the preposition phrase at the beginning of the sentence in terms to explain where the action took place. Based on the findings, some suggestions are addressed to readers, students and lecturers of linguistics, and further researcher. Readers can use the findings of this study to understand more about structural ambiguity in terms of how they can determine the phrase and sentence which is structurally ambiguous, and how they clarify this structurally ambiguous phrase and sentence. Besides, students and lecturers of linguistics may be encouraged to take the structural ambiguity as the subject of their studies. The structural ambiguity is one of the interesting phenomena that is very important to research, because we often find phrases and sentences that are potentially structurally ambiguous everyday through speech and written documents. Finally, the writer suggests that further researchers do more detailed study of structural ambiguity. Besides, the further researchers can use this present study as a reference and comparison.

Alat pemantau suhu travo PLN berbasis mikrokontroler Atmega 8535 / Tri Septian Wijanarko

 

Kata Kunci: Trafo PLN, Speaker, Hand Phone, Sensor Suhu, ATMega8535 Trafo PLN salah satu unsur dalam kelistrikan yang memiliki peranan sangat penting dalam pendistribusian listrik ke rumah masyarakat. Selama ini untuk memeriksa keadaan trafo PLN dilakukan dengan cara manual dan untuk melakukan pemeriksaan semua trafo PLN tidak cukup satu hari. Mengingat pentingya trafo PLN bagi masyarakat, maka dibuat alat pemantau suhu trafo bebasis mikrokontroler. Alat pemantau suhu trafo PLN ini berfungsi untuk mempermudah petugas PLN untuk memantau trafo PLN dan supaya trafo PLN tetap dalam keadaan baik. Suhu maksimal trafo PLN adalah 40°C. Apabila trafo PLN sudah mencapai suhu 40°C, dan kejadian itu dibiarkan saja. Suhu trafo akan terus naik, dan trafo PLN bisa meledak. Alat pemantau suhu trafo berbasis mikrokontroler ini menggunakan komponen-komponen yang meliputi sensor suhu, mikrokontroler ATMega 8535, LCD M1632, Handphone, DTMF MT8870DE, IC Suara ISD1820, IC Audio TBA820M, Speaker. Perancangan pembuatan alat ini dimulai dari sensor suhu sebagai masukan ADC ATMega 8535 kemudian dari ATMega 8535 mengendalikan IC perekam, handphone, dan LCD sebagai tampilan data. Sedangkan DTMF MT8870DE menyambungkan antara handphone dengan IC Suara. Cara kerja dari alat pemantau suhu trafo PLN ini cukup sederhana. Apabila suhu trafo PLN mencapai 40°C, maka alat pemantau suhu trafo PLN akan secara otomatis telpon ke kantor atau nomor tujuan yang sudah diprogram. Berdasarkan hasil pengujian sistem ini diketahui bahwa sistem dapat membaca kondisi suhu pada kisaran 40°C dan secara otomatis menghubungi kantor atau nomor hand phone yang dituju. Jadi sistem dapat digunakan sebagai alat pemantau suhu trafo PLN.

Pengujian pengaruh penggunaan bahan tambah limbah abu sekam terhadap kualitas genteng beton / Faureza Yustyarahmanu

 

Kata Kunci : Uji Genteng Beton, Abu sekam, Home Industry. Genteng beton merupakan produk bahan bangunan dari semen yang digunakan sebagai salah satu alternatif penutup atap. Genteng beton berfungsi sebagai penutup atap bangunan dan melindungi bangunan di bawahnya dari cuaca. Efisiensi dalam pemasangan dan perawatan yang mudah membuat genteng beton lebih banyak diminati. Dewasa ini Seiring berkembangnya produk genteng beton tidak memenuhi standart jadi harus diteliti dan dikembangkan, untuk mendapatkan kualitas yang lebih baik dari pada yang sebelumnya, untuk memberi informasi kepada para pengusaha bagaimanakah kualitas genteng beton yang selama ini diproduksinya. Pengujian ini bersifat perbandingan dan mencari kualitas formula yang terbaik dan bermanfaat, pembuatan benda uji dan sampel diambil dari home industry genteng beton yang berada, di Desa Pojok Kecamatan Ngantru Kabupaten Tulungagung dengan sistem produksi menggunakan manual. Pengambilan limabah abu sekam di Desa Cuiri Kecamatan Kalangbret, dengan menentukan formula tambahan abu sekam yaitu sebesar, 5%, 10%, 15% sebanyak 30 buah, sebagai bahan perbandingan juga diambil 10buah sampel dari home industry yaitu genteng beton jenis garuda. Kemudian sampel dan benda uji dibawa menuju Laboratorium Pengujian Bahan PU Binamarga dan Pengairan Kab. Trenggalek untuk diuji dan diteliti. Tujuan pengujian ini adalah untuk mengetahui kualitas genteng beton dengan bahan tambah limbah abu sekam dan genteng beton produksi home industy, sudah memenuhi Standart yang berlaku Yaitu SNI-03-0096-2007 atau belum, untuk mengetahui bagus tidaknya kualitas genteng beton dengan bahan tambah limbah abu sekam. Pengujian kualitas genteng beton meliputi: uji fisik, ukuran, kerataan, uji beban lentur, penyerapan air dan ketahanan terhadap rembesan (impermeabilitas ). Dari hasil pengujian sifat fisik , uji beban lentur dan penyerapan air sebagian benda uji tidak memenuhi standar yang ditentukan SNI. sementara hasil pengujian genteng beton produksi home industy Kecamatan Ngantru memenuhi standar standar yang ditentukan SNI. Untuk pengujian, beban lentur dari tiga formula yaitu formula 5% dan 10% memenuhi standar kecuali formula 15. begitu juga dengan hasil pengujian penyerapan air yang mempunyai penyerapan air paling tinggi yaitu formula 15% dan formula 10% tidak memenuhi standar SNI. Kecuali formula 5%, untuk pengujian ketahanan terhadap rembesan air tidak ada rembesan sama sekali, pada seluruh benda uji jadi memenuhi standar SNI, genteng beton produksi home ndustri kec. Ngantru dari semua pengujian memenuhi standar SNI-03-0096-2007 .

Analisis prosedur pembiayaan musyarakah mutanaqishah dan penetapan nisbah bagi hasil (Studi kasus pada produk "Pembiayaan Hunian Syariah" PT Bank Muamalat Indonesia Cabang Malang) / Leni Ainiah

 

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 |