Penerapan pembelajaran membaca cepat dalam pelajaran Bahasa Indonesia di kelas VI SDN Sedarum I / oleh Titik Heriyani

 

Dampak pembangunan pangkalan pendaratan ikan terhadap tingkat sosial dan tingkat perekonomian masyarakat di sekitar pantai Desa Tambakrejo Kecamatan Wonotirto Kabupaten Blitar / Pury Primadini Putri

 

Kata Kunci : Dampak, Pembangunan PPI, Tingkat Sosial, Tingkat Perekonomian Pemanfaatan sumber daya alam ( SDA ) dibidang kelautan Desa Tambakrejo, selama ini masih terbilang belum maksimal mengingat fasilitas penunjangnya juga masih dalam tahap pengembangan. Diantaranya adalah sedang dibangunnya pangkalan pendaratan ikan sebagai tempat untuk bersandarnya perahu-perahu nelayan. Pangkalan pendaratan ikan akan sangat mendukung segenap usaha dalam bidang perikanan, termasuk dalam proses modernisasi nelayan tradisional dan untuk meningkatkan taraf hidup dan kesejahteraan nelayan Permasalahan dalam penelitian ini yaitu: Faktor-faktor yang mempengaruhi tingkat sosial dan tingkat perekonomian masyarakat sebelum adanya PPI, bagaimana tingkat sosial dan tingkat perekonomian masyarakat sebelum di bangunnya PPI, bagaimana dampak pembangunan PPI terhadap tingkat sosial dan tingkat perekonomian masyarakat, faktor-faktor yang mempengaruhi tingkat sosial dan tingkat perekonomian setelah adanya pembangunan PPI, dan bagaimana kondisi potensi dan peluang yang ada setelah dibangunnya PPI dengan menggunakan analisis SWOT. Metodologi yang digunakan dalam penelitian ini adalah metode deskriptif dengan melakukan pengumpulan data primer dan sekunder yang meliputi nelayan, pemilik usaha sekitar pantai Desa Tambakrejo, masyarakat di sekitar lokasi dan instansi pemerintah terkait, sedangkan metode analisa yang dipakai adalah analisis kualitatif. Sedangkan untuk mengetahui kondisi potensi dan peluang pantai desa tambakrejo menggunakan analisis SWOT. Hasil yang diperoleh dari penelitian ini menunjukkan bahwa pembangunan PPI mempunyai dampak dalam meningkatkan kesejahteraan sosial dan pertumbuhan ekonomi masyarakat lokal di Kabupaten Blitar. Dalam upaya mengembangkan potensi dan peluang dengan menggunakan analisis SWOT didapatkan tindakan intensifikasi dan ekstensisfikasi. Tindakan intensifikasi yaitu 1) peningkatan kesempatan kerja dan berusaha, 2) memaksimalkan fasilitas pendukung, 3) meningkatkan kualitas sumber daya manusia. Sedangkan tindakan ekstensifikasi yaitu 1) perlu perhatian lebih dari pemerintah dalam upaya pengembangan perikanan, 2) peningkatan kelembagaan.

Pengaruh minat pada profesi guru akuntansi dan motivasi belajar terhadap prestasi belajar mahasiswa Program Studi Pendidikan Akuntansi Fakultas Ekonomi Universitas Negeri Malang / Aprilia Ratna Widuri

 

ABSTRAK Widuri, Aprilia Ratna Widuri. 2009. Pengaruh Minat pada Profesi Guru Akuntansi dan Motivasi Belajar terhadap Prestasi Belajar Mahasiswa Program Studi Pendidikan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Skripsi, Jurusan Akuntansi, Program Studi Pendidikan Akuntansi Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (1) Drs. H. Sumadi, S.E., M.M (2) Dr. H. Tuhardjo, S.E., M.Si. Ak Kata Kunci: Minat pada Profesi Guru Akuntansi, Motivasi Belajar, Prestasi Belajar Minat pada Profesi Guru Akuntansi adalah suatu ketertarikan atau perhatian yang timbul tanpa adanya paksaan, yang muncul dari dalam hati nurani seseorang dalam bentuk perhatian khusus atau perasaan senang terhadap Profesi Guru Akuntansi yang diikuti dengan kemauan/keinginan untuk lebih tahu dan lebih banyak belajar untuk mencapai apa yang diinginkan. Dengan adanya minat yang tingi pada profesi Guru Akuntansi, maka akan dapat mendorong mahasiswa untuk termotivasi dalam setiap belajarnya, guna peningkatan dan pencapaian prestasi belajar yang lebih baik. Penelitian ini bertujuan untuk mengetahui: (1)Pengaruh Minat pada Profesi Guru Akuntansi terhadap prestasi belajar mahasiswa, (2)Pengaruh motivasi belajar terhadap prestasi belajar mahasiswa (3) Pengaruh Minat pada Profesi Guru Akuntansi dan motivasi belajar terhadap prestasi belajar mahasiswa. Jenis penelitian ini adalah deskriptif korelasional. Dengan metode kuantitatif. Penelitian ini menggunakan teknik analisis deskriptif dan analisis regresi linear berganda. Untuk menguji kelayakan regresi dilakukan uji asumsi klasik dan keseluruhan analisis ini menggunakan bantuan program SPSS Versi 16.00. Teknik pengambilan sampel, Proportional Random Sampling. Berdasarkan penelitian ini dapat disimpulkan: (1) Secara parsial Minat mahasiswa berpengaruh positif yang signifikan terhadap prestasi belajar mahasiswa sebesar 80,5% dengan sig t (0,000) < α (0,05). (2) ) Secara parsial motivasi belajar mahasiswa belajar berpengaruh positif yang signifikan terhadap prestasi belajar sebesar 51,3% dengan sig t (0,000) < α (0,05). (3) Secara simultan dapat disimpulkan bahwa ada pengaruh positif yang signifikan antara minat pada profesi guru akuntansi dan motivasi belajar terhadap prestasi belajar mahasiswa yaitu sebesar 83,05%. Nilai R2 sebesar 75,1%. Sedangkan 24,9% dipengaruhi oleh faktor lain di luar variabel. Berdasarkan kesimpulan di atas disarankan bahwa dalam penelitian ini Minat pada Profesi Guru Akuntansi dan motivasi belajar berpengaruh positif terhadap prestasi belajar mahasiswa. Oleh karena itu para Mahasiswa Program Studi Pendidikan Akuntansi dan seluruh pihak yang terkait dalam peningkatan mutu pembelajaran di Program Studi Pendidikan Akuntansi Universitas Negeri Malang senantiasa berusaha meningkatkan dan menggiatkan pelaksanaan semua faktor yang dapat mendukung peningkatan Minat pada Profesi Guru Akuntansi dan motivasi belajar mahasiswa. Sehingga nantinya akan memberikan peningkatan dalam prestasi belajar mahasiswa

Pengaruh marketing public relations terhadap minat pembelian sepeda motor merek Honda (studi pada PT. Mitra Pinasthika Mustika (MPM) Motor Malang) / Abdi Manaf Al Idrus

 

ABSTRAK Abdi Manaf Al Idrus, 2016, SKRIPSI. Judul : Pengaruh Marketing Public Relations Terhadap Minat Pembelian Sepeda Motor Merek Honda (Studi Pada PT. Mitra Pinasthika Mulia (MPM) Motor Malang. Pembimbing: Dr. H. Suharto SM., MPd., MM dan Dr. Titis Shinta Dhewi, S.P., MM Kata Kunci: Marketing Public Relations, Minat Pembelian Dengan semakin berkembangnya dunia pemasaran dalam berusaha, maka perlu diupayakan strategi yang inovatif bagi suatu perusahaan. PT. Mitra Pinasthika Mulia (MPM) Motor Malang yang merupakan perusahaan yang bergerak dalam sektor penjualan Sepeda Motor Merek Honda di kota Malang harus mampu memposisikan diri dan bersaing dengan perusahaan-perusahaan Sepeda Motor lainnya untuk itu penerapan strategi Marketing Public Relations harus terus diupayakan untuk memberikan pengaruh positif bagi perusahaan dalam meningkatkan Minat Pembelian produknya. Penelitian ini ingin mengetahui apakahMarketing Public Relations (X) yang meliputiPublikasi (X1), Event (X2), Sponsorship (X3), dan Media identitas (X.4)secaraparsial dan simultanberpengaruhpositifdansignifikanterhadap Minat PembelianSepeda Motor Merek Honda (Y) pada PT. MitraPinasthikaMulia (MPM) Motor Malang. Penelitian ini merupakan penelitian Kuantitatif dengan pendekatan explanatory (menjelaskan) yaitu mengidentifikasi pengaruh dimensi Marketing Public Relations terhadap Minat Pembelian Sepeda Motor Merek Honda Pada PT. Mitra Pinasthika Mulia (MPM) Motor Malang. Teknik pengambilan sampel dalam penelitian ini menggunakan purposive sampling yaitu penentuan sampel dengan pertimbangan tertentu (bertujuan). Teknik pengumpulan data dalam penelitian ini menggunakan teknik observasi, angket dan dokumentasi. Untuk pengujian instrumen menggunakan uji Validitas dan Reliabilitas. Sedangkan model analisanya menggunakan metode Regresi Linier Berganda. Hasil analisis menunjukkan bahwa variabel bebas yang terdiri dari Publikasi, Event, Sponsorship dan Media Identitassecara parsial (uji t) berpengaruh positif dan signifikan terhadap Minat PembelianSepeda Motor Merek Honda pada PT. MitraPinasthikaMulia (MPM) Motor Malang yang ditunjukkan dengan nilai signifikansi yang lebih kecil dari 0,05 (5 %). Sedangkan secara simultan (uji F) menunjukkan bahwa dimensi Publikasi, Event, Sponsorship dan Media Identitas berpengaruh positif dan signifikan terhadap Minat Pembelian Sepeda Motor Merek Honda pada PT. MitraPinasthikaMulia (MPM) Motor Malang yang ditunjukkan dari hasil perhitungan nilai Fhitung sebesar 21.493 (signifikansi F = 0.000) dimana Sig F < 5% (0.000<0.05). Sedangkan dimensi Event (X2) adalah variabel dominan pengaruhnya terhadap Minat Pembelian (Y)yang ditunjukkan dari nilai koefisien β terstandarisasi (Beta) paling besar yaitu 0,279.

Pengaruh periklanan sebagai bentuk komunikasi pemasaran terhadap perilaku konsumen dalam membeli mie sedaap (studi kasus pada masyarakat Kelurahan Bukir Kecamatan Gadingrejo Kota Pasuruan) / Mokhamad Maulidyin

 

ABSTRAK Maulidyin, Mokhamad. Pengaruh Periklanan Sebagai Bentuk Komunikasi Pemasaran Terhadap Perilaku Konsumen dalam Membeli Mie Sedaap (Studi Kasus Pada Masyarakat Kelurahan Bukir Kecamatan Gadingrejo Kota Pasuruan). Skripsi, program Studi Manajemen Pemasaran Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Dr. Budi Eko Soetjipto, M. Ed, M.Si, (II) Titis Shinta Dhewi, S.P., M.M. Kata kunci: Periklanan, Komunikasi Pemasaran, Perilaku Konsumen. Dalam mengembangkan bisnis, produsen berusaha untuk menguasai pasar dan memenangkan persaingan. Hal ini terjadi pada berbagai sektor bisnis, termasuk bisnis makanan khususnya mie instant. Dimana saat ini banyak bermunculan mie instant dengan berbagai merek. Tiap produsen berusaha menonjolkan keunggulan masing-masing dan menciptakan strategi pemasaran yang bias dikembangkan adalah komunikasi pemasaran yaitu upaya untuk mengkomunikasikan produk/pesan kepada public terutama konsumen sasaran mengenai produk yang ada di pasar. Hal ini bias dilakukan dengan periklanan. Periklanan adalah seluruh proses yang meliputi penyiapan, perencanaan, pelaksanaan dan pengawasan terhadap iklan. Tujuan dari penelitian adalah untuk mengetahui pengaruh periklanan sebagai bentuk komunikasi pemasaran terhadap perilaku konsumen dalam membeli Mie Sedaap pada masyarakat Kelurahan Bukir Kecamatan Gadingrejo Kota Pasuruan, baik secara parsial maupun simultan dan variabel mana yang mempunyai pengaruh dominan. Penelitian ini bersifat deskriptif korelasional. Populasi yang diambil adalah masyarakat Kelurahan Bukir Kecamatan Gadingrejo Kota Pasuruan yang terdiri dari 3123 KK. Teknik pengambilan sampel menggunakan area proportional purposive sampling, dengan sampel sebanyak 100 responden. Untuk menguji kelayakan instrumen digunakan uji validitas dan reliabilitas dengan sampel uji coba sebanyak 30 responden. Data diperoleh melalui responden menggunakan kuesioner/angket tertutup dan diukur menggunakan skala Likert dengan skala lima. Sedangkan analisis data menggunakan regresi linear berganda untuk mengetahui pengaruh perikalanan yang meliputi isi pesan, struktur pesan, format pesan, dan sumber pesan terhadap perilaku konsumen baik secara parsial maupun simultan dan untuk mengetahui variabel mana yang mempunyai pengaruh dominan. Hasil penelitian ini adalah sebagai berikut: (1) Isi Pesan mempunyai nilai sig t = 0,002 lebih kecil dari nilai signifikansi (α = 0,05), nilai koefisien regresi isi pesan -0,946: sehingga pada peluang kesalahan 5% isi pesan mempunyai pengaruh negatif signifikan terhadap perilaku konsumen dalam membeli Mie Sedaap, SE 10,11%; (2) Struktur Pesan mempunyai nilai sig t = 0,000 lebih kecil dari nilai signifikansi (α = 0,05), sehingga pada peluang kesalahan 5% struktur pesan mempunyai pengaruh positif signifikan terhadap perilaku konsumen dalam membeli Mie Sedaap, SE 20%; (3) Format Pesan mempunyai nilai sig t = 0,468 lebih besar dari nilai signifikansi (α = 0,05), sehingga pada peluang kesalahan 5% format pesan tidak mempunyai pengaruh positif signifikan terhadap perilaku konsumen dalam membeli Mie Sedaap, SE 0,56%;(4) Sumber Pesan mempunyai nilai sig t = 0,009 lebih kecil dari nilai signifikansi (α = 0,05), sehingga pada peluang kesalahan 5% sumber pesan mempunyai pengaruh positif signifikan terhadap perilaku konsumen dalam membeli Mie Sedaap, SE 7,08%. Dari empat kegiatan periklanan di atas, secara parsial terdapat satu variabel yang tidak berpengaruh tarhadap perilaku konsumen dalam membeli Mie Sedaap yaitu format pesan. Tidak berpengaruhnya format pesan disebabkan sebagian konsumen mempunyai kesibukan/aktivitas sehingga tidak memiliki banyak waktu untuk memperhatikan iklan yang seksama. Isi pesan mempunyai pengaruh yang negatif signifikan terhadap perilaku konsumen dalam membeli Mie Sedaap, sedangkan struktur pesan dan sumber pesan mempunyai pengaruh yang positif signifikan terhadap perilaku konsumen dalam membeli Mie Sedaap. Struktur pesan merupakan unsur yang dominan berpengaruh terhadap perilaku konsumen dalam membeli Mie Sedaap. Secara simultan, keempat kegiatan periklanan ini memiliki pengaruh terhadap perilaku konsumen dalam membeli Mie Sedaap. Selanjutnya saran-saran yang dapat peneliti berikan adalah : (1) bagi Grup Wings (GW) yang merupakan produsen Mie Sedaap dalam beriklan hendaknya lebih memperhatikan struktur pesan. Struktur pesan harus dibuat semenarik mungkin agar dapat menarik perhatian konsumen. Misalnya dengan adanya penonjolan keunggulan dari berbagai segi, seperti adanya varian rasa Mie Sedaap dan adanya rasa yang khas dibandingkan dengan mie yang lain. (2) Untuk penelitian yang selanjutnya, khususnya tentang pengaruh iklan terhadap perilaku konsumen hendaknya menambahkan variabel lain yang akan diteliti untuk mengembangkan penelitian atau menganalisis permasalahan ini dengan menggunakan metode penelitian lainnya.

Representasi kecerdasan emosional dan kecerdasan majemuk tokoh utama anak dalam novel Totto Chan Gadis Cilik di Jendela karya Tetsuko Kuroyanagi dan pemanfaatannya sebagai bahan ajar apresiasi sastra anak bermuatan pendidikan karakter pada jenjang Sekolah Dasar (kajian

 

Jiwandono, Nahnu Robid. 2014. Representasi Kecerdasan Emosional dan Kecerdasan Majemuk Tokoh Utama Anak dalam Novel Totto-chan Gadis Cilik di Jendela Karya Tetsuko Kuroyanagi dan Pemanfaatannya Sebagai Bahan Ajar Apresiasi Sastra Anak Bermuatan Pendidikan Karakter pada Jenjang Sekolah Dasar (Kajian Psikologi Sastra). Tesis. Program Studi Pendidikan Bahasa Indonesia, Pascasarjana Universitas Negeri Malang. Pembimbing: (I) Dr. Mudjianto, M.Pd., (II) Dr. Widodo HS, M.Pd. Kata kunci: kecerdasan emosional, kecerdasan majemuk, psikologi sastra, sastra anak, pendidikan karakter Sastra merupakan hasil karya cipta manusia yang merefleksikan kehidupan manusia dengan menggunakan media bahasa sebagai sarana penyampainya. Sastra memiliki objek kajian yang sangat luas. Salah satu kajian sastra yang berkembang pesat dewasa ini adalah sastra anak. Sastra anak merupakan jenis sastra yang isinya bercerita tentang kehidupan anak dan hal-hal yang sesuai dengan perkembangan psikologi anak. Penelitian ini menggunakan novel anak Totto-chan Gadis Cilik di Jendela karya Tetsuko Kuroyanagi sebagai objek kajian. Alasan pemilihan novel ini untuk dikaji dalam penelitian ini adalah karena novel ini menggambarkan kehidupan seorang anak dengan segala nilai-nilai kehidupan yang sangat baik dan sesuai digunakan untuk pendidikan karakter bagi anak. Tujuan penelitian ini adalah untuk mendeskripsikan: (1) kecerdasan emosional tokoh utama anak dalam novel Totto-chan Gadis cilik di Jendela, (2) kecerdasan majemuk tokoh anak dalam novel Totto-chan Gadis cilik di Jendela, dan (3) potensi novel Totto-chan Gadis cilik di Jendela sebagai bahan ajar apresiasi sastra anak bermuatan pendidikan karakter pada jenjang Sekolah Dasar . Penelitian ini menggunakan pendekatan psikologi untuk membedah sisi psikologis tokoh anak dalam novel. Penelitian ini tergolong dalam penelitian kualitatif karena didasarkan adanya kecocokan antara data yang diteliti, tujuan penelitian, dan karakteristik penelitian kualitatif. Teori psikologi yang digunakan untuk membedah masalah dalam penelitian ini adalah teori kecerdasan emosional milik Reuven Bar-On dan teori kecerdasan majemuk milik Howard Gardner. Kedua teori psikologi tersebut dapat diterapkan untuk membedah sisi psikologis dalam sebuah karya sastra melalui kajian psikologi sastra. Teori kecerdasan emosional lebih memfokuskan pada kemampuan nonkognitif seseorang, yaitu aspek emosi yang dijelaskan secara rinci dan mendetail, sedangkan teori kecerdasan majemuk mencakup kemampuan kognitif dan aspek emosi. Dengan demikian, kedua teori ini dapat digunakan secara bersamaan dan saling melengkapi satu sama lain. Hasil penelitian ini secara umum dijelaskan sebagai berikut. Pertama, representasi kecerdasan emosional tokoh utama anak menunjukkan aspek-aspek kecerdasan emosional yang meliputi: (1) ranah antarpribadi (meliputi: empati, tanggung jawab sosial, hubungan antarpribadi); (2) ranah intrapribadi (meliputi: kesadaran diri emosional, sikap asertif, kemandirian, penghargaan diri,dan aktualiasai diri); (3) ranah pengendalian stres (meliputi: ketahanan menanggung stres dan pengendalian impuls); (4) ranah penyesuaian diri (meliputi: pemecahan masalah, uji realitas, dan sikap fleksibel); dan (5) ranah suasana hati umum (meliputi: optimisme dan kebahagiaan). Tokoh utama anak (Totto-chan) menunjukkan perkembangan yang positif dalam kelima aspek kecerdasan emosional tersebut yang ditandai dengan adanya perilaku, pikiran, dan perkataan tokoh. Tokoh Totto-chan yang berada pada masa kanak-kanak pertengahan (kurang lebih tujuh tahun, tahun-tahun pertama masuk Sekolah Dasar) mengalami perkembangan aspek-aspek kecerdasan emosional yang sesuai dengan usianya. Kedua, representasi kecerdasan majemuk tokoh anak menunjukkan bahwa tokoh-tokoh anak dalam novel memiliki kadar dan komposisi kecerdasan yang unik dan khas. Representasi keceradasan majemuk tersebut meliputi: (1) Tokoh Totto-chan memiliki kelebihan dalam kecerdasan interpersonal yang menonjol yang ditunjukkan dengan kepekaannya memahami perasaan dan pikiran orang lain (Totto-chan juga menunjukkan kecerdasan musikal, kecerdasan linguistik, kecerdasan spasial, kecerdasan kinestetik tubuh, kecerdasan intrapersonal, kecerdasan logis-matematis, kecerdasan naturalis, dan kecerdasan eksisitensial tetapi dengan kadar yang wajar sesuai dengan usianya); (2) Tokoh Takahasi sangat memiliki kelebihan dalam kecerdasan kinstetik tubuh yang ditunjukkan dengan kemampuan mengkoordinasikan gerak tubuhnya dengan baik; (3) Tokoh Tai-chan sangat menonjol pada kecerdasan logis-matematisnya, yang ditandai dengan minatnya yang besar pada pelajaran sains dan kemampuannya berpikir secara logis, (4) Amadera memiliki kecerdasan naturalis yang tinggi yang ditunjukkan kepedulian pada makhluk hidup lain (hewan) dan nalurinya untuk memperhatikan secara detail bentuk-bentuk alami makhluk hidup. Ketiga, novel ini menunjukkan adanya potensi yang dapat dikembangkan sebagai bahan ajar apresiasi sastra anak bermuatan pendidikan karakter. Hal ini ditunjukkan adanya: (1) kesesuaian muatan isi novel dengan perkembangan psikologi anak pada masa kanak-kanak pertengahan dan (2) kesesuaian aspek-aspek kecerdasan emosional-majemuk dengan nilai-nilai karakter yang dapat diterapkan pada pendidikan karakter anak pada jenjang Sekolah Dasar (SD). Berdasarkan hasil penelitian yang telah dipaparkan, dapat disimpulkan hal-hal berikut: (1) Tokoh utama anak (Totto-chan) menunjukkan perkembangan yang positif pada aspek-aspek kecerdasan emosional, (2) Tokoh anak-anak dalam novel menunjukkan kadar dan komposisi kecerdasan majemuk yang unik dan khas, (3) Novel ini dapat dikembangkan sebagai bahan ajar apresiasi sastra anak bermuatan pendidikan karakter pada jenjang Sekolah Dasar.

Penerapan hiasan pleats pada busana avantgarde / Anggraini Ratna Hakim

 

ABSTRAK Hakim, Anggraini Ratna. 2016. Penerapan Hiasan Pleats Pada Busana Avant Garde. Tugas Akhir, Teknologi Industri, Program Studi Diploma III Tata Busana, Fakultas Teknik, Universitas Negeri Malang. Pembimbing (I) Dra. Endang Prahastuti, M.Pd, (II) Nurul Hidayati, S.Pd., M.Sn Kata Kunci : Busana Avantgarde, Hiasan Pleats. Busana Avant Garde menembus batasan konvensional akan kelaziman berbusana dan menciptakan bentuk sendiri yang secara awam dipandang eksentrik, aneh dan pantas dikenakan di panggung peragaan busana. Penulis membuatbusanainiterinspirasidarigear (rodagigi) denganmenggunakanteknikpleats padabusanaavantgarde.Hiasan Pleats diterapkan pada busana dengan menggunakan cara di som pada bagian rok pada busana dress. Pada pembuatan busana ini penulis membuat busana avantgarde yang terdiri dari dress one pieces menggunakan bahan utama santung berwarna silver dan menggunakan bahan faux leatherpada bagian lengan berwarna gold dan hiasan pada bagian dada berwarna hitam dan silver menggunakan teknik menganyam motif poleng. Teknik utama yang digunakan penulis dalam hiasan utama busana avantgardeadalah terdapat pada rok dengan penerapan hiasan pleatsberbahan furing pelez warna silver dan warna abu-abu yang terinspirasi dari bentuk gear atau roda gigi.Pemilihan bahan utama hiasan pleats menggunakan bahan lining yaitu furing pelez memiliki karakteristik yang ringan dan mempunyai tektsur yang berkilau. Dalam pembuatan hiasan pleats membutuhkan bahan yang terkesan berkilau. Penerapan hiasan pleats adalah lipatan yang terdapat pada busana atau suatu teknik melipat secara bolak balik pada bahan yang kemudian di pressing dengan cara dijahit atau disetrika dengan seksama sampai hasil lipatannya berbentuk secara permanen. Simpulan dan saran yang diperoleh dari pembuatan busana ini adalah pada saat pembuatan busana dibutuhkan ketelatenan dan kehati – hatian dalam proses pembuatan hiasan pleats terutama dalam proses pressing .Karena dalam busana ini membentuk lipatan-lipatan yang rapi dan teratur. Oleh karena itu disarankan untuk mengukur setiap lipatan disaat pressing dilakukan. Penyimpanan juga perlu disimpan dengan benar agar tidak merubah hiasan pleats.

Penerapan model pembelajaran team assisted individualization sebagai upaya peningkatan motivasi, aktivitas, dan hasil belajar akuntansi pada siswa di SMK Negeri 1 Magetan / Nova Tri Wulandari

 

Kata kunci: pembelajaran Model Team Assisted Individualization, motivasi, aktivitas, hasil belajar. Upaya meningkatkan kualitas pendidikan dilaksanakan secara terusmenerus. Pemerintah telah melakukan berbagai upaya penyempurnaan dalam sistem pendidikan, salah satunya yaitu penyempurnaan kurikulum. Pada saat ini, pemerintah sedang menerapkan Kurikulum Tingkat Satuan Pendidikan (KTSP). Dalam KTSP, guru dituntut untuk menciptakan suasana belajar yang mampu mengaktifkan siswa dalam proses pembelajaran. Salah satu model pembelajaran yang digunakan untuk mengaktifkan siswa adalah model pembelajaran Team Assisted Individualization (TAI). Dengan pembelajaran TAI, pengajaran secara kelompok dimana terdapat seorang siswa yang lebih mampu berperan sebagai asisten yang bertugas membantu secara individual siswa lain yang kurang mampu dalam satu kelompok. Dalam model pembelajaran ini siswa dapat bekerja sama antar anggota kelompok, saling menyumbangkan pikiran, dan adanya sikap tanggung jawab terhadap pencapaian hasil belajar secara individu maupun kelompok, sehingga nantinya dapat meningkatkan motivasi, aktivitas, dan hasil belajar dalam mata pelajaran akuntansi. Penelitian ini dilaksanakan di SMK Negeri 1 Magetan pada semester genap tahun pelajaran 2011/2012 dengan menggunakan pendekatan kualitatif. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK) yang terdiri dari 2 siklus. Siklus I dengan materi Mencatat Transaksi ke Jurnal Khusus, sedangkan siklus II materi Melakukan Posting ke Buku Besar. Subjek penelitian ini adalah siswa kelas X Ak 3 SMK Negeri 1 Magetan. Analisis data yang digunakan dengan model alir yang meliputi tahap mereduksi data, menyajikan data, verifikasi data atau menarik kesimpulan. Hasil penelitian ini menunjukkan bahwa ada peningkatan di siklus I dan siklus II untuk motivasi, aktivitas, dan hasil belajar siswa. Motivasi siswa diukur dari 3 aspek yaitu aspek ketekunan, minat, dan perhatian. Persentase skor aktivitas belajar secara klasikal dari empat elemen kooperatif yang diamati mengalami peningkatan.Hasil belajar siswa diukur hanya menggunakan 1 aspek yaitu aspek kognitif saja. Berdasarkan hasil penelitian ini dapat disimpulkan bahwa penerapan model pembelajaran Team Assisted Individualization dapat meningkatkan motivasi, aktivitas, dan hasil belajar siswa kelas X Ak 3 SMK Negeri 1 Magetan. Penerapan pembelajaran ini disarankan sebaiknya guru untuk menerapkan model pembelajaran Team Assisted Individualization supaya pembelajarannya lebih bervariasi. Bagi peneliti berikutnya sebaiknya melaksanakan penelitian lebih dari dua siklus dan memadukan model pembelajaran Team Assisted Individualization dengan metode lain.

Keefektifan penerapan andragogi (studi kasus keberlangsungannya di Program Pelatihan "Sekolah Demokrasi" yang dilaksanakan Averroes Community) / Bangun Setiyawan Nugroho

 

Program pelatihan ”Sekolah Demokrasi” adalah program pendidikan luar sekolah yang diselenggarakan melalui jalur pendidikan nonformal dengan bentuk kegiatan pelatihan dan peserta didiknya adalah orang dewasa. Program pelatihan ”Sekolah Demokrasi” dalam kegiatan pendidikannya menggunakan pendekatan tersendiri yaitu dengan pendidikan orang dewasa (andragogi). Program pelatihan ”Sekolah Demokrasi” merupakan program pelatihan demokrasi yang diselenggarakan oleh Komunitas Indonesia untuk Demokrasi (KID) dan didukung oleh Netherlands Institute for Multi-Party Democracy (NIMD). KID menyakini nilai-nilai universal demokrasi seharusnya operasional dalam konteks budaya lokal. Maka dari itu, KID bekerja sama dengan mitra lokal dalam penyelenggaraan program pelatihan ”Sekolah Demokrasi” di lima provinsi yaitu Jawa Timur, Nusa Tenggara Timur, Sulawesi Selatan, Banten dan Sumatera Selatan. Dalam penelitian ini yang menjadi obyek penelitian adalah program pelatihan ”Sekolah Demokrasi” yang diselenggarakan di Jawa Timur oleh KID dengan menunjuk Averroes Community sebagai lembaga pelaksananya. Program pelatihan ”Sekolah Demokrasi” yang diselenggarakan Averroes Community telah terlaksana di Kabupaten Malang dan Kota Batu. Penerapan andragogi dalam program pelatihan ”Sekolah Demokrasi” berdampak pada proses interaksi antar sesama peserta dan antara peserta dengan nara sumber serta fasilitator sebagai demos atau warga masyarakat yang sedang bertransformasi, sehingga proses pembelajarannya menjadi lebih demokratis. Penelitian ini bertujuan untuk mengetahui gambaran penerapan andragogi di program pelatihan ”Sekolah Demokrasi”, mengetahui masalah-masalah yang dihadapi dalam penerapan andragogi di program pelatihan ”Sekolah Demokrasi” dan mengetahui alasan andragogi sebagai faktor pendukung dan faktor penghambat dalam pelaksanaan pembelajaran di program pelatihan ”Sekolah Demokrasi”. Pendekatan penelitian yang digunakan adalah kualitatif dengan jenis penelitian studi kasus. Teknik penggalian data yang digunakan adalah wawancara, observasi dan dokumentasi. Teknik analisis yang digunakan adalah reduksi data, display data, dan mengambil kesimpulan dan verifikasi. Hasil penelitian ini menunjukkan, bahwa penerapan andragogi di program pelatihan “Sekolah Demokrasi” masih kurang efektif karena disebabkan terbatasnya keterlibatan peserta dalam diagnosis kebutuhan belajar; pem-formulasian tujuan; perencanaan dan pengembangan model umum; dan penetapan materi dan teknik pembelajaran. Masalah-masalah yang dihadapi dalam penerapan andragogi di program pelatihan “Sekolah Demokrasi” yaitu tidak ada hukuman bagi peserta yang melanggar kontrak belajar, fasilitator dalam mengembangkan metode belajar kurang variatif, beberapa peserta minat membacanya rendah, adanya konstruksi budaya tua-muda yang masih kental, beberapa narasumber tidak menempatkan sebagai teman belajar, latar belakang sebagian peserta memiliki eksistensi pribadi yang kuat, beberapa peserta belum terbiasa dengan dunia penyampaian ide dan ada permasalahan individu antar peserta. Andragogi sebagai faktor pendukung dalam pelaksanaan pembelajaran di program pelatihan “Sekolah Demokarasi”, karena andragogi merupakan konsep belajar yang tidak hanya berorientasi pada pengetahuan semata, konsep belajar yang mengakomodir pengalaman peserta, memungkinkan pembelajaran yang tidak bernuansa hegemonik, memungkinkan orientasi belajar peserta berbasiskan pada pemecahan permasalah-an demokrasi, membantu terwujudnya pembelajaran yang berbasis komunitas, menstimulus lahirnya budaya kritis transformatif, memungkinkan pembelajaran yang partisipatif, memungkinkan pembelajaran yang tidak saklek dengan rencana belajar, mampu mensinergiskan antara tujuan program dengan motif peserta, berorientasi pada peningkatan kapasitas dan kualitas peranan sosial, dan mampu menjembatani antara teori dengan realitas lapangan. Andragogi sebagai faktor penghambat dalam pelaksanaan pembelajaran di program pelatihan “Sekolah Demokarasi”, karena andragogi berpotensi melahirkan konflik, dapat berhasil jika pesertanya memiliki motif untuk belajar dan berkomitmen, tidak memungkinkan memaksa peserta untuk membaca, belum efektif dalam menghadapi peserta yang heterogen dan tidak dapat diterapkan secara efektif dalam waktu yang singkat. Saran dalam penelitian ini adalah pelaksana program pelatihan dapat mempertimbangkan perubahan nama “Sekolah Demokrasi” menjadi Pelatihan Demokrasi, pelaksana lebih melibatkan peserta dalam diagnosis kebutuhan belajar, pemformulasian tujuan, perencanaan dan pengembangan model umum, dan penetapan materi dan teknik pembelajaran. Selain itu, pelaksana program dalam penerapan andragogi hendaknya lebih tegas, khususnya dalam menjalankan kontrak belajar. Fasilitator hendaknya terus mengembangkan metode-metode pembelajaran dan keterampilan memfasilitasi. Peserta hendaknya mengikuti program pelatihan “Sekolah Demokrasi” dengan lebih bertanggung jawab dan komitmen untuk menjalankan kewajibannya. Peneliti lanjut dapat memper-timbangkan hasil kajian ini dalam mengadakan penelitian yang serupa.

Analisis media promosi MOP-AD di PT. Rajawali Citra Televisi Indonesia (RCTI) / oleh Maria Uri Ismoyowati

 

Implementasi dan perbaikan modul sistem reproduksi dengan model direct instruction buatan guru kelas XI SMA Diponegoro Tumpang Kabupaten Malang / Fidayatul Hanifah

 

Pembelajaran Biologi dengan pendekatan pengajaran langsung (direct instruction) merupakan pembelajaran yang bertujuan untuk membantu siswa mempelajari kemampuan dasar (basic skills) dan pengetahuan yang terstruktur dengan baik (well-structured knowledge) yang diberikan secara bertahap. Modul dapat diartikan sebagai suatu paket pembelajaran yang digunakan untuk membelajarkan siswa melalui instruksi tertulis. Paket modul mempunyai beberapa versi. Paket modul versi Proyek Perintis Sekolah Pembangunan (PPSP) terdiri dari Buku/Lembaran Kegiatan (LKS), Buku/Lembaran Kerja (LK), Kunci Lembaran Kerja (KLK), Lembaran Tes (LT), Lembaran Jawaban Tes (LJT), dan Kunci Lembaran Tes (KLT). Di samping itu modul juga dilengkapi dengan Buku Petunjuk Guru. Di SMA Diponegoro Tumpang Kabupaten Malang telah menyelenggarakan Workshop Penyusunan dan Pengembangan Bahan Ajar Cetak (Modul, Handout, Lembar Kerja Siswa) untuk siswa kelas X dan XI. Modul yang dibuat oleh guru sekolah tersebut belum pernah diimplementasikan dalam pembelajaran di kelas. Oleh karena itu, perlu dilakukan implementasi dan kajian modul buatan guru untuk mengetahui keberadaan komponen-komponen modul dan melakukan perbaikan terhadap kekurangan modul buatan guru. Tujuan dilakukannya penelitian antara lain untuk mengetahui keberadaan komponen modul buatan guru SMA Diponegoro Tumpang. Keberadaan modul meliputi kesesuaian kompetensi dasar dengan standar isi, kesesuaian indikator kompetensi dengan kompetensi dasar, kesesuaian pokok-pokok materi dengan kompetensi dasar, kesesuaian dan keberagaman pustaka yang digunakan, tingkat pertanyaan pada letihan siswa dan tingkat kognitif pertanyaan uji kompetensi. Penelitian ini juga dilakukan untuk memperbaiki modul buatan guru berdasarkan keberadaan komponen modul yang telah diamati, mengetahui hasil belajar dan kesulitan belajar siswa setelah pembelajaran dengan modul buatan guru serta modul perbaikan. Penelitian yang dilakukan merupakan penelitian tindakan kelas (PTK) yang terdiri dari empat langkah yaitu perencanaan, pelaksanaan, observasi dan refleksi tindakan. Penelitian dilaksanakan di SMA Diponegoro Tumpang Kabupaten Malang pada semester genap siswa kelas XI IPA tahun ajaran 2008/2009, dengan jumlah 34 siswa yang terdiri dari 15 siswa putri dan 19 siswa putra. Instrumen yang digunakan meliputi tes/uji kompetensi, lembar observasi keberadaan komponen modul, lembar observasi motivasi dan aktivitas belajar siswa serta catatan lapangan. Hasil penelitian menunjukkan bahwa keberadaan komponen modul sistem reproduksi dengan model direct instruction buatan guru kelas XI SMA i Diponegoro Tumpang Kabupaten Malang perlu dianalisis dan diperbaiki untuk meningkatkan hasil belajar siswa dan mengurangi kesulitan belajar siswa, karena banyak komponen yang kurang dalam modul buatan guru. Komponen modul yang kurang dalam modul buatan guru antara lain belum ada petunjuk penyajian modul untuk guru, indikator kompetensi belum mencakup tiga aspek (kognitif, afektif dan psikomotorik) dan belum ada pengembangan materi dalam bentuk aplikasi. Dalam lembar kerja, pertanyaan hanya berupa pertanyaan literal dan interpretatif, belum sesuai dengan indikator kompetensi serta belum ada tugas yang berupa pengamatan atau percobaan. Soal dalam uji kompetensi hanya berupa soal pilihan ganda dan belum variatif tingkatan kognitifnya. Selain itu, kurangnya gambar yang mendukung pemahaman siswa dalam modul buatan guru. Komponen yang harus ada dalam modul perbaikan antara lain buku petunjuk guru, petunjuk penggunaan modul untuk siswa, lembar kegiatan siswa (LKS), lembar kerja (LK), kunci lembar kerja (KLK), lembar tes (LT), kunci lembar tes (KLT) dan lembar jawaban tes (LJT). Buku petunjuk guru terdiri dari petunjuk penyajian modul yang mencakup kompetensi dasar, indikator kompetensi, garis-garis besar materi, alokasi waktu, prosedur penyajian yang jelas dan mudah dipahami, komponen yang ada dalam modul dan standar ketuntasan belajar minimal yang harus dicapai siswa. LKS berisi uraian materi dan dilengkapi dengan petunjuk penggunaan modul. Pada LK terdapat pertanyaan literal, interpretative dan aplikatif yang disesuaikan dengan indikator kompetensi dala silabus/RPP. Jenis soal dalam uji kompetensi berupa pilihan ganda dan uraian. Tingkat kognitif pertanyaannya dibuat bervariasi dan bertingkat mulai dari pertanyaan mengingat, memahami, menerapkan, menganalisis, menilai dan menciptakan. Hasil penelitian juga menemukan bahwa motivasi belajar siswa pada pembelajaran dengan modul perbaikan meningkat, terlihat dari munculnya aspek ekstensi yaitu siswa menyelesaikan soal latihan di luar jam sekolah sebesar 70,59%. Aktivitas belajar siswa mengalami peningkatan, ditunjukkan dengan peningkatan pertanyaan dan pendapat siswa yang bersifat menerapkan dan menganalisis. Pertanyaan yang bersifat menerapkan meningkat dari 29,79% menjadi 40,00%, pendapat yang bersifat menerapkan juga meningkat dari 8,51 % menjadi 10,00 %. Pertanyaan menganalisis meningkat dari 4,25% menjadi 5,00%, untuk pendapat yang bersifat menganalisis meningkat dari 2,13% menjadi 10,00%. Selain itu, juga muncul pertanyaan mengevaluasi sebesar 5,00% yang sebelumnya tidak muncul pada pembelajaran dengan modul guru. Hasil belajar siswa juga mengalami peningkatan dari tidak ada siswa yang nilainya mencapai SKM menjadi 88,23%. Dengan adanya peningkatan motivasi, aktivitas dan hasil belajar siswa, menunjukkan bahwa perbaikan modul buatan guru dapat mengurangi kesulitan siswa dalam memahami materi pelajaran. Berdasarkan hasil penelitian perlu disarankan (1) Sebelum implementasi modul buatan guru sebaiknya dilakukan validasi ahli, (2) pada penelitian berikutnya perlu diadakan kegiatan praktikum atau penelitian, sehingga dapat mengukur aspek psikomotorik siswa dan melatih tingkat kognitif mencipta pada siswa, (3) pada penelitian berikutnya sebaiknya siswa diminta memberi komentar pada modul baik modul buatan guru maupun modul perbaikan, untuk mengetahui respon siswa terhadap masing-masing modul.

Pengaruh heat input pada pengelasan mag terhadap sifat mekanik sambungan las / Khoirul Anaam

 

Anaam, Khoirul. 2014. Pengaruh Heat Input Pada Pengelasan MAG Terhadap Sifat Mekanik Sambungan Las. Skripsi, Program Studi Pendidikan Teknik Mesin, Jurusan Teknik Mesin, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (I) Drs. H. Suwarno, M.Pd, (II) PrihantoTri hutomo, S.T., M.T. Kata Kunci: Las MAG, Kekerasan, Struktur Mikro, Heat Input     Pengelasan GMAW banyak digunakan dalam dunia industri salah satunya untuk pengelasan baja karbon rendah. Baja karbon rendah banyak digunakan antara lain untuk konstruksi jembatan, rangka kendaraan dan konstruksi bangunan. Heat input yang digunakan dalam pengelasan mempengaruhi kualitas hasil sambungan las. Hal ini akan mempengaruhi struktur akhir yang terbentuk sehingga berpengaruh pada kekerasan hasil pengelasan. Tujuan penelitian ini yaitu untuk mengetahui pengaruh variasi heat input terhadap kekerasan dan struktur mikro sambungan las baja karbon rendah.     Metode penelitian yang digunakan dalam penelitian ini adalah rancangan penelitian eksperimental. Jenis pendekatan yang digunakan dalam penelitian ini adalah penelitian kuantitatif.Teknik analisis data pada penelitian ini adalah dengan membandingkan data hasil kekerasan dan struktur mikro daerah HAZ. Objek penelitian ini adalah baja karbon rendah yang diberi perlakuan yakni pengelasan dengan variasi heat input dan kemudian di uji kekerasan dan struktur mikro. Spesimen yang telah didinginkan kemudian di lakukan uji kekerasan dan dilakukan foto struktur mikro pada daerah HAZ. Hasil kekerasan dan foto struktur mikro kemudian di analisis.     Hasil penelitian diperoleh pengaruh variasi heat input pada pengelasan baja karbon rendah memberikan pengaruh terhadap kekerasan dan struktur mikro sambungan las. Kekerasan rata-rata dengan heat input 1850 J/mm yaitu 91 HRB, dengan heat input 2122 J/mm yaitu 90.8 HRB,dengan heat input 2394 J/mm yaitu 89.5 HRB, dengan heat input 2404 J/mm yaitu 89.4 HRB,dengan heat input 2757 J/mm yaitu 90.1 HRB,dengan heat input 2958 J/mm yaitu 89.3 HRB, dengan heat input 3111 J/mm yaitu 89.2 HRB, dengan heat input 3393 J/mm yaitu 88.9 HRB dan dengan heat input 3828 J/mm yaitu 88.7 HRB. Sedangkan struktur mikro daerah HAZ yang dihasilkan dengan media pendingin udara didominasi oleh ferit dan perlit. Laju pendinginan berpengaruh terhadap hasil kekerasan sambungan las. Semakin cepat laju pendinginan paska pengelasan maka semakin menaikkan kekerasan..

Penggunaan metode penemuan terbimbing dalam pembelajaran matematika pokok bahasa luas kelas VI semester I sekolah dasar Nahdlatul Ulama Kecamatan Bangil Kabupaten Pasuruan tahun ajaran 2004/2005 / oleh Zainul Arifin

 

Pengaruh stres kerja terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan bagian marketing PT. Bank Rakyat Indonesia Kantor Cabang dan Kantor Cabang Pembantu Martadinata Malang) / Gusti Agung Widya Ksamawati

 

ABSTRAK Ksamawati, GustiAgungWidya. PengaruhStresKerjaterhadapKinejaKaryawanmelaluiMotivasiKerja(StudiPadaKaryawanBagian Marketing PT. Bank Rakyat Indonesia Kantor Cabang Dan Kantor CabangPembantuMartadinata Malang). Skripsi. Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang. Pembimbing (I):Dr. Sopiah, M.Pd., M.M.Pembimbing (II):Drs. H. Mohammad Arief, M.Si. Kata Kunci: StresKerja, KinerjaKaryawan, MotivasiKerja Persaingandantuntutanprofesionalitas yang semakintinggimenimbulkanbanyaknyatekanan-tekanan yang harusdihadapiindividudalamlingkungankerja.Dampak yang sangatmerugikandariadanyagangguankecemasan yang seringdialamikaryawandisebutstres.Untukitudibutuhkanmotivasi agar karyawantidakmengalamistres yang berlebihan. Denganmotivasi yang tinggimenyebabkankaryawanbersemangatdalammenjalankantugasdanmemberikanpengaruhterhadapkinerjakeseluruhan.Tujuanpenelitianiniadalahuntukmengetahui: (1) Pengaruhnegatifsecaralangsung yang signifikan stress kerjaterhadapmotivasikerjakaryawanbagianmarketing PT. Bank Rakyat Indonesia Kantor Cabangdan Kantor CabangPembantuMartadinata Malang; (2) Pengaruhpositifsecaralangsung yang signifikanmotivasikerjaterhdapkinerjakaryawanbagianmarketing PT. Bank Rakyat Indonesia Kantor Cabangdan Kantor CabangPembantuMartadinata Malang; (3) pengaruhsecaratidaklangsung yang signifikan stress kerjaterhadapkinerjamelaluimotivasikerjakaryawanbagianmarketing PT. Bank Rakyat Indonesia Kantor Cabangdan Kantor CabangPembantuMartadinata Malang. Penelitianinimenggunakaninstrumenberupakuesionertertutup, wawancara, sertaobservasi. Populasidalampenelitianiniadalahkaryawanbagianmarketing. Sampeldalampenelitianiniadalahkaryawanbagianmarketing (45 responden). Analisis data dalampenelitianinimenggunakananalisisjalur (path analysis). Berdasarkanhasilanalisisdiketahuibahwa: (1) Terdapatpengaruhnegatifsecaralangsungdansignifikanstreskerjaterhadapmotivasikerjapadakaryawanbagian Marketing PT. Bank Rakyat Indonesia Kantor Cabangdan Kantor CabangPembantuMartadinata Malang; (2) Terdapatpengaruhsecaralangsungdansignifikanmotivasikerjaterhadapkinerjapadakaryawanbagian Marketing PT. Bank Rakyat Indonesia Kantor Cabangdan Kantor CabangPembantuMartadinata Malang; (3) Terdapatpengaruhsecaratidaklangsungdansignifikanstreskerjaterhadapkinerjamelaluimotivasikerjapadakaryawanbagian Marketing PT. Bank Rakyat Indonesia Kantor Cabangdan Kantor CabangPembantuMartadinata Malang. Berdasarkanhasilpenelitian, penulismenyarankan: (1) Pihakperusahaanhendaknyamemberikanwaktu yang sesuaidengan pekerjaan yang diberikan karyawan agar karyawan tidak mengalami stres atau dikejar deadline.(2) Pihakperusahaandapatmemberikanmasukanataupunmotivasibahwapekerjaan yang sedangdijabatolehkaryawannyasaatinimerupakanpekerjaan yang sangatberhargabaikbagidirinyamaupunperusahaansupayakaryawantidakmudahmengeluhdantermotivasiuntukmeningkatkankinerjanya.

Pengaruh corporate social responsibility disclosure berdasarkan indeks GRI (global reporting initiative) terhadap reaksi investor dengan environmental performance rating sebagai variabel moderasi / Triyas Kumalasari

 

Kata Kunci : Pengungkapan Sosial, Reaksi Investor, Abnormal Return, Enviromental Performance Rating (PROPER) Corporate Social Responsibility (CSR) merupakan suatu bentuk transparansi pengungkapan social atas aktivitas sosial yang dilakukan oleh perusahaan. Pengungkapan CSR yang tepat dan sesuai harapan stakeholder dapat memberikan sinyal goodnews kepada pihak investor sehingga mempengaruhi keputusan investasinya. Apabila informasi (CSR-disclosure) mulai diragukan, maka pihak ketiga yang independen mempunyai fungsi untuk menilai kinerja sosial dan lingkungan perusahaan. Adapun pihak ketiga tersebut adalah Kementrian Negara Lingkungan Hidup menggunakan peringkat dalam PROPER yang merupakan instrumen untuk mengukur tingkat ketaatan perusahaan berdasarkan peraturan yang berlaku. Tujuan dari penelitian ini adalah untuk mengetahui pengaruh pengungkapan sosial terhadap reaksi investor dengan variabel pengukur abnormal return dan variabel moderasi environmental performance rating dalam PROPER sebagai alat pengukurannya. Penentuan sampel menggunakan purposive sampling. Teknik analisis data yang digunakan ada dua yaitu analisis regresi sederhana dan Moderate Regression analysis (MRA) dengan variabel independen adalah pengungkapan CSR, variabel dependen adalah abormal return dan variabel moderasi adalah PROPER. Populasi dalam penelitian ini adalah perusahaan manufaktur yang listing di BEI tahun 2008-2010. Hasil penelitian ini menunjukkan bahwa secara parsial (1) pengaruh pengungkapan CSR indikator kinerja ekonomi berpengaruh signifikan terhadap reaksi investor, (2) pengaruh pengungkapan CSR indikator kinerja lingkungan tidak berpengaruh terhadap reaksi investor, (3) pengaruh pengungkapan CSR indikator kinerja sosial berpengaruh signifikan terhadap reaksi investor, dan secara simultan (4) pengaruh pengungkapan CSR berpengaruh signifikan terhadap reaksi investor, dan (5) pengaruh pengungkapan CSR tidak berpengaruh terhadap reaksi investor dengan menggunakan Enviromental Performance sebagai variabel moderasi. Artinya, para investor sudah mulai menggunakan informasi Corporate Social Responsibility (CSR) sebagai pertimbangan dalam pengambilan keputusan investasinya, dan Enviromental Performance sebagai variabel moderasi tidak mampu memperkuat hubungan Corporate Social Responsibility (CSR) terhadap reaksi investor. Untuk penelitian selanjutnya diharapkan dapat menggunakan grand theory lainnya supaya mendapatkan hasil yang lebih akurat dan berbeda dengan penelitian ini.

Kesantunan honorifik dalam tindak direktif berbahasa Indonesia keluarga terpelajar masyarakat tutur Makassar di Kabupaten Gowa / Syafruddin

 

ABSTRAK Syafruddin, 2010. Kesantunan Honorifik dalam Tindak Direktif Berbahasa Indonesia Keluarga Terpelajar Masyarakat Tutur Makassar di Kabu-paten Gowa. Disertasi Program Studi Pendidikan Bahasa Indonesia, Program Pasca Sarjana Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. H. Abdul Syukur Ibrahim, (II) Prof. Dr. H. Suparno, dan (III) Prof. Dr. H. Dawud, M.Pd. Kata kunci: kesantunan, honorifik, tindak direktif, masyarakat Makassar Kesantunan Honorifik (KH) merupakan bagian integral dari tindak tutur berbahasa Indonesia keluarga terpelajar masyarakat Makassar dalam kehidupan sehari-hari. KH tersebut mempunyai kekhasan atau pola tersendiri karena dipengaruhi norma sosial budaya yang mereka miliki. Kekhasan atau pola kesantunan honorifik tersebut menarik untuk dikaji. Hal itu berguna untuk menambah wawasan teoretis dan praktis tentang kesantunan honorifik dalam penggunaan BI pada keluarga masyarakat Indonesia umumnya dan keluarga terpelajar masyarakat Makassar khususnya. Berdasarkan hal tersebut, penelitian ini dilakukan untuk menjawab masalah sebagai berikut. (1) Bagaimanakah bentuk KH dalam tindak direktif keluarga terpelajar masyarakat Makassar di Kabupaten Gowa? (2) Bagaimanakah fungsi KH dalam tindak direktif keluarga terpelajar masyarakat Makassar di Kabupaten Gowa? (3) Bagaimanakah strategi penyampaian KH dalam tindak direktif keluarga terpelajar masyarakat Makassar di Kabupaten Gowa? Penelitian ini merupakan penelitian kualitatif yang menggunakan ancangan teori pragmatik dengan model kajian etnografi komunikasi untuk menginterpretasi KH sebagai tindak tutur. Data penelitian terdiri atas dua jenis, yaitu: (1) data tuturan dan (2) data catatan lapangan. Data tuturan mengandung bentuk, fungsi, dan strategi penyampaian direktif. Data catatan lapangan meliputi catatan lapangan deskriptif dan catatan lapangan reflektif. Data pertama diperoleh melalui teknik perekaman menggunakan tape recorder (MP4), dan data kedua diperoleh melalui teknik observasi dan wawancara. Data penelitian dianalisis dengan menggunakan model analisis interaktif. Prosedur analisis data menggunakan model tersebut melalui empat tahap, yaitu: (1) pengumpulan data, (2) pereduksian data, (3) penyajian data, dan (4) penyimpulan temuan dan triangulasi. Temuan penelitian ini dikemukakan sebagai berikut. Dalam percakapan dan aktivitas interaksi di rumah, bentuk kesantunan honorifik berbahasa Indonesia dalam tindak direktif keluarga terpelajar masyarakat Makassar tampak dalam tuturan bermodus imperatif, interogatif, dan deklaratif. Dalam hal ini, berbagai tuturan tersebut menggunakan alternatif honorifik berupa istilah kekerabatan, kata ganti, dan nama diri. Bentuk KH tersebut digunakan untuk menyatakan berbagai fungsi tindak direktif sesuai dengan norma sosial yang telah mereka miliki dan berorientasi kepada kesantunan yang berbeda-beda sesuai dinamika perubahan suasana dan komunikasi saat interaksi terjadi. Penggunaan bentuk KH dalam tindak direktif keluarga terpelajar masyarakat Makassar mencerminkan penggunaan BI berdasarkan norma sosial budaya yang berlaku dalam keluarga terpelajar masyarakat Makassar di Kabupaten Gowa. Dalam percakapan dan aktivitas interaksi di rumah, KH dalam tindak direktif keluarga terpelajar masyarakat Makassar secara umum mempunyai fungsi yang meliputi perintah, permintaan, larangan, pemberian nasihat, dan pertanyaan. Berbagai fungsi KH tersebut diwujudkan dengan berbagai modus tuturan yang menggunakan honorifik bervariasi dan memperlihatkan kesantunan berbeda-beda, sejalan dengan perubahan suasana komunikasi saat interaksi tersebut terjadi. Penggunaannya mencerminkan penggunaan BI berdasarkan norma sosial budaya masyarakat Makassar umumnya dan norma sosial budaya yang berlaku dalam keluarga terpelajar masyarakat Makassar khususnya. Dalam percakapan dan aktivitas interaksi di rumah, strategi kesantunan honorifik dalam tindak direktif keluarga terpelajar masyarakat Makassar meliputi: strategi langsung dan tidak langsung dengan berbagai variasi. Strategi KH tersebut diutarakan oleh partisipan tutur dengan berbagai modus tuturan yang menggunakan alternatif honorifik bervariasi untuk mengekspresikan fungsi-fungsi direktif mereka. Penggunaannya berorientasi kepada kesantunan berbeda-beda sesuai dengan perubahan suasana komunikasi saat interaksi terjadi. Penggunaan KH dalam tindak direktif keluarga terpelajar masyarakat Makassar itu mencerminkan penggunaan BI berdasarkan norma sosial budaya masyarakat Makassar umumnya dan norma sosial budaya yang berlaku dalam keluarga masyarakat Makassar khususnya. Berdasarkan temuan tersebut, dapat dirumuskan simpulan sebagai berikut. Pertama, sebagai bagian masyarakat Makassar, keluarga terpelajar masyarakat Makassar mempunyai bentuk kesantunan honorifik yang diwujudkan dengan tuturan dalam berbagai modus dengan menggunakan alternatif honorifik bervariasi. Hal itu digunakan untuk menjalin hubungan sosial sesuai dengan norma sosial budaya yang mereka miliki. Kedua, sebagai bagian masyarakat Makassar, keluarga terpelajar masyarakat Makassar mempunyai fungsi kesantunan honorifik dalam tindak direktif bervariasi yang diekspresikan dengan tuturan berbagai modus dengan menggunakan alternatif honorifik tersendiri sesuai dengan norma sosial budaya yang mereka miliki Ketiga, sebagai bagian masyarakat Makassar, keluarga terpelajar masyarakat Makassar mempunyai strategi kesantunan honorifik dalam tindak direktif yang diwujudkan dengan tuturan dalam berbagai modus menggunakan alternatif honorifik bervariasi untuk mengekspresikan fungsi-fungsi direktif mereka dengan berbagai variasi berdasarkan konteks yang berbeda-beda sesuai dengan norma sosial budaya yang mereka miliki. Hasil penelitian ini mempunyai implikasi teoretis, yaitu dapat memperluas wawasan teori tindak tutur dan sosiolinguistik; dan mempunyai implikasi praktis, yaitu dapat memberikan masukan bagi pengajar berbagai bidang studi umumnya, para perencana, penulis buku pelajaran, dan guru bahasa Indonesia khususnya tentang materi perencanaan dan pembelajaran kemampuan berkomunikasi.

Home and space: tracy beaker's spatial identity construction in the dare game / Irna Fibianti

 

Keywords: spatial identity, place, home, The Dare Game Although space and place used to be neglected in the realm of identity theorization, they are now considered as an integral component in understanding identity. Space is closely related to identity construction. Experts argue that space is social construction while the social itself is being spatially organized. Space and place are differentiated by virtue of their attached meanings. The relations between place and people are considered reciprocal and dynamic. Place identity, as one of the emerging concepts that explores the links between people and place, is defined as one of the dimensions of the self that define one’s identity related to the physical environment. Places are important sources of identity elements because places have symbols that have meaning and significance to people. People use space to forge a sense of attachment. They form positive and negative bonds to places that have been given meanings through interaction. People also use narrative account to develop their spatial identity. For example, when people tell stories about places they imply multiple meanings and associations derived from their experience. Spatial identity, like identity in general, is constructed through difference. Thus, place is also saturated with meanings and ideas of otherness which justify exclusion. The Dare Game demonstrates how identity and place are closely related. Tracy’s strong yearning for a home makes the development of her identity to be constructed around home. The Dare Game illustrates how people construct places while their social life is regulated by spaces. Tracy happens to have three possible places where she can make her home, an abandoned house, her biological mother’s home, and her foster mother’s home. In order to make those places her home, Tracy actively constructs her place identity around them. Tracy has constructed and internalized certain meanings and symbols associated with home, like sense of belonging, safety, and comfort. She seeks and attributes these meanings into those places. Her emotional identification with those places result in place attachment for those places. Her place attachment is not only characterized by positive bonds toward the places, but also by negative bonds which display the complex and ambivalent nature of spatial identity construction. Because home has been a central theme in children’s literature, it is important to compare the portrayals of home in The Dare Game with the image of home in children’s literature in general. It turns out that The Dare Game both challenges and enforces the clichéd image of home. It indicates the complex and fractured nature of cultural products, including children’s literature. The Dare Game enforces the cultural cliché that home is where the family is. However, it also challenges the cliché that biological family is better than adoptive family as Tracy chooses her foster parent over her birth parent. Mostly, the book enforces the romantic cliché of home, such as children’s need and longing for an ideal home where they feel safe and happy, the fatal contradiction of staying and i   leaving home, and the gendered space of home as a place dedicated for women and children.

Aplikasi turunan parsial dalam bidang ekonomi / oleh Dwi Retno Anjar Pratiwi

 

Pengaruh keberadaan perpustakaan dan internet terhadap motivasi belajar mahasiswa (studi pada mahasiswa program studi S1 Pendidikan Akuntansi Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang angkatan 2007-2008) / Mokhammad Habibi Gastawa

 

Perpustakaan merupakan sumber informasi cetak yang di dalamnya mahasiswa dapat melengkapi kebutuhan belajarnya , dengan memanfaatkan perpustakaan maka mahasiswa bi sa mengembangkan pengetahuannya. Selain perpustakaan, mahasiswa juga bisa memenuhi kebutuhan belaja rnya lebih luas melalui internet. Informasi yang luas dan up to date, serta fasilitas komunikasi dengan para ahli di internet menjadi pilihan mahasiswa untuk melengkapi memenuhi kebutuhan belajarnya. Kedua sumber informasi tersebut merupakan fasilitas di lingkungan pendidikan yang menjadi faktor pendukung belajar yang memotivasi belajar mahasiswa secara eksternal. Penelitian ini bertujuan untuk mengetahui pengaruh keberadaan perpustakaan dan internet terhadap motivasi belajar mahasiswa Program Studi S1 Pendidikan Akuntansi Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang baik secara parsial maupun simultan terhadap motivasi belajar mahasiswa yang diukur dengan pemanfaatannya . Penelitian ini termasuk penelitian eksplanasi (explanatory research).. mahasiswa Program Studi S1 Pendidikan Akuntansi Jurusan Akuntansi Fakultas Ekonomi Universitas Negeri Malang angkatan 2007 dan 2008 dan penggunaan sampelnya menggunakan teknik ”proportional stratified random sampling ”. Instrumen dalam penelitian ini menggu nakan angket dan dokumentasi. Sedangkan teknik analisis datanya dengan bantuan program SPSS 13.0 menggunakan Pearson Product Moment untuk uji validitas, Alpha Cronbach untuk uji reliabilitas, dan reg resi berganda untuk mengetahui pengaruh baik secara parsial maupun simultan dari variabel -variabel dalam penelitian ini. Dari hasil analisis data diketahui bahwa: (1) keberadaan perpustakaan terhadap motivasi belajar mahasiswa yang terbukti dari hasil analisis diperoleh nilai t = 4,521 dan signifikan t = 0,000; (2) keberadaan internet terhadap motivasi belajar mahasiswa yang terbukti dari hasil analisis diperoleh nilai t = -2,142 dan signifikan t = 0,036; (3) keberadaan perpustakaan dan internet berpengaruh secara simultan terhadap motivasi belajar mahasiswa yang terbukti dari hasil analisis diperoleh nilai F = 13,472 dan signifikan F = 0,000. Adapun koefisien determinasi variabel bebasnya (R square) adalah sebesar 0,306 atau sebesar 30,6% merupakan kontribusi dari keberadaan perpustakaan (X1) dan internet (X2) terhadap motivasi belajar (Y). Sedangkan sisanya sebesar 69,4% merupakan kemungkinan berubahnya motivasi belajar mahasiswa yang disebabkan oleh variabel lain yang tidak diteliti atau di luar penelitian ini.

Masalah pengajaran IPS bagi guru klas IV SD ( Malang Kota XI Kotamadya Malang ) / Sutardjo

 

Upaya mengatasi permasalahan pembelajaran IPS materi Kemerdekaan Indonesia di kelas VB SDN Oro-oro Dowo Kec. Klojen Kota Malang / Eka Pranurganingrum

 

Pranurganingrum, Eka. 2014. Upaya Mengatasi Permasalahan Pembelajaran IPS Materi Kemerdekaan Indonesia di Kelas Vb SDN Oro-Oro Dowo Kec. Klojen Kota Malang. Skripsi, Jurusan Kependidikan Sekolah dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Dra. Murtiningsih, M.Pd, (II) Dra. Nur Hanifah, M. Pd Kata Kunci: permasalahan pembelajaran IPS, materi Kemerdekaan Indonesia, SD Berdasarkan hasil observasi, pembelajaran IPS materi Kemerdekaan Indonesia yang dilakukan di Kelas Vb SDN Oro-Oro Dowo Kec. Klojen Kota Malang selama ini berlangsung secara klasikal. Guru dalam setiap pembelajaran hanya memanfaatkan buku teks yang ada sebagai media pembelajaran, serta pembelajaran umumnya menggunakan metode ceramah saja. Hal ini menjadikan siswa bosan, tidak tertarik dan tidak fokus pada pelajaran. Selain itu materi IPS terlalu banyak dan menghafal materi, minat baca siswa yang rendah, serta hasil belajar siswa yang rendah. Tujuan penelitian ini yaitu (1) mendeskripsikan permasalahan pembelajaran IPS materi Kemerdekaan Indonesia, (2) mendeskripsikan upaya mengatasi permasalahan pembelajaran IPS materi Kemerdekaan Indonesia. Penelitian ini menggunakan pendekatan Penelitian Kualitatif. Subyek penelitian ini yaitu 26 siswa kelas Vb SDN Oro-Oro Dowo Kec. Klojen Kota Malang. Pengumpulan data dilakukan melalui observasi, wawancara, dokumen, dan triangulasi. Kegiatan analisis data dilakukan dari tahap mereduksi data, penyajian data, dan penarikan kesimpulan dan verivikasi data. Hasil penelitian menunjukkan bahwa 1) permasalahan pembelajaran IPS materi Kemerdekaan Indonesia disebabkan karena kegiatan pembelajaran IPS dilaksanakan secara klasikal. Pembelajaran menggunakan metode ceramah saja. Guru juga hanya memanfaatkan buku teks yang ada. Hal ini berdampak pada hasil belajar siswa Kelas Vb, hanya 9 siswa yang mencapai KKM, 2) upaya mengatasi permasalahan dengan penggunaan model, metode, dan media pembelajaran relevan dengan materi. Hal ini dibuktikan dengan hasil belajar siswa pada pembelajaran model mind mapping yaitu 13 siswa mencapai KKM dengan presentase 50%, pada pembelajaran snowball throwing yaitu 15 siswa mencapai KKM dengan presentase 57,7%, dan pada pembelajaran picture and picture yaitu 16 siswa mencapai KKM dengan presentase 61,5%. Kesimpulan penelitian ini yaitu, 1) permasalahan pembelajaran IPS yaitu tidak adanya penggunaan model, metode dan media pembelajaran, 2) upaya mengatasi permasalahan dengan penggunaan model, metode, dan media pembelajaran relevan dengan materi dapat menciptakan pembelajaran yang optimal. Pembelajaran menggunakan model picture and picture lebih dapat mengefektifkan dan mengefisiensikan pembelajaran berdasarkan siswa tuntas KKM yaitu 16 siswa dengan presentase 61,5%. Saran bagi guru, hendaknya dapat menerapkan model, metode dan media pembelajaran dengan lebih variatif lagi. Saran bagi peneliti selanjutnya, hendaknya dapat mengembangakan penelitian ini lebih lanjut.

Sistem pengendalian peralatan pada proyek pembangunan hotel prasasti Pacitan / Nugroho Widyo Yuwono

 

Analisis penyesuaian tarif PBB dan dampaknya bagi PAD Kota Blitar / Chandra Dewi Kartika Sari

 

Kata Kunci : PBB danPAD Dalam rangka intensifikasi kemampuan keuangan daerah, pemerintah daerah melakukan berbagai kebijakan perpajakan diantaranya dengan menetapkan UU No.28 tahun 2009 tentang pajak daerah dan retribusi daerah. Pemberian kewenangan tersebut diharapkan dapat mendorong pemerintah daerah dalam mengoptimalkan PAD khususnya yang berasal dari pajak sehingga pajak daerah bisa menjadi tulang punggung PAD. Namun kenyataannya pemerintah kota Blitar saat ini belum belum bisa merealisasikan kewenangan yang diberikan oleh pemerintah pusat karena berbagai keterbatasan. Penelitian ini bertujuan untuk mendeskripsikan permasalahan yang ada. Penelitian ini menggunakan metode kuantitatif deskriptif. Populasi dalam penelitian ini di Kota Blitar sedangkan sampel dalam penelitian ini adalah di Kelurahan Kauman Kota Blitar dengan melihat data langsung pada laporan SPPT (Surat PemberitahuanPajak Terutang) tahun 2011. Variabel yang dikaji dalam penelitian ini adalah PBB dan PAD. Adapun metode pengumpulan data yang digunakan adalah metode dokumentasi. Sedangkan metode analisis data yang digunakan adalah metode deskriptif persentase. Hasil penelitian menunjukkan bahwa (1) Pencapaian dalam hal Pajak Bumi dan Bangunan di Kota Blitar mengalami peningkatan setiap tahunnya, secara keseluruhan pencapaian penerimaannya 86% dari 44.791 para wajib pajak. (2) Realisasi harga riil dengan NJOP di lapangan Berbeda dengna apa yang sudah ditetapkan, perumahan non komplek lebih tinggi 74,1% dibandignkan dengan penetapan NJOP, perumahan komplek lebih tinggi 38,09% lebih tinggi dari harga penetapan NJOP, sedangkan Pusat Bisnis dan Pertokoan Harga riil dilapangan lebih tinggi 60,03% dari harga penetapan NJOP. Saran dalam penelitian ini adalah pemerintah daerah hendaknya cepat merealisasikan peraturan UU No. 28 Tahun 2009 tentang peralihan pengaturan dan penerimaan pajak. Sehingga pemerintah daerah mendapatkan tamabahan penerimaan pajak PBB secara utuh 100% dan bisa dialokasikan kembali untuk pembangunan dan kemajuan daerah masing-masing

Studi tentang pengajaran fisika dasar dalam hubungannya dengan keberhasilan belajar mahasiswa untuk beberapa matakuliah khusus program Sarjana Muda Departemen Teknik Mesin dan Departemen Teknik Sipil FKT IKIP Malang / oleh Sutarman

 

Layanan transportasi sekolah dalam meningkatkan disiplin waktu peserta didik di MTs Negeri Kepanjen Malang / Mita Anggeni Arta

 

Arta, Mita Anggeni. 2014. Layanan Transportasi SekolahdalamMeningkatkan Disiplin Waktu Peserta Didik di MTs Negeri Kepanjen. Skripsi, JurusanAdministrasi Pendidikan, Fakultas Ilmu Pendidikan, Universitas NegeriMalang, Pembimbing: (I) Dr. H. Kusmintardjo, M.Pd, (II) Dr. Hj. Maisyaroh, M.Pd. Kata kunci: layanan transportasi sekolah, disiplin waktu, danMTs.     Layanan transportasi sekolah merupakan kegiatan pemberianfasilitas untuk melayani antar jemput peserta didik dengan tujuan memudahkan transportasi dari dan menuju sekolah. Peserta didik akan dapat masuk atau pulang sekolah dengan tepat waktu, sehingga disiplin waktu peserta didik akan meningkat. MTs Negeri Kepanjen merupakan salah satu sekolah di Kepanjen yang memiliki layanan transportasi sekolah. Fokus Penelitian ini mendeskripsikan profil layanan transportasi sekolah, pengelolaan layanan transportasi sekolah, disiplin waktu peserta didik setelah mengikuti layanan transportasi Sekolah, factor pendukung, penghambat, dan upaya mengurangi hambatan dalam pengelolaan layanan transportasi sekolah. Penelitian ini bertujuan untuk mendeskripsikan profil layanan transportasi sekolah, pengelolaan layanan transportasi sekolah, disiplin waktu peserta didik setelah mengikuti layanan transportasi sekolah, factor pendukung, penghambat, dan upaya mengurangi hambatan dalam pengelolaan layanan transportasi sekolah.    Penelitian ini dilakukan dengan pendekatan kualitatif. Pendekatan kualitatif dimaksudkan untuk membuktikan kajian yang mendalam tentang fenomena. Jenis penelitian yang digunakan adalah studi kasus. Kehadiran peneliti di lokasi diketahui oleh seluruh warga MTs Negeri Kepanjen. Peneliti hadir di lokasi penelitian sebanyak 20 kali mulai Tanggal 18 Oktober 2013 sampai dengan2 April 2014.Penelitian ini dilakukan di MTs Negeri Kepanjenyang beralamatkan di Jalan Sukoraharjo No 36 Kepanjen Kabupaten Malang, Jawa Timur.Dalam penelitian ini, peneliti berperan sebagai instrumen kunci, dengan subjek penelitian adalah kepala sekolah, waka humas, waka kesiswaan, pengemudi, orangtua pesertadidik, dan pesertadidik.Teknik pengumpulan data yang digunakan peneliti antaralain wawancara, pengamatan, dandokumentasi. Analisis data dilakukan dengancaramereduksi data merangkum, memilih hal-hal yang pokok,memfokuskan pada hal-hal yang penting, dicari tema dan polanya agar data yangtelah direduksi. Pengecekan keabsahan data dengan trianggulasi,pengecekan anggota, meningkatkan ketekunan, diskusi teman sejawat, kecukupan bahan referensi.Tahap-tahap penelitian ini antara lain pendahuluan, penyusunan proposal, pelaksanaan, danpenyusunanlaporan.     Kesimpulan penelitian ini adalah layanan transportasi MTs Negeri Kepanjen diadakan sejak Tahun 2010 dan saat ini pengguan layanan transportasi sekolah berjumlah 28 peserta didik. Kendaraan yang digunakan berupa mobil Carry dan L300. Tujuan layanan transportasi memberikan layanan transportasi, keamanan, dan meningkatkan disiplin waktu.Perencanaannya dimulai dari pengadaan kendaraan dan pengemudi, memberi informasi kepada masyarakat, mendata peserta didik, menentukan rute, membuat jadwal, menentukan biaya transportasi yang ditentukan pengemudi dan orangtua peserta didik. Penanggung jawablayananini waka humas, pengelola administrasi madrasah, dan Kepala Madrasah. Layanan ini berangkat pukul 05.30 WIB sampai disekolah pukul 06.15 WIB, jam masuk sekolah pukul 06.45 WIB. Untuk menjemput peserta didik 20 menit sebelum jam pulang sekolah kendaraan sudah di sekolah. Evaluasi meliputi aspek evaluasi, teknik evaluasi, serta pihak mengevaluasi dan dievaluasi. Faktor Pendukungnya antara lain kesiapan madrasah, kerjasama yang baik, dan dukungan orang tua peserta didik. Hambatannya tidak tepat waktu membayar layanan transportasi sekolah sedangkan upaya mengurangi hambatan menutupi biaya tersebut menggunakan uang madrasah terlebih dahulu. Setelah mengikuti layanan transportasi sekolah peserta didik selalu tepat waktu berangkat dan pulang sekolah, sertabisa memanfaatkan waktu dengan baik untuk kegiatan belajar di sekolah dan di rumah.     Berdasarkan temuan penelitian maka disarankan kepada: Kepala MTs Negeri Kepanjen, mengevaluasi kenyamanan kendaraan, memperbaiki tata tertib yang berhubungan dengan ketepatan waktu pembayaran, membuat kebijakan sanksi bagi pelanggar tata tertib layanan transportasi sekolah, dan membuat kebijakan pembayaran layanan transportasi sekolah disatukan dengan pembayaran SPP. Pengelola Layanan Transportasi Sekolah, sebaiknya membuat buku presensi khusus peserta didik pengguna layanan transportasi sekolah yang diberikan kepada pengemudi dan membuat kotak pengaduan layanan transportasi sekolah hal ini bertujuan mempermudah mengevaluasi kehadiran peserta didik dan program layanan transportasi. Kepala Kantor Kementerian Agama, dapat membantu meningkatkan layanan transportasi madrasah dengan mengadakan layanan transportasi sekolah gratis guna meningkatkan disiplin waktu peserta didik. Masyarakat, dapat mendukung program layanan trasnportasi sekolah dengan mengikutsertakan putra-putrinya mengikuti layanan transportasi sekolah guna meningkatkan disiplin waktu. Penelitilain, kepada para peneliti lain agar dapat melanjutkan penelitian yang sejenis pada berbagai aspek lain dengan latar yang berbeda yang nantinya dapat bermanfaat untuk diteliti.

Implementasi pembelajaran mata pelajaran prakarya dan kewirahusahaan berdasarkan kurikulum 2013 (studi kasus pada paket keahlian jasa boga SMKN 2 Malang) / Adinda Resharnani Triastuti

 

ABSTRAK Triastuti, AdindaResharnani. 2016. ImplementasiPembelajaran Mata PelajaranPrakaryadanKewirausahaanBerdasarkanKurikulum 2013.Skripsi, JurusanTeknologiIndustri, FakultasTeknik, UniversitasNegeri Malang.Pembimbing: (I) Dr.DwiAgusSudjimat, S.T., M.Pd, (II)LismiAnimatulChisbiyah, S.Pd, M.Pd Kata Kunci:implementasi, kurikulum 2013, prakaryadankewirausahaan Fokuspenelitianiniuntukmengetahui: (1) kebijakansekolah; (2) pelaksanaanpembelajaran; (3) kendaladalampelaksanaanpembelajaran; dan (4) pemecahanmasalahataskendaladalampelaksanaanpembelajaranmatapelajaranPrakaryadanKewirausahaanberdasarkanKurikulum 2013 di SMKN 2 Malang. Penelitianinimenggunakanpendekatandeskriptifkualitatifdenganjenispenelitianstudikasus.Informanpadapenelitianiniadalah guru matapelajaranPrakaryadanKewirausahaan.Teknikpengumpulan data yang digunakanadalahobservasi, wawancara, dandokumentasi.Lokasipenelitianadalah SMKN 2 Malang yang beralamat di Jalan Veteran No. 17 Kota Malang.Pengecekankeabsahantemuandilakukandenganmenggunakantekniktriangulasi. Hasiltemuandaripenelitianini: (1) pemilihanbidangyang dilaksanakanpadalingkupmateridanpembelajaranmatapelajaranPrakaryadanKewirausahaantidaksesuaidengankebijakanpadaDirektoratPembinaanSekolahMenengahKejuruan; (2) perencanaanpembelajarandisusundandilaksanakansesuaipendekatansaintifikpadaKurikulum 2013yang terterapadaPermendikbudNomor 65 Tahun 2013, pembelajaran yang dilaksanakansesuaidenganketentuanpadaPermendikbudNomor 105 Tahun 2014, pelaksanaanpenilaiantidaksesuaidenganPeraturanMenteriPendidikandanKebudayaanRepublik Indonesia Nomor 104 Tahun 2014;(3)kendala yang dialamipadapembelajaranmeliputiketerbatasanwaktubelajar dikelas, pengembanganmaterioleh guru, danpenilaian yang dilaksanakanpadapembelajaran; (4) upaya guru dalammengembangkanmateripembelajaransesuaidenganPeraturanMenteriPendidikandanKebudayaanRepublik Indonesia Nomor 103 Tahun 2014, strategi guru dalammengatasipelaksanaanpenilaianpadakegiatanpraktikumtidaksesuaidenganPeraturanMenteriPendidikandanKebudayaanNomor 104 Tahun 2014. Berdasarkanhasiltemuanpenelitian, makadisarankanuntuksekolahmeningkatkanstrategidalampelaksanaanpembelajaran agar sesuaidenganPeraturanMenteriPendidikandanKebudayaanRepublik Indonesia Nomor 65 Tahun 2013 tentangStandar Proses PendidikanDasardanMenengah, sedangkanuntuk guru diharapkandapatmeningkatkanstrategidalampelaksanaanpenilaian agar sesuaidenganPeraturanMenteriPendidikandanKebudayaanRepublik Indonesia Nomor 66 Tahun 2013 tentangStandarPenilaianPendidikan. BagipenelitiselanjutnyadisarankanuntukmenelitipengembanganjiwakewirausahaanpadapesertadidikdalampembelajaranmatapelajaranPrakaryadanKewirausahaan.

Kesejahteraan pekerja industri batu bata Kecamatan Ponggok Kabupaten Blitar / Mega Candra Putri

 

Kata kunci: kesejahteraan dan pekerja industri batu bata Ponggok merupakan salah satu kecamatan di Kabupaten Blitar yang mempunyai potensi dalam bidang industri. Kondisi geografis sangat mendukung untuk didirikannya industri batu bata karena jenis tanahnya adalah tanah liat atau lempung. Tanah liat mempunyai ukuran partikel tanah yang lebih kecil, sulit diremukkan saat kering, terasa licin, plastis dan konsistensi tanah juga sesuai untuk bahan baku batu bata. Tanah jenis ini sangat sesuai untuk bahan baku batu bata. Sentral industri batu bata terdapat di Desa Kebonduren, Desa Kawedusan, dan Desa Dadaplangu. Dari ketiga daerah sentral industri tersebut, para pekerja industri memiliki tingkat kesejahteraan yang berbeda. Penelitian ini bertujuan untuk mendiskripsikan (1) pekerja industri batu bata di Kecamatan Ponggok Kabupaten Blitar, (2) tingkat kesejahteraan pekerja industri batu bata Kecamatan Ponggok Kabupaten Blitar. Penelitian ini merupakan penelitian deskriptif. Metode penelitian yang digunakan adalah metode survey dengan sampel pekerja industri batu bata yang terdapat di Desa Kebonduren, Desa Kawedusan, dan Desa Dadaplangu. Teknik pengambilan data yang digunakan adalah kuesioner, observasi dan dokumentasi. Teknik analisis data yang digunakan adalah tabulasi tunggal. Hasil penelitian menunjukkan bahwa sebagian besar pekerja merupakan lulusan SD dan SMP, menguasai ketrampilan memproduksi batu bata secara otodidak dan turun temurun, berusia antara 32 – 58 tahun dan sudah bekerja sebagai pengrajin batu bata >4 tahun. Penghasilan yang diperoleh relatif kecil, yaitu antara Rp 210.000 – Rp 560.000 perbulan. Setiap rumah industri menyerap tenaga kerja antara 2 – 5 orang, menggunakan modal usaha pribadi dan pinjaman, dan bahan baku diperoleh dari lahan pribadi dan membeli, proses produksi menggunakan alat-alat dan cara tradisional, seperti proses pembakaran masih menggunakan kayu bakar. Sementara itu, untuk tingkat kesejahteraan pekerja dari ketiga sentral industri di Kecamatan Ponggok Kabupaten Blitar terdapat perbedaan antara Desa Kebonduren, Desa Kawedusan dan Desa Dadaplangu. Kesejahteraan pekerja industri batu bata di Desa Kebonduren tergolong Keluarga Sejahtera (KS) II dan KS III, sedangkan kesejahteraan pekerja di Desa Kawedusan dan Desa Dadaplangu tergolong KS I dan KS II. Hal ini karena terdapat perbedaan kualitas batu bata dan pemasarannya, pekerja industri Desa Kebonduren menggunakan bahan baku tanah liat dengan campuran abu sekam atau menggunakan pasir dan air, hal ini membuat batu bata tidak mudah retak, dan pemasarannya sudah sampai ke luar kota Blitar, dan untuk batu bata produksi Desa Kawedusan dan Desa Dadaplangu kualitasnya belum bagus karena bahan baku tanah liat tidak dibantu dengan bahan penolong yang lain.

Analisis kebijakan hutang, profitabilitas, dan pertumbuhan perusahaan terhadap kebijakan dividen pada perusahaan manufaktur yang listing di Bursa Efek Indonesia (BEI) tahun 2005-2008 / Ayu Yenia Sari

 

ABSTRAK Sari, Ayu Yenia. 2009. Analisis Kebijakan Hutang, Profitabilitas, Dan Pertumbuhan Perusahaan Terhadap Kebijakan Dividen Pada Perusahaan Manufaktur Yang Listing Di Bursa Efek Indonesia (BEI) Tahun 2005-2008. Pembimbing: (I) Ely Siswanto, S.Sos., M.M., (II) Fadia Zen, S.E., M.M. Kata Kunci: Kebijakan Hutang, Profitabilitas, Pertumbuhan Perusahaan, Kebijakan dividen. Kebijakan dividen dalam suatu perusahaan merupakan hal yang kompleks karena melibatkan kepentingan berbagai pihak seperti pemegang saham, manajer, kreditor dan pihak eksternal lain yang memiliki kepentingan terhadap informasi yang dikeluarkan oleh perusahaan. Kebijakan dividen pada dasarnya adalah penentuan besarnya porsi keuntungan yang akan diberikan kepada pemegang saham. Kebijakan keputusan pembayaran dividen merupakan hal penting yang menyangkut apakah arus kas akan dibayarkan kepada investor atau akan ditahan untuk diinvestasikan kembali. Besar kecilnya dividen yang dibayarkan oleh perusahaan kepada pemegang saham tergantung pada kebijakan dividen masing-masing perusahaan. Oleh karena itu pertimbangan manajemen mengenai faktor-faktor yang mempengaruhi kebijakan dividen sangat diperlukan. Penelitian ini untuk mengetahui pengaruh kebijakan hutang, profitabilitas, dan pertumbuhan perusahaan terhadap kebijakan dividen. Rancangan penelitian yang digunakan adalah rancangan penelitian deskriptif kuantitatif dan termasuk dan termasuk panalitian Explanatory Research.Populasi dalam penelitian ini adalah perusahaan manufaktur yang listing di Bursa Efek Indonesia (BEI) tahun 2005 samapai dengan 2008. Pengambilan sampel dilakukan dengan menggunakan teknik purposive sampling di mana teknik penentuan sampelnya dilakukan berdasarkan kriteria-kriteria tertentu yang disesuaikan dengan tujuan penelitian sehingga diperoleh sebanyak 20 perusahaan sebagai sampel. Data yang digunakan adalah data sekunder yang diperoleh dari Bursa Efek Indonesia (BEI) melalui Indonesian Capital Market Directory (ICMD) tahun 2005 sampai dengan 2009. Teknik analisis data yang digunakan dalam penelitian ini adalah teknik analisis regresi berganda. Hasil penelitian ini menunjukkan bahwa deskripsi variabel kebijakan hutang mengalami kondisi yang berfluktuasi cenderung naik, variabelprofitabilitas mengalami kondisi yang berfluktuatif cenderung naik, dan variabel pertumbuhan perusahaan juga mengalami kondisi yang berfluktuasi cenderung naik sedangkan variabel kebijakan dividen mengalami kondisi yang berfluktuasi cenderung stabil. Hasil penelitian ini juga menyatakan pengaruh secara parsial, variabel kebijakan hutang dan pertumbuhan perusahaan perusahaan tidak berpengaruh signifikan, sedangkan variabel profitabilitas berpengaruh positif signifikan terhadap kebijakan dividen, sedangkan pengaruh secara simultan ketiga variabel independen tersebut berpengaruh signifikan terhadap kebijakan dividen. Hal ini menunjukkan bahwa sebelum menetapkan kebjiakan dividen, manajer mempertimbangkan kebijakan hutang, profitabilitas, dan pertumbuhan perusahaan. Dari hasil pene;itian juga menunjukkan bahwa 8,1 % variasi dari kebijakan dividen bias dijelaskan ileh ketiga variabel independennya yaitu kebijakan hutang, profitabilitas, dan pertumbuhan perusahaan sedangkan sisanya 91,9% dijelaskan oleh faktor-faktor lain atau variabel lain di luar penelitian. Berdasarkan hasil penelitian ini disarankan bagi peneliti selanjutnya untuk menambah variabel independen seperti kepemilikan manajerial, ukuran perusahaan dan variabel-variabel lain yang berkaitan dengan dividen. Selain itu disarankan pula untuk mengembangkan sampel yang lebih besar lagi.

Sistem kendali otomatis mesin pencetak dan pengeringan dupa gaharu berbasis smart relay / Ani Yuniarti

 

ABSTRAK Yuniarti, Ani. 2016. SistemKendaliOtomatisPencetakdanPengeringanDupaGaharuBerbasis Smart Relay. TugasAkhir, D3 TeknikELektro, JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: Drs. DwiPrihanto, S.S.T., M.Pd. Kata Kunci: SistemKendali,PencetakdanPengeringan,Smart Relay Peningkatanpermintaandupagaharu di pasaransemakinmeningkatbaik di Indonesia sendirimaupunnegara lain. Sehinggamenyebabkansetiapindustridupaselaluberupayauntukefektifdanefisiendalammenjalankanproduksinya. Salah satunyadenganmelakukanotomatisproduksikarenakelebihandarisistemotomasiadalahmenghemattenagamanusia. Sebagaicontoh, pecetakdanpengeringandupagaharusecaraotomatis. Dalamsistempencetaknyamenggunakanprinsippengepresandanuntukpengeringannyamenggunakanhair dryersebagaipengeringanawal. Denganmemanfaatkantimer yang ada di dalam PLC (programmable logic controller) untukperhitunganwaktukerjaalat. Karenakebutuhansistemkendaliinidigunakanuntukindustrimenengah (home industry)makauntukmenghematbiayaPLC yang digunakanadalahjenissmart relaydengantipe SR2B201JD. Program smart relay yang digunakanadalahladder diagram. Dalamalatinikomponenutama yang digunakansebagaiperintahmasukandanpemicu program adalahtomboltekanStart, Stop, Reload, danLimit Switch.Sedangkanuntukkeluaran yang digunakansebagaiperintahlanjutanbagimasukansmart relayadalah driver relay sebagaipemicukerja motor DC.Pembuatanalatinibertujuanuntukmenghasilkansebuahsistemkendaliotomatispencetakdupa yang berbentukbulatdanpengeringanawaldupa.

Taman peristirahatan terakhir sejarah makam Sentong di Desa Wonorejo, Kecamatan Lawang, tahun 1997-2009 / Arti Utomo

 

Kata kunci: Makam Sentong, Peristirahatan Terakhir, Desa Wonorejo Keragaman etnis di Indonesia turut memberikan pengaruh besar terhadap sejarah Indonesia. Begitu pula dengan etnis Cina yang juga turut menorehkan jejak peninggalan sejarah bagi Indonesia. Terdapat bangunan milik warga Cina di Indonesia khususnya di Kecamatan Lawang menandakan keberadaan warga Cina sejak masa kolonial Belanda. Salah satu bangunan milik warga Cina yaitu bangunan makam. Berdasarkan observasi awal, Desa Wonorejo merupakan bagian dari wilayah Kecamatan Lawang yang memiliki lahan pemakaman Cina terbesar di Kabupaten Malang. Makam Cina pertama muncul pada tahun 1977. Kemudian, muncul makam Sentong Baru dan Sentong Raya di Desa Wonorejo. Desa Wonorejo merupakan desa yang memiliki letak di dataran tinggi (gunung Arjuna), sehingga sangat potensial untuk dibangun sebuah makam bagi warga Cina. Dalam tradisi warga Cina pemakaman jenazah pada lereng gunung dipandang sesuai dengan kepercayaan yang mereka anut, dimana meletakkan sebuah bangunan bersandar pada suatu bukit seperti orang duduk di bangku yang merupakan lambang dari sikap kenyaman dan ketenangan yang menghadap ke arah lebih rendah. Rumusan masalah dari penelitian ini yaitu memaparkan : (1) kondisi umum kecamatan Lawang pada tahun 1977-2009, (2) latar belakang hadirnya Makam Cina Sentong di Desa Wonorejo 1977-2009, dan (3) aspek sosial-budaya pada perkembangan Makam Cina Sentong di Desa Wonorejo mulai tahun 1977-2009. Penelitian ini juga memiliki tujuan yaitu mendeskripsikan : (1) kondisi umum Kabupaten Malang 1977-2009, (2) latar belakang hadirnya Makam Tionghoa Sentong di Desa Wonorejo 1977-2009. (3) aspek sosial-budaya pada perkembangan Makam Cina Sentong di Desa Wonorejo mulai tahun 1977-2009. Penelitian ini menggunakan metode penelitian sejarah dengan meliputi beberapa tahap yaitu, pemilihan topik, pengumpulan sumber (Heuristik), kritik sumber, interpretasi, historiografi. Pengumpulan data dalam penelitian ini diperoleh dari observasi, wawancara, dokumentasi. Penelitian ini dilaksanakan di Desa Wonorejo Kecamatan Lawang khususnya pada tahun 1977 sampai dengan tahun 2009. Berdasarkan hasil penelitian dapat disimpulkan bahwa wilayah Kecamatan Lawang merupakan perbatasan antara Kabupaten Pasuruan dan Kabupaten Malang. Wilayah Lawang juga merupakan tempat persinggahan dan peristirahatan warga Cina pada masa kolonial. Terdapat beberapa peninggalan berupa bangunan-bangunan milik warga Cina ataupun Eropa, misalnya Hotel Niagara, stasiun, dan bangunan-bangunan bercorak belanda lainnnya. Selain untuk persinggahan, wilayah juga menjadi tempat peristirahatan terakhir bagi warga Cina. Tempat peristirahatan terakhir itu disebut juga dengan istilah makam, yang diantaranya yaitu makam Sentong Turirejo, makam Sentong Wonorejo, dan Makam Taman Asri Abadi Sidodadi. Makam Sentong di desa Wonorejo terbagi menjadi empat kelompok diantaranya yaitu makam Sentong PGL, makam Kristen Sentong PGL, Sentong Baru, dan makam Sentong Raya. Makam Sentong di Desa Wonorejo didirikan pada tahun 1977, Dari keempat makam tersebut satu diantaranya merupakan makam khusus milik jemaat Gereja kristen di kecamatan Lawang. Makam Sentong pertama kali didirikan pada tahun 1977. Pada tahun 1983 mulai didirikan makam sentong baru di sebelah makam PGL oleh bapak John Simon dengan bantuan yayasan Sinoman Kaliaman Surabaya. Sedangkan pada tahun 2002 makam Sentong Raya milik bapak Sutrisno mulai didirikan yang diawali dengan makam milik orang tua bapak Sutrisno. Sejak tahun 2002 hingga 2009, makam ini berlatar belakang bangunan Cina tradisional dan berlatar belakang Kristen-Katolik dengan jumlah total 157 makam. Warga Cina memilih makam Sentong menjadi tempat peristirahatan terakhir karena terletak di wilayah dataran tinggi di desa Wonorejo, yang mereka anggap bahwa dataran tinggi merupakan tempat yang ideal untuk dijadikan makam menurut kepercayaan orang Cina. Makam Sentong di desa Wonorejo juga memberikan kontribusi terhadap masyarakat desa Wonorejo, terutama kontribusi pada aspek sosial dan budaya. Makam Sentong memberikan pengaruh besar terhadap pola mata pencaharian warga sekitar makam tersebut, terutama dalam bidang pemakaman. Selain aspek sosial, terdapat pula aspek budaya, dimana masuknya budaya kerajinan Cina di desa Wonorejo, misalnya banyak warga desa wonorejo yang mulai mengenal serta membuat kerajinan ukir batu nisan (Bongpai) yang bercorak budaya Cina seperti ukiran naga, burung hong, ukiran anak sayang orang tua dan lain sebagainya. Banyak warga Wonorejo yang mendapatkan keuntungan secara ekonomi dari masuknya budaya Cina di desa Wonorejo. Penelitian ini memberikan wawasan lebih luas terutama bagi peneliti, dimana peninggalan warga Cina di Indonesia tidak hanya berupa peninggalan kronik-kronik berasal dari negeri Cina, atau makanan, kesenian, dan ekonomi, tetapi juga peninggalan berupa pemakaman. Makam Cina memberikan gambaran tentang status sosial, ekonomi dan asal-usul bagi bagi warga Cina di Indonesia.

Meningkatkan kemampuan berhitung anak kelompok B DI BA Restu Malang melalui sirkuit pintar / Nurul Aini

 

Kata Kunci: kemampuan berhitung, bermain, Sirkuit Pintar Taman kanak-kanak adalah tempat bermain dan belajar. Taman kanak-kanak harus menjadi tempat yang menyenangkan bagi anak. Dari hasil observasi rendahnya kemampuan berhitung anak sering disebabkan guru kurang tepat dalam pemilihan cara dan media dalam membelajarkan anak. Anak-anak diajar dengan cara yang tidak menyenangkan serta tidak memperhatikan prinsip belajar anak usia dini. Penelitian ini dilaksanakan dengan tujuan untuk:(1)Mendeskripsikan bagaimana meningkatkan kemampuan berhitung anak kelompok B di BA Restu 1 Malang melalui Sirkuit Pintar, (2)Mendeskripsikan peningkatan kemampuan berhitung anak kelompok B di BA Restu Malang melalui Sirkuit Pintar. Subjek dalam penelitian ini adalah anak kelompok B dengan jumlah 24 anak, terdiri dari 10 anak laki-laki dan 14 anak perempuan. Tempat penelitian ini di BA Restu 1 Malang Jl. Bandung 7D Malang. Pengumpulan data dilakukan dengan menggunakan teknik observasi dan dokumentasi. Instrumen yang digunakan untuk mengumpulkan data adalah lembar observasi kegiatan anak dan format penilaian kemampuan anak. Teknik analisis signifikansi dengan menggunakan rumus rata-rata (mean). Peningkatan kemampuan berhitung sebelum penelitian (pra penelitian) dan sesudah penelitian (Siklus II) pada indikator membilang/menyebut urutan bilangan 1-10 peningkatan sebesar 38%, indikator membilang dengan menunjuk benda (mengenal konsep bilangan dengan benda) sampai 10 mengalami peningkatan sebesar 37% dan indikator memasangkan /menghubungkan lambang bilangan dengan benda sampai 10 mengalami peningkatan sebesar 25%. Sedangkan rata-rata kemampuan berhitung anak mengalami peningkatan sebesar 33%. Dengan peningkatan persentase yang signifikan, maka dapat disimpulkan bahwa dengan Bermain Sirkuit Pintar dapat meningkatkan kemampuan berhitung anak kelompok B. Penelitian ini dapat memberikan alternatif strategi pembelajaran terutama guru TK kelompok B untuk dapat melaksanakan pembelajaran berhitung melalui kegiatan Sirkuit Pintar. Bagi peneliti lain disarankan untuk lebih inovatif dengan jalan menambah variasi pada permainan Sirkuit Pintar agar anak tidak bosan dengan kegiatan yang sama dan dapat mengembangkan kemampuan lainnya.

Pengembangan media VCD pembelajaran materi pembelajaran Pendidikan Pancasila dan Kewarganegaraan kelas 1 sekolah menengah pertama / oleh Rully Novianto

 

Pengaruh gaya mengajar guru ekonomi dan motivasi belajar siswa terhadap prestasi belajar siswa kelas X SMA Islam Al Maarif Singosari tahun ajaran 2008/2009 / Dyah Irawati

 

Gaya mengajar guru dan motivasi belajar siswa merupakan faktor-faktor yang berpengaruh terhadap prestasi belajar siswa. Untuk mengetahui pengaruh gaya mengajar guru dan motivasi belajar siswa terhadap prestasi belajar dilakukan dengan jalan membagikan angket. Penelitian ini bertujuan untuk mengetahui pengaruh gaya mengajar guru dan motivasi belajar siswa terhadap prestasi belajar pada mata pelajaran ekonomi, dan diharapkan dapat dipraktekkan dalam proses belajar mengajar di sekolah. Penelitian ini merupakan penelitian deskriptif kuantitatif. Penelitian dilaksanakan di SMA Islam AlMaarif Singosari tahun ajaran 2008/2009. Subyek dalam penelitian ini adalah siswa kelas X yang berjumlah 100 siswa Hasil penelitian ini menunjukkan bahwa pengujian hipotesis menunjukkan adanya pengaruh secara simultan antara gaya mengajar guru dan motivasi belajar siswa terhadap prestasi belajar siswa pada mata pelajaran ekonomi kelas X SMA Islam ALMaarif Singosari. Hal ini ditunjukkan oleh nilai F = 33,813 pada α 5% dan diperoleh probabilitas (p) sebesar 0,000 sehingga p < 0,05 menunjukkan adanya pengaruh sehingga variabel terikat prestasi belajar dapat dijelaskan oleh dua variabel bebas yaitu gaya mengajar guru dan motivasi belajar siswa. Besar R square adalah 0,411, hal ini berarti 41,1% perubahan variabel y disebabkan oleh perubahan variabel x1, x2 sedangkan sisanya 58,9% disebabkan oleh faktor di luar perubahan variabel x1, x2. gaya mengajar guru berpengaruh sebesar 3,002% dan untuk motivasi belajar siswa berpengaruh sebesar 38,098%. Berdasarkan hasil penelitian tersebut dapat disimpulkan bahwa dalam upaya untuk meningkatkan prestasi belajar siswa dalam mata pelajaran ekonomi, maka faktor gaya mengajar guru dan motivasi belajar siswa harus ditingkatkan. Dikarenakan dari hasil penelitian telah terbukti bahwa prestasi belajar siswa dalam mata pelajaran ekonomi dipengaruhi besar oleh motivasi belajar, maka sebagai konsekuensinya agar para siswa lebih memahami dan menguasai materi ekonomi, serta mempraktekkannya dalam kehidupan sehari-hari

Penelitian kemampuan membaca dalam hati siswa kelas VI Sekolah Dasar Negeri Balerejo Kabupaten Tulungagung
Sutarno

 

Penerapan pendekatan kontekstual materi mengubah pecahan ke bentuk lain pada siswa kelas V SDN Dukuharum Kabupaten Jombang / Silviana Mirani

 

Mirani, Silviana. 2014. Penerapan Pendekatan Kontekstual Materi Mengubah Pecahan ke Bentuk Lain pada Siswa Kelas V SDN Dukuharum Kabupaten Jombang. Skripsi, Program Studi Pendidikan Guru Sekolah Dasar, Jurusan Kependidikan Sekolah Dasar dan Prasekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Goenawan Roebyanto, M.Pd, (II) Dra. Siti Umayaroh, S.Pd, M.Pd Kata Kunci: Pendekatan Kontekstual, Mengubah Pecahan ke Bentuk Lain.     Berdasarkan peneliti pada observasi awal, ditemukan fakta bahwa pembelajaran matematika di kelas V SDN Dukuaharum masih didominasi dengan penjelasan materi dari guru. Guru kurang mengaitkan isi pembelajaran dengan kehidupan sehari-hari. Sedangkan aktivitas siswa hanya mendengarkan penjelasan materi dan mengerjakan latihan soal. Pembelajaran yang tidak memberikan makna tersebut mengakibatkan siswa kurang berpengalaman dalam menyelesaikan masalah kontekstual. Pendekatan kontekstual merupakan salah satu solusi untuk mengatasi masalah tersebut agar proses pembelajaran lebih bermakna bagi siswa.     Penelitian ini bertujuan untuk mendeskripsikan: (1) penerapan pendekatan kontekstual pada pembelajaran matematika, (2) aktivitas siswa saat diterapkan pendekatan kontekstual, dan (3) hasil belajar siswa setelah diterapkan pendekatan kontekstual.     Penelitian ini menggunakan pendekatan kualitatif deskriptif, dengan rancangan Penelitian Tindakan Kelas (PTK). Pengumpulan data menggunakan teknik: observasi, tes, dan dokumentasi. Instrumen yang digunakan, yaitu: lembar observasi, soal tes, dan dokumentasi. Subjek penelitian ini siswa kelas V SDN Dukuharum Kabupaten Jombang terdiri dari 11 siswa laki-laki dan 11 siswa perempuan.     Hasil penerapan kontekstual pada materi mengubah pecahan ke bentuk lain pada siswa kelas V di SDN Dukuharum Kabupaten Jombang sebagai berikut: (1) guru telah melaksanakan pembelajaran dengan pendekatan kontekstual sebesar 86,37% siklus I dan siklus II sebesar 94,32%, (2) nilai aktivitas belajar siswa mengalami peningkatan, siklus I sebesar 78,53 dan meningkat menjadi 86,59 pada siklus II, (3) rata-rata hasil belajar siswa juga meningkat, nilai rata-rata pada siklus I sebesar 82,09 dengan persentase ketuntasan klasikal sebesar 88,64%, nilai rata-rata meningkat menjadi 84,09 pada siklus II dengan persentase ketuntasan klasikal sebesar 88,63%.     Berdasarkan data tersebut disimpulkan bahwa penerapan pendekatan kontekstual dapat meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Dukuharum pada materi mengubah pecahan ke bentuk lain. Oleh karena itu, disarankan kepada guru untuk menerapkan pendekatan kontekstual pada saat pembelajaran matematika karena pendekatan kontekstual dapat meningkatkan kualitas pembelajaran yang dibuktikan dengan meningkatnya aktivitas belajar siswa, serta hasil belajar siswa.

Penerapan prinsip-prinsip andragogi dalam pembelajaran pesantren di Lembaga Tinggi Pesantren Luhur Malang / Himma Nur Umami

 

ABSTRAK ami, Himma Nur. 2009. Penerapan Prinsip-prinsip Andragogi dalam Pembelajaran Pesantren di Lembaga Tinggi Pesantren Luhur Malang. Skripsi, Jurusan Pendidikan Luar Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (1) Drs. Lasi Purwito, M.S, (2) Drs. H. Imam Hambali, M.Pd. Kata kunci: andragogi, pembelajaran pesantren Lembaga Tinggi Pesantren Luhur (Pesantren Luhur) merupakan pesantren mahasiswa yang menjadi salah satu bagian dari pendidikan di luar sekolah. Pesantren ini memiliki santri orang dewasa, pembelajaran yang dilaksanakan berbeda dengan pembelajaran pada anak-anak. Pada saat ini kebutuhan masyarakat terutama muslim akan kehidupan yang bernafaskan Islam berkembang. Motto co-ownership, co-responsibility dan co-determination menjadikan pesantren milik umat ini mengelola pembelajarannya tanpa terlepas dari keterlibatan santri sebagai peserta didik dewasa yang memiliki konsep diri, pengalaman, kebutuhan dan permasalahan yang berbeda dengan anak-anak. Penelitian ini digolongkan sebagai penelitian deskriptif kualitatif karena penelitian ini memaparkan suatu kondisi pembelajaran di Pesantren Luhur yang diharapkan menerapkan prinsip-prinsip andragogi. Dengan penelitian studi kasus yang mengeksplorasi bagaimana penerapan prinsip-prinsip andragogi dengan batasan terperinci, memiliki pengambilan data melalui observasi yang mendalam dengan partisipasi aktif peneliti dalam pemebelajaran, dan menyertakan berbagai sumber informasi. Hasil analisis menunjukkan bahwa, berbagai kegiatan pembelajaran di Pesantren Luhur yang meliputi perencanaan, pelaksanaan dan evaluasi, secara langsung melibatkan santri. Hal ini tidak lain berarti mewadahi pengalaman mereka, kebutuhan mereka serta berorientasi pada permasalahan mereka. Namun tidak secara khusus penerapan prinsip-prinsip tersebut diaplikasikan sebagai bahan pembelajaran, mereka hanya menjalankan sesuai dengan budaya pesantren yang dikelola umat. Hanya secara tidak langsung dengan keterlibatan mereka dalam pengelolaan maka pengalaman mereka akan mendasari pemikiran mereka dalam merencanakan, melaksanakan dan mengevaluasi kegiatan pembelajaran. Dan dengan keterlibatan mereka pula, kebutuhan apa yang mereka harapkan dipenuhi dalam sebuah pembelajaran, begitupula permasalahan yang sedang atau akan mereka hadapi untu dipecahkan dalam pembelajaran. Berdasarkan hasil analisis di atas dapat disimpulkan bahwa Pesantren Luhur sudah menjalankan prinsip-prinsip andragogi, tapi sejauh mana, setiap prinsip berbeda kualitasnya. Disarankan bagi pihak Pesantren Luhur untuk tetap memepertahankan keterlibatan santri, karena sebagai orang dewasa mereka memiliki kebutuhan untuk mengaktualisasikan diri, serta meningkatkan pelaksanaan pembelajaran yang bernafaskan pengalaman santri sehingga santri semakin berkembang.

Study tentang pelaksanaan pengajaran Bahasa Arab di Mu'allimat Malang / oleh Lilik Zuhriyah

 

Studi tentang motif khas "Batik Balitar" di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar / Chusna Yunita

 

Yunita, Chusna. 2014. Studi tentang Motif Khas Batik Balitar di Kelurahan Bendogerit Kecamatan Sananwetan Kota Blitar. Skripsi. Jurusan Teknologi Industri. Fakultas Teknik. Universitas Negeri Malang. Pembimbing: (1) Nurul Hidayati, S.Pd.,M.Sn, (2) Dra. Sri Eko Puji Rahayu, M.Si Kata Kunci: batik, motif khas “Batik Balitar”      Batik Balitar merupakan salah satu industri batik yang ada di Kota Blitar, nama dari “Batik Balitar” tersebut bukan nama sebuah motif batik melainkan nama dari label industri batik dan dipatenkan sejak tanggal 29 Desember 2010 dengan No. D 0020010047502. Batik Balitar sebagai pelopor utama dari pembutan batik khas Kota Blitar, yang tergabung dalam satu kelompok yang dinamakan Asosiasi Batik Blitar Asli (ABABIL). Batik Balitar memiliki lima motif khas, yang kesluruhan motifnya dibuat berdasarkan ikon dan produk unggulan Kota Blitar. Kelima motif tersebut diantaranya adalah motif Sekarjagad Blitar, motif Bendogeritan, motif Koi-koi Blitar, motif Bintang Pancasila, dan motif Onthong-onthong. Penelitian ini dilakukan dengan tujuan untuk mendeskripsikan tentang motif khas “Batik Balitar” di Kelurahan Bendogerit Kecamatan Sananwetan. Penelitian ini merupakan jenis penelitian deskriptif dengan pendekatan kualitatif. Prosedur pengumpulan data dalam penelitian ini menggunakan teknik triangulasi sumber data dan triangulasi teknik.     Hasil penelitian yang diperoleh peneliti, Batik Balitar memiliki lima (5) motif khas diantaranya adalah; (1) Motif Khas Sekarjagad; (2) Motif Khas Bendogeritan; (3) Motif Khas Bintang Pancasila; (4) Motif Khas Koi-koi; (5) Motif Khas Onthong-onthong. (1) Motif khas Sekarjagad memiliki rangkaian motif yang didalamnya, antara lain adalah Gapura makam Bung Karno, Cungkup makam Bung Karno, ikan Koi, buah Belimbing, bunga Melati, bunga Rosella, waterpark Sumberudel, Sambal pecel, dan hasil bubut kayu Kota Blitar. Kesembilan motif tersebut tidak memiliki makna khusus, dan kesembilan motif tersebut hanya menggambarkan ciri khas yang ada di Kota Blitar, hal tersebut sekaligus melambangkan karakteristik manusia yang berbeda-beda; (2) Motif Bendogeritan yang dilambangkan dengan bentuk motif buah bendo, daun bendo, bunga bendo, dan truntum, merupakan gambaran lingkunga sekitar yang terdapat banyak pohon bendo, dari pohon bendo yang saling menyilang dengan pohon lain sehingga menimbulkan suara geritan yang pada akhirnya menjadi cikal bakal nama sebuah Kelurahan yang ada di Kota Blitar. Pada motif ini memiliki makna tuntunan atau arahan kepada aparatur kelurahan untuk dapat mengayomi, mengarahkan masyarakat ke hal yang lebih baik; (3) Motif Bintang Pancasila dilambangkan dalam bentuk Gunungan limo, Kawung panca, dan ungker-ungkeran wajah manusia, yang menggambarkan lahirnya Pancasila yang hanya diperingati setiap tahun di Kota Blitar yang disebut dengan Grebeg Pancasila, sedangkan makna dari lambang motif tersebut dimaknai, siapapun yang mengenakan motif ini diharapkan dapat menjadi bintang dalam masyarakat jika dalam kesehariannya masih menghargai dan menjalankan kelima sila Pancasila; (4) Motif Koi-koi dilambangkan dengan bentuk ikan Koi, dimana motif tersebut diciptakan karena Kota Blitar sebagai salah satu pembudidayaan ikan Koi yang telah dikenal masyarakat luas, dan sekligus sebagai gambaran karakteristik manusia yang beragam; (5) Motif Onthong-onthong dilambangkan dengan bentuk macam-macam mainan anak-anak yakni Yoyo, Onthong-onthong, Marakas labu dan Marakas telur, dimana motif ini diciptakan oleh perajin karena Kota Blitar sebagai produsen mainan anak-anak dan sekaligus sebagai produk unggulan bubut kayu di Kota Blitar. Pada motif ini juga sebagai gambaran karakteristik anak-anak yang berbeda-beda.     Saran yang dapat diberikan adalah (1) Pemerintah Daerah Kota Blitar, disarankan untuk mengadakan pelatihan atau lomba-lomba desain motif batik agar muncul ide-ide baru dalam pembutan motif batik Balitar khususnya dan dapat mendatangkan beberapa ahli pembatik dari daerah lain agar dapat melakukan pengembangan pada motif ataupun pengembangan pewarnaan batik; (2) Bagi Dinas Perindustrian dan Perdagangan Kota Blitar, agar Batik Balitar lebih dikenal oleh masyarakat luas khususnya didalam ataupun di luar Kota Blitar, maka dapat diperkenalkan melalui kegiatan pameran nasional atau diadakannya gelar potensi di kota Blitar khususnya; (3) Saran bagi perajin Batik Balitar, diharapkan dapat melakukan pengembangan desain motif dan pengembangan pewarnaan “Batik Balitar” dan sekaligus dapat mendokumentasikan ataupun membukukan motif-motif khas “Batik Balitar” , dengan tujuan untuk menghindari hilangnya data-data penting yang ada di Batik Balitar dan Motif khas Batik Balitar agar tidak diklaim oleh daerah lain, disarankan kepada perajin Batik Balitar untuk segera mengurus hak cipta motif di HaKI; (4) Pada penelitian ini diharapkan budayawan yang ada di Kota Blitar dapat ikut serta mendampingi dan menjadi narasumber dalam pengembangan motif “Batik Balitar”.

Investigasi matematika dalam proses belajar mengajar topik pola bilangan dan barisan siswa kelas III SMP Negeri I Surabaya / oleh Mega Teguh Budiarto

 

Pengaruh pemahaman, sikap, dan implementasi sistem manajemen mutu ISO 9001:2008 terhadap kinerja profesional guru SMK Muhammadiyah 7 Gondanglegi Kabupaten Malang / Ningari Fitra Inesty

 

ABSTRAK Inesty, N.F. 2016. Pengaruh Pemahaman, Sikap, dan Implementasi Sistem Manajemen Mutu ISO 9001:2008 Terhadap Kinerja Profesional Guru SMK Muhammadiyah 7 Gondanglegi Kabupaten Malang. Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. H. Gatot Isnani, M.Si., (II) Lohana Juariyah, S.E., M.Si. Kata kunci:pemahaman, sikap, implementasi, SMM ISO 9001:2008, kinerja profesional SMM ISO 9001:2008 merupakan sistem yang berorientasi pada pendekatan proses dalam rangka perbaikan yang berkelanjutan untuk mencapai kebutuhan dan kepuasan pelanggan.Penerapan SMM ISO 9001:2008 di lembaga pendidikan berorientasi pada peningkatan kualitas pelayanan sehingga diharapkan dapat memuaskan pelanggan yang pada akhirnya berdampak pada peningkatan mutu sekolah maupun mutu pendidikan secara nasional di Indonesia. Faktor utama yang menentukan mutu pendidikan adalah guru. Untuk melaksanakan tugas dan tanggung jawab guru secara profesional, seorang guru harus memenuhi kompetensi yang dipersyaratkan. SMK yang telah memiliki sertifikat ISO 9001:2008 dalam sistem pengelolaan manajemen sekolah, secara tidak langsung harus menjamin kualitas lulusan dengan angka yang memuaskan. Untuk itu harus diimbangi dengan kompetensi yang dimiliki oleh guru. Dalam pelaksanaannya, dibutuhkan pemahaman, sikap, dan penerapan SMM ISO 9001:2008 oleh guru, agar pelaksanaan sistem tersebut dapat dilakukan secara optimal dalam proses pembelajaran.Tujuan penelitian ini untuk mengetahui: (1) deskripsi pemahaman, sikap, implementasi SMM ISO 9001:2008, dan kinerja profesional guru, (2) pengaruh pemahaman, sikap, dan implementasi SMM ISO 9001:2008 secara parsial terhadap kinerja profesional guru, (3) pengaruh pemahaman, sikap, dan implementasi SMM ISO 9001:2008 secara simultan terhadap kinerja profesional guru, (4) pengaruh dominan pemahaman, sikap, dan implementasi SMM ISO 9001:2008 terhadap kinerja profesional guru. Penelitian ini merupakan penelitian kuantitatif bersifat deskriptif korelasional. Variabel bebas dari penelitian ini adalah pemahaman SMM ISO 9001:2008 (X_1), sikap terhadap SMM ISO 9001:2008 (X_2), dan implementasi SMM ISO 9001:2008 (X_3), dengan variabel terikat adalah kinerja profesional guru (Y). Populasi penelitian adalah guru SMK Muhammadiyah 7 Gondanglegi Kabupaten Malang berjumlah 77 guru, dengan jumlah sampel 65 guru. Teknik sampling menggunakan proportionate stratified random sampling. Skala yang digunakan adalah skala Likert. Sumber data berasal dari data primer yang diperoleh dari responden, dan data sekunder yang diperoleh dari data jumlah guru, dan sertifikat ISO 9001:2008. Teknik pengumpulan data menggunakan: (1) angket/kuesioner, dan (2) dokumentasi. Uji kelayakan instrumen menggunakan uji validitas dan reliabilitas. Teknik analisis data menggunakan analisis data deskriptif, dan analisis regresi linear berganda. Sebelum dilakukan analisis regresi linear berganda, dilakukan uji asumsi klasik dan analisis korelasi berganda, untuk melihat seberapa besar koefisien korelasi antar variabel penelitian. Hasil uji asumsi klasik menunjukkan bahwa: (1) model regresi memenuhi asumsi normalitas terlihat dari titik-titik menyebar di sekitar dan mengikuti garis diagonal pada gambar grafik P-P Plot of Regression Standardized Residual, (2) model regresi tidak terjadi gejala multikolinearitas yang terlihat pada nilai VIF < 10 dan mempunyai angka Tolerance > 0,1, (3) model regresi tidak terjadi heteroskedastisitas terlihat pada gambar grafik scatterplot yang tidak membentuk suatu pola tertentu dan menyebar secara acak di atas dan di bawah angka 0 pada sumbu Y. Hasil analisis deskriptif menunjukkan bahwa: (1) pemahaman SMM ISO 9001:2008 guru termasuk dalam kategori baik, (2) sikap terhadap SMM ISO 9001:2008 guru termasuk dalam kategori sangat baik, (3) implementasi SMM ISO 9001:2008 guru termasuk dalam kategori sangat baik, (4) kinerja profesional guru termasuk dalam kategori sangat baik.Sedangkan hasil uji hipotesis menunjukkan bahwa: (1) tidak ada pengaruh positif dan signifikan antara pemahaman SMM ISO 9001:2008 terhadap kinerja profesional guru, (2) ada pengaruh positif dan signifikan antara sikap terhadap SMM ISO 9001:2008 terhadap kinerja profesional guru, (3) tidak ada pengaruh positif dan signifikan antara implementasi SMM ISO 9001:2008 terhadap kinerja profesional guru, (4) ada pengaruh positif dan signifikan antara pemahaman, sikap, dan implementasi SMM ISO 9001:2008 secara bersama-sama terhadap kinerja profesional guru, (5) variabel sikap terhadap SMM ISO 9001:2008 merupakan variabel dominan yang mempengaruhi kinerja profesional guru yaitu sebesar 35,54%. Berdasarkan hasil penelitian ini, dapat disimpulkan bahwa: (1) hasil analisis data deskriptif diketahui pemahaman SMM ISO 9001:2008 guru dalam deskripsi baik, sikap terhadap SMM ISO 9001:2008 guru dalam deskripsi sangat baik, implementasi SMM ISO 9001:2008 guru dalam deskripsi sangat baik, kinerja profesional guru dalam deskripsi sangat baik, (2) perhitungan uji t diketahui tidak ada pengaruh positif dan signifikan antara pemahaman SMM ISO 9001:2008 terhadap kinerja profesional guru, ada pengaruh positif dan signifikan antara sikap terhadap SMM ISO 9001:2008 terhadap kinerja profesional guru, tidak ada pengaruh positif dan signifikan antaraimplementasi SMM ISO 9001:2008 terhadap kinerja profesional guru, (3) perhitungan uji F dapat disimpulkan bahwa ada pengaruh positif dan signifikan antara pemahaman, sikap, dan implementasi SMM ISO 9001:2008 secara bersama-sama terhadap kinerja profesional guru, (4) sikap terhadap SMM ISO 9001:2008 merupakan variabel dominan yang mempengaruhi kinerja profesional guru. Peneliti memberikan saran sebagai berikut: (1) bagi kepala SMK Muhammadiyah 7 Gondanglegi untuk meningkatkan peran SMM ISO 9001:2008 dalam meningkatkan mutu pelayanan kepada konsumen sekolah, (2) bagi guru SMK Muhammadiyah 7 Gondanglegi untuk mengembangkan kompetensi pedagogik yang dimiliki, (3) bagi peneliti selanjutnya yang tertarik untuk melanjutkan penelitian ini, perlu dilakukan penelitian lebih lanjut mengenai variabel lain yang dapat mempengaruhi kinerja profesional guru seperti kemampuan, keterampilan, kepribadian, persepsi, motivasi menjadi guru, pengalaman lapangan, latar belakang keluarga, gaji, sarana dan prasarana, lingkungan kerja fisik, dan kepemimpinan.

Penerapan model pembelajaran kooperatif (cooperative learning) metode snowball throwing untuk meningkatkan minat belajar siswa kelas XI IPS SMA Kertanegara Malang pada mata pelajaran akuntansi / Nurinda Hamida

 

ABSTRAK Hamida, Nurinda. 2009. Penerapan Model Pembelajaran Kooperatif (Cooperative Learning) Metode Snowball Throwing untuk Meningkatkan Minat Belajar Siswa kelas XI IPS SMA Kertanegara Malang pada Mata Pelajaran Akuntansi. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Sawitri Dwi Prastiti, S.E., M.Si., Ak. (II) Sri Pujiningsih, S.E., M.Si., Ak. Kata kunci: Pembelajaran kooperatif, metode snowball throwing, minat belajar siswa. Berdasarkan observasi awal yang dilakukan di kelas XI IPS SMA Kertanegara Malang maka dapat diidentifkasi masalah yang terjadi di kelas yaitu siswa kurang aktif dalam proses pembelajaran, siswa sering mengobrol saat guru menjelaskan materi pelajaran, kurangnya literatur yang mendukung proses pembelajaran, dan siswa juga kurang aktif dalam tanya jawab. Adanya masalah tersebut menunjukkan bahwa siswa kurang berminat dalam proses pembelajaran akuntansi di kelas. Maka dilakukan suatu tindakan perbaikan dalam proses pembelajaran yaitu dengan menerapkan pembelajaran kooperatif metode snowball throwing untuk meningkatkan minat belajar siswa kelas XI IPS SMA Kertanegara Malang. Siklus I pertemuan I dan II jumlah siswa yang mempunyai minat belajar maksimal masingmasing sebanyak 9 dan 10 orang, siswa yang mempunyai minat belajar kurang maksimal masingmasing sebanyak 7 dan 6 orang, serta siswa yang mempunyai minat belajar tidak maksimal sebanyak 7 orang. Sedangkan pada siklus II menunjukkan bahwa pada pertemuan III dan IV jumlah siswa yang mempunyai minat belajar maksimal sebanyak 15 orang, siswa yang mempunyai minat belajar kurang maksimal masingmasing sebanyak 3 dan 5 orang, serta siswa yang mempunyai minat belajar tidak maksimal masingmasing sebanyak 5 dan 3 orang. Hasil tersebut menyatakan bahwa penerapan metode snowball throwing dapat meningkatkan minat belajar siswa melalui aktivitas membuat soal, menjawab soal, mengemukakan jawaban, dan menyimpulkan/menilai jawaban dari kelompok lain. Aktivitas tersebut membuat minat belajar siswa secara individu menjadi meningkat karena selama proses pembelajaran, siswa harus berdiskusi dengan kelompoknya dan saling bertukar pendapat mengenai materi yang diajarkan, berbicara dengan temannya mengenai materi pelajaran sesuai dengan waktu/kesempatan yang diberikan oleh guru, membawa buku pelajaran akuntansi dan menggunakannya sebagai literatur dalam pembelajaran, serta aktif dalam bertanya dan menjawab pertanyaan dari guru. Berdasarkan penelitian yang telah dilakukan dapat disimpulkan bahwa penerapan model pembelajaran kooperatif (cooperative learning) metode snowball throwing dapat meningkatkan minat belajar siswa. Keterbatasan penelitian ini adalah tahap melempar bola ada kelompok yang mendapat soal yang dibuat oleh kelompoknya sendiri. Peneliti menyarankan apabila ada kelompok yang mendapat soal yang ia buat sendiri maka tahap melempar bola harus diulang sampai tiap kelompok mendapat soal dari kelompok lain.

Pengaruh kondisi perbekalan, tata ruang kantor dan karakteristik individu terhadap efisiensi kerja pegawai (studi pada Kantor Kepolisian Resort Kota Malang)
oleh Wahyu Widati

 

Perbekaladna n.tatar uangk antor merupakanf aktor yang memiliki peranan pentingd alamp elaksanaakne rja di dalam suatuo rganisasiS. uksesti daknyas uatu organisastei rgantungd ari kondisi perbekaland an tata ruang kantor. Di sisi lain, pegawasi ebagaui nsurp elaksanad ari kebijaksanaanya ng ada di dalam organisasi juga memiliki karakteristik yang berbeda satu sama lain. Ketiga faktor ini memerlukapne rhatiank arenam emiliki pengaruhte rhadape fisiensik erja pegawai. Pelaksanaank e{a yang efisien akan memberikank ontribusi yang positif pula terhadakpe berhasilaonr ganisasdi alamm encapatiu juannya. Tujuand ari pelaksanaapne nelitiani ni adalahu ntuk mendeskripsikakno ndisi obyektifp erbekalank antor, tata ruang kantor, karakteristiki ndividu dan efisiensi ke{a pegawadi i Kantor KepolisianR esortK ota Malang, sertam enganalisis ecara parsiadl ans imultanp engaruhk ondisip erbekalant,a tar uangk antor,d ank arakteristik individut erhadape fisienski erjap egawadi i KantorK epolisianR esortK ota Malang. Metode yang digunakan dalam pengumpulan data adalah: angket dan dokumeny angd ilaksanakapna dab ulanJ uni2 002d engans ampesl ebesa3r 4 dari 137 populasi. Pengambilan sarnpel berdasarkan pada sampel acak berlapis yang proporsionaDl. alamp enelitiani ni pengolahand ata dilakukand enganm enggunakan teknika nalisiss tatistikd eskriptifd ans tatistiki nferensial. Dari hasila nalisisd atad iperolehh asil penelitians ebagabi erikut:( a) Kondisi perbekalaKn antorK epolisianR esortK ota Malanga da dalamk eadaanc ukup baik, terbuktil ebih dari separor espondeny aitu 55,88%m enyatakanc ukupb aik, 11,76% menyatakasna ngatb aik, 20,59%m enyatakank urangb aik dan 11,76%m enyatakan sangatti dakb aik. (b) Kondisi tatar uangK antor KepolisianR esortK ota Malanga da dalam keadaan cukup baik, yang dapat dibuktikan dari 76,470/o responden menyatakapn€ nataarnu angk antort empatm erekab ekerjad alamk eadaanc ukupb aik, 11,76% menyatakan sangat baik, 8,82% menyatakan kurang baik dan 2,94yo menyatakansa ngatt idak baik. (c) Kondisi karakleristiki ndividu pegawaiK antor KepolisianR esortK ota Malang menyatakanb ahwa 82Yop egawaim e:miliki latar belakanpge ndidikaSn LTA,3 % pegawami emilikil atarb elakangp endrdikadni ploma danl |vo pegawarin erniliklia tarb elakangp endidikanp erguruatnin ggi.i vlasak erja4 tahuns .d 11 tahuns ebesa2r 47o, masak erja 12 tahuns .d 19 tahuns ebesa4r 4y0, masak erja2 0 tahuns .d2 7 tahuns ebesa2r 6%iom, asak erja 28 tahuns .d3 5 tahun sebesa6r% , usia 23 tahuns .d 30 tahuns ebesa1r 5%,u sia 3l tahuns .d 38 tahun sebesa2r9 o/ou, sia3 9 tahuns .d4 6 tahuns ebesa4r 7vo.u sia4 7 tahuns .d 54 tahun sebesagry o.( d) Kondisi eflsiensik erja, ada dalam keadaany ang kurangt inggi, terbuktdi ari5 2,94or/oe spondenm enyatakabna hwae fisiensik erja pegawaai dad alam keadaaknu rangt inggi, 14,71%m enyatakaenf isiensik erja pegawais angat inggi, 14,71%m enyatakane fisiensi kerja pegawai dalam keadaant inggi dan 17,64Vo menyatakaenfi sienski erja pegawadi alamk ondisiy angr endah.( e) Secarap arsial tidakt erdapapt engaruhy ang signifikan dari kondisi perbekalante rhadape fisiensi kerjap egawaKi antorK epolisianR esortK ota Malangt erbuktid ari Sig t (0,389)> (0,05). (0 Secara parsial tidak terdapat pengaruh yang signifikan dari kondisi tata ruangk antort erhadape fisiensik erja pegawaKi antorK epolisianR esortK ota Malang terbuktid ari Sig t (0,256)> (0,05).( g) Secarap arsial terdapatp engaruhy ang sigaifikan dari karakteristik individu terhadap efisiensi kerja pegawai Kantor KepolisianR esortK ota Malang terbukti dari Sig t pada uji regresig andas ebesar 0,002< (0,05).( h) Secaras imultant erdapapt engaruhy angs ignifikand ari kondisi perbekalanta, ta ruangk anlor, dan karakteristiki ndividu terbulti dari Sig F hitung 0,014< (0,05),d anA dlustedR Square0 ,223 Berdasarkahna sil penelitiani ni, disarankanu ntuk meningkatkanka rakteristik individu dalam hal ini adalah tingkat pendidikan karena karakleristik individu memberikan kontribusi terhadap peningkatan efisiensi kef a pegawai Kantor KepolisiaRne sorKt otaM alang.

Peran wanita petani dalam kehidupan ekonomi keluarga di desa Pucakwangi Kecamatan Pucakwangi Kabupaten Pati / oleh Ambit Novendi Triwibowo

 

Paradigma lembaga kepresidenan berdasarkan Undang-undang Dasar Negara Republik Indonesia Tahun 1945 (analisis perspektif teori lembaga negara) / Fidya Karyawati

 

Kurang lebih selama tiga puluh tahun telah dibangun kekuasaan eksekutif yang absolut dengan dukungan para elit militer dan menjadikan Indonesia sebuah negara kekuasaan dengan sistem pemerintahan yang sentralistik dan represif. Kekuasaan yang dijalankan mengabaikan prinsip-prinsip kedaulatan rakyat, bahkan telah jauh menyimpang dari konstitusi UUD 1945, cita-cita kemerdekaan, prinsip negara hukum serta hak-hak dasar rakyat. Penumpukan kekuasaan ditubuh eksekutif memberikan peluang kepada penguasa untuk bertindak sewenang- wenang. Oleh sebab itu timbul usaha untuk mereduksi kekuasaan eksekutif dengan jalan merubah konstitusi. Sejarah perkembangan lembaga negara yang ada di Indonesia menunjukkan jika lembaga negara mengalami beberapa kali perubahan. Hal ini disebabkan adanya perubahan UUD yang terjadi sebanyak empat kali, mulai dari tahun 1999 sampai dengan 2002. Adanya perubahan terhadap UUD 1945 secara otomatis merubah struktur kelembagaan negara. Termasuk didalamnya lembaga kepresidenan. Penataan kembali lembaga kepresidenan mempunyai peranan penting dalam keberlangsungan kehidupan berbangsa dan bernegara, hal ini bertujuan untuk mewujudkan lembaga kepresidenan yang lebih aspiratif, akomodatif berdasarkan peraturan perundang-undangan yang berlaku, sesuai dengan teori pemisahan dan pembagian kekuasaan yang dianut (eksekutif, legislatif, dan yudikatif), demi terwujudnya mekanisme checks and balances diantara ketiga kekuasaan negara. Penelitian ini merupakan penelitian hukum normatif yang bertujuan untuk untuk mengetahui, mengkaji dan menganalisis mengenai hakekat dan kedudukan lembaga kepresidenan di Indonesia dalam mewujudkan negara hukum yang demokratis dan mengetahui, mengkaji dan menganalisis mengenai hubungan lembaga kepresidenan dengan lembaga negara lainnya berdasarkan UUD Negara Republik Indonesia Tahun 1945. Temuan dalam penelitian ini antara lain mengenai kedudukan lembaga kepresidenan dalam mewujudkan negara hukum demokratis pada hakekatnya sudah tertuang dalam UUD Negara Republik Indonesia Tahun 1945. Lembaga kepresidenan di Indonesia tidak hanya sebagai sebuah institusi kelembagaan yang mempunyai kewenangan untuk mengatur dan mengeluarkan kebijakan dalam suatu negara, akan tetapi lembaga kepresidenan sebagai sebuah lembaga negara idealnya dapat memberikan contoh dan teladan terhadap penerapan nilai-nilai luhur yang tercermin dalam sila Pancasila, yang juga dipraktekkan oleh para aparatur pemerintahan sebagai ”abdi” negara sebagaimana tertuang dalam pembukaan UUD 1945. Hubungan lembaga Kepresidenan dengan lembaga negara lainnya berdasarkan UUD Negara Republik Indonesia Tahun 1945 adalah hubungan yang bersifat fungsional, pengawasan. Hubungan antara lembaga kepresidenan dengan lembaga negara lainnya diharapkan adanya hubungan yang sinergis, sehingga terwujud good governance dan clean governance. Oleh sebab itu lembaga kepresidenan perlu dibuatkan perangkat hukum atau kejelasan payung hukum yang lebih spesifik, untuk mengatur Presiden dan Wakil Presiden, agar tidak muncul pelbagai permasalahan yang mengarah pada abuse of power menuju reformasi lembaga kepresidenan yang secara normatif sah berdasarkan hukum konstitusi. Dari temuan dalam penelitian ini, disampaikan saran: perlunya mencari formulasi kaidah hukum yang paling tepat untuk lembaga kepresidenan, mengingat rancangan undang-undang tentang lembaga tersebut sampai sekarang belum disahkan.

Gaya kelekatan ambivalen pada perempuan yang mengalami kekerasan dalam pacaran / Risma Nur'aini

 

Fungsi Situs Jedong dalam lintas masa (IX-XV Masehi) / oleh Marifatin Fitriyah Karyantie

 

Persepsi wajib pajak atas penerapan sistem e-filing terhadap kepatuhan wajib pajak dalam pelaporan SPT pada KPP Pratama Malang Utara / Hayu Pikukuhing Tyas

 

ABSTRAK Tyas, Hayu Pikukuhing. 2016. Persepsi Wajib Pajak Atas Penerapan Sistem E-Filing Terhadap Kepatuhan Wajib Pajak Dalam Pelaporan SPT Pada KPP Pratama Malang Utara. Skripsi, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Dr. Puji Handayati, S.E, M.M, Ak . CA, C.MA, (II) Sriyani Mentari, S.Pd, M.M. Kata Kunci: e-filing, persepsi kegunaan dan kemudahan e-filing, kepatuhan wajib pajak. Indonesia adalah salah satu negara berkembang yang masih giat melakukan pembangunan, baik pembangunan ditingkat pusat maupun daerah. Untuk mewujudkannya, negara Indonesia memerlukan dana atau penerimaan yang cukup besar bagi kas negara, salah satunya dengan pemungutan pajak. Reformasi perpajakan pada tahun 1983 mengubah tata cara pemungutan pajak yang awalnya menggunakan Official Assessment System menjadi Self Assessment System. Seiring dengan perkembangan teknologi informasi yang semakin canggih, pemerintah dalam hal ini Direktorat Jendral Pajak menyikapinya dengan melakukan modernisasi perpajakan dengan pelaporan pajak menggunakan E-filing. E-filing diciptakan dengan tujuan untuk memberi kemudahan dan manfaat kepada Wajib Pajak dalam melaporkan pajaknya. Penelitian ini merupakan studi empiris yang menggunakan teknik Convenience sampling dalam pengumpulan data. Data yang digunakan adalah data primer yang diperoleh dengan menggunakan kuesioner. Subjek penelitian ini adalah Wajib Pajak yang terdaftar di KPP Pratama Malang Utara. Analisis data menggunakan SPSS 21.0 for Windows. Hasil dari penelitian ini mengindikasikan bahwa semua hipotesis diterima. Hipotesis 1 menunjukkan bahwa kegunaan penggunaan sistem e-filing secara signifikan berpengaruh positif terhadap kepatuhan wajib pajak. Hipotesis 2 menunjukkan bahwa kemudahan penggunaan sistem e-filing juga secara signifikan berpengaruh positif terhadap kepatuhan wajib pajak. Ada beberapa keterbatasan dalam penelitian ini, yaitu hanya menggunakan 2 variabel indipenden yaitu kegunaan dan kemudahan penggunaan fasilitas e-filing, pada kenyataannya faktor lain juga dapat mempengarui tingkat kepatuhan wajib pajak, tidak hanya kedua faktor tersebut. Bagi peneliti selanjutnya bisa menggunakan teknik lain dalam pengambilan data, atau menggunakan variabel bebas yang lebih bervariasi.

Studi tentang ragam desain dan proses pembuatan produk kerajinan pasir laut di industri kerajinan "Katulistiwa Handy Craft" di Kota Malang / oleh Dina Susanti

 

Analisis pengendalian internal pengeluaran kas di Badan Pengelolaan Keuangan dan Aset Daerah Blitar / Asianye Nenda Asmara Wati

 

ABSTRAK Wati, Asianye Nenda Asmara. 2016. Analisis Sistem Pengendalian Internal Pengeluaran Kas di Badan Pengelolaan Keuangan dan Aset Daerah Blitar. Tugas Akhir, Jurusan Akuntansi, Fakultas Ekonomi, Universitas Negeri Malang, Pembimbing: Nujmatul Laily, S.Pd., M.SA. Kata Kunci: Sistem Pengendalian Intern, Kas Penelitian ini bertujuan untuk mengetahui prosedur-prosedur yang digunakan untuk pengeluaran kas BPKAD kota Blitar serta sistem pengendalian internalnya apakah sudah diterapkan sesuai dengan peraturan. Metode pemecahan masalah yang digunakan untuk menjawab tujuan penelitian ini adalah metode kualitatif. Berdasarkan hasil analisis data maka diperoleh (1) Prosedur pengeluaran kas sesuai dengan pengeluaran yang dibutuhkan. (2) Sistem Pengendalian Internal Pengeluaran Kas di Badan Pengelolaan Keuangan dan Aset Daerah Blitar, (a) Pembentukan tanggung jawab yang ditentukan secara tegas, Bendahara Umum Daerah memiliki tanggung jawab untuk mengawasi adanya pengeluaran kas dan Sub Bagian Program memiliki tanggung jawab dalam mengamankan data keuangan pada komputer, (b) Pemisahan tugas dilakukan dengan membedakan fungsi pengeluaran kas dengan fungsi pencatatan pengeluaran kas, (c) Prosedur dokumentasi memiliki prenumbered dan memiliki tandatangan pihak yang bertanggung jawab, (d) Pengendalian fisik, mekanik dan elektronik dilakukan dengan cara tidak membentuk dana kas kecil, seluruh uang disimpan di Bank, dan adanya password saat mengakses data di komputer, (e) Verifikasi internal independen dilakukan secara rutin dan mendadak, (f) Pengendali sumber daya manusia kurang efektif karena peraturan yang tidak tegas. Peneliti memberikan beberapa saran, yaitu (1) Perbaikan kebijakan terhadap pemberian password untuk setiap komputer, (2) Meningkatkan pengawasan terhadap kinerja pegawai, (3) Melakukan perputaran jabatan ketika kinerja karyawan bermasalah.

Persepsi laba pengusaha tempe skala mikro di Malang / Hanjar Ikrima Nanda

 

ABSTRAK Nanda, Hanjar Ikrima. 2016. Persepsi Laba bagi Pengusaha Tempe Skala Mikro di Malang. Tesis. Jurusan Akuntansi, Program Pascasarjana Universitas Negeri Malang. Pembimbing:(I) Dr. Puji Handayati, S.E., M.M., Ak., CA., CMA, CIBA, CSRS, (II) Dr. Suparti, M.P. Kata kunci: persepsi laba, tujuan usaha, usaha mikro Tempe merupakan salah satu produk unggulan Malang. Perkembangan usaha tempe cukup tinggi, hal ini dapat dilihat dari data Dinas Koperasi dan UMKM tahun 2015 yaitu ada 1.532 unit usaha tempe skala mikro di Malang. Namun, secara finansial tingkat pertumbuhannya stagnan. Mereka kurang percaya diri untuk meningkatkan volume usahanya, sehingga laba yang dihasilkan kurang maksimal. Terdapat perbedaan kinerja untuk memperoleh laba usaha. Perbedaan kinerja ini dipengaruhi oleh perbedaan tujuan dalam mendirikan usaha. Hal ini akan melahirkan cara pandang berbeda terkait dengan laba usaha. Oleh karena itu, penelitian ini berusaha mengetahui persepsi laba pengusaha tempe skala mikro yang ada di Malang. Tujuan usaha dan cara menghitung laba akan membantu kontruksi persepsi laba tersebut. Pengumpulan data dilakukan menggunakan pendekatan kualitatif, fenomenologi. Sampel diambil dengan menggunakan teknik snowball sampling. Data diambil dengan menggunakan teknik wawancara mendalam. Hasil observasi, dan dokumentasi juga digunakan untuk mendukung penelitian ini. Pada penelitian ini, peneliti bertindak sebagai instrumen sekaligus pengumpul data. Pemeriksaan keabsahan data dilakukan dengan menggunakan triangulasi. Hasil penelitian menunjukkan bahwa pengusaha tempe skala mikro mengetahui laba dari dari peningkatan jumlah kekayaan mereka. Kesimpulan penelitian ini adalah (1) bagi pengusaha yang memiliki tujuan untuk memenuhi kebutuhan sehari-hari, laba adalah tambahan harta yang dapat membuat balik modal dan dapat digunakan untuk memenuhi kebutuhan harian; (2) bagi pengusaha yang memiliki tujuan untuk bisa berinvestasi ke lain bidang, laba adalah tambahan harta yang membuat pengusaha dapat memperkaya diri sendiri dalam wujud investasi lain; (3) bagi pengusaha yang memiliki tujuan agar bisa bebas mengatur waktunya, laba adalah kepuasan batin ketika dapat meluangkan waktu untuk keluarga atau dapat menjalankan usaha sesuai dengan keinginannya; (4)bagi pengusaha yang memiliki tujuan usaha untuk selalu dekat dengan Tuhan laba adalah kepuasan batin ketika dapat mengatur waktu ibadah sesuai dengan aturan Tuhan, atau ketika bisa terus bersedekah; (5) bagi pengusaha yang memiliki tujuan untuk bisa membahagiakan orang lain, laba adalah meningkatnya kepuasan batin diri mereka sendiri ketika dapat membuat pelanggan senang dengan produk dan pelayanan yang diberikan, atau ketika karyawan nyaman mengerjakan tugasnya. Hasil penelitian ini memiliki implikasi praktis: (1) pendidikan yang dilakukan oleh pemerintah seharusnya lebih ditekankan pada pembentukan kesadaran akan pentingnya mengetahui beban usaha, sehingga mereka menyadari berapa laba yang akan didapatkan dari usaha; (2) pelatihan yang dilakukan oleh pemerintah untuk meningkatkan inovasi usaha mikro perlu dilengkapi dengan solusi pemasaran produk, sehingga rasa percaya diri pengusaha untuk mampu menembus pasar meningkat; (3) peneliti berikutnya dapat mempertimbangkan perbedaan suku, agama, dan etnis informan yang dijadikan subjek penelitian.

The effectiveness of the KWLM technique in the teaching of reading comprehension in the non-English Departments / Ive Emaliana

 

Graduate Program in English Language Teaching, State University of Malang. Advisors: (I)Dr. Sri Rachmajanti, Dip. TESL.,M.Pd. (II)Dr. ArwijatiWahjudiMurdbjono, Dip. TESL.,M.Pd. Key words:effectiveness, reading comprehension, KWLM technique, conventional technique This study was conducted to investigate whether the use of the KWLM technique in the teaching of reading is effective. The objective of the study is to investigate the effectiveness ofthe KWLMtechnique in teaching reading comprehension in the non-English department students. The hypothesis for this study is stated as follows: “The reading comprehension score of students who are taught using the KWLM technique is significantly higher than those who are taught using the conventional technique.” The design of the study was quasi-experimental with non-randomized pre-test post-test. The samples of this study were taken from the population of the first semester students of the faculty of Fisheries and Marine Science in Brawijaya University in the 2011/2012 academic year. The populations were 550 students; distributed in 11 classes.Each of the group basically had the same possibility to be the sample of the research. In the present study, classes B and D were chosen because in this semester, the researcher was assignedby the faculty to teach these two classes. The result of the lottery showed that class B was the experimental group, while class D was the control group. In collecting data, the instruments used were test (major data), students’ questionnaires and observation sheet (minor data). The test was in the form of multiple choice which covered the subject matter of reading comprehension. Pre-test was administered to both groups at the same day before treatment. The same test was also used in the post-test which was administered after the treatment to both groups in the same day. The experimental group was then taught using the KWLM technique in the treatment. Meanwhile, the control group was taught using the conventional technique, DRA in the treatment. The minor data, the student questionnaire was used to explain the students’ motivation in learning English language before the treatment (for experimental and control groups). The questionnaire on students’ attitude in the teaching of English in general was given only to the experimental group to support the description of the students’ active participation as the effect of the KWLM technique.The students’ opinion was used to know the students’ attitude in the implementation of the KWLM technique. The observation sheet was used to assure that the teaching and learning process was appropriate based on the lesson plans made. The pre-test means of both groups were analyzed statistically using a Levene’s test, and it was revealed that the significant value was .537 that was higher than the level of significance 0.05. This result indicates that the difference between variances is not significant. It means the subjects of the experimental and control groups are not significantly different before the experiment in their pre-test scoresof reading comprehension test. Therefore, an independent t-test was used to analyze the pre-test means. On the statistical computation for post-test by using independent t-test revealed that t-value for df 98is 2.34.The value is bigger than t-critical value 2.27 at the level of significance of 0.05 for a one tailed test (t-value>t-critical value: 2.34>2.27). This indicates that there is a significant difference of means scores between students who are taught using KWLM technique and those who are taught using conventional technique in teaching reading comprehension. The gain of reading comprehension means score of experimental group is significantly higher than the gain of reading comprehension means score of control group. Therefore, Ho was rejected and the H1 works. Based on the result of research findings, it can be concluded that using the KWLM in teaching reading comprehension proved to be effective in increasing the students’ reading comprehension achievement. Thus, it is suggested that English lecturer to utilize the KWLM technique in teaching reading comprehension, for it was proven that this teaching technique can improve the students’ achievement in reading comprehension. Besides, for future researchers are suggested to investigate the gain of micro-skills and to consider the subject characteristics like learning style, genders, learning strategies, or learning motivation when they are going to conduct research on the effectiveness of the KWLM technique in the teaching of reading in other than non-English departments

Pengaruh kualitas layanan terhadap kepuasan pengguna jasa / studi pada pelayanan jasa kapal PT. Persero Pelabuhan Indonesia III Surabaya / oleh Siska Puspasari

 

Pengaruh kesesuaian penempatan karyawan terhadap prestasi kerja karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang) / Lailatul Badriyah

 

ABSTRAK Badriyah, L. 2016. Pengaruh Kesesuaian Penempatan Karyawan terhadap Prestasi Kerja Karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang). Skripsi, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing: (I) Drs. I Nyoman Suputra, M.Si. (II) Drs. H. Mohammad Arief, M.Si. Kata Kunci: Penempatan Karyawan, Prestasi Kerja Perusahaan-perusahaan pada umumnya akan melakukan berbagai usaha untuk mencapai tingkat prestasi dan kinerja yang tinggi dengan merencanakan dan merealisasikan program manajemen sumber daya manusia diantaranya adalah proses penempatan karyawan yang baik secara efektif dan efisien. Tujuan dari penelitian ini adalah (1) Untuk mengetahui deskripsi tentang Penempatan Karyawan (yang terdiri dari pengetahuan, keterampilan, dan kemampuan) di PT. Telkom Indonesia Witel Jatim Selatan (Malang); (2) Untuk mengetahui apakah ada pengaruh penempatan karyawan (yang terdiri dari pengetahuan, keterampilan, dan kemampuan) secara parsial dan simultan terhadap prestasi kerja karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang). Penelitian ini menggunakan metode kuantitatif. Populasi dalam penelitian ini adalah seluruh karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang) sejumlah 116 orang dari semua divisi dan sampelnya adalah 90 orang. Instrumen penelitian menggunakan skala likert dan teknik sampling yang digunakan adalah proportional random sampling. Teknik pengumpulan data yaitu dengan cara menyebarkan angket kepada responden dan teknik analisis data yang digunakan adalah analisis regresi linier berganda. Variabel bebas dalam penelitian ini adalah penempatan karyawan yang terdiri dari pengetahuan (X1), keterampilan (X2), dan kemampuan (X3) sedangkan variabel terikatnya adalah prestasi kerja (Y). Hasil penelitian ini menunjukkan bahwa secara simultan penempatan karyawan (yang terdiri dari pengetahuan, keterampilan, dan kemampuan) berpengaruh signifikan terhadap prestasi kerja karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang). Hal ini dibuktikan dengan nilai signifikansi sebesar 0,000 (0,000 < 0,05), sehingga H0 ditolak. Sedangkan secara parsial variabel pengetahuan, keterampilan, dan kemampuan berpengaruh signifikan terhadap prestasi kerja karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang). Hal ini dibuktikan dengan nilai signifikansi variabel pengetahuan sebesar 0,000 (0,000 < 0,05), variabel keterampilan sebesar 0,000 (0,000 < 0,05), dan variabel kemampuan sebesar 0,005 (0,005 < 0,05), sehingga H0 ditolak. Saran pada penelitian berikutnya, sebaiknya menambahkan variabel moderating maupun variabel intervening karena ada beberapa variabel lain yang memiliki hubungan dengan prestasi kerja sehingga bisa lebih bervariasi.

Pengembangan media kubah (kubus hijaiyah) dalam pembelajaran membaca huruf hijaiyah siswa tunarungu kelas VIII di SPMLBN Kedung Kandang Malang / Siti Mar'atus Sholikha

 

ABSTRAK Sholihah, Siti Mar’atus. 2016. Pengembangan Media KUBAH (Kubus Hijaiyah) dalam Pembelajaran Membaca Huruf Hijaiyah Siswa Tunarungu Kelas VIII di SMPLBN Kedung Kandang Malang. Skripsi, Jurusan Pendidikan Luar Biasa, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Drs. Abdul Huda, M.Pd, (II) Drs. Usep Kustiawan, M.Sn. Kata Kunci: Kubus Hijaiyah, Huruf Hijaiyah, Tunarungu. Saat studi pendahuluan ditemukan siswa tunarungu mengalami kesulitan, dan belum tersedia media pembelajaran dalam pembelajaran membaca huruf hijaiyah. Melihat karakteristik anak tunarungu, pemilihan media yang sesuai dengan kemampuan dan karekteristik mereka yaitu menggunakan media visual. Dalam penelitian ini, peneliti mengembangkan KUBAH (Kubus Hijaiyah). Tujuan penelitian pengembangan secara umum yaitu menghasilkan media pembelajaran KUBAH (Kubus Hijaiyah) yang valid dimanfaatkan bagi siswa tunarungu kelas VIII dalam pembelajaran membaca huruf hijaiyah di SMPLBN Kedung Kandang Malang. Penelitian ini, menggunakanmodel pengembangan Research and Development (R&D) Borg dan Gallyaitu: (1)Penelitian dan Pengumpulan data; (2) Perencanaan; (3) Pengembangan draf produk; (4) Uji coba lapangan awal; (5)Merevisi hasil uji coba; (6) Uji coba lapangan; (7) Penyempurnaan produk hasil uji lapangan. Hasil penelitian menunjukkan bahwa KUBAH (Kubus Hijiayah) sangat valid untuk digunakan. Hasil dari ahli materi diperoleh skor 95 % (sangat layak), ahli media 100 % (sangat layak), ahli praktisi 93 % (sangat valid), dan untuk calon pengguna 81 % (sangat layak). Kesimpulan dari penelitian dan pengembangan ini adalah sangat valid digunakan beradasarkan validasi dari ahli materi, ahli media, ahli praktisi dan calon pengguna. Berdasarkan uji coba penggunaan KUBAH pada siswa tunarungu kelas VIII secara kuantitatif dapat meningkatkan hasil belajar. Saran dari penelitian ini adalah: (1) KUBAH diharapkan lebih variatif sehingga dapat mencapai tujuan pembelajaran yang diharapkan; (2) Untuk subjek penelitian diharapkan lebih luas lagi, tidak hanya di SMPLB Negeri Kedung Kandang Malang, tapi juga untuk ABK dan sekolah lainnya.

Keanekaragaman serangga parasitoid pada tumbuhan penutup tanah Arachis pintoii L. di area kebun teh afdeling Wonosari Singosari Kabupaten Malang / Ivone Wulandari Budiharto

 

ABSTRAK Wulan, Ivone. 2009. Keanekaragaman Serangga Parasitoid pada Tumbuhan Penutup Tanah Arachis pintoii L. di Area Kebun Teh Afdeling Wonosari Singosari Kabupaten Malang. Skripsi, Jurusan Biologi FMIPA Universitas Negeri Malang. Pembimbing: (I) Dr. Fatchur Rohman, M.Si, (II) Drs. H. Fathurrachman, M.Si. Kata kunci : Keanekaragaman serangga parasitoid, faktor abiotik, Arachis pintoii L. Keanekaragaman spesies merupakan suatu karakteristik tingkatan komunitas berdasarkan organisasi biologisnya, yang dapat digunakan untuk menyatakan struktur komunitas. Suatu komunitas dikatakan mempunyai keanekaragaman spesies tinggi jika komunitas itu disusun oleh banyak spesies (jenis) dengan kelimpahan spesies yang sama atau hampir sama. Penelitian ini bertujuan untuk mengetahui komposisi, kepadatan populasi, dan keanekaragaman spesies, mengetahui 1) perbedaan keanekaragaman spesies serangga parasitoid pada tumbuhan penutup tanah Arachis pintoii L. di area Kebun Teh Afdeling Wonosari Singosari pagi,siang, dan sore hari 2) faktor abiotik yang paling menentukan terhadap Keanekaragaman Spesies Serangga Parasitoid pada Tumbuhan Penutup Tanah Arachis pintoii L. di area Kebun Teh Afdeling Wonosari Singosari Kabupaten Malang. Penelitian ini merupakan penelitian deskriptif eksploratif bersifat kuantitatif. Pengambilan sampel dilakukan pada bulan Pebruari-April 2009 di Kebun Teh Afdeling Wonosari Kabupaten Malang. Pengambilan sampel dilakukan secara sistematik di dalam area tepi petak kebun teh yang tertanami oleh Arachis pintoii L. dengan membuat 10 titik menggunakan jaring ayun dengan ukuran mata jaring 0,5mm. Faktor abiotik yang diukur meliputi kecepatan angin, kelembapan udara, suhu udara, dan Intensitas cahaya. Indeks keanekaragaman spesies serangga parasitoid ditentukan berdasarkan indeks Shanon Wiener dan untuk membandingkan keanekaragaman secara mewaktu dilakukan Uji t taraf signifikan 5% Dominansi spesies serangga parasitoid dianalisis berdasarkan indeks dominansi (Di). Faktor abiotik yang paling menentukan terhadap keanekaragaman serangga parasitoid dilakukan analisis regresi ganda bertahap (step wise multiple regression) dengan program SPSS versi 12. Komposisi Serangga Parasitoid yang ditemukan di Kebun Teh Afdeling Wonosari Singosari Kabupaten Malang meliputi atas 5 taksa dalam 2 ordo. Kepadatan populasi Serangga Parasitoid di Kebun Teh Afdeling Wonosari Singosari Kabupaten Malang pagi berjumlah 7 ind/jaring, siang berjumlah 6 ind/jaring, dan sore berjumlah 5 ind/jaring. Keanekaragaman spesies (H’) serangga parasitoid pada pagi hari sebesar 1,42937, siang hari sebesar 1,23498, dan sore hari sebesar 0,72871. Berdasarkan hasil Uji t (0,05) terdapat perbedaan yang signifikan antara keanekaragaman spesies serangga parasitoid antara pagi hari dan sore hari. Secara umum spesies serangga parasitoid yang mendominasi kebun teh pada tumbuhan penutup tanah Arachis pintoii L. adalah i Trichophtalma sp 13 %, Musca domestica 17% , Siphona sp 47%, Carcelia sp14%, Bessa remota 9%. Hasil uji statistik dengan regresi ganda bertahap terhadap faktor abiotik menunjukkan bahwa untuk faktor abiotik yang sangat menentukan terhadap keanekaragaman spesies serangga parasitoid pada pagi hari adalah suhu (R2 =11,9%), siang hari adalah suhu ((R2= 12,5%), dan sore hari adalah kec.angin (R2= 15.9%), sedangkan untuk faktor abiotik yang memberikan sumbangan paling besar pada pagi hari adalah suhu (r2= 24%), suhu dengan nilai siang hari ( r2 = 6%), dan suhu dengan nilai sore hari ( r 2 = 4%).

Tahapan kegiatan personal selling sebagai strategi promosi pada PT Surya Jawara Eco Singosari / Isnani Atilavi

 

ABSTRAK Atilavi, Isnani. 2016. Tahapan Kegiatan Personal Selling Sebagai Strategi Promosi pada PT Surya Jawara Eco Singosari. Tugas Akhir Program Studi D-III Manajemen Pemasaran, Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang. Pembimbing : Handri Dian Wahyudi, M.Sc Kata Kunci : Personal Selling, Salesman, PT Surya Jawara Eco Personal sellingadalah salah satu komponen dari bauran promosi, yakni strategi untuk mempromosikan produk guna memperkenalkan produk kepada calon konsumen dan menimbulkan keinginan calon konsumen untuk melakukan pembelian.Personal selling, merupakan cara mempromosikan produk ataupun jasa secara personalmelalui tatap muka langsung dengan calon konsumen. Hal ini bertujuan untuk memberikan konsumen pemahaman mengenai produk dan meyakinkan konsumen secara langsung. PT Surya Jawara Eco adalah perusahaan yang bergerak dibidang otomotif, perusahaan ini memproduksi produk yang memenuhi kebutuhan car care dan car wash. Pemasaran produk yang dilakukan PT Surya Jawara Eco menerapkan personal selling sebagai startegi promosi, guna mendapatkan kepercayaan dan loyalitas konsumen, serta meningkatkan angka penjualan. Kegiatan personal selling yang dilakukan oleh salesman PT Surya Jawara Eco memiliki beberapa tahapan. Secara garis besar, tahapan yang dilakukan ada dua macam, meliputi tahapan kegiatan personal selling dan langkah-langkah dalam melakukan transaksi penjualan. Pelaksanaan kegiatan personal selling bukanlah hal yang mudah, ada beberapa hambatan yang dihadapi oleh salesman, di antaranya kompetitor dengan harga lebih rendah, kemampuan salesman yang kurang dan kondisi pasar otomotif yang menurun. Penelitian ini dilakukan guna mendeskripsikan seluruh tahapan kegiatan personal sellingdan hambatan yang dihadapi pada PT Surya Jawara Eco. Berdasarkan hasil penelitian, alternatif pemecahan masalah dari hambatan yang dihadapi, meliputi pencantuman keterangan MSDS (material safety data sheet) dalam company profile, sebagai bukti bahwa produk yang dihasilkan adalah produk yang bisa dipertanggung jawabkan keamanannya, pemberian pelatihan kepada salesman dari awal rekrutment, sekitar dua sampai tiga bulan danmenetapkan jadwal pasti mengenai agenda tahunan pertemuan salesman, serta menyarankan pihak bengkel untuk mengadakan program paket hemat yang menarik bagi konsumen bengkel dan salon mobil khusus untuk penggunaan produk PT Surya Jawara Eco dan pihak bengkel akan diberikan diskon khusus untuk menunjang program tersebut.

Pengembangan fitur-fitur tambahan pada software autoCAD pada matakuliah gambar teknik materi menggambar instalasi listrik rumah sederhana untuk S1 PTE Universitas Negeri Malang / Intan Rahayu

 

ABSTRAK Rahayu, Intan. 2016. PengembanganFitur-FiturTambahanpadaSoftwareAutoCADpadaMatakuliahGambarTeknikMateriMenggambarInstalasiListrikRumahSederhanauntuk S1 PTE UniversitasNegeri Malang. Skripsi.JurusanTeknikElektro, FakultasTeknik, UniversitasNegeri Malang. Pembimbing: (1) Ahmad Fahmi, S.T., M.T., (2) Drs. HariPutranto Kata Kunci: pengembangan, fitur-fiturtambahan, softwareAutoCAD, GambarTeknik, menggambarinstalasilistrik. Pengembanganinimenghasilkanfitur-fiturtambahanpadasoftware AutoCAD 2016 untukmatakuliahGambarTeknikdanbahanajarcetakberupahandout, jobsheet, danmanual book.Tujuandaripenelitianiniadalahuntukmengetahuikelyakandariprodukdanmemudahkanmenggambarinstalasilistrikuntuk S1 PTE 2012 UniversitasNegeri Malang. Berdasarkanhasilpengamatan proses pembelajaran yang terjadi di kelas PTE A 2012 padamatakuliahGambarteknik, faktor yang mendorongpenelitiuntukmengembangkanfiturtambahanpada software AutoCAD yang disertaibahan ajar cetakadalahpadasaatmenggambarmahasiswatidakbisamemasukkanukuransecaralangsung yang akandibuatmelainkanharusmenyesuaikannyamelaluirules padalembarkerjaMs. Visio 2007, sehinggamemerlukantingkatketelitian yang tinggidalammenentukanukuran agar hasilgambarsesuaidengan yang diinginkan yang mengakibatkanmahasiswamembutuhkanwaktu lama dalammenggambarinstalasilistrik. Olehkarenaitu, pengembangmengembangkansoftware AutoCAD yang bergunauntukmemudahkanmahasiswadalammenggambarinstalasilistrik.Fiturtambahanpadasoftware AutoCAD 2016 untukmatakuliahGambarTeknikmaterimenggambarinstalasilistrikberisisimbol-simbol yang digunakanuntukmenggambarinstalsilistrik. Model pengembanganinimenggunakan model pegembanganSugiyono (2011) yang telahdimodifikasi.Adapunlangkah yang dilakukanadalahsebagaiberikut: (1) potensidanmasalah; (2) pengumpulan data; (3) desainproduk; (4) validasidesain; (5) revisidesain; (6) ujicobaproduk; (7) revisiproduk; (8) ujicobapemakaian; (9) revisiproduk; (10) produkmasal. Rancangan model initelahsesuaidengankebutuhanpenelitiuntukmelakukanpengembanganfitur-fiturtambahan. Hasilsecarakeseluruhandaripengembanganbahan ajar menggambarinstalasilistrikrumahsederhanamenggunakanAutoCAD padamatakuliahGambarTeknikuntuk S1 PendidikanTeknikElektroUniversitasNegeri Malang didapattingkatkelayakan 87,56 % dandinyatakansangatlayak. Hasilvalidasiahlimateridiperolehpersentase 92,79 % dandinyatakansangat valid. Hasilvalidasiahli media diperolehpersentase 86,61 % dandinyatakansangat valid. Hasilujicobakelompokkecil yang dilakukanolehmahasiswa S1 PTE offering A angkatan 2012 UniversitasNegeri Malang diperolehpersentase 85,94 % danujicobakelompokbesar yang dilakukanolehmahasiswa S1 PTE offering A dan C angkatan 2013 UniversitasNegeri Malang diperolehpersentase 84,71 %.

Peningkatan motivasi dan hasil belajar mata diklat menggunakan perkakas tangan melalui lesson study bagi siswa kelas X kompetensi keahlian teknik pemesinan di SMK Pekerjaan Umum Malang / Erik Prihandono

 

Kata Kunci:Lesson study, motivasibelajar, hasilbelajar. Berdasarkanhasilobservasi, Kegiatanpembelajaran yang dilakukan di kelas X kompetensikeahlianteknikpemesinanSMK PekerjaanUmum Malang masihmenggunakanmetodeceramah, tanyajawab, diskusi, danpraktikum. Sebagianbesarsiswakurangmenunjukkan rasa ingintahudanbelumdapatmengaitkanmanfaatpembelajaran yang dilakukandalamkehidupansehinggapemahamanterhadapmateri-materi yang dibelajarkanmasihkurang. Hal inimenyebabkanhasilbelajarmenggunakanperkakastangansiswakelas X kompetensikeahlianteknikpemesinanmasihkurangmemuaskan. Padaulanganharianmenggunakankikirtarafketuntasanklasikalbarumencapai 20% sehinggaperluditingkatkanlagihinggamencapai 85%.Penelitianinimengkaji(1) motivasibelajarsiswa, (2) hasilbelajarsiswa (ranahkognitif), (3) pelaksanaanlesson study, Penelitianinimerupakanpenelitiantindakandenganpendekatandeskriptifkualitatif.SubjekpenelitianyaitusiswakelasX kompetensikeahlianteknikpemesinansebanyak 25siswa, seorang guru model, dan3 orang observer.Data yang dikumpulkanberupa data motivasibelajarsiswa, hasilbelajar (ranahkognitif), pelaksanaanlesson study.Instrumenpengumpulan data yang digunakanberupaangket, lembarobservasi, danteshasilbelajar.Teknikanalisis data yang digunakanadalahreduksi data, paparan data, dankesimpulanatauverifikasidata. Hasilpenelitianmenunjukkanbahwamotivasibelajarsiswaberdasarkanjawabanangket model ARCS memilikiskor rata-rata 3.7 (baik) sebelumpelaksanaanlesson study, menurunmenjadi 3.6 (baik) saatOpen Lesson (OL) padapelaksanaanlesson study, danmeningkatkembalimenjadi 3.9 (baik) saatOLakhirpelaksanaanlesson study. Motivasibelajarsiswaberdasarkanlembarobservasimotivasibelajarmemilikiskorklasikal 43.0% (cukup) padatindakan 1, 50.0% (cukup) padatindakan 2, dan 62.0% (baik) padatindakan 3.Berdasarkanjawabanangketresponssiswaterhadapkegiatanpembelajaran, siswameresponspositifkegiatanpembelajaranselamapelaksanaankegiatanpembelajaranmelaluilesson study.Hasilbelajarsiswapadapokokbahasanmenggunakanpaludengantarafketuntasanklasikal28.0%, meningkatpadapokokbahasanmenggunakanguntingmenjadi 60.0%, dansemakinmeningkatpadapokokbahasanmenggunakanjangkamenjadi 93.5%. Tarafketerlaksanaanlangkah-langkahlesson study di SMK PekerjaanUmumMalang sangatsesuaidenganstandar monitoring tahapPlan, Do, danSee yang ditetapkanolehDitjenDikti. Kesimpulanpenelitianiniadalahbahwalesson studydapatmeningkatkanmotivasidanhasilbelajarsiswakelasX kompetensikeahlianteknikpemesinan di SMK PekerjaanUmum Malang. Saran yang dapatdisampaikanyaitupelaksanaan lesson studylebih baik dilaksanakan secara berkala di SMK PU Malang karena terbukti dapat meningkatkan motivasi dan hasil belajar.

Peran pendidik anak usia dini dalam mendukung perkembangan bahasa anak / Titik Milawati

 

ABSTRAK Milawati, Titik. 2009. Peran Pendidik Anak Usia Dini Dalam Mendukung Perkembangan Bahasa Anak. Skripsi, Jurusan Pendidikan Luar Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Kentar Budhojo. Drs. M.pd (II) Umidayati Drs. M.pd Kata Kunci : Pendidikan Anak Usia Dini, Perkembangan Bahasa Anak Pendidikan Anak Usia Dini (PAUD) merupakan pendidikan yang sangat mendasar dan strategis dalam pembangunan sumber daya manusia. PAUD diperuntukkan untuk anak usia 0-6 tahun. Anak usia tersebut dipandang memiliki karakteristik yang berbeda dengan anak usia di atasnya dan anak pada usia tersebut pada masa golden age. PAUD adalah investasi yang sangat besar bagi keluarga dan bangsa, karena PAUD membentuk anak Indonesia yang berkualitas yaitu anak yang tumbuh dan berkembang sesuai dengan tingkat perkembangannya sehingga memiliki kesiapan yang optimal di dalam memasuki pendidikan dasar serta mempengaruhi kehiduapn di masa dewasanya. Tujuan penelitian ini adalah untuk: (1). Mendeskripsikan perkembangan bahasa anak usia dini di PAUD-As Salam, (2). Mendeskripsikan peran pendidik dalam mendukung perkembangan bahasa anak usia dini di KB As-Salam, (3). Mendeskripsikan hambatan-hambatan yang dihadapi dalam mengembangkan kecerdasan bahasa anak usia dini di KB As-Salam Dalam penelitian ini peneliti menggunakan metode penelitian deskriptif. Populasinya adalah 32 orang tua dan 6 tutor kelas di Play Group As-Salam. Pengumpulan data dilakukan dengan menggunakan teknik angket dan dokumentasi. Teknik analisa data yang digunakan dalam penelitian ini adalah deskriptif dengan menggunakan persentase. Hasil penelitian menunjukkan bahwa perkembangan bahasa anak usia dini di kelompok belajar As Salam pada umumnya sangat baik. Hal ini ditunjukkan dengan tercapainya seluruh indikator perkembangan bahasa anak usia dini. Selain itu dari hasil penelitian dapat ditemukan hambatan-hambatan orang tua dalam mengembangkan berbahasa anak usia. Berdasarkan hasil penelitian, disarankan agar: (1) Bagi peneliti selanjutnya, diharapkan untuk melengkapi kekurangan yang ada untuk mengembangkan ilmu tentang Peran Pendidikan Anak Usia Dini Dalam Mendukung Perkembangan Bahasa Anak dan dapat digunakan untuk penelitian-penelitian lanjutan. (2) Bagi Orang Tua sebagai pendidik yang pertama dan paling utama dalam perkembangan anak khususnya perkembangan bahasa anak. Terutama bagi orang tua yang kurang memiliki pengetahuan dan pengalaman, diharapkan tidak enggan untuk menambah ilmunya tentang PAUD terkait dengan perkembangan bahasa anak. (3) Bagi Jurusan Pendidikan Luar Sekolah hendaknya Jurusan PLS menambah referansi kepustakaan mengenai PAUD khususnya tentang perkembangan bahasa anak usia dini. (4) Bagi KB As Salam diharapkan bisa menjadi media perantara dalam pemberian informasi tentang tumbuh kembang anak kepada orang tua dan menghadapi media pembelajaran untuk mengembangkan kecerdasan bahasa anak. Sehingga pendidikan yang diberikan bisa lebih optimal.

Pengaruh scientific approach terhadap keterampilan geografi siswa kelas X SMA Negeri 1 Batu / Aimatus Sholihah

 

Sholihah, Aimatus.2014. Pengaruh Scientific Approach terhadap Keterampilan Geografi Siswa Kelas X SMA Negeri 1 Batu. Skripsi, Jurusan Pendidikan Geografi, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) Drs. Budi Handoyo, M.Si, (2) Purwanto, S.Pd, M.Si Kata Kunci: Scientific Approach, Keterampilan Geografi     Pembelajaran Geografi menekankan aspek hafalan-hafalan tempat, ruang, penduduk dan interaksinya, selain itu menyiapkan peserta didik yang memiliki keterampilan, cakap berpikir  dalam pemecahan masalah (skills), dan memiliki sikap dan nilai-nilai positif (attitudes and values). Salah satu permasalahan yang ada pada saat ini yaitu rendahnya keterampilan geografi. Keterampilan Geografi yang dimiliki siswa akan membantu menerapkan pengetahuan, pemahaman serta menganalisis permasalahan. Scientific Approach salah satu metode yang digunakan dalam proses pembelajaran dan didalamnya mencakup komponen: mengamati, menanya, mengasosiasi, mencoba, dan mengkomunikasikan.     Penelitian ini bertujuan untuk mengetahui pengaruh scientific approach terhadap keterampilan geografi siswa kelas X SMA Negeri 1 Batu. Metode penelitian ini menggunakan penelitian quasi eksperiment. Desain penelitian eksperimen semu (quasi eksperiment) ini adalah pretest-postest control group design. Perlakuan pada kelas eksperimen menggunakan scientific approach, sedangkan pada kelas kontrol diberikan perlakuan dengan metode ceramah dan diskusi. Data dikumpulkan dengan cara pretest dan postest. Analisis data dalam penellitian ini menggunakan uji t (t-test) untuk sampel mandiri (independent sampel).     Hasil penelitian menunjukkan bahwa nilai sig. (2-tailed) adalah 0,000< 0,05 sehingga H0 ditolak, ini berarti ada pengaruh scientific approach terhadap keterampilan geografi siswa kelas X SMA Negeri 1 Batu. Hal ini juga dibuktikan dengan nilai gain score antara kelas kontrol dan kelas eksperimen yang diperoleh masing-masing 14,43 dan 22,27. Dengan demikian dapat disimpulkan bahwa terjadi peningkatan keterampilan geografi siswa antara sebelum dan sesudah adanya perlakuan terhadap kelas kontrol dan kelas eksperimen. Namun dalam pelaksanaannya, harus diperhatikan hal-hal yang penting setiap tahapan scientific approach dan perlu adanya pengelolaan waktu yang baik agar scientific approach dapat terlaksana dengan baik.     

Modernitas individu pelaku mobilitas non permanen ditinjau dari karakteristik demografi penduduk di Kecamatan Gatak Kabupaten Sukoharjo Propinsi Jawa Tengah / oleh Achmad Ardiansyah

 

Kebijakan Pemerintah Daerah dalam upaya peningkatan kesejahteraan Guru (Studi kasus pada Dinas Pendidikan Kota Ternate Maluku Utara) / Irsan Marsaoly

 

Tesis, Program Studi Manajemen Pendidikan, Program Pascasarjana Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Ibrahim Bafadal, M.Pd., (II) Prof. H. Ahmad Sonhadji K.H., M.A., Ph.D. Kata kunci: kebijakan, pemerintah daerah, peningkatan kesejahteraan guru. Peningkatan kualitas suatu bangsa dapat dilakukan melalui sektor pendidikan, sedangkan peningkatan kualitas pendidikan salah satunya dapat dilakukan melalui peningkatan kesejahteraan guru. Dalam dunia pendidikan, keberadaan, peran dan fungsi guru merupakan salah satu faktor yang sangat urgen. Guru merupakan bagian terpenting dalam proses belajar mengajar. Oleh karena itu, dalam setiap kebijakan yang berkaitan dengan upaya peningkatan kualitas pendidikan, tidak dapat dilepaskan dari hal-hal yang berkaitan dengan eksistensi guru itu sendiri, termasuk meningkatkan kesejahteraannya. Yang menjadi fokus dari penelitian ini adalah: (1) kebijakan pemerintah daerah dalam upaya peningkatan kesejahteraan guru di kota Ternate propinsi Maluku Utara, meliputi: a) Pemberian biaya tambahan penghasilan kepada guru, b) tunjangan untuk tenaga guru dikecamatan dan kelurahan daerah terpencil, (2) prosedur implementasi kebijakan pemerintah daerah dalam upaya peningkatan kesejahteraan guru, meliputi: a) Pemberian biaya tambahan penghasilan kepada guru, b) tunjangan untuk tenaga guru, dikecamatan dan kelurahan daerah terpencil, (3) prosedur evaluasi pelaksanaan kebijakan pemerintah daerah dalam upaya peningkatan kesejahteraan guru, meliputi: a) pemberian biaya tambahan penghasilan kepada guru, b) tunjangan untuk tenaga guru, dikecamatan dan kelurahan daerah terpencil. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif dengan rancangan studi kasus dengan mengembangkan konsep dilapangan. Teknik pengumpulan data yang digunakan adalah observasi, wawancara mendalam dan dokumentasi. Pemilihan informan penelitian dilakukan secara snowball sampling. data yang terkumpul dianalisis secara deskreptif dengan alur: (1) reduksi data, (2) penyajian data, (3) penarikan kesimpulan. Agar memperoleh keabsahan data dilakukan melalui: (1) uji kredibilitas yang terdiri dari Triangulasi, Member cek, dan Pendapat para ahli; (2) dependabilitas; dan (3) konfirmabilitas. Hasil penelitian menunjukkan: pertama kebijakan pemerintah kota Ternate dalam upaya peningkatan kesejahteraan guru mengacu pada Surat keputusan walikota Ternate No 157 tahun 2008 tentang pemberian biaya tambahan penghasilan kepada pegawai negeri sipil dilingkungan pemerintah kota Terante dan Surat keputusan walikota Terate No. 800/1821/2008 tentang penetapan besarnya tunjangan untuk tenaga guru, tenaga kesehatan dan pegawai negeri sipil umum di kecamatan dan kelurahan daerah terpencil dalam wilayah pemerintah kota Ternate. Kedua implementasi kebijakan pemerintah kota dalam upaya peningkatan kesejahteraan guru bersifat (top-down) yakni dasar hukum dari adanya pencairan dana tersebut mengacu pada Surat keputusan walikota Ternate No 157 tahun 2008 dan surat keputusan walikota Ternate No. 800/1821/2008 yang dilanjutkan oleh Sekda kota, dan bagian hukum. kemudian dari Sekda kota dilanjutkan ke badan pencatat kekayaan dan keuangan serta aset daerah, selanjutnya ke bendahara pemda kota, bendahara dinas pendidikan, bendahara Sekolah selanjutnya di distribusikan kepada guru/pegawai negeri sipil umum secara langsung jika sekolah tersebut statusnya negeri. Sedangkan bagi guru/pegawai yang bertugas di sekolah swasta dapat menerima langsung di bendahara dinas pendidikan kota Ternate karena di sekolah swasta tidak memiliki bendahara sekolah yang ditunjuk oleh pemerintah kota. Adapun prosedur implementasi kebijakan dalam rangka upaya peningkatan kesejahteraan guru di kota Ternate diawali dengan: (1) sosialisasi kebijakan kepada jajaran terkait, (2) pendataan jumlah guru/pegawai negeri sipil umum lainnya, dan (3) pelaksanaan kebijakan dimaksud. Ketiga, evaluasi pelaksanaan kebijakan pemerintah kota Ternate dalam upaya peningkatan kesejahteraan guru sudah sesuai dengan prosedur yang telah disusun anatara lain tahapannya sebagai berikut: (1) pengamatan, (2) wawancara, (3) pemeriksaan dokumen, (4) pengisian kuisioner, dan (5) pelaporan hasil evaluasi program. Dari hasil penelitian dapat direkomendasikan sebagai berikut: (1) Bagi pemerintah kota Ternate, perlu adanya kebijakan yang mengarah ke upaya peningkatan kesejahteraan pegawai negeri sipil akan tetapi kebijakannya lebih khusus kepada guru dan tenaga kependidikan. (2) Bagi dinas pendidikan kota Terante, agar berkoordinasi yang insentif dengan walikota untuk merumuskan kebijakan yang mengarah pada peningkatan kesejahteraan guru dan tenaga kependidikan sehingga dapat mendorong semangat para guru dan tenaga kependidikan lainnya dalam tugas sehari-hari guna peningkatan mutu pendidikan di kota Ternate. (3) Bagi guru, agar mengevaluasi dan meningkatkan kinerjanya karena guru sebagai manusia menjadi sorotan utama dalam berbagai kesempatan dan forum. Sehingga guru yang memiliki pekerjaan sampingan di luar jam mengajarnya di sekolah hendaknya dapat mempertahankan eksistensi dirinya sebagai sosok guru yang dinamis, inovatif, dan kreatif selama pemerintah belum mampu memenuhi standar kesejahteraan guru yang diharapkan, (4) Bagi peneliti selanjutnya, dapat dijadikan acuan dalam rangka upaya perbaikan kedepan, jika metodologi dan temuan penelitian ini dinilai kredibel dan relevan, maka dapat dimanfaatkan sebagai referensi dalam meneliti kasus sejenis dengan fokus lebih mendalam atau pada lembaga lain.

Perancangan film animasi tentang 4 tipe kepribadian, sanguinis, koleris, melankolis, dan plegmatis untuk remaja usia 13 tahun keatas / Risa Mariana Hutabarat

 

ABSTRAK Hutabarat, Risa Mariana. Oktober 2015. Perancangan Film Animasi 2D Penjelasan tentang 4 Tipe Kepribadian Sanguinis, Koleris, Melankolis dan Plegmatis untuk Usia 13 Tahun Keatas. Tugas Akhir, Jurusan Seni dan Desain, Fakultas Sastra Universitas Negeri Malang. Pembimbing; (I) Joko Samodra, S.Kom (II) Mitra Istiar Wardhana, S.Kom, M.T Kata Kunci : Perancangan, Animasi, Kepribadian, Sanguin, Koleris, Melankolis, Plegmatis Kepribadian adalah bentuk atau sifat yang ada pada seseorang. Ada 4 tipe kepribadian manusia yang dapat menggambarkan sebagian besar sifat seseorang. Kepribadian tersebut yakni Sanguin, Koleris, Melankolis dan Plegmatis. Mayoritas masyarakat belum mengetahui tentang macam – macam kepribadian manusia. Salah satu cara untuk meberikan informasi tentang 4 tipe kepribadian manusia adalah dengan media. Media animasi 2D merupakan media menarik untuk digunakan sebagai penyampaian informasi. Perancangan tentang 4 tipe kepribadian ini dimaksudkan untuk menjelaskan serta menciptakan karakter imajinatif yang akan digunakan untuk pembuatan film animasi informatif. Proses perancangan untuk film animasi tentang 4 kepribadian manusia ini terdiri dari 3 tahap : (1) praproduksi yang merupakan tahap awal dalam perancangan sebuah produk; terdiri dari kegiatan penyusunan konsep karya serta pengumpulan data dan bahan-bahan yang dibutuhkan untuk memproduksi karya, (2) Produksi merupakan proses pengerjaan dengan mengolah bahan-bahan yang telah dikonsep sebelum hingga menghasilkan suatu produk jadi, dan (3) pascaproduksi yang merupakan tahap visualisasi desain yang telah dikerjakan pada proses produksi. Hasil perancangan ini berupa desain karakter dan animasi dari Empat tipe Kepribadian Manusia yakni Sanguin, Koleris, Melankolis, dan Plegmatis untuk keperluan pembuatan animasi informatif. Animasi yang memunculkan karakter sanguin, koleris, melankolis, dan plegmatis secara imajinatif

Sejarah paguyuban wayang kulit "Setio Laras" 1978-2012 Dusun Rembu Desa Japanan Kecamatan Kemlagi Kabupaten Mojokerto / Ika Wulan Actisya

 

Actisya, Ika Wulan. 2014. Sejarah Paguyuban Wayang Kulit “Setio Laras” 1978-2012 Dusun Rembu Desa Japanan Kecamatan Kemlagi Kabupaten Mojokerto. Skripsi, Jurusan Pendidikan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing; (1) Drs. I Wayan Legawa, M.Si. (II) Drs. Irawan, M.Hum. Kata Kunci: Wayang Kulit, Paguyuban “Setio Laras”, Mojokerto      Kesenian wayang kulit merupakan salah satu kesenian tradisional yang mampu bertahan di dalam era globalisasi. Salah satu paguyuban yang bergerak dalam melestarikan kesenian wayang kulit di Kabupaten Mojokerto adalah paguyuban “Setio Laras”. Paguyuban “Setio Laras” didirikan pada tahun 1978 oleh Bapak Hadi Suparto. Penelitian ini ditekankan tentang perkembangan dari paguyuban “Setio Laras” mulai dari awal berdiri hingga tahun 2012. Perkembangan paguyuban ini menarik untuk dikaji, karena mampu bertahan dalam persaingan dengan budaya modernisasi.     Rumusan masalah penelitian ini adalah: (1) Bagaimana latar belakang berdirinya paguyuban “Setio Laras” di Kabupaten Mojokerto? (2) Bagaimana perkembangan paguyuban “Setio Laras” (1978-2012) di Kabupaten Mojokerto?. Penelitian ini dilakukan dengan tujuan untuk mendeskripsikan sejarah berdirinya paguyuban “Setio Laras” serta perkembangannya dalam dunia seni pertunjukkan tahun 1978-2012.     Penulisan skripsi ini menggunakan metode penelitian sejarah. Metode penelitian sejarah terdiri dari lima tahapan yaitu (1) pemilihan topik, (2) heuristik yaitu tahapan untuk pengumpulan data baik primer maupun sekunder, (3) kritik sumber atau verifikasi yaitu tahapan untuk menguji keabsahan sumber yang diperoleh, (4) interpretasi yaitu penggambaran data dan informasi yang sudah diolah agar mudah dipahami, (5) historiografi tahapan dalam penyajian data penelitian secara sistematis.     Berdasarkan penelitian yang dilakukan diperoleh kesimpulan bahwa berdirinya paguyuban “Setio Laras” tidak lepas dari peran Bapak Hadi Suparto. Kecintaan beliau terhadap seni pewayangan yang mendorong beliau untuk belajar mendalang dengan cara nyantrik di dalang senior. Faktor ekonomi juga mempengaruhi pilihan beliau untuk menjadi cantrik dari Dalang Suleman. Perkembangan paguyuban “Setio Laras” pada tahun 1984 hingga tahun 1990an berada pada masa kejayaannya. Perkembangan paguyuban ini sempat mengalami kemunduran akibat dari adanya masuknya video layar tancap pada tahun 1994 dan krisis moneter 1997. Pengakuan UNESCO pada tahun 2003, tidak membawa perubahan dalam perkembangan paguyuban ini. Paguyuban ini mulai mengalami peningkatan dari tahun 2010 hingga 2012, berkat upaya yang dilakukan oleh Bapak Hadi Suparto dengan mengikuti sarasehan yang diadakan oleh pemerintah.     Saran bagi peneliti selanjutnya diharapkan dapat membahas keberadaan paguyuban sebagai organisasi yang bergerak untuk komersialisasi kesenian wayang kulit. Selain itu keberadaan paguyuban yang mulai terpinggirkan dalam era globalisasi menarik untuk dikaji. Perubahan sosial yang terjadi di dalam masyarakat telah mempengaruhi makna dari keberadaan paguyuban.

Perbedaan prestasi belajar antara siswa yang diajar menggunakan pembelajaran kooperatif model TGT dan siswa yang diajar menggunakan pembelajaran ekspositori pada pokok bahasa teorema phytagoras di MTsN Malang II / oleh KHusnul Hidaya

 

Pelaksanaan metode pembelajaran team teaching pada program keahlian teknik gambar bangunan di SMK Negeri 1 Singosari / Ifa Maulidia

 

Kata Kunci: metode pembelajaran, team teaching, gambar bangunan. Pemerintah senantiasa meningkatkan mutu pendidikan di Indonesia. Hal ini bertujuan untuk meningkatkan kualitas siswa yang nantinya bisa sejajar dengan negara lain dan akhirnya mampu bersaing di era global. Berbagai metode digunakan untuk mencapai tujuan tersebut. Salah satu metode yang disajikan guna meningkatkan kemampuan siswa di sini adalah Team Teaching. Metode inilah yang saat ini diterapkan di SMK Negeri 1 Singosari untuk meningkatkan kemampuan siswa. Selain untuk meningkatkan mutu , over load tenaga pengajar di sekolah merupakan alasan diberlakukannnya team teaching . Khususnya saat sekarang ini adalah terkumpulnya tenaga pengajar pada disiplin ilmu yang sama di satu sekolah, dalam konteks ini adalah sekolah negeri. Team teaching adalah suatu kegiatan yang melibatkan beberapa orang guru (kolaborasi) yang bertujuan untuk peningkatan mutu. Metode ini juga digunakan untuk menagani suatu persoalan yang dihadapi siswa pada saat kegiatan pembelajaran di kelas. Tujuan SMK Negeri 1 Singosari menerapkan metode pembelajaran team teaching yaitu dengan tersedianya lebih dari satu guru dalam satu kelas, akan membuat siswa bebas meminta pelayanan dalam memecahkan masalah dan mendiskusikannya tanpa adanya batasan-batasan yang biasa mereka temui dalam kegiatan belajar reguler Penelitian ini bertujuan untuk mendeskripsikan: (1) pelaksanaan pembelajaran dengan menggunakan metode team teaching pada program keahlian gambar bangunan SMKN 1 Singosari, (2) hambatan-hambatan yang terjadi serta (3)upaya yang dilakukan untuk menanggulangi hambatan yang terjadi. Jenis penelitian yang digunakan dalam penelitian ini adalah penelitian deskriptif kualitatif. Penelitian kualitatif dilakukan pada kondisi alamiah dan bersifat penemuan. Data penelitian yang dipaparkan berupa hasil wawancara, catatan lapangan, dan dokumentasi. Wawancara dilakukan terhadap 2 macam sumber yaitu terhadap guru dan siswa. Sedangkan untuk metode observasi, peneliti mengguanakan metode observasi partisipasi (participant observation). Observasi partisipasi adalah metode pengumpulan data yang digunakan untuk menghimpun data penelitian melalui pengamatan dan pengindraan dimana observer atau peneliti benar-benar terlibat dalam keseharian responden. Analisis data dalam penelitian ini meliputi: 1.Reduksi Data, yang terdiri dari proses identifikasi satuan, koding yaitu pemberian kode pada setiap satuan terkecil, 2.Kategorisasi, 3.Sintesisasi. Tahap-tahap yang dilakukan dalam penelitian ini meliputi tahap pra lapangan, tahap lapangan dan pengolaan data. Untuk menjaga keabsahan data digunakan triangulasi data. Analisis data yang digunakan adalah menggunakan metode perbandingan tetap (Constant Comparative Method) karena membandingkan satu datum dengan datum lain, dan kemudian secara tetap membandingkan kategori dengan kategori lain. Uji keabsahan data menggunakan uji kredibilitas yang meliputi : (1) Perpanjangan Pengamatan, (2) Peningkatan Ketekunan dan (3) Triangulasi Paparan data dan hasil temuan yang didapat yaitu berupa profil SMKN 1 Singosari, data responden, hasil wawancara, observasi dan dokumentasi. Selanjutnya dari hasil wawancara, observasi dan dokumentasi dikorelasikan dalam tabel triangulasi. Berdasarkan hasil analisis data tersebut maka disimpulkan 3 kesimpulan yaitu: (1) Pelaksanaan metode pembelajaran team teaching pada SMK Negeri 1 Singosari dilaksanakan oleh dua guru yang mengajar dalam satu kelas, pada hampir semua mata pelajaran dan dapat meningkatkan prestasi siswa., (2) hambatan yang terjadi dalam pelaksanaan team teaching adalah terjadinya dominasi mengajar, kebosanan dalam mengajar, perbedaan penyampaian materi. (3) upaya dalam menganggulangi hambatan tersebut adalah koordinasi dalam mengajar, mencari aktifitas lain untuk guru yang tidak menerangkan materi., pembagian bab yang akan diajarkan kepada siswa

Rekayasa sambungan purus dengan perkuatan baut terhadap kekuatan lentur untuk mebel bambu cendani / Ervan Djunaidi

 

ABSTRAK Djunaidi, Ervan. 2016. Rekayasa Sambungan Purus dengan Perkuatan Baut terhadap Kekuatan Lentur untuk Mebel Bambu Cendani. Skripsi, Program Studi S1 Pendidikan Teknik Bangunan Fakultas Teknik Universitas Negeri Malang. Pembimbing: (I) Dr. Karyadi, S.Pd., M.P., M.T. (II) Drs. Eko Suwarno, M.Ed., M.Pd. Kata Kunci: kekuatan dan lendutan, sambungan purus, perkuatan baut ada dan tanpa ring, dan bambu ada (nodia) dan tanpa nodia (internodia). Bambu cendani (Phyllostachys Aurea A. & Ch. Riviera) merupakan salah satu bambu yang sering digunakan dalam pembuatan produk mebel/furniture oleh pengusaha kerajinan bambu. Dalam penelitian ini menggunakan sambungan purus. Penelitian yang dilakukan (Nugraha, 2012) dan (Abad, 2015) sama – sama mengetahui tegangan geser sambungan bambu yang di uji tarik. Belum ada pengujian lentur pada bambu cendani dan uji lentur pada sambungan mebel amat penting untuk mengetahui kekuatan dan lendutan bambu. Tujuan dari penelitian ini yaitu: (1) kekuatan dan lendutan sambungan purus dengan baut ada ring pada (nodia); (2) kekuatan dan lendutan sambungan purus dengan baut tanpa ring pada (nodia); (3) kekuatan dan lendutan sambungan purus dengan baut ada ring pada (internodia); (4) kekuatan dan lendutan sambungan purus dengan baut tanpa ring pada (internodia); (5) perbedaan kekuatan sambungan purus dengan baut ada dan tanpa ring, sambungan purus dengan baut pada bambu ada dan tanpa nodia dan antara ring-nodia. Dalam penelitian ini menggunakan analisis variasi dua jalur yaitu ANOVA dua jalur untuk menguji hipotesis dengan bantuan aplikasi SPSS versi 16, dengan taraf signifikansi 0,05. Tujuannya untuk mengetahui perbedaan kekuatan sambungan purus dengan baut ada dan tanpa ring, sambungan purus dengan baut pada bambu ada dan tanpa nodia dan antara ring-nodia. Hasil penelitian ini menunjukan : (1) kekuatan sambungan dan lendutan pada baut – dengan ring pada nodia bambu. Masing – masing 24,75 kg - 28,58 kg dan lendutan 2,70 cm - 3,21 cm, (2) kekuatan sambungan dan lendutan pada baut – tanpa ring pada nodia bambu. Masing – masing 22,50 kg - 36,90 kg dan lendutan 2,64 cm - 3,23 cm, (3) kekuatan sambungan dan lendutan pada baut – dengan ring pada internodia bambu. Masing – masing 49,50 kg - 63,68 kg dan lendutan 3,00 cm - 4,14 cm, (4) kekuatan sambungan dan lendutan pada baut – tanpa ring pada internodia bambu. Masing – masing 63,23 kg - 68,63 kg dan lendutan 2,19 cm - 3,69 cm. Hasil penelitian ini disimpulkan bahwa : (1) sambungan purus - baut dengan dan tanpa ring tidak berpengaruh terhadap kekuatan sambungan, (2) Sambungan purus - baut pada nodia dan internodia bambu tidak berpengaruh terhadap kekuatan sambungan., (3) Tidak ada hubungan antara ring dengan nodia dan antara nodia dengan ring, ring dan nodia berdiri sendiri.

Pengembangan modul online berbasis scientific approach sebagai implementasi kurikulum 2013 pada materi usaha dan energi untuk meningkatkan prestasi belajar siswa kelas XI SMA Negeri 7 Malang / Febriyana Faradila Asokawati

 

ABSTRAK Asokawati, Febriyana Faradila. 2016. Pengembangan Modul Online Berbasis Scientific Approach sebagai Implementasi Kurikulum 2013 pada Materi Usaha dan Energi untuk Meningkatkan Prestasi Belajar Siswa Kelas XI SMA Negeri 7 Malang. Skripsi, Jurusan Fisika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Drs. Purbo Suwasono, M.Si, (II) Drs. H. Winarto, M.Pd. Kata Kunci: Modul, Scientific Approach, Website, Prestasi Belajar. Pembelajaran pada Kurikulum 2013 menggunakan pendekatan saintifik. Sehingga pada implementasinya siswa dituntut aktif dalam pembelajaran khususnya pada pelajaran Fisika. Pada proses pembelajaran siswa diharapkan mampu mengkonstruk konsep, hukum, atau prinsip melalui kegiatan 5M yaitu mengamati, menanya, mengeksplorasi, mengasosiasi, dan mengkomunikasikan hasil belajar siswa. Oleh karena itu perlu adanya pengembangan bahan ajar berupa modul online berbasis Scientific Approach yang dapat memfasilitasi kegiatan belajar siswa sesuai dengan tuntutan kurikulum 2013. Menurut permendikbud Nomor 103 tahun 2014 dijelaskan bahwa selain menggunakan pendekatan saintifik pada proses pembelajaran, guru juga dituntut agar mampu memanfaatkan secara optimal teknologi informasi dan komunikasi saat mengajar di kelas agar materi yang diajarkan dapat diterima siswa secara optimal. sehingga modul yang dikembangkan dalam penelitian ini akan disajikan dalam bentuk website yang dapat diakses siswa secara online agar guru lebih terampil dalam memanfaatkan sarana teknologi dan komunikasi di sekolah serta penggunaan kertas dapat diminimalisir. Penelitian ini mengadaptasi langkah-langkah penelitian dan pengembangan Borg and Gall dalam Sukmadinata. Jenis data penelitian berupa data kualitatif dan data kuantitatif yang diperoleh dari hasil validasi oleh dosen ahli materi, guru, dan uji coba terbatas pada siswa. Data kualitatif berupa komentar dan saran sedangkan data kuantitatif berupa nilai rentangan skala 1-4 yang diperoleh dari lembar validasi yang diberikan secara langsung kepada validator. Setelah divalidasi produk pengembangan direvisi dan di uji coba terbatas pada siswa baru kemudian diterapkan kepada siswa untuk uji coba prestasi belajar siswa. Data yang diperoleh dari lembar validasi dihitung dengan teknik analisis rata-rata sedangkan nilai hasil uji prestasi belajar siswa dianalisis dengan membandingkan nilai test yang diperoleh siswa dengan nilai KKM pelajaran Fisika. Hasil persetase rerata uji kelayakan website dari validator dosen ahli dan guru adalah sebesar 97,50% sehingga uji kelayakan website termasuk dalam kriteria Layak. Sedangkan hasil persetase rerata uji kelayakan modul dari kedua validator adalah sebesar 86,21% dan masih termasuk dalam kriteria layak. Hasil uji coba keterbacaan pada siswa didapat respon yang baik dari siswa. kemudian berdasarkan hasil uji prestasi belajar siswa didapat presentase kelulusan siswa sebesar 100% diatas nilai KKM pelajaran Fisika. Kesimpulan secara keseluruhan modul online berbasis scientific approach ini layak digunakan pada pembelajaran dan dapat meningkatkan prestasi belajar siswa.

Analisis komparatif kinerja keuangan sebelum dan sesudah akuisisi : studi pada perusahaan yang listing di Bursa Efek Jakarta / oleh Ari Widiyanti

 

Studi spesies kupu-kupu family Papilionidae dan Lycanidae serta status perlindungannya di kawasan wisata air terjun Coban Rais Kota Batu / Warda Venia Ningtias

 

Ningtias, Warda Venia. 2014. Studi Spesies Kupu-kupu Famili Papilionidae dan Famili Lycanidae Serta Status Perlindungannya di Kawasan Wisata Air Terjun Coban Rais Kota Batu. Skripsi, Jurusan Biologi Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Sofia Ery Rahayu, S.Pd, M.Si, (II) Dra Hawa Tuarita, M.S. Kata kunci: kupu-kupu, status perlindungan, coban rais    Kawasan Wisata Air Terjun Coban Rais merupakan kawasan yang endemis bagi penyebaran hewan dan tumbuhan, dimana salah satu hewan yang menarik pada kawasan tersebut adalah kupu-kupu. Kupu-kupu (Lepidoptera) berperan penting dalam ekologi, antara lain sebagai polinator dan bioindikator lingkungan. Tujuan penelitian ini adalah untuk mengetahui jumlah spesies penyusun komunitas kupu-kupu ditinjau dari jenis-jenis kupu-kupu yang ditemukan berserta faktor abiotik yang mempengaruhi keberadaan kupu-kupu dan status perlindungannya di kawasan wisata air terjun Coban Rais    Penelitian ini merupakan penelitian eskriptif eksploratif untuk menangkap kupu-kupu famili Papilionidae dan Famili Lycanidae yang ditemukan di kawasan wisata air terjun Coban Rais. Penelitian dilaksanakan pada bulan Februari sampai Maret 2014 dengan menggunakan metode jelajah. Survei spesies kupu-kupu dilakukan di kawasan wisata air terjun Coban Rais pada lima sektor area yang dimulai dari area parkir sampai menuju air terjun dengan jarak antar sektor 500 m. Penelitian dilakukan dengan tiga kali ulangan antara pukul 07.00 WIB sampai 12.00 WIB. Data ciri morfologi kupu-kupu yang ditemukan di Kawasan Wisata Air Terjun Coban Rais dianalisis secara diskriptif. Identifikasi kupu-kupu yang dilakukan berdasarkan panjang sayap depan, rentang sayap, antena, pola warna serta venasi sayap.    Hasil penelitian ditemukan sembilan spesies kupu-kupu dengan rincian tujuh spesies termasuk famili Papilionidae dan dua spesies dari famili Lycanidae. Sembilan spesies dari famili Papilionidae yaitu Papilio memnon, Papilio polytes, Papilio demoleus, Papilio paris, Troides helena, Graphium agamemon, dan Graphium sarpedon. Dua spesies dari Lycanidae yaitu Udara akasa dan Arhopala athada. Dari sembilan spesies yang ditemukan Troides helena merupakan spesies yang tergolong kategori spesies yang dilindungi berdasarkan Peraturan Pemerintah No 7 Tahun 1999, CITES dan buku Precious and Protected Indonesian Butterflies. Suhu, kelembaban udara, dan intensitas cahaya berpengaruh terhadap jumlah spesies yang ditemukan di kawasan wisata air terjun Coban Rais

Penerapan metode SQ3R (Survey, Queation, Read, Recite/Recall, Review) pada pembelajaran Kecamatan Pasrepan Kabupaten Pasuruan / oleh Susi Kurniawardani

 

Pemanfaatan limbah udang sebagai bahan baku saus udang (shrimp sauce) serta aplikasinya pada masakan mujair saus udang / Shanti Dri Lestari

 

ABSTRAK Lestari, S, D. 2016. Pemanfaatan Limbah Udang Sebagai Bahan Baku Saus Udang (Shrimp Sauce) Serta Aplikasinya Pada Masakan Mujair Saus Udang. Skripsi, Jurusan Teknologi Industri, Fakultas Teknik, Universitas Negeri Malang. Pembimbing: (1) Dr. Ir. Soenar Soekopitojo, M. Si., (2) Dr. Dra. Mazarina Devi, M.Si. Kata Kunci : limbah udang, hidrolisis, saus udang Meningkatnya produksi udang di Indonesia saat ini berdampak semakin tinggi pula limbah yang dihasilkan. Diperkirakan dihasilkan limbah sebesar 325.000 ton/tahun. Pemanfaatan limbah udang menjadi saus udang serta mengaplikasikannya pada masakan mujair saus udang merupakan salah satu inovasi untuk meningkatkan nilai ekonomi limbah udang. Tujuan penelitian ini adalah untuk mengetahui: kandungan protein limbah udang dan saus udang, kandungan logam berat (Pb) limbah udang dan saus udang, tingkat perbedaan aroma, rasa dan warna saus udang dengan saus tiram komersial serta tingkat kesukaan panelis terhadap masakan mujair saus udang melalui uji organoleptik. Penelitian ini merupakan penelitian eksperimen dengan Rancangan Acak Lengkap (RAL) dua kali pengulangan, analisis data uji perbedaan sifat organoleptik saus udang dan saus tiram komersial menggunakan tabel Critical Number of Correct Responses in a Duo-Trio Test dan analisis data sifat hedonik aroma, rasa serta warna masakan mujair saus udang menggunakan ANOVA dengan dilanjutkan DMRT. Hasil penelitian ini menunjukkan bahwa kandungan protein limbah udang sebesar 18,281% dan kandungan protein saus udang sebesar 6,107%. Kandunganlogam berat (Pb) pada limbah udang sebesar 0,750 mg/kg sedangkan kandungan logam berat (Pb) pada saus udang sebesar 0,052 mg/kg. Hasil uji organoleptik menunjukkan bahwa aroma, rasa dan warna saus udang berbeda dengan aroma, rasa dan warna saus tiram komersial sedangkan hasil uji hedonik menunjukkan bahwa tidak ada perbedaan terhadap sifat hedonik aroma dari ketiga masakan tersebut namun, terdapat perbedaan terhadap sifat hedonik rasa dan sifat hedonik warna pada ketiga masakan tersebut. Panelis lebih menyukai masakan mujair saus tiram komersial dari segi aroma, rasa dan warna dari pada masakan mujair saus udang dan masakan mujair campuran saus udang dan saus tiram komersial (1:1). Perlu adanya perbaikan formula lebih lanjut pada saus udang agar bisa menyerupai saus tiram komersial dari segi aroma, rasa dan warna.

Rancangan pembelajaran kooperatif metode numbered heads together pada pokok bahasan operasi pecahan bentuk aljabar pada siswa kelas VIII SMP Negeri 8 Kota Blitar / Suhardiono

 

ABSTRAK Suhardiono. 2008.Rancangan Pembelajaran Kooperatif Metode Numbered Heads Together Pada Pokok Bahasan Operasi Pecahan Bentuk Aljabar Pada Siswa Kelas VIII. Skripsi. Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing (I) Rini Nurhakiki, M.Pd, (II) Dr. Cholis Sa’dijah, M.Pd, M.A Kata Kunci: Rancangan Pembelajaran, Numbered Heads Together Rancangan Pembelajaran merupakan komponen yang sangat penting dalam suatu proses pembelajaran yang harus dikembangkan secara operasional dan rinci.Dalam pengembangan rancangan pembelajaran guru diberikan kebebasan untuk memodifikasi sesuai dengan kondisi sekolah didaerahnya.Jika metode dan rancangan pembelajaran dapat dipilih dengan tepat oleh seorang guru maka minat siswa dalam mengikuti pembelajaran akan meningkat dan secara otomatis akan meningkatkan prestasi belajar siswa. Penulisan ini bertujuan untuk menyusun rancangan pembelajaran kooperatif model numbered heads together pada pokok bahasan operasi aljabar untuk siswa kelas VIII. Numbered Heads Together merupakan salah satu model pembelajaran kooperatif yang dikembangkan oleh Spencer Kagan. Model pembelajaran ini selalu diawali dengan membagi kelas dengan beberapa kelompok dan tiap siswa dalam kelompok diberikan nomor urut sesuai banyaknya anak dalam kelompok tersebut untuk memudahkan kinerja kelompok, Mengubah posisi kelompok, menyusun materi, mempresentasikan dan mendapat tanggapan dari kelompok lain. Rancangan pembelajaran yang telah disusun kemudian divalidasi yang mana hasil dari validasi rancangan pembelajaran ini berupa penilaian yang diberikan oleh validator yang terdiri satu dosen matematika UM dan satu guru matematika SMP. Dari validasi tersebutlah dapat dinyatakan rancangan pembelajaran yang dihasilkan sudah valid. Setelah memperoleh hasil validasi terhadap rancangan pembelajaran tersebut, untuk langkah selajutnya penulis mengujicobakan rancangan pembelajaran yang telah disusun tersebut ke lapangan. Mengetahui, ABSTRACT Suhardiono. 2008. Cooperative Learning Design of Numbered Heads Together Method in the Discussion of Fractional Operation in the Form of Algebra for Eighth Grade Students. Thesis. Mathematic Department. Mathematic and Science Faculty. State University of Malang. Advisors: (I) Rini Nurhakiki, M.Pd, (II) Dr. Cholis Sa’dijah, M.Pd., M.A. Keywords: Learning Design, Numbered Heads Together Learning design is a very important component in the learning process that must be developed operationally. In addition, it must be developed in a detail. In the development of learning design, a teacher is free to modify it in accordance to the need of his school condition. If the learning method and design are chosen appropriately, students’ interest of learning will increase that in turn will increase students’ achievement automatically. This research aims at arranging cooperative learning design of numbered heads together method in the discussion of fractional operation of in the form of algebra for eighth grade students. Numbered Heads Together is one of cooperative learning models which is developed by Spencer Kagan. This learning model is always initiated by dividing students in the classroom into several groups at which each student in each group will be given serial number from the total students in the group so that it will ease the performance of group, change the groups’ position, arrange materials, present and is given feedback from other groups. The arranged learning design then validated in which the result of learning design validation is in the form of score given by validators consisting of a lecturer of Mathematic Department, State University of Malang and a mathematic teacher of Junior High School. It is based on the validation that the learning design is considered valid. After obtaining the result of validation of learning design, the researcher tries it out in the field. Approval, ABSTRAK Suhardiono. 2008.Rancangan Pembelajaran Kooperatif Metode Numbered Heads Together Pada Pokok Bahasan Operasi Pecahan Bentuk Aljabar Pada Siswa Kelas VIII. Skripsi. Jurusan Matematika FMIPA Universitas Negeri Malang. Pembimbing (I) Rini Nurhakiki, M.Pd, (II) Dr. Cholis Sa’dijah, M.Pd, M.A Kata Kunci: Rancangan Pembelajaran, Numbered Heads Together Rancangan Pembelajaran merupakan komponen yang sangat penting dalam suatu proses pembelajaran yang harus dikembangkan secara operasional dan rinci.Dalam pengembangan rancangan pembelajaran guru diberikan kebebasan untuk memodifikasi sesuai dengan kondisi sekolah didaerahnya.Jika metode dan rancangan pembelajaran dapat dipilih dengan tepat oleh seorang guru maka minat siswa dalam mengikuti pembelajaran akan meningkat dan secara otomatis akan meningkatkan prestasi belajar siswa. Penulisan ini bertujuan untuk menyusun rancangan pembelajaran kooperatif model numbered heads together pada pokok bahasan operasi aljabar untuk siswa kelas VIII. Numbered Heads Together merupakan salah satu model pembelajaran kooperatif yang dikembangkan oleh Spencer Kagan. Model pembelajaran ini selalu diawali dengan membagi kelas dengan beberapa kelompok dan tiap siswa dalam kelompok diberikan nomor urut sesuai banyaknya anak dalam kelompok tersebut untuk memudahkan kinerja kelompok, Mengubah posisi kelompok, menyusun materi, mempresentasikan dan mendapat tanggapan dari kelompok lain. Rancangan pembelajaran yang telah disusun kemudian divalidasi yang mana hasil dari validasi rancangan pembelajaran ini berupa penilaian yang diberikan oleh validator yang terdiri satu dosen matematika UM dan satu guru matematika SMP. Dari validasi tersebutlah dapat dinyatakan rancangan pembelajaran yang dihasilkan sudah valid. Setelah memperoleh hasil validasi terhadap rancangan pembelajaran tersebut, untuk langkah selajutnya penulis mengujicobakan rancangan pembelajaran yang telah disusun tersebut ke lapangan. Mengetahui, ABSTRACT Suhardiono. 2008. Cooperative Learning Design of Numbered Heads Together Method in the Discussion of Fractional Operation in the Form of Algebra for Eighth Grade Students. Thesis. Mathematic Department. Mathematic and Science Faculty. State University of Malang. Advisors: (I) Rini Nurhakiki, M.Pd, (II) Dr. Cholis Sa’dijah, M.Pd., M.A. Keywords: Learning Design, Numbered Heads Together Learning design is a very important component in the learning process that must be developed operationally. In addition, it must be developed in a detail. In the development of learning design, a teacher is free to modify it in accordance to the need of his school condition. If the learning method and design are chosen appropriately, students’ interest of learning will increase that in turn will increase students’ achievement automatically. This research aims at arranging cooperative learning design of numbered heads together method in the discussion of fractional operation of in the form of algebra for eighth grade students. Numbered Heads Together is one of cooperative learning models which is developed by Spencer Kagan. This learning model is always initiated by dividing students in the classroom into several groups at which each student in each group will be given serial number from the total students in the group so that it will ease the performance of group, change the groups’ position, arrange materials, present and is given feedback from other groups. The arranged learning design then validated in which the result of learning design validation is in the form of score given by validators consisting of a lecturer of Mathematic Department, State University of Malang and a mathematic teacher of Junior High School. It is based on the validation that the learning design is considered valid. After obtaining the result of validation of learning design, the researcher tries it out in the field. Approval,

Pengaruh disiplin kerja terhadap produktivitas kerja karyawan (studi pada CV Indonesia Jersey Malang) / Ferdianta Hendrawan

 

ABSTRAK Hendrawan, Ferdianta.2009. Pengaruh Disiplin Kerja Terhadap Produktivitas Kerja Karyawan (Studi Pada CV Indonesia Jersey Malang). Skripsi, Program studi S1 Manajemen Sumber Daya manusia Fakultas Ekonomi Universitas Negeri Malang. Pembimbing: (I) Drs. I Nyoman Saputra, M.Si (II) Elfia Nora, SE, M.Si Kata Kunci: Disiplin Kerja, Produktivitas Kerja Manusia merupakan salah satu sumber daya perusahaan yang mempunyai nilai prakarsa dan mempunyai peran serta dalam penggunaan sumber daya lain yang ada didalam perusahaan. Sistem pengelolaan sumber daya manusia yang tepat merupakan kunci keberhasilan perusahaan untuk mencapai tujuannya. Perusahaan dalam menjalankan usahanya terus didukung oleh oleh sumber daya manusia yaitu karyawan-karyawan yang sifat dan sikap disiplin yang baik, mempunyai daya tanggap yang tinggi, inisiatif dan kreatif dan sebagainya. Oleh karena itu manusia sangatlah penting karena selain sebagai obyek manajemen juga sebagai pelaksana. Untuk itu peranan seorang pemimpin dalm perusahaan semakin penting artinya dalam upaya meningkatkan produktivitas kerja karyawan. Untuk mencapai tujuan tersebut perusahaan memerlukan seorang pemimpin yang mampu mengkoordinasikan sumber daya manusia yang dipimpinnya ke arah tujuan yang di inginkan melalui berbagai sikap disiplin kerja yang sesuai dengan kondisi dan situasi perusahaan. Penelitian ini bertujuan untuk: (1) Mengetahui tingkat disiplin kerja yang meliputi disiplin waktu dan sikap CV Indonesia Jersey Malang. (2) Mengetahui tingkat produktivitas kerja karyawan CV Indonesia Jersey Malang. (3) Mengetahui pengaruh variabel disiplin waktu terhadap produktivitas kerja karyawan pada CV Indonesia Jersey Malang. (4) Mengetahui pengaruh variabel disiplin sikap terhadap produktivitas kerja karyawan pada CV Indonesia Jersey Malang. (5) Mengetahui pengaruh variabel disiplin waktu, disiplin sikap secara simultan terhadap produktivitas kerja karyawan pada CV Indonesia Jersey. Rancangan penelitian yang digunakan adalah penelitian deskriptif korelasional. Sampel pada penelitian ini adalah 80 karyawan dari jumlah total 422 karyawan yang ada dan diambil secara acak yang ada pada CV Indonesia Jersey Malang. Teknik sampling yang digunakan adalah simple random sampling. Data diperoleh dari responden dengan menggunakan alat pengumpul data berupa kuesioner. Analisis data yang digunakan adalah analisis regresi linier berganda dengan menggunakan bantuan komputer program SPSS 15.0 for windows. Hasil penelitian ini menunjukkan bahwa terdapat pengaruh positif yang sgnifikan dari variabel disiplin kerja yang meliputi disiplin waktu, disiplin sikap terhadap produktivitas kerja karyawan pada CV Indonesia Jersey Malang. Terdapat pengaruh positif yang signifikan secara simultan dari variabel disiplin kerja yang meliputi disiplin waktu, disiplin sikap terhadap produktivitas kerja karyawan pada CV Indonesia Jersey Malang. Berdasarkan penelitian yang telah dilakukan diharapkan bagi peneliti selanjutnya untuk menggali variabel-variabel baru selain disiplin waktu dan disiplin sikap misalnya perilaku tugas dan perilaku hubungan dan beberapa variabel lain yang dapat dijadikan temuan baru dalam penelitian sebelumnya. Sedangkan bagi perusahaan diharapkan mempertahankan dan meningkatkan disiplin kerja yang sudah ada, dan menyesuaikan penerapannya seuai dengan kondisi dan situasi dalam rangka mencapai tujuan perusahaan.

Hubungan antara tingkat pengetahuan berkoperasi anggota dengan partisipasi anggota dalam menyimpan di Koperasi Kredit Abadi Desa Arjosari Kec. Kalipare Kab. Malang
Tarman

 

Pengembangan pola latihan transisi bertahan ke menyerang pada permainan futsal menggunakan pola 4-0 bagi atlet senior BHS Malang / Papink Eka Rulyarni

 

Rulyarni, Papink Eka. 2014. Pengembangan Pola Latihan Transisi Bertahan ke Menyerang Pada Permainan Futsal Menggunakan Pola 4-0 Bagi Atlet Senior BHS Malang. Skripsi, Jurusan Pendidikan Jasmani dan Kesehatan, Fakultas Ilmu Keolahragaan, Universitas Negeri Malang. Pembimbing: (I) Drs. Mu’arifin, M.Pd., (II) I Nengah Sudjana, S.Pd., M.Pd. Kata Kunci: pengembangan, pola latihan, transisi bertahan ke menyerang, futsal, pola 4-0 Futsal merupakan permainan bola sepak yang dimainkan oleh 5 orang dengan lapangan yang lebih sempit dari lapangan sepakbola. Permainan futsal merupakan permainan yang sangat cepat dan dinamis. Dalam permainan futsal terdapat suatu pola transisi permainan, salah satunya transisi bertahan ke menyerang. Berdasarkan penelitian awal yang dilakukan pada tanggal 26 Januari 2014 dengan observasi melalui wawancara dan penyebaran angket kepada 20 atlet senior dan 1 orang pelatih diperoleh data sebagai berikut: 1) karakter tim senior BHS Malang merupakan tim bertahan dengan pola 4-0, 2) atlet sulit melakukan transisi bertahan ke menyerang, 3) kesulitan menempatkan posisi saat melakukan transisi, 4) kurang dukungan dari teman saat seorang atlet menguasai bola, 5) sebagian besar atlet merupakan seorang pelajar sehingga jadwal latihan tidak jarang terbentur dengan jadwal sekolah sehingga atlet kurang disiplin saat mengikuti latihan, 6) pemberian materi latihan transisi bertahan ke menyerang diberikan saat mendekati turnamen saja, 7) dengan frekuensi latihan yang kurang perlu adanya media yang dapat membantu atlet dalam berlatih pola latihan transisi bertahan ke menyerang. Berdasarkan masalah yang telah dipaparkan, maka peneliti menyimpulkan bahwa tim mengalami masalah dalam pergerakan transisi bertahan ke menyerang. Dari permasalahan tersebut, maka disusunlah rancangan produk pengembangan pola latihan transisi bertahan ke menyerang pada permainan futsal menggunakan pola 4-0 bagi atlet senior BHS Malang.     Penelitian ini dilaksanakan dengan tujuan untuk menghasilkan pola latihan transisi bertahan ke menyerang pada permainan futsal menggunakan pola 4-0 bagi atlet senior BHS Malang yang berguna untuk melakukan latihan secara mandiri di luar jadwal latihan. Penelitian ini menggunakan metode penelitian dan pengembangan dari Borg and Gall (1983:775) yang telah dimodifikasi dan disesuaikan dengan keadaan di lapangan mengacu teori Ardhana, adapun langkah-langkah yang diambil sebagai berikut: (1) melakukan observasi melalui wawancara dan penyebaran angket kepada atlet dan pelatih, (2) kajian pustaka, (3) membuat rancangan produk, (4) evaluasi ahli, (5) revisi produk, (6) uji coba kelompok kecil, (7) revisi produk, (8) uji coba kelompok besar, (9) revisi produk akhir, (10) hasil akhir produk. Analisis data dilakukan secara deskriptif baik kualitatif maupun kuantitatif.     Hasil produk yang dikembangkan berupa 9 pola latihan transisi bertahan ke menyerang pada permainan futsal menggunakan pola 4-0 yang disajikan dalam media video. Sembilan pola latihan transisi bertahan ke menyerang terdiri dari: pemanasan dengan 2 bola (menggunakan tangan), pemanasan dengan 2 bola (menggunakan kaki), pemanasan statis, pergerakan formasi dasar 4-0, pola latihan transisi bertahan ke menyerang dari 4-0 menjadi 1-2-1, pola latihan transisi bertahan ke menyerang dari 4-0 menjadi 1-1-2, pola latihan transisi bertahan ke menyerang dari 4-0 menjadi 0-4, game situation, pendinginan.     Produk yang dikembangankan berdasarkan dari saran atau masukanpara ahli, yang terdiri dari 2 ahli kepelatihan futsal 88,5% dan ahli media 72,32%, serta uji coba kelompok kecil 82,79% dan uji coba kelompok besar 82,92%. Sehingga seluruh aspek dalam pengembangan pola latihan transisi bertahan ke menyerang pada permainan futsal menggunakan pola 4-0 ini telah memenuhi kriteria kualitas produk menurut Akbar dan Sriwiyana 75,01%-100% yang bermakna “Sangat Valid (dapat digunakan tanpa revisi)”.     Berdasarkan dari hasil evaluasi ahli dan uji coba kelompok kecil dan besar, maka produk akhir yang dikembangkan berupa 9 pola latihan transisi bertahan ke menyerang pada permainan futsal menggunakan pola 4-0 yang disajikan dalam media video. Hasil pengembangan ini hanya terbatas pada pengembangan produk, maka diharapkan ada peneliti selanjutnya yang dapat menguji tingkat keefektifan dari produk ini dengan uji coba dan ruang lingkup yang lebih luas.

Motivasi tokoh utama dalam novel sang pemimpi karya Andrea Hirata / Lu'luul Faizah

 

Kata kunci: motivasi, tokoh, novel Motivasi adalah daya dorong yang mengakibatkan seseorang mau dan rela untuk mengerahkan kemampuan –dalam bentuk keahlian atau ketrampilan— tenaga dan waktunya untuk menyelenggarakan berbagai kegiatan yang menjadi tanggung jawabnya dan menunaikan kewajibannya, dalam rangka pencapaian tujuan. Macam motivasi ada dua yaitu motivasi intrinsik dan motivasi ekstrinsik. Motivasi intrinsik adalah suatu kegiatan belajar dimulai dan diteruskan berdasarkan penghayatan suatu kebutuhan dan dorongan yang secara mutlak berkaitan dengan aktifitas belajar. Sedangkan motivasi ekstrinsik adalah motivasi yang keberadaannya karena pengaruh rangsangan dari luar. Tokoh Ikal dalam novel Sang Pemimpi karya Andrea Hirata memiliki semangat dalam menempuh hidup dan dalam menggapai mimpinya. Semangat tersebut berasal dari motivasi yang dimiliki Ikal, yang bersumber dari dalam dirinya maupun dari luar dirinya. Oleh sebab itu, pengkajian motivasi tokoh dilakukan. Kajian motivasi tokoh adalah sebuah bagian kajian psikologi sastra yang dimiliki oleh tokoh dalam sebuah cerita. Novel sebagai suatu bentuk representasi kehidupan nyata yang dituangkan pengarang dalam bentuk karya indah yang bersifat fiktif. Kehidupan nyata yang dialami seorang tokoh dalam novel menjadi acuan dalam penelitian. Hal ini disebabkan motivasi tokoh merupakan cerminan perilaku dari tindakan seseorang. Tindakan seseorang tersebut selalu didasari kekuatan yang dapat berasal dari luar dirinya maupun dari dalam dirinya. Kekuatan tersebut merupakan sebuah dorongan untuk berperilaku. Jadi yang menjadi tolok ukur dalam penelitian ini adalah tindakan manusia yang mendapatkan dorongan dari luar dirinya dan dorongan dari dalam dirinya. Penelitian ini bertujuan untuk mengidentifikasi motivasi tokoh utama dalam novel Sang Pemimpi karya Andrea Hirata. Identifikasi motivasi tokoh utama tersebut meliputi: (1) motivasi intrinsik apa sajakah yang terdapat dalam diri tokoh utama; (2) motivasi ekstrinsik apa sajakah yang terdapat dalam diri tokoh utama. Tujuan motivasi tokoh utama di atas dalam penelitian ini yaitu mengarahkan tingkah laku tokoh utama yang memberikan dampak terhadap perkembangan karakter tokoh utama. Selanjutnya, tujuan motivasi juga memberikan dampak terhadap perkembangan alur peristiwa. Penelitian ini termasuk penelitian kualitatif karena menghasilkan data deskripstif yang berupa kata-kata tertulis. Sedangkan pendekatan yang digunakan adalah pendekatan psikologi sastra karena penelitian ini berusaha untuk mengaji motivasi yang dimiliki tokoh dalam cerita sekaligus menghubungkan ke dalam cerita. Data dalam penelitian ini adalah kutipan novel yang berupa paparan narasi dan dialog tentang motivasi tokoh dalam novel Sang Pemimpi karya Andrea Hirata. Sedangkan sumber data dalam penelitian ini adalah novel Sang Pemimpi karya Andrea Hirata tersebut. Novel ini diterbitkan oleh Bentang Pustaka Yogyakarta pada tahun 2009. Dalam penelitian ini peneliti bertindak sebagai human instrument yang bertugas mengumpulkan dan mengolah data. Prosedur pengumpulan data yang digunakan adalah (1) membaca secara kromprehensif dan kritis novel Sang Pemimpi, (2) mengidentifikasi kata-kata yang mengandung motivasi tokoh utama, (3) kodifikasi setiap kata yang ditemukan, dan (4) klasifikasi sesuai rumusan masalah yang disusun. Analisis data dilakukan dengan cara kodifikasi, reduksi data, analisis interpretasi kemudian terdapat hasil temuan. Deskripsi yang diperoleh dari hasil analisis adalah (1) motivasi ekstrinsik yang terdapat dalam diri tokoh utama, meliputi (a) kebutuhan yang berupa fisiologis, rasa aman, kasih sayang, harga diri dan aktualisasi diri; (b) dorongan yang berupa motivasi dari orang tua, motivasi dari A Ling, motivasi dari guru, dan motivasi dari sahabat; (c) tujuan yaitu membanggakan orang tua dan bertemu dengan A Ling; (2) motivasi intrinsik yang terdapat dalam diri tokoh utama, meliputi (a) kebutuhan, yang berupa cita-cita, minat, dan potensi; (b) dorongan yang berupa sukses dan keluar dari kemiskinan; (c) tujuan yang berupa membanggakan orang tua dan bertemu dengan A Ling. Dari kedua motivasi di atas, memberikan dampak terhadap perkembangan karakter tokoh dan perkembangan alur peristiwa. Motivasi ekstrinsik yang dimiliki Ikal di atas mempengaruhi motivasi intrinsiknya, karena motivasi ekstrinsik dapat membangkitkan atau dapat berubah menjadi motivasi intrinsik. Awalnya,segala sesuatu yang Ikal kerjakan khususnya yang berhubungan dengan sekolah, ia lakukan karena dorongan dari luar yaitu ayahnya sebagai motivasi terkuatnya. Namun, seiring Ikal melakukan kegiatannya, Ikal merasa tertarik dan berminat misalnya, Ikal menjadi senang membaca buku dan Ikal sangat tertarik dengan pengetahuan tentang luar negeri.

Implementasi pembelajaran kooperatif model jigsaw pada mata diklat penanganan surat masuk dan keluar untuk meningkatkan hasil belajar siswa kelas II program keahlian Administrasi Perkantoran di SMK PGRI 2 Malang / oleh Nur Rakhmi Fajriyah

 

Penerapan model pembelajaran cooperative learning snowball throwing untuk meningkatkan hasil belajar dan aktivitas belajar siswa pada mata pelajaran pelayanan prima (studi pada siswa kelas X Pemasaran SMK Muhammadiyah 2 Malang) / Yulianita Rahayu

 

Kata Kunci: model pembelajaran Cooperative Learning Snowball Throwing, hasil belajar dan aktivitas belajar, Penelitian Tindakan Kelas. Berdasarkan hasil wawancara guru dan pengamatan awal di kelas menunjukkan bahwa selama ini guru mata pelajaran Pelayanan Prima kelas X Pemasaran SMK Muhammadiyah 2 Malang mengajar dengan menggunakan metode ceramah dan belum pernah menggunakan model pembelajaran Cooperative Learning Snowball Throwing. Oleh karena itu, dengan melihat permasalahan yang dialami saat proses belajar di kelas perlu dilakukan proses belajar mengajar dengan menggunakan suatu model pembelajaran yang dimaksud adalah model pembelajaran Cooperative Learning Snowball Throwing. Penelitian ini menggunakan pendekatan kualitatif. Jenis penelitian ini adalah Penelitian Tindakan Kelas (PTK). Subyek penelitian adalah siswa kelas X PMS SMK Muhammadiyah 2 Malang. Teknik pengambilan dan pengumpulan data dilakukan dengan menggunakan lembar observasi, pedoman wawancara, tes, catatan lapangan, dan dokumentasi. Analisis data yang digunakan adalah analisis data model alur. Tujuan dilakukan penelitian dalam penerapan pembelajaran kooperatif model Snowball Throwing pada mata pelajaran Pelayanan Prima adalah: (1) Peneliti menerapkan kepada siswa di kelas tentang metode pembelajaran kooperatif model Snowball Throwing, (2) Peneliti melihat adanya peningkatan hasil belajar dan aktivitas belajar siswa setelah model pembelajaran Snowball Throwing di kelas, (3) Peneliti melihat respon siswa baik dengan menggunakan model pembelajaran Snowball Throwing. Hasil penelitian ini menunjukkan bahwa penerapan model pembelajaran Cooperative Learning Snowball Throwing yang dilakukan pada mata pelajaran Pelayanan Prima siswa kelas X Pemasaran SMK Muhammadiyah 2 Malang baik. Menunjukkan hasil belajar siswa dari siklus I ke siklus II, dilihat dari aspek kognitif yaitu dengan taraf keberhasilan pada siklus I dilihat dari rata-rata kelas diperoleh 92,37 dan pada siklus II yang nilai rata-rata kelas diperoleh 81,48. Kriteria hasil tes ini dapat dikatakan baik. Sedangkan dilihat dari aktivitas siswa pada siklus I berdasarkan 2 pengamat diperoleh 62,89% dan untuk siklus II diperoleh 67,97% . Pada penilaian afektif telah diperoleh peningkatan hasil dari pertemuan 1 hingga pertemuan 4, yaitu pada pertemuan awal diperoleh 81,30% dan selanjutnya pada pertemuan berikutnya diperoleh hasil secara berurutan 68,90%, 82,11%, 83,33%. Berdasarkan hasil penemuan pada penelitian tersebut, dapat disarankan bahwa dalam menerapkan model Cooperative Learning Snowball Throwing dapat menjadi metode alternative dalam meningkatkan hasil belajar dan aktivitas belajar siswa. Untuk siswa agar lebih dapat berperan aktif dalam proses belajar mengajar di kelas. Sedangkan bagi peneliti sendiri adanya penelitian menggunakan model pembelajaran snowball throwing dapat dijadikan referensi ketika menjadi guru nantinya.

Penerapan model TAI (Team Assisted Individualization) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV B SDN Candirenggo 04 Singosari Kabupaten Malang / Lailatul Nikmah

 

Kata Kunci: model TAI, aktivitas belajar, hasil belajar, SD Model TAI merupakan model pembelajaran secara individu yang kemudian menjadi pembelajaran secara berkelompok. Pembelajaran IPA di kelas IV B pada saat observasi, menunjukkan bahwa siswa belum mempunyai rasa tanggung jawab dan keberanian. Meskipun dalam pembelajaran siswa sudah dirangsang dengan melakukan tanya jawab. Hal ini terlihat siswa yang kurang aktif sebanyak 16 siswa dan siswa yang aktif sebanyak 4 siswa. Dan hasil belajar siswa terlihat dari hasil UTS yang tuntas hanya 6 siswa dari 20 siswa. Berdasarkan masalah yang ada, peneliti merasa perlu mengadakan perbaikan pembelajaran dengan menerapkan model pembelajaran TAI. Rumusan masalahnya yaitu (1) Bagaimanakah penerapan model pembelajaran TAI pada pembelajaran IPA materi energi panas dan bunyi?; (2) Bagaimanakah aktivitas belajar siswa selama penerapan model TAI pada pembelajaran IPA materi energi panas dan bunyi?; (3) Bagaimanakah hasil belajar siswa setelah penerapan model pembelajaran TAI pada pembelajaran IPA materi energi panas dan bunyi?. Penelitian ini dilaksanakan di SDN Candirenggo 04 Singosari Kabupaten Malang dan dilaksanakan pada tanggal 7 sampai dengan 16 Maret 2013. Penelitian ini menggunakan Penelitian Tindakan Kelas (PTK) yang dilakukan dalam 2 siklus. Setiap siklus terdiri dari 2 kali pertemuan. Subjek penelitian ini adalah siswa kelas IV B SDN Candirenggo 04 Singosari Kabupaten Malang dengan jumlah 20 siswa. Hasil penelitian menunjukkan bahwa, penerapan model TAI mengalami peningkatan. Aktivitas siswa pada siklus I mencapai rata-rata 65,825dan siklus II mencapai rata-rata 83,31. Hasil belajar siswa pada pra tindakan mencapai rata-rata 68,5 dengan siswa yang tuntas sebanyak 6 siswa (30%). Pada siklus I mencapai 79,55 dengan siswa yang tuntas sebanyak 14 siswa (70%) dan siklus II mencapai 79,86 dengan siswa yang tuntas sebanyak 17 siswa (85%). Berdasarkan hasil aktivitas dan hasil belajar siswa dapat disimpulkan bahwa model pembelajaran TAI dapat meningkatkan aktivitas dan hasil belajar IPA khususnya materi energi panas dan bunyi serta sifat-sifatnya. Berdasarkan hasil penelitian disarankan kapada guru kelas IV B supaya menggunakan model TAI, karena dengan menggunakan model TAI dapat menjadikan siswa aktif dan dapat meningkatkan hasil belajar IPA. Hal ini terlihat dari hasil aktivitas dan hasil belajar yang diperoleh siswa. Disamping itu, model TAI juga dapat memotivasi siswa dalam belajar dan mengerjakan soal,serta siswa dapat berperan aktif selama pembelajaran berlangsung.

Peningkatan efektivitas pemurnian nira tebu menggunakan mikrofiltrasi membran skala laboratorium / Harina Pangestu Yulianingtias

 

Kata kunci : mikrofiltrasi membran, pemurnian nira, sulfitasi alkalis Pemurnian dengan membran dapat diartikan sebagai proses pemisahan dua atau lebih komponen dari fluida melalui suatu membran. Teknologi membran telah banyak di kembangkan untuk industri makanan dan farmasi tetapi belum banyak digunakan secara komersial dalam industri gula. Proses pemurnian nira di Pabrik Gula Indonesia sebagian besar menggunakan proses sulfitasi yang dalam proses pemurnian belum menghasilkan kualitas nira yang diharapkan. Permasalahan yang dihadapi oleh pabrik gula tersebut dalam penelitian ini akan dicoba untuk diatasi dengan mengunakan proses mikrofiltrasi membran dalam tahap pemurnian nira. Penelitian ini bersifat eksperimental dan dilakukan di Laboratorium Pusat Penelitian Perkebunan Gula Indonesia (P3GI) Pasuruan. Proses pemurnian dilakukan menggunakan mikrofiltrasi membran terhadap sampel nira encer hasil proses sulfitasi alkalis. Hasil pemurnian dikarakterisasi dengan analisis: % brix, % pol, kadar CaO, kekeruhan, warna ICUMSA dan kadar amilum. Hasil penelitian menunjukkan (1) Nira hasil pemurnian dengan sulfitasi mempunyai % pol sebesar 11,69%; % brix sebesar 14,71%; kadar amilum sebesar 722 mg/L; kekeruhan sebesar 100 mg/L; warna ICUMSA sebesar 27872 IU, dan kadar CaO sebesar 1454 mg/L. (2) Setelah dimurnikan dengan mikrofiltrasi membran kualitas nira hasil proses sulfitasi menjadi lebih baik, yang ditandai dengan kadar amilum sebesar 178 mg/L; kekeruhan sebesar 11 mg/L; warna ICUMSA sebesar 24267 IU; dan kadar CaO sebesar 230 mg/L. Sedangkan % brix dan % pol relatif tetap yaitu masing-masing sebesar 12,93% dan10,40%. (3) Pemurnian dengan menggunakan mikrofiltrasi membran efektif dalam mengeliminir bahan bukan gula yang terkandung dalam nira yang tidak dapat diendapkan dalam pemurnian sulfitasi alkalis. Hal ini dibuktikan dengan peningkatan kualitas nira yaitu kadar CaO menurun sebesar 84,18%; kekeruhan menurun sebesar 89%; warna ICUMSA menurun sebesar 12,9%; dan kadar amilum menurun sebesar 75,35 %, meskipun % brix dan % pol relatif tetap.

Hubungan tingkat pendidikan orang tua keluarga petani dengan persepsi pendidikan anak usia dini di Desa Kalitidu Kecamatan Kalitidu Kabupaten Bojonegoro / Dwi Basuki Rahmad

 

Kata kunci: orangtua keluarga petani, persepsi pendidikan anak usia dini, Kalitidu, pendidikan luar sekolah. Orang tua memegang peranan yang sangat penting dalam membentuk kepribadian anak. Pendidikan yang pernah dienyam oleh para orang tua juga bisa dikatakan menjadi tolok ukur dalam cara mendidik anak-anaknya, baik yang diperoleh melalui jalur formal maupun non formal. Orang tua yang jenjang pendidikannya tinggi akan memperoleh ilmu pengetahuan dan informasi yang lebih banyak daripada orang tua yang tingkat pendidikannya rendah atau tidak berpendidikan. Pendidikan yang pernah dijalani oleh orang tua dapat menentukan baik tidaknya persepsi atau pandangan terhadap suatu hal. Tujuan penelitian untuk mendeskripsikan tingkat pendidikan orang tua keluarga petani, mendeskripsikan persepsi pendidikan anak usia dini, mengetahui hubungan antara tingkat pendidikan orang tua keluarga petani dengan persepsi pendidikan anak usia dini di Desa Kalitidu Kecamatan Kalitidu Kabupaten Bojonegoro. Rancangan penelitian ini bersifat deskriptif korelasional. Instrumen pengumpulan data berupa angket atau kuesioner. Responden penelitian sebanyak 30 orang keluarga petani sebagai sampel, 15% dari populasi yang berjumlah 200 orang. Teknik analisis data yang digunakan yaitu analisis korelasi Product Moment Pearson. Hasil penelitian ini menunjukkan bahwa tingkat pendidikan yang ditempuh oleh orang tua keluarga petani berbeda-beda. Demikian juga dengan persepsi pendidikan anak usia dini juga berbeda sesuai dengan tingkat pendidikan masing-masing. Hipotesis yang diajukan menyatakan bahwa terdapat hubungan yang signifikan antara latar belakang pendidikan orang tua keluarga petani dengan persepsi pendidikan anak usia dini di Desa Kalitidu Kecamatan Kalitidu Kabupaten Bojonegoro. Hal ini terbukti r hitung lebih besar dari r tabel yaitu 0,601 > 0,361. Berdasarkan hasil penelitian ini, dapat dikemukakan saran yaitu orang tua keluarga petani hendaknya meningkatkan pendidikan baik formal maupun non, agar menambah ilmu pengetahuan maupun informasi mengenai cara mendidik anak. Bagi masyarakat desa kalitidu khususnya petani, hendaknya lebih memperhatikan pendidikan anak di usia dini demi tumbuh kembang anak.

Methode pengajaran management kelas III SMEA Arjuna Malang
oleh Syachrul

 

Pemanfaatan dedak jagung sebagai bahan tambahan pakan untuk pertumbuhan udang Vannamei (Litopenaeus Vannamei) / Hesty Alfianti Wulandari

 

Kata kunci :dedak jagung, tambahan pakan, pertumbuhan udang vannamei Kegiatan pembenihan dan budidaya udang di Indonesia masih merupakan aktivitas yang relatif sedikit dan pengembangannya masih perlu ditingkatkan lagi. Faktor yang menentukan keberhasilan produksi dalam budidaya udang adalah manajemen pakan yang berpengaruh secara menyeluruh terhadap pertumbuhan udang karena pakan memiliki fungsi sebagai pemasok energi untuk memacu pertumbuhan dan sintasannya. Ketersediaan pakan, baik itu pakan alami dan buatan maupun pakan tambahan akan mempengaruhi kelangsungan produksi udang secara berkesinambungan. Dedak jagung sebagai alternatif tambahan pakan berpotensi besar untuk bahan baku industri pakan udang karena memilki jumlah kandungan protein lebih tinggi daripada dedak lain. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian dedak jagung sebagai bahan tambahan pakan untuk pertumbuhan udang vannamei (Litopenaeus vannamei). Penelitian yang digunakan adalah berupa experimental laboratories. Menggunakan Rancangan Acak Lengkap (RAL) dengan 5 perlakuan dan 5 kali ulangan. Parameter pertumbuhan dalam penelitian ini adalah bobot dan panjang udang vannamei. Perlakuan dedak jagung diberikan dengan konsentrasi 0%, 10%, 20%, 30%, dan 40%. Data yang didapat berupa pertambahan biomassa mutlak, panjang mutlak udang, dan menghitung rasio konversi pakan (FCR). Data dianalisis menggunakan ANAKOVA untuk mengetahui pengaruh pemberian dedak jagung untuk pertumbuhan udang vannamei (Litopenaeus vannamei). Kesimpulan hasil penelitian yaitu bahwa pemberian dedak jagung sebagai tambahan pakan tidak berpengaruh terhadap pertumbuhan udang vannamei (Litopenaeus vannamei), akan tetapi terdapat kecenderungan meningkat pada konsentrasi 20%.

Tinjauan sistim organisasi pada Maskapai Asuransi Jiwa Bersama Bumi Putra" 1912 Malang / oleh Surjani Sulistyawati"

 

Peranan Perusahaan Perseroan (Persero) P.T. Asuransi Jiwasraya" perwakilan Malang terhadap nasabah khususnya & masyarakat umumnya / oleh Rubiyanti S"

 

Pengembangan multimedia interaktif menggunakan siklus belajar 5E mata pelajaran biologi KD 2.2 kelas VIIIC SMPN 1 Bakung Kabupaten Blitar / Evi Ria Rahayu

 

ABSTRAK Rahayu, Evi Ria. 2016. Pengembangan Multimedia Interaktif Menggunakan Siklus Belajar 5E MataPelajaran Biologi KD 2.2 Kelas VIIIC SMPN 1 Bakung Kabupaten Blitar. Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing: (I) Dr. Endang Suarsini, M.Ked., (II) Ir. Nugrahaningsih, M.P. Kata Kunci: Multimedia interaktif, siklus belajar 5E, matapelajaran biologi KD 2.2 Pembelajaran biologi yang ideal sulit terwujud apabila pendidik tidak melibatkan siswa dalam kegiatan belajar. Pembelajaran seperti ini kurang tepat karena hanya menekankan pada produk keilmuan saja. Diperlukan suatu komponen yang dapat membantu siswa dalam kegiatan belajar, salah satunya menggunakan media pembelajaran. Berdasarkan wawancara kepada siswa kelas VIIIC SMPN 1 Bakung dinyatakan, bahwa mereka jarang menggunakan media pembelajaran, guru lebih mendominasi pembelajaran dan siswa menginginkan multimedia interaktif sebagai media pembelajaran terutama pembahasan pada materi yang sifatnya abstrak dan berhubungan dengan bioproses. Berkaitan dengan hal tersebut, maka penelitian ini bertujuan untuk mengembangkan multimedia interaktif menggunakan aplikasi Macromedia Flash Profesional 8 pa matapelajaran biologi KD 2.2 (mendeskripsikan proses perolehan nutrisi dan transformasi energi pada tumbuhan hijau) menggunakan siklus belajar 5E. Penelitian dan pengembangan ini menggunakan model penelitian ASSURE yang terdiri dari 6 tahap yakni, tahap I: Analyze learner characteristics, tahap II: State performance objectives, tahap III: Select methods, media and materials, utilize materials, tahap IV: Utilize Media and Materials, tahap V: Requires learner participation, dan tahap VI: Evaluation and revision. Data penelitian diperoleh dari penilaian ahli media, ahli materi, praktisi lapangan, siswa (pengguna produk) kelas VIIIC SMPN 1 Bakung dan skor hasil pretest posttest untuk mengetahui tingkat kevalidan, kepraktisan dan keefektifan multimedia interaktif. Instrumen yang digunakan dalam penelitian ini berupa angket dan soal pretest posttest. Hasil penelitian menunjukkan, multimedia interaktif tergolong multimedia yang valid, praktis dan efektif. Nilai kevalidan hasil validasi ahli media sebesar 89,23%, ahli materi sebesar 91,42%, praktisi lapangan sebesar 90%. Nilai kepraktisan sebesar 91,21%, nilai keefektifan yaitu pada pertemuan 1 sebesar 70,04 (rata-rata pretest) menjadi 88,47 (rata-rata posttest) dan pada pertemuan 2 sebesar 60 (rata-rata pretest) menjadi 90 (rata-rata posttest). ………………………………….………. ……………………………………………………… .

Pengaruh kualitas layanan perbankan terhadap kepuasan nasabah : studi pada PT. Bank Mandiri Ritel Cabang Surabaya / oleh Nur Alfiani

 

Usaha Desa Sumbersari Kecamatan Klojen Kodya Malang dalam meningkatkan produksi pertanian / oleh Mu'arifah

 

Analisis filogenetik kura-kura (Cuora amboinensis) di daerah Sulawesi berdasarkan DNA mitokondria (Cytochrome c Oxidase Sub Unit 1) / Fyrga Afryani

 

Afryani , Fyrga. 2014. Analisis Filogenetik Kura-Kura (Cuora amboinensis) di Daerah Sulawesi Berdasarkan DNA Mitokondria (Cytochrome c Oxidase Sub Unit I). Skripsi, Jurusan Biologi, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Malang. Pembimbing (1) Prof. dr.agr. H. Mohammad Amin S.Pd., M.Si., (2) Sofia Ery Rahayu S.Pd., M.Si. Kata Kunci : Cuora amboinensis, filogenetik, jarak genetik, cytochrome c oxydase sub unit I (COI). Cuora amboinensis merupakan spesies endemik Indonesia Timur yang sebarannya merata di wilayah Sulawesi dan sekitarnya. Populasi Cuora amboinensis semakin menurun karena perburuan dan perdagangan ilegal. Selain itu masalah pencemaran air dan kerusakan habitat perairan juga menjadi ancaman terhadap keberadaan hewan ini. Maka dari itu IUCN (International Union For Conservation of Nature and Natural Resources) atau Uni Konservasi Dunia telah memasukkan populasi C. amboinensis ke dalam kategori rentan. Penelitian ini bertujuan untuk menganalisis filogenetik dan hubungan kekerabatan pada Cuora amboinensis di Sulawesi menggunakan gen mitokondria Cytochrome c Oxidase Sub Unit 1 (COI). Jenis penelitian ini adalah deskriptif eksploratif. Objek berasal dari koleksi jaringan ekor kura-kura yang disimpan di Laboratorium Biologi Molekular Jurusan Biologi FMIPA UM. Semua kura-kura berasal dari pulau Sulawesi di daerah Makasar 2 objek dan Kendari 2 objek dengan pertimbangan sebaran geografis. Amplifikasi menggunakan primer COI Forward : 5- TCG ACT AAT CAT AAA GAT ATC GGC AC -3. Analisis genetik menggunakan software MEGA 5 dengan metode penghitungan jarak genetik dan jumlah mutasi sedangkan untuk analisis filogenetik menggunakan model Neighboor Joining (NJ) dan Minimum Evolution (ME). Berdasarkan analisis data diperoleh hasil perbandingan sekuens dan komposisi basa yang menunjukkan individu Cuora amboinensis dari daerah Makasar dan Kendari memiliki jarak genetik sebesar 0,000 yang berarti memiliki karakter yang sama persis. Hal tersebut dikarenakan persebaran kedua individu berasal dari daerah yang sama yaitu Sulawesi.. Apabila dibandingkan dengan Cuora yunnanensis, Cuora boureti, Cuora aurocapitata, dan Cuora garbinifrons menghasilkan jarak genetik yang jauh, yang berarti sekuens dari individu-individu tersebut tidak sama. Hal tersebut disebabkan oleh persebaran keempat spesies cukup jauh yaitu Cuora yunnanensis, Cuora boureti berasal dari Cina dan Cuora aurocapitata, dan Cuora garbinifrons berasal dari Vietnam. Hubungan kekerabatan COI menggunakan model Neighbor-Joining dan model Minimum Evolution dengan pengolahan bootstrap 1000 terlihat bahwa Cuora amboinensis Makasar dan Kendari membentuk satu subcluster yang sama. Analisis selanjutnya dilakukan pembanding dengan spesies outgroup untuk membuktikan posisi taksa Cuora amboienensis. Spesies yang digunakan moyang adalah Rana pyrenica yang termasuk dalam kelas Amfibi. Hasil topologi pohon filogenetik menunjukkan bahwa outgroup berada pada cabang yang terpisah jauh dengan kelompok sample Cuora amboinensis.

Pelaksanaan manajemen partisipasi masyarakat di SDN Rowogempol I Kecamatan Lekok / oleh Sutomo

 

Peningkatan pembelajaran menulis teks ulasan cerpen menggunakan teknik mind map pada siswa kelas VIII F SMP Negeri 1 Kesamben / Ilma Lailatul Farida

 

ABSTRAK Farida, Ilma Lailatul. 2016. Peningkatan Pembelajaran Menulis Teks Ulasan Cerpen Menggunakan Teknik Mind Map pada Siswa Kelas VIII F SMP Negeri 1 Kesamben. Skripsi, Jurusan Sastra Indonesia, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (I) Prof. Dr. Dawud, M.Pd. Pembimbing (II) Dr. Nurchasanah, M.Pd. Kata kunci: menulis, teks ulasan, cerpen, teknik mind map Menulis merupakan keterampilan berbahasa yang kedudukannya paling tinggi dalam taksonomi Bloom, yaitu termasuk kategori mencipta sehingga banyak siswa yang mengalami kesulitan. Berdasarkan wawancara dan observasi pada tahap pratindakan dapat diketahui bahwa guru hanya menggunakan teknik ceramah dan teks yang diulas adalah novel yang memliki cerita terlalu panjang sehingga siswa kurang tertarik terhadap pembelajaran menulis teks ulasan dan nilai yang tuntas, yaitu 71,4%, padahal standar ketuntasan klasikal yang harus dicapai adalah ≥80%. Oleh sebab itu, penelitian ini memberikan solusi menulis teks ulasan cerpen menggunakan teknik mind map. Penelitian ini dilaksanakan untuk mengetahui peningkatan proses dan hasil menulis teks ulasan cerpen menggunakan teknik mind map pada siswa kelas VIII F SMP Negeri 1 Kesamben. Jenis penelitian ini adalah Penelitian Tindakan Kelas. Peneliti berperan sebagai perancang tindakan, pengelola instrumen, pengamat, pewawancara, pengumpul data, dan guru model. Penelitian ini dilaksanakan di SMP Negeri 1 Kesamben Kabupaten Blitar. Subjek penelitian adalah siswa kelas VIII F SMP Negeri 1 Kesamben. Penelitian dilaksanakan selama empat bulan, yaitu Januari sampai dengan April. Kegiatan dilakukan mulai dari identifikasi masalah sampai dengan melaksanakan tindakan. Data penelitian berupa deskripsi proses pembelajaran menulis teks ulasan cerpen menggunakan teknik mind map dan skor menulis teks ulasan cerpen menggunakan teknik mind map yang diperoleh siswa. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara, tes, dan dokumentasi. Analisis data proses menulis dilakukan dengan teknik deskriptif kualitatif, sedangkan data hasil menulis dianalisis dengan cara menentukan skor berdasarkan rubrik penilaian. Berdasarkan analisis data, peningkatan proses dapat diketahui dari persentase aktivitas siswa yang meningkat dalam tahap prapenulisan, penulisan, dan revisi. Persentase aktivitas siswa yang diperoleh pada tahap pratindakan kategori sangat baik mencapai 26,1%, kategori baik mencapai 86,9%, kategori cukup baik mencapai 60,9%, dan kategori kurang baik mencapai 21,7%. Pada siklus I, persentase aktivitas siswa yang diperoleh untuk kategori sangat baik mencapai 34,8%, kategori baik mencapai 86,9%, kategori cukup baik mencapai 54,4%, dan kategori kurang baik mencapai 10,8%. Pada siklus II, persentase aktivitas siswa yang diperoleh untuk kategori sangat baik mencapai 50,0%, kategori baik mencapai 86,9%, kategori cukup baik mencapai 34,8%, dan kategori kurang baik mencapai 4,3%. Peningkatan hasil menulis dapat diketahui dari siswa yang tuntas pada tahap pratindakan sebanyak 71,4%, pada siklus I sebanyak 77,2%, dan pada siklus II sebanyak 85,3% sehingga dapat dikatakan bahwa hasil menulis teks ulasan cerpen sudah meningkat karena telah memenuhi standar ketuntasan klasikal, yaitu ≥80%. Berdasarkan hasil analisis tersebut dinyatakan bahwa proses dan hasil menulis teks ulasan cerpen dapat meningkat dengan menggunakan teknik mind map. Hal yang perlu diperhatikan adalah mind map yang baik akan menghasilkan teks ulasan cerpen yang baik pula.

Tinjauan terhadap perhitungan harga pokok pada pabrik miehun Sinar Jaya Tumpang - Malang / oleh Mawahib

 

Penerapan metode penemuan terbimbing rumus luas segitiga dalam pembelajaran matematika kelas V SDN Gunting I Kecamatan Sukorejo Kabupaten Pasuruan / oleh Nawi

 

Piranti estetika dan nilai pendidikan Singir Mitera sejati dan Ngudi Susila karya Kiai Bisri Musthofa / Moh. Ahsan Shohifur Rizal

 

Rizal, Moh. Ahsan Shohifur. 2015. Piranti Estetika dan Nilai Pendidikan Naskah Singir Mitera Sejati dan Ngudi Susila Karya Kiai Bisri Musthofa. Tesis Program Studi Pendidikan Bahasa Indonesia, Program Pascasarjana, Universitas Negeri Malang. Pembimbing: (1) Prof. Dr. H. Wahyudi Siswanto, M.Pd, (2) Dr. Sunoto, M.Pd. Kata kunci : singir, estetika dan pendidikan Abstrak Singir Mitera Sejati dan Ngudi Susila merupakan karya sastra yang berbentuk nadhom dengan puitika mengikuti kaidah ilmu arudl. Sehingga terdapat nilai estetika dan pendidikan. Singir dapat dijadikan sebagai media edukasi dan sumber belajar. Singir menyimpan nilai adhiluhung. Khususnya di dalam pembelajaran sastra di sekolah maupun pesantren. Penelitian ini bertujuan untuk mendeskripsikan nilai estetika dan pendidikan. Secara substansial, penelitian ini mengambarkan mengenai tiga hal pokok yakni, (1) piranti estetika yang mencakup, (a) estetika bentuk, dan (b) estetika isi. (2) nilai pendidikan (a) nilai terkait hubungan manusia dengan tuhan, (b) hubungan manusia dengan manusia, (c) hubungan manusia dengan dirinya sendiri dan (d) hubungan manusia dengan lingkungan atau alam. Penelitian ini menggunakan rancangan hubungan penelitian kualitatif dengan metode hermeneutika, yakni studi pemahaman, khususnya tugas pemahaman teks. Kajian hermeneutik berkembang sebagai sebuah usaha untuk menggambarkan pemahaman teks, lebih spesifik pemahaman historis dan humanistik. Dengan demikian, hermeneutik mencakup dalam dua fokus perhatian yang berbeda dan saling berinteraksi yakni; (1) peristiwa pemahaman teks (2) persoalan yang mengarah mengenai apa pemahaman interpretasi. (Palmer, 1969: 8). Hasil analisis menunjukkan temuan piranti estetika dan nilai pendidikan singir Mitera Sejati dan Ngudi Susila. Piranti estetika meliputi estetika bentuk dan etsteika isi. Nilai Pendidikan dalam naskah Mitera Sejati dan Ngudi Susila karya Kiai Bisri Musthofa yakni nilai pendidikan terkait hubungan manusia dengan Tuhan, hubungan manusia dengan manusia, manusia dengan dirinya sendiri dan manusia dengan lingkungan atau alam. Kesimpulan yang diperoleh dalam penelitian ini, adalah dalam singir Mitera Sejati dan Ngudi Susila terdapat piranti estetika dan nilai pendidikan. Nilai yang terdapat pada kedua singir tidak sekedar memberikan piranti estetis tetapi mengajarkan sekaligus himbauan agar manusia mengimplementasikan nilai-nilai adiluhung untuk konteks sosial, agama, bangsa maupun bernegara. Aspek estetis sastra yang tersampaikan di dalam singir mitera sejati dan ngudi susila syarat dengan ilmu bahasa arab yang terpadu dalam terminologi Jawa. Kaidah-kaidah yang digunakan dalam ilmu arudl ternyata dapat direlevansikan dengan singir yang berbahasa jawa ditulis dengan menggunakan hurup pegon. Selain itu, Istilah keislaman dan kepesantrenan secara eksplisit digunakan penulis guna menyelaraskan piranti estetika dan nilai penddikan di dalam kedua singir tersebut.

Desain dan implementasi evaluasi pada program pelatihan otomotif di UPT-PK Singosari / Albasit Bhekti Firmansyah

 

Firmansyah, Albasit Bhekti. 2014. Desain dan Implementasi Evaluasi pada Program Pelatihan Otomotif di UPT-PK Singosari. Skripsi, Jurusan Pendidikan Luar Sekolah, FakultasI lmu Pendidikan, Universitas Negeri Malang. Pembimbing: (I) Prof. Dr. Supriyono, M.Pd, (II) Dr. M. Djauzi Moedzakir, M.A. Kata Kunci: Evaluasi, Pelatihan Evaluasi merupakan hal yang sangat penting dalam pelatihan, karena evaluasi dapat mencerminkan perkembangan dan kemajuan kualitas hasil pendidikan. Unit Pelaksana Teknis Pelatihan Kerja (UPT-PK) Singosari merupakan penggerak di dalam menjalankan program-program kegiatan pelatihan untuk melatih tenaga kerja yang kompeten dan produktif sehingga mempunyai peranan penting untuk memberikan pelayanan pelatihan yang berkualitas.     Penelitian ini bertujuan mendeskripsikan, (1) desain evaluasi hasil belajar pada pelatihan otomotif di UPT-PK Singosari, (2) desain evaluasi program pada pelatihan otomotif di UPT-PK Singosari, (3) implementasi evaluasi hasil belajar dan evaluasi pada program pelatihan otomotif di UPT-PK Singosari.     Pendekatan penelitian yang digunakan dalam penelitian ini adalah kualitatif deskriptif yang dirancang dalam bentuk studi kasus. Metode pengumpulan data yang digunakan adalah dengan teknik observasi, wawancara, dan studi dokumentasi. Teknik analisis data dengan menggunakan reduksi data, display data, dan mengambil kesimpulan. Pengecekan keabsahan data dilakukan dengan menggunakan triangulasi sumber dan triangulasi metode.     Berdasarkan hasil penelitian ini, diperoleh tiga simpulan hasil penelitian sebagai berikut. Pertama, desain evaluasi hasil belajar pada pelatihan otomotif di UPT-PK Singosari bertujuan untuk menggambarkan kemampuan belajar peserta pelatihan pada ranah kognitif yang digambarkan pada evaluasi teori, ranah afektif digambarkan pada evaluasi perfomansi yang terdiri dari penilaian kehadiran, kedisiplinan, kerjasama, dan inisiatif, dan ranah psikomotorik digambarkan pada evaluasi praktik.     Kedua, desain evaluasi program pada pelatihan otomotif yang dilaksanakan di UPT-PK Singosari terdiri dari empat tahap. Tahap pertama adalah tahap untuk mengukur tingkat kepuasan peserta pelatihan terhadap penyelenggaraan pelatihan. Tahap kedua adalah tahap untuk mengevaluasi hasil belajar peserta pelatihan selama mengikuti kegiatan pelatihan. Dengan semakin banyak hasil belajar yang didapat oleh peserta pelatihan menunjukkan bahwa program pelatihan tersebut berhasil. Tahap ketiga adalah tahap untuk menunjukkan seberapa besar hasil belajar peserta pelatihan yang telah diterapkan di tempat mereka bekerja. Tahap yang keempat adalah tahap untuk menggambarkan pengaruh pelatihan terhadap peningkatan produksi dan pendapatan perusahaan tempat peserta pelatihan bekerja.     Ketiga, pada tahap perencanaan evaluasi hasil belajar instruktur menyiapkan instrumen yang telah disesuaikan dengan kurikulum pelatihan untuk mengetahui tipe hasil belajar. Kemudian pada tahap pengumpulan data instruktur mengunakan teknik tes dan nontes. Pada teknik tes instrukur sudah mempunyai instrumen pengumpulan data yang cukup baik sedangkan pada teknik nontes instruktur hanya melakukan pengamatan dan langsung memberikan nilai tanpa adanya pedoman pengamatan. Pada tahap pengolahan data instruktur sudah mempunyai rumus baku untuk menentukan nilai peserta pelatihan sehingga dalam pengolahan data bisa dilakukan oleh orang lain selain instruktur pelatihan. Kemudian langkah tindak lanjut dari hasil pengolahan data yang dilakukan adalah dengan memberikan jam tambahan bagi peserta pelatihan yang belum mencapai standard kompetensi yang telah ditetapkan. Evaluasi program pada pelatihan otomotif di UPT-PK Singosari pada tahap pertama menggunakan angket sebagai alat pengumpul data. Dengan menggunakan angket pihak penyelenggara pelatihan akan menghemat biaya dan waktu dalam pengumpulan data karena angket tersebut terdiri dari 20 pertanyaan. Pada tahap kedua evaluasi program pihak penyelenggara pelatihan menyelenggarakan serangkaian kegiatan tes dan nontes untuk mengumpulkan data. Evaluasi program pelatihan pada tahap ketiga dan keempat memiliki persamaan dalam cara pengumpulan data yaitu dengan melakukan wawancara kepada atasan perusahaan. Pada tahap ketiga evaluator menekankan untuk memperoleh informasi mengenai aplikasi hasil pelatihan di tempat kerja sedangkan pada tahap keempat lebih menekankan pada pengaruh pelatihan terhadap peningkatan produksi dan pendapatan perusahaan.     Berdasarkan hasil penelitian ini, UPT-PK Singosari disarankan agar menjadikan penelitian ini sebagai bahan masukan agar dalam evaluasi program pada tahap perilaku dan hasil menggunakan instrumen pengumpulan data yang baku sehingga dalam melakukan penilaian memiliki sifat yang objektif. Bagi instruktur pelatihan otomotif disarankan lebih memperhatikan pelaksanaan evaluasi hasil belajar pada tahap tindak lanjut. Pada tahap tindak lanjut, instruktur disarankan agar memberikan pembelajaran yang lebih variatif ketika melakukan pembelajaran pada jam tambahan bagi peserta pelatihan yang belum mencapai standard kompetensi.

Perbedaan kemampuan memahami peta pada mata pelajaran ilmu pengetahuan sosial kelas V di Sekolah Dasar Negeri Cendono 1 Kecamatan Purwosari Kabupaten Pasuruan sebelum dan sesudah diajar dengan media peta buta / oleh Machmud

 

Pemanfaatan media pembelajaran IPS kelas II oleh guru di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang / Awaluddin Rahmawan

 

Rahmawan, Awalludin. 2009. Pemanfaatan Media Pembelajaran IPS Kelas II Oleh Guru Di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang. Skripsi. Jurusan Teknologi Pendidikan. Fakultas Ilmu Pendidikan. Universitas Negeri Malang. Pembimbing: (1) Drs. Joseph Mbulu, M.Pd. (2) Drs. H. Zainul Abidin, M.Pd. Kata kunci: Pemanfaatan, Media Pembelajaran. Media pembelajaran berperan penting dalam kegiatan pembelajaran untuk memudahkan tercapainya tujuan pembelajaran tersebut. Agar media pembelajaran dapat dimanfaatkan secara efektif, maka guru harus memiliki kemampuan dalam hal merencanakan, memilih dan menggunakan media tersebut. Berdasarkan hal tersebut maka peneliti bermaksud akan mengungkapkan tentang pemanfaatan media pembelajaran IPS di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang. Tujuan penelitian ini adalah: (1) Mendeskripsikan perencanaan pemanfaatan media pembelajaran IPS oleh guru di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang; (2) Mendeskripsikan pemilihan media pembelajaran IPS oleh guru di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang; (3) Mendeskripsikan penggunaan media pembelajaran IPS di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang. Penelitian ini menggunakan metode deskriptif. Penelitian deskriptif ini diarahkan untuk mendeskripsikan obyek atau peristiwa tanpa suatu maksud menguji hipotesis. Subyek penelitian ini adalah guru IPS yang ada di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang yang berjumlah 6 orang. Pengumpulan data menggunakan teknik analisis statistik dengan prosentase. Hasil penelitian menunjukkan bahwa: (1) Media pembelajaran yang dimanfaatkan oleh guru dengan sangat efektif adalah papan tulis, papan magnet, poster, diagram, ensiklopedi, foto (83,3%), bagan, peta, grafik, modul, surat kabar/ majalah, buku pelajaran, dan cd audio (100%), media pembelajaran yang kurang efektif pemanfaatannya adalah papan tempel, widyawisata, peta timbul, radio, tape recorder, dan internet/ PC komputer (16,6%). (2) Media pembelajaran yang sering dimanfaatkan oleh guru adalah media papan (50%), media yang kadang-kadang dimanfaatkan oleh guru adalah media grafis (66,6%), media cetak (50%), media benda sebenarnya, media pandang dengar (83,3%), media dengar, dan media pandang (50%). (3) Perencanaan pemanfaatan media dalam kegiatan pembelajaran IPS di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang menunjukkan bahwa guru yang selalu mempelajari petunjuk pemanfaatan media lebih sedikit, sedangkan guru yang kadang-kadang mempelajari petunjuk pemanfaatan media lebih banyak, guru yang selalu mempersiapkan media sebelum kegiatan pembelajaran IPS sama dengan guru yang sering mempersiapkan media sebelum kegiatan pembelajaran IPS, yaitu separuh dari guru IPS yang ada; sedangkan guru yang selalu mengetahui kondisi media sebelum kegiatan pembelajaran IPS juga separuh dari guru yang ada; untuk guru yang sering mengetahui kondisi media sebelum kegiatan pembelajaran IPS lebih sedikit dari guru yang kadang-kadang mengetahui kondisi media sebelum kegiatan pembelajaran IPS; dari hasil ini menunjukkan bahwa guru kurang efektif dalam hal perencanaan pemanfatan media dalam kegiatan pembelajaran. (4) Hampir seluruh guru di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang selalu memilih media pembelajaran IPS yang sesuai dengan tujuan pembelajaran; dalam hal ini kegiatan guru dalam memilih media pembelajaran IPS yang sesuai dengan tujuan pembelajaran adalah sangat efektif; untuk pemilihan media pembelajaran IPS yang sesuai dengan materi pembelajaran juga hampir semua guru melakukannya; pemilihan media pembelajaran IPS yang selalu disesuaikan dengan metode pembelajaran dilakukan oleh separuh dari guru; hampir seluruh guru di Madrasah Tsanawiyah Negeri Bakalan Rayung Jombang selalu memilih media pembelajaran IPS yang sesuai dengan karakteristik pembelajaran; sedangkan untuk pemilihan media pembelajaran IPS yang sesuai dengan kualitas media pembelajaran hanya separuh guru yang sering melakukannya; hal ini menunjukkan bahwa guru sangat efektif dalam hal pemilihan media pembelajaran IPS yang sesuai dengan karakteristik yang telah disebutkan di atas. (5) Guru selalu mempelajari tujuan pembelajaran khusus sebelum memanfaatkan media, guru juga meneliti perlengkapan media pembelajaran yang akan digunakan; ketersediaan media pembelajaran IPS yang akan dimanfaatkan sudah sesuai dan layak untuk pencapaian tujuan pembelajaran serta selalu dapat dimanfaatkan oleh para siswa; pola pemanfaatan media pembelajaran IPS di dalam kelas yang digunakan guru adalah secara klasikal, individu, dan kelompok; pola pemanfaatan media pembelajaran IPS di luar kelas guru menggunakan cara bebas dan terkontrol. Berdasarkan hasil penelitian tersebut, maka peneliti menyarankan (1) Kepala MTsN Bakalan Rayung Jombang perlu menambah dan melengkapi media pembelajaran yang belum ada dan memperbaiki media pembelajaran yang rusak; memberikan instruksi kepada guru IPS agar menggunakan media pembelajaran IPS dalam kegiatan pembelajaran IPS. (2) Hendaknya guru memanfaatkan media pembelajaran yang ada secara efektif dan optimal dalam kegiatan pembelajaran; memilih media yang akan digunakan dalam kegiatan pembelajaran yang sesuai dengan kriteria pemilihan media pembelajaran yang ada; meningkatkan frekuensi pemanfaatan media pembelajaran yang hanya kadang-kadang saja digunakan. (3) Peneliti berharap kepada peneliti berikutnya untuk menambah permasalahan-permasalahan ataupun kajian-kajian pustaka yang terdapat dalam penelitian tentang pemanfaatan media pembelajaran ini untuk lebih memperkaya khasanah keilmuan tentang media pembelajaran dan pemanfaatannya.

Relevansi karakter tokoh utama kumpulan cerpen Hidup Berawal Dari Mimpi karya Fahd Djibran dengan nilai pendidikan karakter di SMA / Firdausya Lana

 

ABSTRAK Lana, Firdausya. 2015. Relevansi Karakter Tokoh Utama dalam Kumpulan Cerpen Hidup Berawal dari Mimpi Karya Fahd Djibran dengan Nilai Karakter di SMA. Skripsi. Jurusan Sastra Indonesia. Fakultas Sastra Universitas Negeri Malang. Pembimbing: (I) Dr. Muakibatul Hasanah, M.Pd. (II) Dr. Nita Widiati, M.Pd. Kata kunci: cerpen, karakter, tokoh utama, nilai pendidikan karakter. Unsur pembangun cerpen yang membuktikan bahwa cerpen merupakan gambaran kehidupan nyata adalah tokoh-tokohnya. Watak atau karakter tokohlah yang membuat tokoh dalam suatu cerita memiliki kedekatan dengan pembaca. Kajian telaah karakter tokoh melalui kecermatan memilih cerita dapat memberikan alternatif dalam pendidikan nilai karakter pada peserta didik. Tokoh utama dalam kumpulan cerpen Hidup Berawal dari Mimpi sengaja dibuat untuk memberikan motivasi pembacanya untuk menjadi manusia yang lebih baik pada tiap aspek kehidupannya. Mayoritas tokoh utama yang merupakan remaja dalam kumpulan cerpen karya Fahd Djibran ini dapat menarik pembaca kalangan remaja pula. Penelitian ini bertujuan mendeskripsikan relevansi karakter tokoh utama dalam kumpulan cerpen Hidup Berawal dari Mimpi karya Fahd Djibran dengan nilai pendidikan karakter di SMA. Sejalan dengan tujuannya, penelitian ini adalah penelitian kualitatif, yang mendeskripsikan. Data yang dianalisis kutipan berupa narasi dan dialog dari kumpulan cerpen yang menggambarkan karakter tokoh utama. Instrumen kunci dalam penelitian ini adalah peneliti sendiri karena peneliti merupakan alat pengumpul data dengan pedoman analisis. Tahapan analisis dimulai dari tahap identifikasi data, pengodean, klasifikasi data, dan penarikan simpulan. Berdasarkan hasil analisis data dideskripsikan tujuh simpulan. Pertama, terdapat enam nilai pendidikan karakter di SMA yang sesuai dengan karakter tokoh utama dalam kumpulan cerpen Hidup Berawal dari Mimpi karya Fahd Djibran. Enam nilai karakter tersebut meliputi (1) penyelesai masalah, (2) responsif, (3) religius, (4) peduli sesama, (5) proaktif, dan (6) tanggung jawab. Nilai religius merupakan hasil rumusan SKL KI-1. Nilai penyelesai masalah, responsif, peduli sesama, proaktif dan tanggung jawab merupakan hasil rumusan SKL KI-2. Kedua, terdapat delapan tokoh utama dalam kumpulan cerpen yang memiliki nilai karakter penyelesai masalah, meliputi (1) Reza dalam Kau Puisi, (2) Bumi dalam Bumi ke Langit, (3) Acep dalam Cahya Cinta Sejati, (4) aku dalam Kita Selamanya, (5) Teguh dalam U’ll Sorry, (6) aku dalam Save Our Soul, (7) aku dalam Xpresikan, dan (8) Kautsar dalam Hidup Berawal dari Mimpi-Perspektif. Ketiga, terdapat tujuh tokoh utama dalam kumpulan cerpen yang memiliki nilai karakter responsif, meliputi (1) Reza dalam Kau Puisi, (2) penyair dalam Hidup Berawal dari Mimpi-Utopia, (3) aku dalam Kita Selamanya, (4) aku dalam Xpresikan, (5) Pak Hasan dalam Hidup Berawal dari Mimpi-Titik Balik, (6) Kyai Husain dalam Hidup Berawal dari Mimpi-Kedewasaan, dan (7) Fahd dalam Hidup Berawal dari Mimpi-Percaya. Keempat, terdapat lima tokoh utama dalam kumpulan cerpen yang memiliki nilai karakter religius, meliputi (1) penjual pisang dalam cerpen Sang Juara, (2) aku dalam Not With Me, (3) aku dalam Waktu, (4) aku dalam Save Our Soul, dan (5) aku dalam Hidup Berawal dari Mimpi-Proses. Kelima, terdapat tiga tokoh utama dalam kumpulan cerpen yang memiliki nilai karakter peduli sesama, meliputi (1) aku dalam Not With Me, (2) gadis kecil dalam Hidup Berawal dari Mimpi-Harapan, dan (3) penyair dalam Hidup Berawal dari Mimpi-Utopia. Keenam, terdapat satu tokoh utama dalam kumpulan cerpen yang memiliki nilai karakter proaktif yaitu penjual pisang dalam cerpen berjudul Sang Juara. Ketujuh, terdapat satu tokoh utama dalam kumpulan cerpen yang memiliki nilai karakter tanggung jawab yaitu tokoh Yusuf dalam cerpen berjudul Ya Sudahlah. Berdasarkan simpulan di atas, disarankan dua hal. Bagi guru, penelitian ini dapat menambah pengetahuan baru bagi guru dan dapat menjadi penunjang pengajaran sastra. Selain itu, hasil penelitian ini dapat pula dijadikan pertimbangan bagi pengajar sebagai materi pembelajaran membaca dan menulis cerpen, sehingga dapat membantu mengembangkan keterampilan peserta didik sekaligus memberikan pendidikan karakter sesuai dengan SKL nilai pendidikan karakter di SMA. Bagi peneliti lain, penelitian ini dapat dijadikan sebagai inspirasi dan referensi penelitian. Penelitian lanjutan maupun penelitian lain yang sejalan tentang cerpen, terutama perkembangan karakter tokoh utama dan nilai pendidikan karakter

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 | 515 | 516 | 517 | 518 | 519 | 520 | 521 | 522 | 523 | 524 | 525 | 526 | 527 | 528 | 529 | 530 | 531 | 532 | 533 | 534 | 535 | 536 | 537 | 538 | 539 | 540 | 541 | 542 | 543 | 544 | 545 | 546 | 547 | 548 | 549 | 550 | 551 | 552 | 553 | 554 | 555 | 556 | 557 | 558 | 559 | 560 | 561 | 562 | 563 | 564 | 565 | 566 | 567 | 568 | 569 | 570 | 571 | 572 | 573 | 574 | 575 | 576 | 577 | 578 | 579 | 580 | 581 | 582 | 583 | 584 | 585 | 586 | 587 | 588 | 589 | 590 | 591 | 592 | 593 | 594 | 595 | 596 | 597 | 598 | 599 | 600 | 601 | 602 | 603 | 604 | 605 | 606 | 607 | 608 | 609 | 610 | 611 | 612 | 613 | 614 | 615 | 616 | 617 | 618 | 619 | 620 | 621 | 622 | 623 | 624 | 625 | 626 | 627 | 628 | 629 | 630 | 631 | 632 | 633 | 634 | 635 | 636 | 637 | 638 | 639 | 640 | 641 | 642 | 643 | 644 | 645 | 646 | 647 | 648 | 649 | 650 | 651 | 652 | 653 | 654 | 655 | 656 | 657 | 658 | 659 | 660 |