The development of English syllabus and lesson plans at SMK Negeri 8 Malang / Herny Istiqomah

 

Key words: the development, English syllabus, English lesson plans This study was intended to describe how English syllabus and lesson plans at SMK Negeri 8 Malang are developed. This study was a descriptive qualitative research. The study was conducted in SMK Negeri 8 Malang. The subject of the study was the Vice Principal of Curriculum Affairs and three English teachers. The data were obtained from the Vice Principal of Curriculum Affairs and three English teachers of grade X which coded as Teacher 1 (T1), Teacher 2 (T2), and Teacher 3 (T3). The research used questionnaires and interview guide to collect all data and information. Based on the findings, the research concluded that the development of English syllabus and lesson plans at SMK Negeri 8 Malang is influenced by the vision and missions of the school and the curriculum use for English subject which combines the curriculum of SMK and SMA. The formats of the syllabus and lesson plans follow the criteria of KTSP syllabus and lesson with character values. The procedures of developing the syllabus do not completely follow the criteria of KTSP while the procedures of developing the lesson plan follow the criteria of KTSP. It could hereafter be seen upon descriptions as follows. Firstly, to reach the vision and missions of the school, the time allocation for English subject is bigger than the minimum requirement that is set in the Standard of Content. In addition, the curriculum use is aimed to prepare the students to compete with SMA students in facing the National Examination. Secondly, the format of the syllabus follows the criteria of KTSP which consists of syllabus identity, standard of competence, basic competence, indicator, instructional materials, learning activity, assessment, time allocation, and learning sources. In addition, the syllabus is categorized as characterized syllabus since the character values is put in the syllabus. Furthermore, the format of the lesson plan follow the standard lesson plan of KTSP which consists of standard of competence, basic competence, indicator, learning objectives, instructional materials, learning methods, learning stages, learning sources, and assessment. The character values are also put in the lesson plans. Therefore, the lesson plans of T1 and T3 are considered as characterized lesson plans while the lesson plan of T2 are not considered as a characterized lesson plan since there is no character values in the lesson plan. The last, the procedures of developing the syllabus do not completely follow the procedures of developing the syllabus by KTSP since the syllabus does not change significantly in every year while the procedures developing the lesson plans follow the procedures of developing the lesson plan of KTSP. In fact, the development of syllabus and lesson plans at SMK Negeri 8 Malang does not take significant roles in determining the learning outcomes of the students. In contrast to the potential of the school which is accredited as A and implements the ISO 9001:2008 as the management quality system, the syllabus and lesson plans are only for the documentation of school administration. Based on the aforementioned evidences, the researcher provides some suggestions. For English teachers, they should develop the syllabus and lesson plan not just for the documentation of school administration, but as the planning that will determine the learning outcome of the students and establish good communication among the teachers to have the same idea of developing the syllabus and lesson plans, especially in putting the character values in the lesson plan. For the Vice Principal of Curriculum Affairs, he should check the documentation of school administrations and evaluate the development of syllabus and lesson plan at school thoroughly. At last, the future researchers can do a study focusing in the implementation of the syllabus and lesson plans at school.

Upaya masyarakat untuk mengatasi konflik antar petani sebagai akibat rusaknya tanggul irigasi (dam dremen) di Kelurahan Klemunan Kecamatan Wlingi Kabupaten Blitar / Linda Septiana

 

Kata Kunci: Mengatasi Konflik Antar Petani, Rusaknya Dam Dermen Konflik merupakan hal yang biasa terjadi di masyarakat sebagai akibat adanya interaksi sosial antar masyarakat. Konflik antar petani di Kelurahan Klemunan, Kecamatan Wlingi, Kabupaten Blitar yang disebabkan rusaknya tanggul irigasi (Dam Dermen) yang kemudian memunculkan konflik diantara para petani, hal ini merupakan salah satu contohnya. Banyak pengalaman yang dapat diambil dari adanya konflik tersebut. Disisi lain konflik dianggap dapat meningkatkan kinerja kelompok, tetapi disisi lain kebanyakan kelompok dan organisasi dianggap dapat memecah belah mereka, sehingga kebanyakan dari mereka lebih memilih untuk menghindari konflik. Penelitian ini bertujuan untuk : (1) Penyebab terjadinya konflik antar petani di Kelurahan Klemunan Kecamatan Wlingi Kabupaten Blitar; (2) Upaya yang dilakukan masyarakat untuk mengatasi konflik; (3) Peran Pemerintah untuk mengatasi konflik; (4) Hambatan masyarakat dalam menangani konflik; (5) Upaya masyarakat untuk mengatasi hambatan dalam menyelesaikan konflik antar petani. Penelitian ini menggunakan pendekatan kualitatif yaitu berusaha mendapatkan informasi yang selengkap mungkin mengenai upaya masyarakat dalam menyelesaikan konflik antar petani di Kelurahan Klemunan Kecamatan Wlingi Kabupaten Blitar. Informasi yang digali lewat observasi dan wawancara serta dokumentasi terhadap informan yaitu Bapak Kepala Kelurahan Klemunan, Bapak Sekretaris Kelurahan Klemunan, Kepala Lingkungan Kelurahan Klemunan, Bapak Ketua RT, serta warga sekitar. Jenis penelitian yang digunakan dalam penelitian ini adalah kualitatif deskriptif, yaitu dengan reduksi data, display data dan pengambilan kesimpulan. Hasil penelitian dan pembahasan menunjukkan bahwa (1) penyebab terjadinya konflik antar petani di Kelurahan Klemunan Kecamatan Wlingi Kabupaten Blitar adalah (a) Kurangnya kesadaran masyarakat untuk mematuhi kesepakatan yang telah dibuat (b) Perbedaan pemahaman akan pentingnya kesepakatan yang telah dibuat (c) Perbedaan sikap dan kepribadian (d) Perubahan keadaan yang mendadak; (2) Upaya yang dilakukan masyarakat untuk mengatasi konflik antar petani di Kelurahan Klemunan adalah (a) Melakukan akomodasi atau peleburan urusan pribadi untuk lebih mementingkan kepentingan bersama (b) Mengupayakan melakukan kompromi atau diskusi mencari jalan tengah agar tidak ada yang dirugikan (c) Berusaha menciptakan kesepakatan antara pihak yang berkonflik atau melalui mediasi; (3) Peran pemerintah untuk mengatasi konflik antar petani di Kelurahan Klemunan adalah (a) Menyelesaikan konflik melalui persuasi (b) Diskusi dengan kelompok yang bertikai untuk mencapai kesepakatan (c) Melakukan pendekatan pada pihak yang berkonflik; (4) Hambatan masyarakat dalam menyelesaikan konflik antar petani di Kelurahan Klemunan adalah (a) Sulitnya mencari mediator dalam proses mediasi (b) Perbedaan karakter dan kebudayaan; (5) Upaya masyarakat untuk mengatasi hambatan dalam menyelesaikan konflik antar petani di Kelurahan Klemunan adalah (a) Menunjuk seorang mediator yang disegani di Kelurahan Klemunan (b) Berusaha menyatukan perbedaan karakter dan kebudayaan masyarakat yang berkonflik dengan membentuk kelompok tani. Berdasarkan hasil penelitian tersebut dapat disarankan sebagai berikut : (1) Untuk masyarakat, jika terjadi konflik hendaknya segera diselesaikan dengan baik tanpa menggunakan kekerasan atau pertikaian (2) Untuk petani yang terlibat konflik, penyelesaian konflik dapat dilakukan dengan berbagai cara, jika terjadi konflik di masyarakat hendaknya dipilih cara yang paling tepat dalam penyelesaiannya (3) Untuk mediator harus melakukan pendekatan dengan kelompok yang terlibat konflik. Agar dapat diketahui penyebab yang pasti terjadinya konflik sehingga dapat mengawal jalannya mediasi dengan baik (4) Untuk peneliti lanjutan, hasil penelitian ini hendaknya dapat dijadikan informasi tambahan untuk penelitian di bidang manajemen konflik.

Kinerja birokrasi desa dalam meningkatkan pelayanan publik di Desa Gedongarum Kecamatan Kanor Kabupaten Bojonegoro / Ahmad Bonadi

 

Bonadi, Ahmad.2013. Kinerja Birokrasi Desa Dalam Meningkatkan Pelayanan Publik di Desa Gedongarum Kecamatan Kanor Kabupaten Bojonegoro. Skripsi, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (1) Drs. Edi Suhartono, S.H., M.Pd, (II) Nuruddin Hady, S.H., M.Hum. Kata Kunci: Kinerja Birokrasi Desa, Pelayanan Publik. Pelayanan publik, segala bentuk kegiatan pelayanan yang dilaksanakan oleh instansi pemerintah pusat, daerah dan lingkungan badan usaha milik Negara atau daerah dalam bentuk barang dan atau jasa, baik dalam rangka upaya pemenuhan kebutuhan masyarakat maupun dalam rangka pelaksanaan ketentuan peraturan perundang-undangan. Akan tetapi pemerintahan pasca reformasi tidak menjamin reformasi di bidang birokrasi terealisasi dengan baik. Sebagian masyarakat masih merasa reformasi yang terjadi tidak menyentuh sama sekali reformasi di bidang birokrasi pemerintahan baik pusat maupun daerah. Tuntutan adanya pelayanan yang berkualitas disetiap daerah, mendorong peneliti untuk melihat langsung bagaimana kinerja birokrasi desa dalam meningkatkan pelayanan publik yang ada di desa Gedongarum kecamatan Kanor kabupaten Bojonegoro. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal meliputi: (1) kedudukan birokrasi desa Gedongarum (2) kinerja birokrasi desa Gedongarum (3) permasalahan yang di hadapi pemerintah desa Gedongarum (4) upaya yang dilakukan pemerintah desa Gedongarumdalam mengatasi permasalahan yang dihadapi, serta (5) Akses masyarakat dalam mengawasi kebijakan pemerintah desa Gedongarum. Model penelitian ini menggunakan pendekatan kualitatif, jenis deskriptif. Lokasi penelitian di desa Gedongarum kecamatan Kanor kabupaten Bojonegoro. Sumber data yang digunakan menggunakan data primer dan data sekunder, pengumpulan data dilakukan dengan menggunakan teknik wawancara, observasi dan telaah dokumentasi. Dalam kegiatan analisis dimulai dari tahap reduksi data kemudian penyajian data dan terakhir penarikan kesimpulan. Berdasarkan hasil analisis data tersebut diperoleh lima kesimpulan, hasil penelitian sebagai berikut. Pertama,kedudukan birokrasi desa adalah sebagai pengelola administrasi desa yaitu mengatur dan mengelola buku-buku administrasi yang ada didesa sesuai dengan tugas dari masing-masing bidang kepala urusan ( KAUR), selain itu juga ada tugas non administrasi yaitu tentang pemberdayaan masyarakat desa Gedongarum, peningkatan sumberdaya manusia melalui pembinaaan dan pelatihan, dan pengembangan potensi desa, serta melaksanakan pembinaan terhadap organaisasi pemuda dan lembaga kemasyarakatan desa.Kedua, pemerintah desa Gedongarum kecamatan Kanor kabupaten Bojonegoro di dalam memberikan pelayanan publik kepada masyarakat bisa dikatakan sudah sesuai dengan kriteria pelayanan publik yang professionalyang mempunyai ciri-ciri antara lain (1) Efektif, (2) Sederhana (3) Kejelasan dan kepastian (transparan), (4) Keterbukaan (5) Efisiensi (6) Ketepatan waktu, (7) Responsif dan (8) Adaptif. Ketiga, ada beberapa masalah yang dihadapi pemerintah desa dalam menjalankan tugasnya antara lain : (1) Masalah dalam menjembatani atau mengakomodir kepentingan masyarakat banyak yang berbeda, (2) Tidak terealisasi semua rencana pembangunan satu tahun berjalan, (3) Masalah pembagian bantuan dari pemerintah seperti sembako, jamkesmas atau jamkesda (4) pembengkakan anggaran dana desa, (5) Tidak lengkapnya struktur kepengurusan Badan Permusyawaratan Desa ( BPD ). Keempat, upaya yang dilakukan pemerintah desa Gedongarum dalam mengatasi permasalahan yang dihadapi antara lain : (1) Mengedepankan asas musyawarah, (2) Dalam pelaksanaan rencana pembangunan yang ada dalam satu tahun berjalan tersebut di utamakan kebutuhan yang sangat penting dahulu dan membawa manfaat bagi masyarakat secara umum,(3)Meminta bantuan ketua RT untuk mendata anggotanya yang benar-benar memerlukan bantuan dari pemerintah baik sembako maupun pelayanan kesehatan seperti jamkesmas dan jamkesda, (4) Untuk mengatasi mengenai pembengkakan anggaran dana desa solusi dari hasil musyawarah aparat pemerintah desa adalah dengan cara meminjam terlebih dahulu anggaran lain dan memilah-milah program kerja yang lebih penting di realisasikan terlebih dahulu, (5) Untuk menyelesaikan masalah akan kekosongan dari Bendahara BPD, sekretaris BPD bertugas rangkap jabatan menjadi Bendahara BPD.Kelima, Mekanisme yang dilakukan masyarakat dalam mengkritisi kebijakan pemerintah desa Gedongarum adalah melalui ketua RT atau anggota Badan Permusyawaratan desa ( BPD ). Berdasarkan hasil penelitian disarankan (1) Pemerintah desa seyogjanya meningkatkan kualitas dari proses dan hasil pelayanan publik agar dapat memberikan kenyamanan, kelancaran dan kepastian hukum yang dapat dipertanggungjawabkan (2) Masyarakat hendaknya tidak hanya menilai pemerintah desa dari luarnya saja, tetapi juga harus lebih menghargai apa yang telah diupayakan oleh pemerintah desa dalam upaya meningkatkan pelayanan publik kepada masyarakat serta meningkatkan pembangunan desa (3) Bagi peneliti selanjutnya apabila meneliti meneliti hal yang sama dengan peneliti ini diharapkan variabel yang ingin diteliti lebih diperluas lagi dan dalam pengambilan data lebih ditingkatkan metode-metode yang digunakan, sehingga hasil penelitian diharapkan dapat digunakan sebagai landsasan atau literature untuk penelitian lebih lanjut.

Pembinaan rasa cinta budaya melalui kegiatan ekstrakurikuler karawitan di SMP Negeri 2 Sambit Kecamatan Sambit Kabupaten Ponorogo / Rely Mariana Dewi

 

Kata Kunci : Kebudayaan, Ekstrakurikuler, Karawitan Kodrat manusia selalu hidup bersama karena manusia bersifat homo socius . Interaksi antar manusia terjadi melalui cipta, rasa dan karsa dan karyanya melahirkan kebudayaan. Kebudayaan merupakan sesuatu yang bersifat organis yang lahir, timbul dan berkembang dalam dinamika dan tantangan masyarakatnya. Produk budaya yang menjadikan hidup manusia indah dan bermakna adalah kesenian. Di Jawa salah satu wujud kesenian yang dianggap bernilai adi luhung adalah karawitan. Di Ponorogo Karawitan merupakan asset kebudayaan daerah yang perlu dilestarikan. Untuk merealisasi hal itu SMP Negeri 2 Sambit memasukkan kesenian karawitan sebagai program ekstrakurikuler. Kegiatan tersebut sebagai tindak lanjut dari rencana pelestarian budaya Jawa dan juga usulan dari para guru yang mencintai budaya sendiri. Ekstrakurikuler Karawitan di SMP Negeri 2 Sambit sebagai upaya pelestarian budaya melalui penanaman cinta budaya lokal (Jawa) kesenian Karawitan inilah sebagai upaya menjaga eksistensi budaya Jawa dan menjadi hal yang menarik untuk diteliti. Penelitian ini bertujuan untuk mendiskripsikan: (1) latar belakang diadakannya ekstrakurikuler karawitan di SMP Negeri 2 Sambit; (2) rancangan program pembinaan rasa cinta budaya melalui ekstrakurikuler karawitan di SMP Negeri 2 Sambit; (3) pelaksanaan pembinaan rasa cinta budaya melalui ekstrakurikuler yang berlangsung di SMP Negeri 2 Sambit; (4) tanggapan siswa terhadap pembinaan rasa cinta budaya melalui kegiatan ekstrakurikuler karawitan di SMP Negeri 2 Sambit; (5) kendala yang dihadapi program pembinaan rasa cinta budaya melalui ekstrakurikuler karawitan di SMP Negeri 2 Sambit; (6) usaha dalam mengatasi kendala yang dihadapi dalam kegiatan ekstrakurikuler karawitan di SMP Negeri 2 Sambit. Metode yang digunakan dalam penelitian ini adalah menggunakan pendekatan kualitatif dengan jenis penelitian studi kasus. Teknik pengumpulan data yang digunakan adalah observasi, wawancara dan dokumentasi. Penelitian ini diperoleh kesimpulan sebagai berikut; (1) Latar belakang dipilihnya ekstrakurikuler karawitan adalah sebagai bentuk pelestarian budaya Jawa yang harus dijaga dan dilestarikan . Selain itu juga sebagai wadah para siswa untuk menuangkan minat dan bakatnya di bidang seni karawitan; (2) Perencanaan (program) ekstrakurikuler karawitan mempunyai tujuan untuk melestarikan kebudayaan , untuk menjadikan para siswa sebagai generasi muda yang tidak tercerabut dari akar budaya daerahnya; (3) Pelaksanaan kegiatan ekstrakurikuler karawitan SMP Negeri 2 Sambit dilaksanakan secara rutin setiap hari Rabu pukul 12.30 sepulang sekolah. Pada pelaksanaan ekstrakurikuler karawitan diawali dengan berdo’a bersama kemudian dilanjutkan dengan latihan “nabuh” alat musik karawitan dan mempelajari “gendhing” (lagu;tembang) dan diakhiri dengan do’a; (4) Melalui kegiatan ekstrakurikuler karawitan ini para siswa mempunyai rasa cinta budaya; (5) Beberapa kendala dalam kegiatan ekstrakurikuler karawitan ini yaitu faktor cuaca dan fasilitas yang kurang memenuhi syarat; (6) Upaya dalam mengatasi kendala tersebut adalah sedang diupayakan dengan jalan mengupayakan tempat yang lebih memadai.

Motivasi belajar siswa yang terbiasa menggunakan facebook dalam mata pelajaran PKn siswa kelas VIII-7 di SMPN 3 Malang / Irawan Hadi Wiranata

 

Kata Kunci: Motivasi Belajar, Facebook, Pelajaran Pkn Facebook merupakan salah satu jejaring sosial yang tengah populer dikalangan remaja. Dengan facebook seseorang dapat bertukar informasi, memberikan komentar, chatting, mengunggah gambar, catatan, dan video kemudian membagikan kepada pengguna lain. facebook sedikit banyak mempengaruhi belajar siswa. Siswa yang kecanduan facebook akan mengurangi motivasi belajarnya, tetapi sebaliknya siswa yang mampu memanfaatkan facebook bisa menumbuhkan motivasi belajar. Terlebih pelajaran PKn yang bisa dikatakan membosankan bagi siswa jika guru kurang inovatif dalam menyampaikan materi. Penelitian ini bertujuan untuk mengetahui: 1). Motivasi belajar siswa yang terbiasa menggunakan facebook dalam mata pelajaran PKn pada siswa kelas VIII-7 di SMPN 3 Malang, 2). Faktor-faktor yang menimbulkan motivasi belajar siswa yang terbiasa menggunakan facebook dalam mata pelajaran PKn pada siswa kelas VIII-7 di SMPN 3 Malang, dan 3). Bentuk-bentuk motivasi belajar siswa yang terbiasa menggunakan facebook dalam mata pelajaran PKn pada siswa kelas VIII-7 di SMPN 3 Malang. Penelitian ini merupakan penelitian deskriptif kualitatif. Teknik pengumpulan data yang digunakan adalah wawancara, observasi, dan dokumentasi. Teknik analisis data yang digunakan adalah model analisis kualitatif pendekatan induktif. Penelitian dilakukan di SMPN 3 Malang dengan objek penelitian adalah motivasi belajar siswa yang terbiasa menggunakan facebook siswa kelas VIII-7. Hasil yang diperoleh dari penelitian ini adalah Motivasi belajar siswa yang terbiasa menggunakan facebook terhadap pelajaran Pkn pada siswa kelas VIII-7 SMPN 3 Malang hampir sama dengan siswa lainnya di kelas tersebut. Motivasi mereka belajar PKn karena PKn merupakan pelajaran yang wajib menurut kurikulum. Sehingga apapun keadaannya harus mengikuti pelajaran PKn dengan berbagai kekurangan dalam pelaksanaan KBM. Dari segi faktor yang mempengaruhi motivasi belajar, terlihat ada 2 faktor. Yang pertama faktor individual, yaitu berasal dari dalam diri. Siswa yang masih labil atau dalam tahap perubahan menuju remaja dipengaruhi mental yang ada dalam diri siswa itu sendiri, kemudian faktor emosi, motivasi dari dalam diri, kecerdasan dan kepribadian masing-masing individu. Faktor sosial, yaitu berasal dari keadaan sosial di rumah maupun di sekolah. Bentuk motivasi belajar yang dirangsang oleh guru tercipta melalui angka atau nilai, ulangan atau ujian, dan hukuman. Dari penelitian ini saran-saran yang diajukan yaitu: (1) hendaknya Kepala Sekolah lebih memperhatikan terhadap guru-guru yang mengajar untuk menimbulkan motivasi bagi siswa. Karena motivasi penting dalam menumbuhkan minat belajar siswa, (2) dengan menggunakan jejaring sosial facebook diharapkan siswa mampu menggunakan itu untuk membantu kegiatan belajar. Pergunakan teknologi untuk membantu motivasi dalam belajar. (3) Untuk para guru diharapkan lebih memanfaatkan jejaring sosial untuk media pembelajaran.

Pelaksanaan tata tertib sekolah dalam rangka pembinaan moral di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan Kabupaten Pacitan / Revin Septiandho

 

Kata Kunci: Tata Tertib, Pembinaan Moral. Dalam skripsi ini, penulis meneliti pelaksanaan tata tertib sekolah dalam rangka pembinaan moral di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan Kabupaten Pacitan. Dari hasil pengamatan awal di lapangan yang dilakukan oleh peneliti di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan, diketahui kasus atau pelanggaran terhadap tata tertib sekolah masih sering dilakukan siswa. Pelanggaran tersebut meliputi tidak masuk tanpa keterangan (alpa), meninggalkan pelajaran tanpa izin, baju tidak dimasukkan, mencorat-coret seragam sekolah. Hal ini menunjukkan bahwa tingkat kasus atau pelanggaran terhadap tata tertib sekolah yang dilakukan oleh siswa masih cukup tinggi. Pelanggaran terhadap tata tertib sekolah menunjukkan siswa kurang patuh terhadap peraturan sekolah. Sedangkan pelanggaran tata tertib yang sering dilakukan oleh guru dan karyawan/Tu selama ini adalah keterlambatan kehadiran. Oleh karena itu penelitian ini bertujuan untuk mengetahui: (1) Muatan pembinaan moral dalam tata tertib di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan, (2) pelaksanaan tata tertib sekolah sebagai sarana pembinaan moral di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan, (3) kendala-kendala yang dihadapi dalam pelaksanaan tata tertib sekolah sebagai sarana pembinaan moral di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan, dan (4) upaya yang dilakukan untuk mengatasi kendala-kendala yang dihadapi dalam pelaksanaan tata tertib sekolah sebagai sarana pembinaan moral di Sekolah Menengah Kejuruan (SMK) Negeri 1 Nawangan. Dalam penelitian ini, peneliti menggunakan penelitian yang bersifat kualitatif deskriptif. Data yang didapatkan kemudian dianalisis secara deskriptif melalui prosedur pemecahan masalah dengan cara memaparkan data, menganalisis, menyimpulkan dan melaporkan hasil temuan tersebut. Lokasi penelitian ini berada di SMK Negeri Nawangan yang beralamat di Jl Jenderal Sudirman No. 3 Pakis Baru, kecamatan Nawangan, Kabupaten Pacitan. Teknik pengumpulan data menggunakan metode observasi, wawancara, dan dokumentasi. Temuan penelitian menunjukkan bahwa, muatan pembinaan moral dalam tata tertib SMKN 1 Nawangan terdapat dalam tata tertib guru, karyawan/TU dan siswa SMKN 1 Nawangan. Muatan pembinaan moral yang terkandung dalam tata tertib guru adalah sopan santun, tanggung jawab guru dengan semua tugasnya sebagai pengajar, serta tertib dalam jam kehadiran maupun jam mengajar. Muatan pembinaan moral pada tata tertib karyawan/TU di SMKN 1 Nawangan adalah sopan dalam berpenampilan dan santun dalam berbicara serta tanggung jawab dan tertib/ketertiban dalam kehadiran di sekolah. Muatan pembinaan Moral pada tata tertib Siswa SMKN 1 Nawangan antara lain dalam etika berpakaian, sopan santun terhadap guru, bertingkah laku terhadap teman baik sebaya maupun adik kelas dan kakak kelas, ketepatan waktu/kedisiplinan, ketakwaan terhadap Tuhan YME, serta kejujuran siswa SMKN 1 Nawangan. Pelaksanaan tata tertib sekolah dalam rangka pembentukan pembinaan moral di sekolah dibagi menjadi pelaksanaan tata tertib guru, karyawan/TU, dan tata tertib siswa. Pelaksanaan tata tertib guru masih ditemui beberapa pelanggaran dalam hal keterlambatan kehadiran guru pada jam pertama. Pelaksanaan tata tertib karyawan/TU keterlambatan kehadiran karyawan/TU di sekolah. Dalam pelaksanaan tata tertib siswa di SMKN 1 Nawangan masih ada pelanggaran yang dilakukan terutama dalam perihal pakaian/seragam, kehadiran, dan perijinan. Selain itu ada beberapa pelanggaran lain yaitu menggunakan hp pada waktu KBM, terlambat 10 menit, membolos mulai jam ke 2 sampai terakhir, memalsu surat keterangan, tidak menyerahkan surat keterangan tugas dari RT, membawa rokok, melindungi teman yang melanggar tatib, parkir motor diluar lingkungan sekolah, tidak ikut upacara, tidak masuk 3 hari berturut-turut, memakai pewarna rambut, menyimpan film porno di HP, tidak melaksanakan piket kelas, memakai sandal, dan membolos dengan alasan kegiatan sekolah. Kendala yang dihadapi dalam pelaksanaan tata tertib di SMKN 1 Nawangan meliputi kendala yang dialami guru, karyawan/TU dan siswa. Kendala dalam pelaksanaan tata tertib bagi guru meliputi faktor alam yaitu letak geografis yang berada di pegunungan, cuaca yang sewaktu-waktu sering hujan, transportasi yang kurang memadai,serta kondisi gedung yang terbagi menjadi dua gedung yang berjarak cukup jauh. Kendala pelaksanaan tata tertib karyawan/TU di sekolah adalah kondisi geografis cuaca dan juga transportasi yang kurang memadahi. Dan kendala pelaksanaan tata tertib siswa adalah faktor cuaca yang sewaktu-waktu sering hujan, transportasi yang kurang memadahi, serta kurang adanya semangat dan motivasi siswa untuk datang ke sekolah. Upaya yang dilakukan untuk mengatasi kendala-kendala yang dihadapi dalam pelaksanaan tata tertib sekolah dengan cara memberikan teguran kepada guru, karyawan/TU yang melanggar tata tertib sekolah, serta berusaha untuk mengatasi permasalahan dalam tata tertib dengan cara (1) memundurkan jam masuk pertama dari jam 07.00 menjadi jam 07.15, (2) memperbaiki akses jalan masuk ke lingkungan sekolah, (3) membuat jadwal piket untuk tim STP2K, dan (4) memberikan motivasi dan sosialisasi pentingnya sekolah dan mematuhi tata tertib bagi siswa, serta (5) memberi poin pelanggaran kepada siswa yang melakukan pelanggaran tata tertib. Dari hasil penelitian ini saran-saran yang diajukan yaitu: (1) kepala sekolah, guru dan karyawan/ TU SMKN 1 Nawangan diharapkan memberikan contoh positif dengan cara tidak melakukan pelanggaran tata tertib sekolah, (2) kepala sekolah dan guru SMKN 1 Nawangan diharapkan memberikan motivasi kepada siswa agar bersemangat pergi ke sekolah, (3) perlu dibangun sarana dan prasarana yang memadahi terutama pagar sekolah sebagai pembatas agar siswa tidak ada yang terlambat masuk ke sekolah, (4) kepala sekolah agar memberikan peringatan dan sanksi yang tegas kepada guru dan karyawan/TU yang melakukan pelanggaran tata tertib sekolah, (5) bagi tim STP2K agar benar-benar memberikan sanksi yang tegas bagi siswa yang melanggar tata tertib sekolah.

Pengaruh model group investigation terhadap kemampuan berpikir analisis siswa kelas X SMA Negeri 1 Lawang Kabupaten Malang / Valeriana Rasweda Shela Perwitasari

 

Kata Kunci: pembelajaran model group investigation, kemampuan berpikir analitis Model pembelajaran yang berkembang saat ini adalah pembelajaran kooperatif, yang mengkondisikan siswa untuk aktif dan saling memberi dukungan dalam kerja kelompok untuk menuntaskan materi masalah dalam belajar. Pembelajaran kooperatif memiliki berbagai macam model, salah satunya ialah Group Investigation. Dipilihnya model Group Investigation karena model ini merupakan model pembelajaran kooperatif yang memadukan antara prinsip belajar kooperatif dengan pembelajaran yang berbasis konstruktivisme dan prinsip pembelajaran demokrasi, dapat melatih siswa menumbuhkan kemampuan berpikir mandiri, dan adanya kelebihan-kelebihan dari model ini. Tujuan penelitian ini ialah untuk mengetahui apakah kemampuan berpikir analitis siswa pada mata pelajaran geografi dengan menggunakan pembelajaran model Group Investigation lebih tinggi daripada siswa yang tidak menggunakan (konvensional). Konvensional pada penelitian ini merujuk pada kegiatan pembelajaran yang biasa dilakukan di kelas, yaitu ceramah, tanya jawab, dan diskusi. Jenis penelitian ini ialah penelitian eksperimen semu yang termasuk penelitian kuantitatif. Penelitian dilakukan di SMA Negeri 1 Lawang Kabupaten Malang dengan kelas eksperimen X-8 dan kelas kontrol X-6, yang masing-masing terdiri dari 36 siswa. Data dalam penelitian ini ialah kemampuan berpikir analitis siswa. Pengumpulan data dengan pemberian tes sebelum perlakuan dan sesudah perlakuan. Analisis data dengan membandingkan gain score kemampuan berpikir analitis siswa menggunakan program SPSS 16.0for Windows . Hasil penelitian menunjukkan bahwa kemampuan berpikir analitis siswa kelas X yang mengikuti pembelajaran dengan model Group Investigation lebih tinggi daripada siswa yang tidak menggunakan (konvensional) di SMA Negeri 1 Lawang. Diharapkan pada guru mata pelajaran, dapat menerapkan pembelajaran model Group Investigation sebagai alternatif dalam pembelajaran sehingga siswa mengeluarkan seluruh kemampuannya dalam pembelajaran, terutama dalam kemampuan berpikir analitis.

Pengaruh model pembelajaran kooperatif number head together terhadap hasil belajar siswa pada topik hidrosfer kelas X MAN Malang II Batu / Novita Selviana

 

Kata kunci: Model PembelajaranNumber Head Together, hasilbelajar Peningkatan hasil belajar dapat dilakukan dengan meningkatan kualitas proses pembelajaran. Salah satu jenis model pembelajaran yang dapat digunakan untuk meningkatkan hasil belajar adalah model Number Head Together.Pembelajaran menggunakan Number Head Together, terdiri dari 4 fase yaitu: penomoran, pengajuan pertanyaan, berpikir bersama dan pemberian jawaban. Padadasarnya modelinidapatmeningkatkanpelaksanaanaktivitas belajar siswa yang berujungpadameningkatnyaketerampilankognitifsiswayaituhasilbelajar. Penelitian ini bertujuan untuk membuktikanpengaruhpenerapanpembelajarankooperatif model Number Head Together terhadaphasilbelajargeografisiswakelas X MAN Malang II Batu. Penelitian ini dirancangmenggunakanpenelitian eksperimen semu (Quasi Eksperiment) dengan mengambil subjek penelitian dua kelas yaitu kelas X6 sebagai kelas eksperimen dan kelas X10 sebagai kelas kontrol. Instrumen penelitian berupa tes untuk prates dan pascates. Teknik analisis yang digunakan adalah uji t tidak berpasangan (Independent Samples Test) yang dapat diselesaikan dengan bantuan SPSS 16.00 for Windows. Hasil penelitian menunjukkan bahwa terdapat pengaruh model pembelajaran Number Head Togetherterhadap hasil belajar geografi siswa di MAN Malang II Batu.Dari hasil analisis data diketahui bahwa hasil belajar siswa pada kelas yang menggunakan model pembelajaranNumber Head Togethermemiliki rata-rata sebesar 34,45 sedangkan pada kelas yang menggunakanpembelajarankonvensional memiliki rata-rata 26,09dengan probabilitas (sig.) 0,001, sehingga dapatdisimpulkanbahwaada pengaruh penerapan model pembelajaran Number Head Together terhadap hasil belajar Geografi siswa pada topik Hidrosfer. Disarankan bagi sekolahuntukmemberikan dukunganterhadap guru-guru tentang model pembelajarankooperatif, khususnyaNumber Head Togetherdalamkegiatanpembelajaran. Bagi guru Geografi untuk menggunakan model pembelajaran Number Head Togethersebagai alternatif model pembelajaran karena dapat meningkatkan hasil belajar siswa. Bagi peneliti lanjut yang menelititentang model pembelajaranNumber Head Together disarankan untuk mengelolawaktudenganbaik agar model pembelajaranNumber Head Togetherterlaksanadenganbaik.

Penerapan perpaduan model pembelajaran kooperatif numbered heads together dan debate untuk meningkatkan kemampuan berpikir kritis geografi materi lingkungan hidup kelas XI IPS 2 SMA Negeri Ploso Jombang / Debrina Kusuma Wardhani

 

Kata Kunci: model pembelajaran Numbered Heads Together dan Debate, kemampuan berpikir kritis. Mengacu pada pembelajaran konstruktivistik, pembelajaran terpusat pada siswa dengan membangun pengetahuannya sendiri. Ketika siswa berupaya membangun pengetahuannya sendiri, secara tidak langsung siswa dilatih untuk berpikir secara mandiri, dalam penelitian ini adalah berpikir kritis. Untuk menstimulus siswa agar mampu meningkatkan kemampuan berpikir kritisnya, guru juga harus dapat mengembangkan model-model pembelajaran yang tepat. Untuk itu perlu diterapkan perpaduan model pembelajaran Numbered Heads Together (NHT) dan Debate untuk meningkatkan kemampuan berpikir kritis geografi. Penelitian ini bertujuan untuk mendeskripsikan penerapan perpaduan model pembelajaran Numbered Heads Together (NHT) dan Debate dalam meningkatkan kemampuan berpikir kritis geografi materi lingkungan hidup kelas XI IPS 2 SMA Negeri Ploso Jombang. Penelitian ini termasuk Penelitian Tindakan Kelas (PTK) dengan subjek penelitian siswa kelas XI IPS 2. Instrumen penelitian ini berupa lembar observasi aktivitas kemampuan berpikir kritis, tes kemampuan berpikir kritis, dan lembar observasi keterlaksanaan pembelajaran perpaduan model Numbered Heads Together (NHT) dan Debate. Analisis data yang digunakan adalah dengan metode scoring dan percenting. Hasil penelitian ini menunjukkan bahwa ada peningkatan kemampuan berpikir kritis geografi kelas XI IPS 2 setelah dilakukan tindakan. Sebelum tindakan, rata-rata kemampuan berpikir kritis geografi sebesar 20,92%. Setelah diberi tindakan pada siklus I, menjadi 70,57%. Pada siklus II, rata-rata kemampuan berpikir kritis naik menjadi 87%. Hasil ini membuktikan bahwa dengan menerapkan perpaduan model pembelajaran Numbered Heads Together (NHT) dan Debate dapat meningkatkan kemampuan berpikir kritis geografi siswa. Disarankan bagi guru geografi untuk menerapkan perpaduan model pembelajaran Numbered Heads Together (NHT) dan Debate sebagai variasi model pembelajaran karena dapat meningkatkan kemampuan berpikir kritis geografi siswa. Bagi siswa disarankan untuk lebih aktif dalam pembelajaran di kelas, mengungkpan ide, saran dan tanggapan saat pembelajaran berlangsung, khususnya mata pelajaran geografi. Bagi peneliti selanjutnya disarankan untuk menambah variabel-variabel lain selain kemampuan berpikir kritis.

Evaluasi kondisi geografis pantai Jolosutro di Kecamatan Wates Kabupaten Blitar / Afif Dwi Afrizal

 

Kata Kunci: Geografis, Pantai Jolosutro Pariwisata merupakan suatu aset yang strategis untuk mendorong pembangunan wilayah yang mempunyai potensi objek wisata. Pembangunan daerah menjadi daerah tujuan wisata tergantung dari daya tarik yang berupa keindahan alam, tempat bersejarah, tata cara hidup bermasyarakat maupun upacara keagamaan. Salah satu daerah yang memiliki objek wisata yang cukup menarik dan bervariatif adalah Kabupaten Blitar. Daerah pesisir wilayah Kabupaten Blitar berhadapan langsung dengan Samudera Hindia, sehingga sesuai untuk dikembangkan untuk wisata rekreasi pantai, salah satunya Pantai Jolosutro. Berdasarkan RTRW Kabupaten Blitar, Pantai Jolosutro diarahkan untuk menjadi kawasan rekreasi pantai bagi masyarakat Kabupaten Blitar maupun wisatawan dari luar daerah. Fasilitas dan potensi yang dimiliki belum dikembangkan secara maksimal yang berakibat pada penurunan jumlah pengunjung. Oleh karena itu, perlu dilakukan penelitian untuk mengetahui potensi yang dimiliki Pantai Jolosutro berdasarkan kondisi geografis, sehingga dapat dilakukan evaluasi terhadap hal-hal yang terkait dengan pengembangan obyek wisata ini. Penelitian ini bertujuan untuk (1) mengetahui kondisi Pantai Jolosutro berdasarkan aspek fisik dalam mendukung pengembangan pariwisata (2) mengetahui kondisi Pantai Jolosutro berdasarkan kondisi sarana pendukung (3) mengetahui interaksi antarwilayah dalam mendukung pengembangan pariwisata berdasarkan analisis spasial. Jenis penelitian ini adalah survei. Subyek penelitian ini adalah obyek wisata Pantai Jolosutro dan wisatawan. Data primer diperoleh dengan teknik pengukuran lapangan, observasi, dan kuesioner. Data sekunder diperoleh dengan teknik dokumentasi. Pengukuran lapangan dan observasi dilakukan dengan teknik purpossive. Data tanggapan pengunjung mengenai kondisi sarana dan pra-sarana Pantai Jolosutro dilakukan dengan mengambil teknik kuota 50 orang. Data dianalisis menggunakan statistik deskriptif. Hasil penelitian menunjukkan kondisi fisik Pantai Jolosutro tergolong dalam kategori sangat mendukung, namun tidak diizinkan untuk wisata aktif di perairan karena terdapat biota berbahaya dan ombak yang besar. Kondisi sarana dan pra-sarana dalam mendukung obyek wisata Pantai Jolosutro tergolong dalam kategori kurang sesuai, terutama dalam pengelolaan warung, tempat parkir, dan toilet serta penyediaan angkutan umum. Pantai Jolosutro memiliki nilai interaksi yang rendah terhadap pusat pemerintahan dibandingkan dengan obyek wisata pantai, namun memiliki daya tarik dan keunikan, yaitu pasir besi dan Upacara Melasti.

Hubungan antara keterampilan mengajar guru dengan hasil belajar pendidikan kewarganegaraan siswa kelas X di MAN 2 Batu / Lailatul Fitria

 

Kata Kunci: Keterampilan Mengajar Guru, dan Hasil belajar Pendidikan Kewarganegaraan. Dalam proses belajar mengajar terjadi dua macam kegiatan yakni kegiatan belajar pada siswa dan kegiatan mengajar pada guru. Pendidikan Kewarganegaraan merupakan salah satu bentuk pendidikan yang ada di Indonesia yang mempunyai bagian dari proses keseluruhan yang mempunyai tujuan dalam pembentukan kognitif, afektif, dan psikomotor seseorang. Terlaksanakannya tujuan Pendidikan Kewarganegaran sendiri tidak lepas dari peranan seorang guru yang memiliki peranan sangat penting dalam keberhasilan siswa, guru harus mampu menumbuhkan minat belajar siswa agar diperoleh hasil belajar yang maksimal. Untuk itu guru harus memiliki keterampilan mengajar yang baik, karena guru adalah pihak yang paling dekat dengan siswa dalam pelaksanaan pendidikan di sekolah. Guru juga menentukan keberhasilan siswa, terutama dalam kaitannya dalam proses pembelajaran. Untuk itu, seorang guru yang mempunyai keterampilan mengajar yang baik, akan menarik minat siswa untuk mengikuti pelajaran sehingga siswa termotivasi untuk belajar. Keterampilan mengajar yang dimiliki guru jika didukung dengan minat belajar siswa yang tinggi, akan melahirkan hubungan timbal balik yang baik bagi perkembangan hasil belajar siswa. Penelitian ini bertujuan untuk mengetahui: bagaimana hubungan antara keterampilan mengajar guru dengan hasil belajar PKn siswa kelas X MAN II Kota Batu. Penelitian ini merupakan penelitian korelasi (correlational research). Populasi pada penelitian ini adalah siswa kelas X MAN II Kota Batu semester dua tahun pelajaran 2012/2013. Sampel penelitian ini terdiri dari 77 siswa yang ditentukan dengan teknik proportional random sampling. Variabel terikat dalam penelitian ini adalah keterampilan mengajar guru, yang terdiri dari keterampilan membuka pelajaran, keterampilan menjelaskan, keterampilan bertanya, keterampilan memberi penguatan, keterampilan menggunakan variasi, dan keterampilan menutup pelajaran, sedangkan variabel bebasnya adalah hasil belajar siswa. Instrument yang digunakan dalam penelitian ini adalah angket, lembar observasi, wawancara, dan dokumentasi. Uji hipotesis penelitian digunakan korelasi Product Moment. Data angket dan data obeservasi yang terdiri dari enam komponen dideskripsikan secara kualitatif. Hasil penelitian ini menunjukkan bahwa ada hubungan yang positif dan signifikan antara keterampilan mengajar dan hasil belajar PKn. Artinya semakin baik keterampilan mengajar guru maka akan di ikuti dengan hasil belajar PKn yang baik.demikian sebaliknya semakin rendah tingkat keterampilan guru mengajar maka akan diikuti hasil belajar PKn yang kurang baik. Koefisien korelasi berada pada kategori sedang. Ini berarti, jika variabel keterampilan mengajar tinggi, maka variabel hasil belajar semakin tinggi. Berikut perhitungan korealasi Product Moment = 0,496. Dari tabel Product Moment diperoleh rt dengan signifikasi 5% adalah 0,296, atau ro > rt (0,496 > 0,296). Karena keterampilan mengajar guru terbukti dapat meningkatkan hasil belajar siswa, maka kiranya perlu ditekankan pada perbaikan dan pengoptimalan kegiatan belajar mengajar. Yang meliputi penguasaan mata pelajaran, keterampilan mengajar, sikap keguruan, pengalaman mengajar, cara menilai, kemauan mengembangkan profesinya, keterampilan komunikasi, kemauan dan kemampuan memberikan bantuan dan bimbingan kepada siswa, dan keterampilan lain yang diperlukan.

Model penyelesaian tawuran pelajar sebagai upaya mencegah terjadinya degradasi moral pelajar (studi kasus di Kota Blitar Jawa TImur) / Septian Bayu Rismanto

 

Kata Kunci: model penyelesaian tawuran pelajar, degradasi moral. Tawuran pelajar merupakan salah satu masalah yang senantiasamuncul di tengah-tengah komunitas masyarakat dan sering menghiasi lembaran koran ataupun televisi. Masalah tersebut merupakan suatu hal yang sangat penting dan selalu menarik serta aktual diperbincangkan karena masalah tawuran pelajar adalah problem yang menimpa gerenasi muda khususnya di bidang pendidikan, sedangkan generasi muda merupakan tumpuhan atau masa depan bangsa dan negara. Di tangan generasi mudalah terletak masa depan negara kita ini. Model penyelesaian tawuran yang efektif dan ampuh untuk menyelesiakan masalah tawuran, akan mengatasi berbagai pengaruh negatif, seperti degradasi moral (kemerosotan moral) yang timbul dari kalangan remaja yang ikut dalam aksi tawuran dan tentunya akan mengubah sudut pandang masyarakat ke arah positif. Positif bagi sekolah, daerah, maupun bangsa dan negara. Berangkat dari latar belakang diatas, penulis mengadakan penelitian dengan tujuan untuk mengetahui faktor-faktor yang melatarbelakangi tawuran, realitastawuran, dampak yang ditimbulkan dari terjadinya tawuran, persepsi sosial masyarakat terhadap tawuran, dan model penyelesaian tawuran sebagai upaya mencegah degradasi moral tentang terjadinya tawuran antara SMK 1 Islam Blitar dengan SMK Katolik Santo Yusuf Blitar di Kota Blitar Jawa Timur, Jenis penelitian yang digunakan ini adalah penelitian deskriptif kualitatif bertujuan untuk menggambarkan, meringkaskan berbagai kondisi, situasi atau berbagi fenomena realitas sosial yang berada di masyarakat yang menjadi objek penelitian dan berupaya menarik realitas itu kepermukaan sebagai suatu ciri, karakter, sifat, model, tanda atau gambaran tentang kondisi, situasi ataupun fenomena tertentu Akhir dari penelitian ini penulis memperoleh suatu kesimpulam bahwa faktor yang melatarbelakangi aksi tawuran antara SMK 1 Islam Blitar dan SMK Katolik Santo Yusuf Blitar, yaitu faktor pihak ketiga, faktor adu gengsi, faktor dendam lama, faktor perempuan, faktor ketersinggungan, faktor saling ejek. Realitas tawuran terjadi pada tahun1989 sampai 2012.Dampak yang ditimbulkan akibat tawuran tersebut, yaitu kerugianfisik,kerugian material masyarakatsekitartempatterjadinyatawuran,menggangukenyamananpengendarajalan,terganggunya proses belajarmengajar, menurunnyamoralitasparapelajarkeduasekolah,hilangnyaperasaanpeka, toleransi, tenggang rasa, dansalingmenghargaiantarsesamapelajarpersepsi masyarakat tentang terjadinya tawuran adalah tawuran sangat berdampak buruk terhadap citra daerahpersepsi masyarakat tentang terjadinya tawuran adalah tawuran sangat berdampak buruk terhadap citra daerah. Dengan adanya penyelesaian tawuran pelajar maka masyarakatmenggagap hal tersebut sebagaititik balik yang positif. Model penyelesain tawuran menggunakan model wejangan dengan suasana kekeluargaan terbukti efektif menyelesaikan konflik kedua belah pihak. Dari hasil penelitian ini, disarankan bagi kepala sekolah, guru, dan para orang tua untuk selalu memberikan pendidikan moral yang baik dan hendaknya bisa menciptakan suasana yang harmonis atau agamis sehingga siswa mempunyai suatu kesibukan yang terarah dan dapat menguntungkan siswa, pihak sekolah, keluarga, alumni, masyarakat Kota Blitar serta bagi bangsa dan negara yang akan datang

Peranan sekolah dalam pendidikan moral di kalangan siswa SMA Negeri 1 Gondang Kabupaten Tulungagung / Anita Okva Ambarwati

 

Kata kunci: peranan sekolah, pendidikan moral Dunia pendidikan di Indonesia dihadapkan pada berbagai permasalahan sosial dan moral. Munculnya perilaku menyimpang di kalangan siswa seperti: tindakan kekerasan antar siswa, penyalahgunaan narkoba, serta berbagai perilaku menyimpang lainnya yang mengarah pada kemerosotan moral siswa. Masyarakat mempertanyakan tanggung jawab sekolah atas maraknya berbagai kasus perilaku menyimpang siswa. Sekolah diharapkan mampu menunjukkan peran dalam mendidik dan membentuk moral siswa, demi mencegah perilaku menyimpang di kalangan siswa. Perlu adanya koordinasi, integrasi dan sinkronisasi pendidikan moral dalam setiap kebijakan sekolah untuk upaya pembentukan moralitas atau budi pekerti siswa. Penelitian ini bertujuan untuk mengetahui sejauh mana peranan sekolah dalam pendidikan moral, bentuk kegiatan sekolah dalam pendidikan moral, hambatan sekolah dalam pendidikan moral dan upaya sekolah mengatasi hambatan dalam pendidikan moral tersebut. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Pengumpulan data dilakukan dengan menggunakan teknik observasi, wawancara dan dokumentasi. Data penelitian berupa paparan tentang peranan sekolah dalam pendidikan moral di kalangan siswa SMA Negeri 1 Gondang Tulungagung diperoleh dari kepala sekolah, wakasek kesiswaan, guru pendidikan kewarganegaraan, guru pendidikan agama dan siswa. Kegiatan analisis data di mulai dari tahap reduksi data, penyajian data dan penarikan kesimpulan atau verifikasi. Berdasarkan hasil analisis data tersebut, diperoleh empat kesimpulan hasil penelitian sebagai berikut: (1) peranan sekolah dalam pendidikan moral ialah berusaha membentuk kepribadian dan perilaku baik siswa melalui penerapan kedisiplinan, ketertiban dan kesopanan, memberikan teladan yang baik bagi siswa agar mentaati aturan yang berlaku, (2) bentuk kegiatan sekolah dalam pendidikan moral melalui kegiatan sosial yaitu kegiatan donor darah dan santunan terhadap anak yatim, kegiatan keagamaan seperti kegiatan istighosah, pondok ramadhan, khataman Al-Qur’an, sholat jumat dan sholat dzuhur berjamaah dan kegiatan kerjasama antara pihak sekolah dengan instansi lain yaitu kegiatan pemeriksaan atau tes urin siswa, (3) hambatan sekolah dalam pendidikan moral ialah latar belakang siswa, siswa salah dalam memanfaatkan perkembangan informasi dan teknologi, serta kurangnya kebersamaan dan ketegasan guru, (4) upaya sekolah mengatasi hambatan dalam pendidikan moral ialah melalui pembinaan, pembiasaan dan pengawasan kepala sekolah, wakasek kesiswaan, guru bimbingan konseling, wali kelas, serta pemberian arahan dan bimbingan oleh guru mata pelajaran. Berdasarkan hasil penelitian dapat disarankan sebagai berikut: (1) meningkatkan koordinasi, integrasi dan sinkronisasi antara kepala sekolah, guru dan siswa untuk meningkatkan pendidikan moral di sekolah, supaya tercipta situasi yang kondusif, sehingga mendukung terwujudnya budi pekerti luhur pada diri siswa, (2) mengingat bahwa penanaman sikap dan nilai moral merupakan proses, maka kegiatan-kegiatan yang berkaitan dengan pendidikan moral perlu dirancang dan diprogramkan secara matang oleh pihak sekolah.

Peran Dinas Perindustrian dan Perdagangan dalam rangka pengembangan pusat perkulakan sepatu Trowulan di Kabupaten Mojokerto / Ahmad Sukrisno Akbar Hamdani

 

Kata Kunci: PeranPemerintah, Pusat Perkulakan Sepatu. Mengingat tujuan negara Indonesia yang salah satunya untuk mensejahterakan rakyat, yaitu salah satunya dengan upaya pemerintahan dalam kebijakan desentralisasi berupa otonomi daerah. Sejak diberlakukan Undang-Undang No. 32 Tahun 2004 tentang Pemerintahan Daerah yang khususnya ada dalam pasal 21, 22, dan 23 yang mengenai hak dan kewajiban yang diwujudkan dalam bentuk rencana kerja pemerintahan daerah dan dijabarkan dalam bentuk pendapatan, belanja, dan pembiayaan daerah yang dikelola dalam sistem pengelolaan keuangan daerah, maka tiap-tiap daerah mempunyai kewenangan sendiri untuk mengatur dan mengurus rumah tangganya sendiri serta mengembangkan segala potensi atau sumber-sumber keuangan yang dimiliki. Pada tahun 2007 berdirinya Pusat Perkulakan Sepatu Trowulan Pemerintah Kabupaten Mojokerto yang diwakili oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto mengembangkan dan memberdayakan keberadaan industri kerajinan alas kaki. Dengan adanya potensi daerah tersebut peneliti tertarik untuk mengkaji secara lebih mendalam keberadaan Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam perannya mengembangkan Pusat Perkulakan Sepatu Trowulan. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal meliputi: 1) Apa yang melatar belakangi program pengembangan Pusat Perkulakan Sepatu Trowulan oleh pemerintah khususnya bagi Dinas Perindustrian dan PerdaganganKabupaten Mojokerto, 2) Apa saja hambatan-hambatan yang dihadapi oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam pelaksanaan program pengembangan Pusat Perkulakan Sepatu Trowulan tersebut, 3) Solusi untuk meminimalisir hambatan-hambatan yang dihadapi oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam pelaksanaan program pengembangan Pusat Perkulakan Sepatu Trowulan tersebut,4) Bagaimana peran Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam usaha menjaga hubungan yang kondusif antara pengrajin dengan pengusaha sepatu untuk memberikan Inovasi dan kreasi di Pusat Perkulakan Sepatu Trowulan. Model penelitian ini menggunakan pendekatan kualitatif, jenis deskriptif. Lokasi penelitian di Dinas Perindustrian dan Perdagangan kabupaten Mojokerto dan Pusat Perkulakan Sepatu Trowulan.. Sumber data yang digunakan menggunakan data primer dan data sekunder, pengumpulan data dilakukan dengan mkewawancarai responden yaitu pegawai yang berwenang menangani Pusat Perkulakan Sepatu Trowulan di Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto, para pedagang, dan seluruh elemen terkait yang berada di Pusat Perkulakan Sepatu Trowulan, observasi dan telaah dokumentasi yang berkaitan dengan Pusat Perkulakan Sepatu Trowulan, foto-foto yang berkaitan dengan Pusat Perkulakan Sepatu Trowulan, dan Laporan kegiatan yang telah dilakukan oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam rangka pengembangan Pusat Perkulakan Sepatu Trowulan. Dalam kegiatan analisis dimulai dari tahap reduksi data kemudian penyajian data dan terakhir penarikan kesimpulan. Berdasarkan hasil analisi data tersebut diperoleh empat kesimpulan, hasil penelitian sebagai berikut. Pertama program pengembangan Pusat Perkulakan Sepatu Trowulan oleh Dinas Perindustrian dan Perdagangan adalah pertama, program pemantauan langsung di Pusat Perkulakan Sepatu Trowulan. Kedua, program promosi atau publikasi Pusat Perkulakan Sepatu Trowulan. Ketiga, program penerapan jam buka kios bagi pedagang di Pusat Perkulakan Sepatu Trowulan. Keempat, program pewajiban penggunaan SPG bagi para pedagang di Pusat Perkulakan Sepatu Trowulan. Kelima, program pembinaan bagi pengrajin sepatu di Kabupaten Mojokerto. Keenam, program pemasaran produk sepatu di Kabupaten Mojokerto. Ketujuh, program bantuan permodalan. Kedelapan, program sewa kios di Pusat Perkulakan Sepatu Trowulan murah. Dan yang terakhir program pengembangan Pusat Perkulakan Sepatu Trowulan oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto yaitu yang kesembilan, program pemudahan akses ke Pusat Perkulakan Sepatu Trowulan. Kedua, Hambatan yang dihadapi oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam Pelaksanaan Program Pengembangan Pusat Perkulakan Sepatu Trowulan yaitu yang pertama, hambatan yang paling medasar dalam pengembangan Pusat Perkulakan Sepatu Trowulan yaitu sepinya pengunjung yang datang ke Pusat Perkulakan Sepatu Trowulan. Kedua, hambatan yang dialami oleh Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dalam upaya pengembangan Pusat Perkulakan Sepatu Trowulan yaitu tidak disiplinnya pedagang Pusat Perkulakan Sepatu Trowulan dalam mematuhi kebijakan dari Dinas Perindustrian dan Perdagangan. Ketiga, inkonsistensi lembaga lain yang diajak kerjasama oleh Dinas Perindustrian dan Perdagangan. Ketiga, dalam menghadapi hambatan-hambatan di atas Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto menerapkan solusi untuk meminimalisir hambatan-hambatan tersebut dalam Upaya Program Pengembangan Pusat Perkulakan Sepatu Trowulan tersebut. Dinas Perindustrian dan Perdagangan secara umum dalam mengatasi hambatan tersebut yaitu pertama, dengan cara pemantapan publikasi atau promosi Pusat Perkulakan Sepatu Trowulan. Kedua, kerjasama dengan aliansi Gabungan Pengusaha Sepatu untuk pemasaran sepatu di Pusat Perkulakan Sepatu Trowulan. Ketiga, penegasan peraturan jam buka kios di Pusat Perkulakan Sepatu Trowulan. Keempat, demi menjaga relasi yang positif antara Dinas Perindustrian dan Perdagangan Kabupaten Mojokerto dengan Pengrajin, Pengusaha, dan Pedagang Sepatu di Pusat Perkulakan Sepatu Trowulan, dalam kedudukannya yaitu pertama, merupakan sebagai fasilitator bagi pengrajin sepatu, pengusaha sepatu, dan pedagang sepatu di Kabupaten Mojokerto khususnya di Pusat Perkulakan Sepatu Trowulan. Kedua, sebagai pembuat kebijakan untuk memudahkan pengrajin, pengusaha, dan pedagang sepatu di Pusat Perkulakan Sepatu Trowulan.

Program pemerintah dalam menanggulangi pengangguran dan kemiskinan di Kota Mojokerto / Farischa Kurnianing Putri

 

Efektivitas program adiwiyata sebagai upaya penanaman rasa cinta lingkungan di SMP Negeri 3 Malang / Tri Rismawati

 

Kata Kunci : Efektivitas, Program Adiwiyata, Rasa Cinta Lingkungan Adiwiyata mempunyai pengertian atau makna: tempat yang baik dan ideal dimana dapat diperoleh segala ilmu pengetahuan dan berbagai norma serta etika yang dapat menjadi dasar manusia menuju terciptanya kesejahteraan huidup kita dan menuju cita-cita pembangunan berkelanjutan. Adiwiyata dicanangkan untuk mendorong dan membentuk sekolah-sekolah di Indonesia agar dapat turut melaksanakan upaya pemerintah menuju pelestarian lingkungan dan pembangunan berkelanjutan bagi kepentingan generasi sekarang maupun yang akan datang. Penelitian ini bertujuan untuk mengetahui : (1) gambaran kondisi lingkungan SMP Negeri 3 Malang sebelum adanya program Sekolah Peduli dan Berbudaya Lingkungan (SPBL), (2) program Sekolah Peduli dan Berbudaya Lingkungan (SPBL) di SMP Negeri 3 Malang (3) pelaksanaan program Sekolah Peduli dan Berbudaya Lingkungan (SPBL) di SMP Negeri 3 Malang (4) efektifitas program Sekolah Peduli dan Berbudaya Lingkungan (SPBL) di SMP Negeri 3 Malang (5) apa saja kendala dan usaha dalam mengatasi pelaksanaan program Sekolah Peduli dan Berbudaya Lingkungan (SPBL) di SMP Negeri 3 Malang. Penelitian ini merupakan penelitian deskriptif kualitatif. Teknik pengumpulan data yang digunakan adalah wawancara, observasi dan dokumentasi. Teknik analisis data yang digunakan adalah model analisis deskriptif. Penelitian dilakukan di SMP Negeri 3 Malang dengan objek penelitian adalah efektivitas pelaksanaan program adiwiyata (sekolah peduli dan berbudaya lingkungan). Hasil penelitian yang diperoleh dari penelitian ini adalah (1) kondisi lingkungan sekolah sebelum adanya program sekolah peduli dan berbudaya lingkungan dapat dilihat dari keadaan lingkungan yang ada didalam sekolah, baik ruang kelas, kantor, kamar mandi, halaman sekolah maupun lapangan sekolah. Sekolah banyak melakukan penghijauan dan menjaga kebersihan sekolah meskipun Adiwiyata masih belum diresmikan (2) Program sekolah peduli dan berbudaya lingkungan (SPBL) di SMP Negeri 3 Malang dapat dibedakan menjadi 4 (empat) bagian pertama program kebijakan sekolah antara lain visi, misi, dan tujuan sekolah, penghematan SDA (listrik dan air) ATK dan peraturan sekolah yang mengatur kebersihan dan kesehatan, program kurikulum berbasis lingkungan dapat ditemukan dalam silabus dan RPP sedangkan program kegiatan berbasis partisipatif yaitu pemberantasan sarang nyamuk (jumat bersih dan bakiak) dan Sekbid 9 dalam susunan Organisasi Siswa Intra Sekolah (OSIS) yang terakhir adalah pengelolaan sarana prasarana sekolah berupa air bersih, komposter, paving block, septictang, tempat sampah terpisah (organik dan anorganik), biopori, kebun toga dan wastafel (3) pelaksanaan SPBL di SMPN 3 Malang sebagian telah berjalan dengan baik dan membawa dampak yang positif bagi seluruh warga sekolah mengingat keberhasilan dari pelaksanaan program tidak dapat dilepaskan dari adanya dukungan dan partisipasi dari seluruh warga sekolah (4) efektivitas dari sebagian besar program telah berjalan dengan baik, namun ada satu program yang masih belum dapat diefektifkan pemanfaatannya yakni komposter sekolah (5) Faktor sumber daya alam dan sumber daya manusia merupakan kendala yang dihadapi oleh sekolah dalam pelaksanaan program. Kurangnya lahan sekolah, kurangnya tenaga pengurus dan kesadaran warga sekolah akan pentingnya menjaga lingkungan sekolah menjadi hal yang harus dihadapi sekolah. Hal itu telah disiasati sekolah dengan menanam tanaman dan bunga didalam pot serta memanfaatkan lahan yang ada dengan semaksimal mungkin. Kemudian menggunakan bantuan tenaga dari luar sekolah untuk merawat dan menjaga kebersihan lingkungan sekolah dan juga menumbuhkan kesadaran warga sekolah akan pentingnya menjaga lingkungan sekolah. Dari penelitian ini saran-saran yang diajukan yaitu : (1) agar pemanfaatan komposter dapat berjalan secara maksimal seyogyanya Kepala Sekolah lebih memperhatikan pelaksanaan program SPBL khususnya pengelolaan sarana dan prasarana sekolah (2) agar pengelolaan sarana dan prasarana sekolah dapat berjalan secara maksimal seyogyanya tenaga pendidik dan pegawai sekolah tidak menggantungkan seluruh pekerjaan kepada petugas kebersihan saja namun juga ikut berpartisipasi dalam merawat dan menjaga sarana dan prasarana sekolah dan yang terakhir agar kebersihan lingkungan sekolah dapat selalu terjaga seyogyanya seluruh warga sekolah dapat bekerja sama dalam hal menjaga lingkungan sekolah baik kebersihan maupun pengelolaan sarana dan prasarana sekolah.

Hubungan antara penggunaan e-learning dengan hasil belajar siswa kelas XI IPS pada mata pelajaran sejarah semester genap tahun 2012/2013 di SMA Muhammadiyah 1 Ponorogo / Dian Nur Antika Eky Hastuti

 

Hastuti, Dian Nur Antika Eky. 2013. Hubungan antara Penggunaan E–Learning dengan Hasil Belajar Siswa Kelas XI IPS pada Mata Pelajaran Sejarah Semester Genap Tahun 2012/2013 di SMA Muhammadiyah I Ponorogo. Skripsi, Jurusan Sejarah, Program Studi S1 Pendidikan Sejarah, Fakultas Ilmu Sosial, Universitas Negeri Malang. Pembimbing: (I) Drs. Kasimanuddin Ismain., M.Pd, (II) Drs. Mashuri, M.Hum. Kata Kunci: penggunaan E-Learning, hasil belajar Pemanfaatan TIK dalam kegiatan belajar dan mengajar diperlukan untuk mewujudkan efektifitas dan optimalisasi pembelajaran. Salah satu bentuk dari kecanggihan TIK yang digunakan dalam proses pembelajaran adalah E-Learning. SMA Muhammadiyah 1 Ponorogo telah mengembangkan pembelajaran berbasis TIK yang terdapat dalam situs E-Learningnya. Adanya E-Learning ini memungkinkan siswa belajar tanpa batas waktu dan tempat, karena dapat diakses setiap saat. E-Learning SMA Muhammadiyah 1 Ponorogo ini bertujuan untuk meningkat kualitas belajar mengajar. Dengan adanya fasilitas E-Learning ini diharapkan dapat meningkatkan hasil belajar siswa. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan beberapa hal yang mencakup tentang penggunaan E-Learning di SMA Muhammadiyah 1 Ponorogo, hasil belajar sejarah siswa kelas XI IPS di SMA Muhammadiyah 1 Ponorogo, serta hubungan antara penggunaan E-Learning dengan hasil belajar sejarah siswa kelas XI IPS pada di SMA Muhammadiyah 1 Ponorogo. Penelitian ini menggunakan rancangan penelitian deskriptif korelasional, dengan menggunakan pendekatan kuantitatif. Penelitian ini termasuk penelitian deskriptif karena memberikan gambaran tentang penggunaan E-Learning kelas XI IPS di SMA Muhammadiyah 1 Ponorogo. Penelitian ini termasuk penelitian korelasional karena berusaha menerangkan sejauh mana dua variabel atau lebih berkorelasi, dalam hal ini adalah variabel bebas (X) dan variabel terikat (Y). Populasi dalam penelitian ini adalah seluruh siswa kelas XI IPS di SMA Muhammadiyah 1 Ponorogo dengan jumlah 93 siswa. Sedangkan sampelnya yaitu seluruh anggota populasi. Analisis data yang digunakan dalam penelitian ini adalah analisis deskriptif untuk mendeskripsikan masing–masing variabel yang diteliti yaitu antara penggunaan E-Learning sebagai variabel bebas (X) dan hasil belajar sebagai variabel terikat (Y). Rumus yang digunakan yaitu rumus korelasi product moment. Berdasarkan hasil analisis data diperoleh rhitung pada variabel penggunaan E-Learning sebesar 0,813 dengan signifikansi 0,000. Sedangkan hasil belajar siswa, dari 93 orang siswa kelas XI IPS di SMA Muhammadiyah 1 Ponorogo sebanyak 85 siswa memperoleh nilai dalam kategori tuntas sedangkan 6 orang siswa belum tuntas. Hasil belajar sejarah siswa kelas XI IPS di SMA Muhammadiyah 1 Ponorogo termasuk dalam kategori baik. Korelasi atau hubungan antara penggunaan E-Learning dengan hasil belajar sejarah siswa kelas XI IPS di SMA Muhammadiyah 1 Ponorogo termasuk kategori tinggi karena jika dilihat dalam tabel interpretasi nilai r, rhitung sebesar 0,813 berada di antara 0,800 sampai ii dengan 0,1000. Penelitian ini menunjukkan bahwa ada hubungan yang signifikan antara penggunaan E-Learning dengan hasil belajar siswa kelas XI IPS di SMA Muhammadiyah 1 Ponorogo. Berdasarkan hasil penelitian ini, dapat peneliti sarankan bagi sekolah agar melengkapi sarana dan prasarana khususnya pada bidang teknologi informasi dan komunikasi yang sesuai dengan kebutuhan siswa, sehingga dapat menunjang kegiatan pembelajaran dengan lebih baik. Kepada guru mata pelajaran dan siswa hendaknya fasilitas yang telah disediakan oleh sekolah dipergunakan secara maksimal untuk meningkatkan hasil belajar. Sedangkan untuk peneliti selanjutnya hendaknya lebih bisa mencari variabel-variabel lain yang berkaitan dengan judul penelitian ini. Sehingga penelitian yang selanjutnya akan bisa lebih dikembangkan lagi dan bisa menjadi lebih baik lagi.

Pola penguasaan tanah perdikan di Desa Demuk (1893-2011) Kecamatan Pucanglaban Kabupaten Tulungagung / Candra Indayati

 

Kata Kunci: desa perdikan, Tulungagung, RM Djajengkosoemo. Desa perdikan merupakan perkembangan dari istilah sima yang ada pada masa Jawa Kuno (Hindhu-Budha). Perkembangan selanjutnya istilah sima berubah menjadi perdikan. Pada masa Jawa Kuno desa dengan status sima atau perdikan memiliki keistimewaan didalamnya. Pada daerah Tulungagung terdapat beberapa desa dengan status perdikan. Salah satunya bernama Demuk, memiliki keunikan dari desa perdikan lain yang ada di Tulungagung. Keunikan terletak pada pola kepemilikan tanah yang ada di Desa Demuk. Rumusan masalah dari penelitian ini adalah mengapa desa Demuk menjadi desa yang berstatus perdikan pada tahun 1893, bagaimana pola kepemilikan tanahnya selama perdikan dan saat status perdikan tersebut dihapus serta bagaimana perdikan Demuk memberikan sumbangan bagi pendidikan sejarah. Tujuan penelitian ini adalah mengungkap latar belakang Demuk menjadi desa perdikan, mengetahui pola kepemilikan tanahnya serta manfaat sejarah desa dengan materi pembelajaran sejarah lokal yang ada di sekolah. Penelitian ini merupakan penelitian dengan menggunakan metode historis. Hasil penelitian ini berupa (1) Desa Demuk adalah desa yang dibuka oleh RM Djajengkoesoemo pada saat menjalani hukuman yang diberikan pemerintahan Kolonial Belanda. Desa ini mendapat status perdikan karena segi geneologis dari RM Djajengkoesoemo memiliki keturunan dengan Kerajaan Mataram. Eyang Djajengkoesoemo yang bernama Pangeran Notokoesoemo telah membantu mengamankan wilayah mancanegara wetan dari serangan VOC, sehingga wilayah mancanegara wetan tidak dikuasai oleh VOC dan tetap mendapat pengaruh dari Kesultanan Ngayogyakartahadiningrat. (2) Dalam perkembangannya desa Demuk memiliki sistem kepemilikan tanah yang khas, dimana mendapat pengaruh masa Cultuurstelsel. (3) Penelitian ini substansi materinya dapat digunakan untuk pengembangan sejarah lokal yang ada di wilayah Tulungagung, selain itu dapat digunakan sebagai alternatif pembelajaran sejarah yang memiliki hubungan materi yang sama dengan tema yang diambil, dimana para pelajar dapat melihat langsung Desa Demuk sebagai khasanah situs peninggalan masa dahulu yang masih tetap ada pada masa sekarang ini. Subtansi materi yang ada didalamnya bisa dimanfaatkan bagi pelajar baik dari SMP, SMA maupun Perguruan Tinggi untuk menambah wawasan mengenai sejarah-sejarah yang belum terungkapkan secara meluas.

Pesan moral dalam novel Sebelas Patriot karya Andrea Hirata / Rodiyatul Ula

 

Kata kunci: moral, novel Sebelas Patriot. Karya fiksi adalah cerita yang tidak benar-benar terjadi. Fiksi menceritakan masalah-masalah yang berkaitan dengan kehidupan manusia. Moral adalah baik buruknya perilaku seseorang dalam kehidupan sehari-hari. Peneliti memilih Novel Sebelas Patriot karya Andrea Hirata karena novel ini berkisah tentang cinta seorang anak kepada Ayahnya, bangsa, dan perjuangannya mencapai cita-cita. Peneliti bertujuan mendeskripsikan pesan moral manusia terhadap Allah, moral manusia terhadap dirinya sendiri, moral manusia dalam keluarga, dan moral manusia dalam masyarakat yang terdapat dalam novel tersebut. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Sumber data penelitian ini adalah novel Sebelas Patriot karya Andrea Hirata cetakan pertama yang diterbitkan oleh PT. Bentang Pustaka pada Juni 2011. Pengumpulan data yang dilakukan peneliti adalah dengan membaca novel, mengambil teks-teks yang menunjukkan konsep penelitian ini, memasukkan teks-teks ke dalam bagian-bagian analisis, identifikasi data, pengkodean, dan pengelompokan data. Teknik analisis data yang digunakan dalam penelitian ini adalah interpretasi dan penarikan kesimpulan. Untuk menjaga keabsahan data diperlukan dua teknik yakni peneliti membaca novel yang diteliti secara berulang-ulang dan mendiskusikan hasil temuan dengan dosen pembimbing. Hasil penelitian ini menunjukkan terdapat empat pesan moral manusia terhadap Allah, dua pesan moral manusia terhadap dirinya sendiri, lima pesan moral manusia dalam keluarga, dan tiga pesan moral manusia dalam masyarakat. Peneliti menyarankan kepada peneliti lain agar dapat mengembangkan penelitian ini dengan teori dan sudut pandang berbeda sehingga penelitian yang ada bisa lebih beragam. Sedangkan untuk pembaca, peneliti menyarankan agar dapat menyaring isi yang ada dalam karya sastra. Ada perbuatan yang patut dicontoh dan ada yang tidak patut dicontoh. Pembaca harus dapat menangkap pesan moral yang ingin disampaikan penulis melalui karyanya agar dalam membaca tidak hanya sekedar menikmati karya sastra tersebut tapi juga dapat mengambil pesan yang ingin disampaikan. Terutama bagi guru dapat juga menyampaikan pesan moral tersebut kepada anak didiknya.

Pengembangan media pembelajaran interaktif pada aplikasi kamus elektronik istilah mapel fisika di SMK / Andi Haris Rachmadini

 

Kata Kunci: SMK, Media pembelajaran, Kamus Elektronik, Fisika. Sekolah Menengah Kejuruan (SMK), adalah jenjang pendidikan menengah pada pendidikan formal di Indonesia setelah lulus Sekolah Menengah Pertama (atau sederajat) yang dipersiapkan untuk dunia kerja. Sekolah Menengah Kejuruan ditempuh dalam waktu 3 tahun, mulai dari kelas 10 sampai kelas 12. Pada kelas 10 terdapat mata pelajaran dasar yang harus dikuasai oleh para siswa SMK. Dunia pendidikan senantiasa bergerak maju secara dinamis salah satunya untuk menciptakan bahan ajar khususnya bahan ajar Fisika yang semakin menarik, interaktif, dan komprehensif. Fisika adalah salah satu mata pelajaran yang termasuk dalam ruang lingkup IPA. Ilmu Fisika sangat erat hubungannya dengan kehidupan, sehingga siswa perlu mempelajari ilmu fisika dengan baik. Namun di mata pelajaran Fisika banyak sekali terdapat kata-kata sukar. Referensi seperti RPAL, Wikipedia, dan Buku Sekolah Elektronik (BSE) terdapat kendala yang bermacam-macam, sehingga siswa kurang fokus dalam memahami kata-kata sukar. Maka perlu dikembangkan suatu Kamus elektronik istilah pada Mapel Fisika yang dapat mempermudah siswa dalam mencari kata-kata sukar. Penelitian ini menggunakan rancangan penelitian pengembangan. Model penelitian pengembangan ini berdasarkan model pengembangan yang dinyatakan oleh Pustekkom Depdiknas dengan sedikit modifikasi. Validasi produk dilakukan oleh ahli media dan ahli materi untuk menilai produk yang dirancang. Setiap validator diminta untuk menilai produk agar diketahui kekurangan dan keunggulan produk. Setelah itu akan diujicobakan kepada 45 siswa dari tiga SMK di Kota Malang. Penelitian dan pengembangan ini menghasilkan produk pengembangan media pembelajaran yang dapat dijalankan menggunakan web browser berupa Kamus Elektronik Fisika untuk SMK. Guru Fisika dapat menggunakannya sebagai alat bantu dalam pembelajaran di kelas. Selain itu, siswa juga dapat memanfaatkannya untuk belajar di kelas ataupun belajar secara mandiri di rumah. Produk ini juga berhasil memvisualisasikan kamus istilah mata pelajaran Fisika dengan baik. Dapat dibuktikan dengan persentase kevalidan rata-rata dari ahli media, ahli materi 1, ahli materi 2, dan ahli materi 3 sebesar 88,02%. Serta telah diujicobakan kepada 45 siswa dari 3 SMK dengan respon siswa yang tertarik menggunakannya untuk belajar secara mandiri ataupun di dalam proses pembelajaran.

Using K-W-L strategy to improve the reading comprehension of the seventh graders of SMP Negeri 8 Malang / Pusfika Rayuningtya

 

Kata Kunci: membaca, kosa kata, teks deskriptif, strategi K-W-L, dasar pengetahuan Penelitian ini bertujuan untuk meningkatkan kemampuan siswa dalam memahami bacaan seiring dengan kemampuan siswa dalam penguasaan kosakata. Penelitian ini termasuk dalam Penelitian Tindakan Kelas yang dilakukan dalam dua siklus. Satu siklus terdiri dari empat langkah: perencanaan, pelaksanaan, observasi dan refleksi. Subyek penelitian ini adalah 44 siswa-siswi kelas VII-B siswa SMP Negeri 8 Malang. Berdasarkan penelitian yang dilakukan pada preliminary fase, hasil menunjukkan bahwa siswa mengalami kesulitan dalam membaca karena kurangnya penguasaan kosa kata. Oleh karena itu, peneliti ingin meningkatkan kemampuan membaca bersamaan dengan penguasaan kosa kata dengan mengimplementasi strategi K-W-L. Instrumen yang digunakan untuk penelitian ini adalah pedoman wawancara, observation checklist, kuisioner, field notes, tes membaca dan kosa kata, lembar kerja KWL, pekerjaan siswa dalam latihan dan tabel keaktifan siswa. Data dianalisis dan direfleksikan untuk melihat apakah penelitian mencapai kriteria keberhasilan. Kriteria keberhasilan adalah 70% siswa melewati standar nilai minimal yaitu 75 dan minimal 60% siswa aktif selama proses belajar mengajar di kelas. Peneliti bersama dengan guru bahasa Inggris menentukan kriteria keberhasilan. Hasil penelitian ini menunjukkan bahwa strategi K-W-L meningkatkan pemahaman siswa dalam membaca dan penguasaan kosa kata. Dari siklus II, 87% siswa mencapai standar nilai minimal dan 100% siswa aktif selama proses belajar mengajar mengajar. Dalam pelaksanaan strategi, peneliti membagikan lembar latihan K-W-L yang dibagi dalam tiga kolom yaitu kolom K,W dan L kepada setiap siswa. Sebelum memulai pelajaran, peneliti memberitahukan topik untuk teks yang akan dibahas pada suatu pertemuan. Kemudia, peneliti melaksanakan strategi yang tebagi dalam tiga langkah. Pertama, siswa ditugaskan untuk brainstorm setiap informasi dan kosakata yang telah mereka ketahui tentang suatu topik dengan cara mendaftar informasi tersebut dalam kolom K pada lembar kerja. Kedua, siswa diminta untuk memikirkan informasi yang ingin mereka ketahui dengan menciptakan pertanyaan untuk ditulis dalam kolom W pada lembar kerja. Terakhir, siswa ditugaskan untuk menuliskan informasi dan kosakata yang mereka dapat setelah membaca teks dengan menjawab pertanyaan yang mereka buat sebelumnya dan menuliskan kosakata yang baru mereka pelajari dalam teks. Karena strategi K-W-L juga digunakan untuk mengajar kosa kata, kamus digunakan selama proses belajar mengajar untuk mencari arti kata-kata sulit yang terdapat dalam teks. Dalam menerapkan strategi ini, siswa ditugaskan untuk bekerja secara individual atau berkelompok. Berdasarkan hasil penelitian ini, disarankan kepada para guru Bahasa Inggris agar menerapkan strategi K-W-L sebagai salah satu teknik mengajar terutama untuk mengajar skill membaca untuk meningkatkan kemampuan siswa dalam memahami bacaan dan penguasaan kosa kata.

Pengembangan aplikasi game interaktif sebagai media pembelajaran bahasa Inggris siswa sekolah menengah pertama kelas VII / Teguh Satriya Wibawa

 

Kata Kunci: game, interaktif, media pembelajaran, bahasa Inggris Bahasa Inggris adalah salah satu mata pelajaran yang diajarkan pada Sekolah Menengah Pertama. Tetapi kenyataanya banyak siswa yang merasa enggan untuk mempelajari dan menggunakan bahasa Inggris. Melihat kenyataan tersebut, peneliti mengembangkan sebuah media pembelajaran berbasis game interaktif. Pemilihan game sebagai media pembelajaran bahasa Inggris dinilai tepat karena game mampu memberikan penggunanya skenario yang dapat dikembangkan menjadi pengalaman di kehidupan nyata. Pengembangan ini dilaksanakan dengan tujuan untuk menghasilkan perangkat lunak (software) dalam bentuk media pembelajaran berbasis game interaktif yang telah diuji tingkat kelayakannya dan dapat dimanfaatkan untuk belajar siswa. Media pembelajaran berbasis game interaktif ini dikembangkan menggunakan Model Pengembangan menurut Sugiyono. Uji coba dilakukan dengan menggunakan evaluasi formatif berdasarkan Sadiman, dkk, dimana terdapat 3 tahap, yaitu uji perorangan (validasi materi, validasi media, 5 orang siswa), uji coba kelompok kecil, dan uji coba lapangan. Media pembelajaran yang dikembangkan berupa game interaktif. Pengguna tidak hanya membaca teks, mendengar suara, dan melihat animasi, tetapi juga dapat berinteraksi dengan media. Dengan penggunaan game interaktif sebagai media belajar, diharapkan dapat memvisualisasikan materi-materi pada kompetensi dasar memahami makna dalam percakapan transaksional dan interpersonal sangat sederhana untuk berinteraksi dengan lingkungan terdekat. Media pembelajaran interaktif ini didesain berupa file executable (.exe). Jadi sistem operasi berbasis Windows dapat menjalankan media pembelajaran interaktif secara langsung. Berdasarkan hasil analisis data yang dilakukan, didapat persentase hasil validasi oleh ahli media sebesar 97%, hasil validasi oleh ahli materi sebesar 93%, hasil uji coba perorangan ke siswa sebesar 89,1%, hasil uji coba kelompok kecil sebesar 88,3% dan hasil uji coba lapangan sebesar 90,9%. Dari hasil analisis data, dapat disimpulkan bahwa bahan ajar interaktif secara keseluruhan dinyatakan layak/valid dengan pencapaian rata-rata sebesar 91,6%. Bahan ajar berbasis game interaktif dapat digunakan sebagai suplemen pembelajaran dan media belajar mandiri siswa.

Hubungan antara keterampilan metakognitif terhadap hasil belajar biologi dan retensi siswa kelas X dengan strategi reciprocal teaching di SMA Negeri 1 Lawang / Mukhammad Syamsul Arifin

 

Kata Kunci: Reciprocal Teaching, keterampilan metakognitif, hasil belajar biologi, retensi. Keterampilan metakognitif memiliki peranan penting dalam membangun kemandirian siswa dalam belajar. Siswa yang memiliki keterampilan metakognitif yang baik maka hasil belajar Biologi yang dicapai baik pula. Selain keterampilan metakognitif dan hasil belajar, retensi siswa juga penting dalam mengukur keberhasilan belajar siswa. Hasil belajar siswa SMA Negeri 1 Lawang masih rendah, siswa juga kurang aktif dalam proses pembelajaran, serta kemandirian untuk belajar siswa masih rendah, serta siswa juga cenderung melupakan pengetahuan yang sudah dipelajari setelah beberapa selang waktu tertentu. Strategi reciprocal teaching berpotensi dalam memberdayakan keterampilan metakognitif siswa sehingga hasil belajar dan retensi siswa meningkat. Selain itu strategi reciprocal teaching juga berpotensi untuk meningkatkan kemampuan siswa untuk lebih baik dalam membaca dan membantu siswa dalam mencapai tujuan penting dari strategi reciprocal teaching yaitu menjadi siswa yang mandiri. Penelitian ini bertujuan untuk mengetahui adanya hubungan antara keterampilan metakognitif terhadap hasil belajar dan retensi siswa kelas X. Penelitian ini merupakan penelitian kuantitatif dengan menggunakan metode korelasional. Populasi dalam penelitian ini adalah seluruh kelas X SMA Negeri 1 Lawang semester ganjil tahun pelajaran 2012/2013. Sampel penelitian adalah kelas X-9. Instrumen penelitian yaitu soal tes uraian 17 soal untuk mengakses keterampilan metakognitif dan hasil belajar yang diberikan pada saat pre test dan post test, serta retensi siswa yang diberikan dua minggu setelah pelaksanaan post test. Data hasil penelitian kemudian dianalisis menggunakan analisis regresi. Pengujian terhadap konsistensi pelaksanaan strategi pembelajaran juga menggunakan analisis regresi. Pengujian hipotesis dilakukan pada taraf signifikansi 0,5%. Analisis data dilakukan dengan bantuan program SPSS 16 for Windows. Hasil penelitian menunjukkan ada hubungan antara keterampilan metakognitif dan hasil belajar biologi pada penerapan strategi reciprocal teaching dengan nilai keterandalan 31,9 %, yang berarti sumbangan keterampilan metakognitif terhadap hasil belajar adalah 31,9 %, sedangkan 68,1 % merupakan faktor-faktor lain selain keterampilan metakognitif. Penelitian ini juga menunjukkan hubungan yang tidak nyata antara retensi keterampilan metakognitif dan retensi hasil belajar biologi pada penerapan strategi reciprocal teaching. Terkait hasil penelitian ini, maka peneliti memberikan saran pada guru agar menggunakan strategi pembelajaran reciprocal teaching sebagai alternative strategi pembelajaran untuk memberdayakan keterampilan metakognitif siswa, guru harus selalu memonitor dan membimbing siswa saat menggunakan strategi reciprocal teaching. Selain itu, siswa sebaiknya memberikan perhatian khusus pada informasi yang penting. Adanya perhatian ini dapat memudahkan siswa dalam mengelola informasi dengan baik sehingga informasi tersimpan dengan baik pula.  

Kajian desain tas rajut karya Kaboki House of Crochet Pandaan Pasuruan / Anna Eka Rahayu

 

Rahayu, Anna Eka. 2013. Kajian Desain Tas Rajut Kaboki House of Crochet Pandaan Pasuruan. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing: (I) Dra. Lilik Indrawati, M.Pd, (II) Drs. AAG Rai Arimbawa, M.Sn. Kata Kunci: desain, tas rajut, motif, teknik rajut Rajut merupakan kerajinan yang membentuk suatu benda yang terbuat dari ikalan-ikalan benang dan dikerjakan manual dengan tangan. Semakin berkembangnya industri kerajinan di Indonesia, banyak desain-desain produk yang terbuat dari rajutan dengan beraneka ragam jenis benang yang digunakan. Salah satu rumah produksi yang berkecimpung dalam industri rajutan adalah Kaboki House of Crochet. Desain-desain tas rajut yang up to date menjadi fokus dalam industri rajut “Kaboki”. Berkaitan dengan hal tersebut, maka penelitian ini bertujuan untuk mendeskripsikan tentang variasi desain tas rajut dan teknik pada varian motif tas rajut karya Kaboki House of Crochet Pandaan Pasuruan produksi tahun 2012. Penelitian ini merupakan penelitian kualitatif deskriptif yang studi kasusnya mengarah pada pendeskripsian secara rinci dan mendalam mengenai variasi desain tas rajut serta teknik pada varian motif tas rajut “Kaboki”. Lokasi penelitian, yaitu di Kaboki House of Crochet yang terletak di Jalan Raya Sukorejo-Bangil KM 1.5 Lecari Sukorejo Pandaan Pasuruan. Analisis data mengacu pada model analisis interaktif yang terdiri dari tiga komponen pokok yaitu reduksi data, sajian data, dan penarikan simpulan dengan verifikasinya. Pengecekan keabsahan temuan menggunakan teknik trianggulasi metode yang terdiri dari dokumentasi, wawancara, dan observasi. Berdasarkan hasil penelitian menggunakan teknik pengumpulan data berupa observasi, wawancara serta dokumentasi, diperoleh data berupa variasi desain tas rajut “Kaboki” yang dikelompokkan dalam tiga golongan yaitu maxi, midi dan mini. Pengelompokan variasi desain tersebut berdasarkan ukuran tas. Desain maxi merupakan tas rajut dengan ukuran rata-rata lebih dari 40×30 cm, golongan midi tidak lebih dari 40 cm, dan golongan mini berukuran rata-rata 20 cm. Teknik pada varian motif tas rajut “Kaboki” sangat bervariasi. Dari ke-12 desain tas rajut yang diobservasi, terdapat 6 variasi motif yang dimanfaatkan namun secara keseluruhan teknik yang digunakan sama, hanya terdapat modifikasi pada teknik atau jenis tusukan rajut sehingga memunculkan motif yang bervariasi. Jenis tusukan rajut atau teknik yang digunakan secara umum yaitu tusuk tunggal atau tusuk mati (sc), setengah tusuk ganda (hdc), dan tusuk ganda atau tusuk tiang (dc). Dari seluruh variasi desain dengan motifnya masing-masing, desain tas rajut dengan motif yang rapat menjadi desain yang paling diminati oleh konsumen “Kaboki”. Motif rapat tersebut terbentuk oleh teknik rajut tusuk tunggal atau tusuk mati (sc) yang membentuk tekstur rajutan rapat, sehingga tas rajut tidak mudah melar, seperti pada desain tas rajut “Maribaya”, “Krakatau”, dan “Adora Mini”.

Pengaruh pemahaman, manfaat langsung, dan kualitas pelayanan fiskus terhadap motivasi pelaporan pajak pada usaha mikro kecil (studi kasus pada coffeeshop di Kediri) / Dini Norma Husnia

 

Kata kunci:Pemahaman, Manfaat Langsung, Kualitas Pelayanan, Motivasi, Mikro Kecil. PajakmerupakanpenerimaanterbesarsuatuNegara,pajakdigunakan untuk seluruhpembiayaanpembangunannegara.Indonesia menganut self assesment systemyang memberikepercayaanterhadapwajibpajakuntukmenghitung, menyetordanmelaporkansendiripajaknya. Kesadaran pelaporan pajak dipengaruhi oleh motivasi wajib pajak itu sendiri. Dalammewujudkanmasyarakattaatpajak, pemerintahharusmemberikanjaminanadanyaaksestimbalbalik yang langsungdapatdirasakanmasyarakatdalamkeikutsertaanyamembayarpajak. Pajak juga memilikifungsimengatursertamenciptakaniklim yang sehatbagiperkembanganduniausaha. Dari tahun ke tahun, usaha mikro, kecil, dan menengah(UMKM)semakinmenunjukkanperkembangan yang bagus, namun masih banyak dari mereka yang tidak termotivasi untuk membayar pajak.. Adapun faktor yang mempengaruhi motivasi pelaporan pajak diantaranya adalah pemahaman tentang kewajiban pelaporan pajak, manfaat langsung pemilik UMKM yang melakukan kewajiban pajak, dan kualitas pelayanan fiskus terkait pelaporan pajak yang dilakukan wajib pajak. Olehkarenaitumakapermasalahan yang dikajidalampenelitianiniadalah: (1)Apakahpemahaman, manfaat langsung, dan kualitas pelayanan fiskus secarasimultanmempunyaipengaruhterhadapmotivasi pelaporan pajak. (2)Apakahpemahaman, manfaat langsung, dan kualitas pelayanan fiskussecaraparsialmempunyaipengaruhterhadapmotivasi pelaporan pajak. Adapunsampeldalampenelitianiniadalahpemilik usaha Coffeeshop di Kediridengansampelpenelitian yang diambilmenggunakanteknikConvenience Sampling diperoleh 41pemilik usaha. Variabelindependendalampenelitianiniadalahpemahaman, manfaat langsung, dan kualitas pelayanan fiskussedangkanvariabeldependennyaadalahmotivasi pelaporan pajak.Untukmetodepengumpulan data dilakukandenganmetodekuesioner.Data yang terkumpuldianalisisdenganteknikanalisisdiskriptifdananalisisstatistik. Hasilpenelitianmenunjukkanbahwasecarasimultan pemahamanwajibpajak, manfaatlangsungpajak, dankualitaspelayananfiskusmempunyaipengaruh yang signifikanterhadapmotivasiwajibpajak.koefisiendeterminasimenunjukkanbahwasecarabersama-samapemahamanwajibpajak, manfaatlangsungpajak, dankualitaspelayananfiskusmemberikansumbanganterhadapvariabelterikat (Motivasi Wajib Pajak) sebesar59% sedangkansisanya41% dipengaruhiolehfaktor lain diluar model.

Klinik Lavalette 1918-1942: perkembangan dan kontribusi terhadap pelayanan kesehatan di Malang / Indun Retnowati

 

Retnowati, Indun. 2013. Klinik Lavalette 1918-1942: Perkembangan dan Kontribusi Terhadap Pelayanan Kesehatan di Malang. Skripsi, Jurusan Sejarah, Fakultas Ilmu Sosial. Pembimbing (I) Dr. R. Reza Hudiyanto, S.S, M.Hum, (II) Najib Jauhari S.Pd, M.Hum. Kata Kunci: Klinik Lavalette, Perkembangan, Pelayanan Kesehatan     Perkembangan Kota Malang berawal pada abad 19 yang ditandai dengan perubahan hutan dan tanah-tanah woeste menjadi tanah perkebunan. Sumber daya alam berupa kesuburan tanah dan keberadaan sumber air di wilayah Afdeeling Malang menjadikan kota ini sebagai budidaya tanaman perkebunan. Daya dukung lingkungan dan intervensi kekuatan eksternal yaitu pengusaha perkebunan telah menjadi faktor yang menentukan pertumbuhan Malang. Salah satu dampak positifnya adalah para pengusaha perkebunan tersebut mendirikan pelayanan kesehatan untuk para pekerjanya yang dinamakan Klinik Lavalette. Perkembangan kebijakan subsidi kesehatan di Malang, mempengaruhi kualitas pelayanan kesehatan di Klinik Lavalette. Penelitian ini bertujuan untuk mendeskripsikan perkembangan Klinik Lavalette dan kontribusinya terhadap pelayanan kesehatan di Malang.     Metode yang digunakan dalam penelitian ini adalah penelitian sejarah memakai sumber-sumber sejarah untuk menyusun fakta, mendeskripsikan, dan menarik kesimpulan tentang masa lampau. Adapun kegiatan yang dilakukan dalam metode sejarah yaitu pemilihan topik, heuristik, kritik, intepretasi dan historiografi.     Hasil yang diperoleh adalah sebagai berikut: Klinik Lavalette didirikan pada tanggal 9 Desember 1918 atas prakarsa para pengusaha Perkebunan Besar yang tergabung dalam sebuah Yayasan bernama "Stichting Malangsche Ziekenverpleging". Diberi nama "Klinik Lavalette". Nama tersebut diambil dari nama Ketua Yayasan yaitu G. Chr. Renardel de Lavalette, yang mempunyai saham besar dalam pendirian klinik tersebut. Perkembangan Klinik Lavalette dibagi menjadi dua periode, pertama antara tahun 1918-1928 pada periode ini Klinik Lavalette belum mengalami perkembangan pesat. Kedua, antara tahun 1929-1942 pada periode kedua ini Klinik Lavalette perkembangannya baru terlihat, dengan adanya penambahan sarana dan prasarana. Kontribusi yang diberikan dari Klinik Lavalette yaitu pelayanan kesehatan tetapi juga memberikan pelayanan pendidikan dan pelayanan asuhan keperawatan, fungsinya adalah penyusunan rencana kebutuhan tenaga keperawatan, melaksanakan pelayanan rujukan, bagi klinik lain yang yaitu Klinik Sumber Arum, Klinik Glusing dan Klinik Sumber Telogo. Saran bagi peneliti berikutnya, Kota Malang merupakan kota yang memiliki sejarah panjang dalam pembentukannya, kajian sejarah kesehatan sangat menarik untuk dikaji, terutama tema-tema tentang rumah sakit-rumah sakit yang ada di Malang, khususnya mengambil tema tentang kesehatan di Kota Malang pada masa pendudukan Jepang. Pada masa itu sangat menarik untuk dikaji, karena pada masa pemerintahan Jepang fasilitas kesehatan dimanfaatkan untuk keperluan perang Asia Timur Raya. Hal itu sangat merugikan masyarakat pribumi.Bagi pemerintah kota, diharapkan penelitian ini mampu memberikan wawasan akan pentingnya peristiwa-peristiwa lalu yang terjadi di Kota Malang. Rumah Sakit Lavalette memiliki nilai-nilai kesejarahan yang tinggi, sehingga sebaiknya pemerintah kota menjadikan Rumah Sakit Lavalette sebagai heritage kota.

Makna simbolik tentang motif batik tulis Liong karya Ir. Nurul Huda di Sidoarjo / Ainun Rizka Pratiwi

 

Kata Kunci: makna simbolik, motif, motif Batik Liong Batik adalah salah satu kebudayaan Indonesia yang sudah disahkan oleh UNESCO sebagai warisan kemanusiaan untuk Budaya Lisan dan Nonbendawi. Ada beberapa pandangan yang mengelompokkan batik menjadi dua kelompok seni batik, yakni batik keraton dan seni batik pesisir. Motif seni batik keraton banyak yang mempunyai arti filosofi, sarat dengan makna kehidupan, gambarnya rumit/halus dan mempunyai beberapa warna. Motif seni batik pesisir lebih bebas serta kaya motif dan warna, lebih bebas dan tidak terikat dengan aturan keraton dan sedikit memiliki arti filosofi. Motif batik pesisir banyak yang berupa flora, fauna dan ciri khas lingkungannya. Warnanya semarak agar lebih menarik konsumen. Berbeda dengan motif Batik Tulis Liong karya Ir. Nurul Huda yang merupakan sebuah bentuk karya batik kreasi yang berhasil menstilasi bentuk-bentuk ornamen menjadi sedemikian rupa dengan kekhasannya sendiri. Stilasi pada ornamen utama yaitu naga atau Liong menjadi sorotan atau ikon yang memiliki makna-makna simbolik mulai dari bentuk, gaya serta warna. Pada ornamen pendukung juga terdapat makna simbolik namun hanya beberapa saja. Penelitian dengan rancangan deskriptif kualitatif ini dilaksanakan dengan tujuan untuk mendiskripsikan beberapa hal yang mencakup motif, warna, proses pembatikan dan makna simbolik tentang motif Batik Tulis Liong karya Ir. Nurul Huda di Sidoarjo yang terangkum dalam ruang lingkup penelitian. Pengumpulan data dilakukan dengan menggunakan teknik wawancara, observasi dan dokumentasi. Analisis data dimulai dari reduksi data, sajian data dan penarikan kesimpulan. Berdasarkan hasil analisis tersebut, dipaparkan bahwa terciptanya motif Batik Liong karya Ir. Nurul Huda ini dilatarbelakangi untuk menyambut masuknya tahun baru 2012 atau menjelang tahun baru Imlek 2563 yang memasuki tahun naga. Terkait dengan visualisasi motif batik Liong karya Ir. Nurul Huda, pada batik ini ditemukan motif flora, fauna, serta alam. Bahan pada proses penciptaan motif Batik Liong adalah menggunakan bahan utama kain centiyu, malam batik, pewarna Napthol dan Indigosol. Teknik yang digunakan adalah teknik tulis, dan warnanya cenderung pada warna merah dan kuning. Dari hasil penelitian, disarankan kepada pengrajin Rumah Batik Al-Huda supaya mendokumentasikan tiap desain dan hasil produk batik agar dapat bermanfaat bagi pelajar atau peneliti sebagai sumber referensi pencarian data mengenai makna simbolik motif Batik Liong.

Penerapan pembelajaran kooperatif model Two Stay Two Stray (TSTS) untuk meningkatkan motivasi dan hasil belajar siswa pada standar kompetensi melakukan prosedur administrasi (studi pada siswa kelas X Administrasi Perkantoran SMK PGRI 2 Malang) / Jimat Efendy

 

Kata Kunci: Pembelajaran Kooperatif, Model Pembelajaran Two Stay Two Stray (TSTS), Motivasi Belajar, Hasil Belajar Pembelajaran kooperatif mempunyai pengaruh yang positif terhadap siswa yang hasil belajarnya rendah. Dalam proses pembelajaran diperlukan model pembelajaran kooperatif yang dapat membantu siswa meningkatkan hasil belajarnya, agar siswa dapat mencapai nilai di atas SKM yang telah ditetapkan. Bukan hanya hasil belajar saja yang perlu ditingkatkan, motivasi belajar siswa juga perlu ditingkatkan lagi. Keaktifan siswa dalam mengikuti kegiatan pembelajaran masih sering didominasi oleh beberapa orang siswa saja, sehingga keaktifan siswa masih belum menyeluruh. Agar siswa lebih termotivasi dan dapat bekerjasama dengan siswa yang lain maka guru perlu mengambil tindakan untuk mengatasi beberapa permasalahan siswa dalam belajar. Dalam mengatasi permasalahan tersebut salah satu tindakan yang dapat diambil guru yaitu dengan menerapkan pembelajaran kooperatif model Two Stay Two Stray (TSTS). Penelitian ini bertujuan untuk meningkatkan motivasi belajar dan hasil belajar siswa pada Standar Kompetensi Melakukan Prosedur Administrasi dengan Kompetesi Dasar Melakukan Surat Menyurat dengan menerapkan model pembelajaran Two Stay Two Stray (TSTS). Upaya peneliti dalam mencapai tujuan tersebut, maka penelitian ini dirancang dengan model penelitian tindakan kelas yang dilaksanakan pada Bulan Maret 2013. Subjek penelitian ini adalah siswa kelas X APK SMK PGRI 2 Malang yang berjumlah 44 siswa. Penelitian ini terdiri dari dua siklus, dimana masing-masing siklus terdiri dari 2 pertemuan. Teknik pengumpulan data yang digunakan dalam penelitian ini melalui lembar observasi, wawancara, tes, angket, catatan lapangan, dan dokumentasi. Hasil penelitian ini menunjukkan bahwa siswa kelas X APK SMK PGRI 2 Malang mengalami peningkatan motivasi belajar dan hasil belajar siswa aspek kognitif, afektif, dan psikomotor, setelah penerapan pembelajaran model Two Stay Two Stray (TSTS). Berdasarkan hasil angket motivasi belajar siswa dapat diketahui bahwa motivasi belajar siswa pada siklus I mencapai rata-rata 80,84% (Baik) dan motivasi belajar siswa pada siklus II mencapai rata-rata 87,50% (Sangat Baik). Sehingga dapat disimpulkan bahwa rata-rata motivasi belajar siswa setelah penerapan model pembelajaran Two Stay Two Stray (TSTS) mengalami peningkatan sebanyak 6,66%. Berdasarkan data yang diperoleh diketahui bahwa hasil belajar aspek kognitif nilai rata-rata pre test siklus I adalah 64,51 dan nilai rata-rata post test siklus I adalah 75,73. Sedangkan pada siklus II nilai rata-rata pre test siklus II adalah 65,73 dan rata-rata post test siklus II adalah 86,46. Sehingga dapat disimpulkan bahwa hasil belajar aspek kognitif pada siklus II rata-rata hasil post test mengalami peningkatan sebesar 10,73% dari hasil post test siklus I. Hasil belajar siswa aspek afektif pada siklus I mencapai nilai rata-rata kelas sebesar 75 dengan kriteria baik, sedangkan pada siklus II mencapai nilai rata-rata sebesar 89,05 dengan kriteria sangat baik. Sehingga dapat disimpulkan bahwa hasil belajar siswa aspek afektif pada siklus II mengalami peningkatan sebesar 14,05%. Hasil belajar siswa aspek psikomotor pada siklus I mencapai nilai rata-rata kelas sebesar 75 sedangkan pada siklus II mencapai nilai rata-rata sebesar 89,39. Sehingga dapat disimpulkan bahwa hasil belajar siswa aspek psikomotor pada siklus II mengalami peningkatan sebesar 14,39%. Berdasarkan hasil analisis data tersebut diperoleh kesimpulan bahwa penerapan model pembelajaran Two Stay Two Stray (TSTS) pada Standar Kompetensi Melakukan Prosedur Administrasi di kelas X APK telah terlaksana dengan baik dan sudah sesuai dengan perencanaan terbukti dengan meningkatnya motivasi belajar dan hasil belajar siswa. Berdasarkan hasil penelitian ini, saran yang diberikan peneliti yaitu: (1) Guru Standar Kompetensi Melakukan Prosedur Administrasi berusaha menciptakan suasana kelas yang menyenangkan dan tidak membosankan agar siswa merasa termotivasi untuk memperhatikan dan mendengarkan penjelasan materi dari guru, (2) Siswa seharusnya lebih berani mengemukakan pendapat, pertanyaan, menghargai teman, dan membekali diri terlebih dahulu dengan belajar di rumah sebelum mengikuti pembelajaran di sekolah, (3) peneliti lain yang ingin melakukan penelitian yang sama dengan standar kompetensi yang berbeda sebaiknya dapat memodifikasi model pembelajaran ini dengan model pembelajaran yang lain agar pembelajaran yang dilakukan dapat meningkatkan motivasi belajar dan hasil belajar siswa.

Analisis kesalahan ejaan karangan narasi siswa kelas IV SDN Gugus 5 Kecamatan Sumberpucung Kabupaten Malang / Aulia Yuni Afita

 

Kata Kunci: kesalahan ejaan, karangan narasi, siswa kelas IV SD. Kesalahan siswa dalam belajar bahasa merupakan suatu yang wajar terjadi, namun apabila kesalahan tersebut dibiarkan akan menjadi kebiasaan yang kurang baik dan cenderung akan berulang kembali. Kesalahan dalam berbahasa siswa khususnya bahasa tulis harus dihilangkan. Hal ini dapat dilakukan apabila guru mengetahui kesalahan-kesalahan yang dilakukan oleh siswa. Penelitian ini bertujuan untuk mendeskripsikan pengetahuan siswa dalam penggunaan ejaan pada karangan narasi siswa kelas IV SDN Gugus 5 Kecamatan Sumberpucung Kabupaten Malang. Metode yang digunakan dalam penelitian ini adalah pendekatan kuantitatif yang bersifat deskriptif (kuantitatif deskriptif). Sumber data dalam penelitian ini adalah siswa kelas IV SDN Gugus 5 Kecamatan Sumberpucung Kabupaten Malang yang terdapat 7 SDN yaitu SDN Ngebruk 01, SDN Ngebruk 03, SDN Ngebruk 03, SDN Ternyang 01, SDN Ternyang 02, SDN Ternyang 03, dan SDN Ternyang 04. Jumlah Populasi sebesar 170 dengan jumlah sampel penelitian sebanyak 43. Pengumpulan data dilakukan dengan teknik tes kepada siswa. Analisis data dilakukan dengan teknik persentase. Berdasarkan hasil analisis data dari siswa kelas IV SDN Gugus 5 Kecamatan Sumberpucung Kabupaten Malang diperoleh hasil bahwa (1) kesalahan penggunaan huruf kapital di awal kalimat mencapai 174 kesalahan dari 466 jumlah keseluruhan penggunaan huruf kapital di awal kalimat atau 37,33% termasuk dalam kategori banyak, (2) kesalahan penggunaan kata depan di/ke mencapai 52 kesalahan dari 147 jumlah keseluruhan penggunaan kata depan di/ke atau 35,37% termasuk dalam kategori agak banyak, dan (3) kesalahan penggunaan tanda titik di akhir kalimat mencapai 169 kesalahan dari jumlah keseluruhan penggunaan tanda titik di akhir kalimat atau 36,26% termasuk dalam kategori agak banyak. Dari deskripsi analisis data tersebut, dapat disimpulkan bahwa siswa kelas IV SDN Gugus 5 Kecamatan Sumberpucung Kabupaten Malang melakukan kesalahan ejaan. Mengingat pentingnya penggunaan bahasa tulis, maka disarankan bagi guru untuk lebih memperhatikan penggunaan ejaan dalam setiap tulisan siswa agar nantinya siswa dapat menulis dengan baik dan benar. Bagi para peneliti lebih lanjut disarankan untuk melakukan penelitian tidak hanya dalam aspek penggunaan ejaan saja, melainkan juga dapat melakukan penelitian pada aspek yang lainnya. Tidak hanya bahasa tulis namun juga pada bahasa lisan sehingga nantinya penggunaan bahasa Indonesia akan menjadi lebih baik.

Restrukturisasi bentuk gerak tari Renggarini di SMA Negeri 5 Malang / Siwi Jevanika

 

Kata Kunci : Struktur Bentuk Gerak Tari SMA Negeri 5 Malang merupakan salah satu sekolah yang menjadikan seni tari sebagai salah satu mata pelajaran. Salah satu tari yang diberikan adalah tari Renggarini. Pada pembelajaran seni tari, siswa kelas X diajak untuk mengembangkan struktur bentuk gerak tari Renggarini. Tari Renggarini merupakan tari yang diciptakan oleh guru seni tari melalui proses koreografi. Penelitian ini bertujuan untuk mendeskripsikan struktur bentuk gerak tari Renggarini dan struktur bentuk gerak tari Renggarini yang sudah dikembangkan oleh siswa. Penelitian ini menggunakan penelitian kualitatif dengan jenis penelitian deskriptif. Penelitian ini dilakukan secara alami dengan hasil penelitian yang dideskripsikan dalam bentuk kata-kata, gambar, dan diteliti secara mendalam. Lokasi penelitian ini berada di SMA Negeri 5 Malang dengan narasumber Retno Paminggit yang merupakan guru seni tari SMA Negeri 5 Malang. Penelitian ini dilakukan pada satu kelompok dari lima kelompok siswa kelas X menurut rekomendasi dari guru. Metode pengumpulan data menggunakan wawancara, observasi, dan dokumentasi. Analisis yang dilakukan dengan mengelompokkan data serta klasifikasi data, memaparkan data, dan menarik kesimpulan. Hasil penelitian mencakup dua hal yaitu: (1) Struktur bentuk gerak tari Renggarini yaitu bahwa: unsur gerak kepala terdiri dari empat unsur gerak, unsur gerak badan terdiri dari dua unsur gerak, unsur gerak tangan terdiri dari sebelas unsur gerak, unsur gerak kaki terdiri dari sembilan unsur gerak. Mempunyai tiga belas motif gerak. Mempunyai sembilan ragam gerak. (2) Struktur bentuk gerak tari Renggarini yang dikembangkan oleh siswa SMA Negeri 5 Malang yaitu: unsur gerak kepala terdiri dari lima unsur gerak, unsur gerak badan terdiri dari tiga unsur gerak, unsur gerak tangan terdiri dari lima belas unsur gerak, unsur gerak gerak kaki terdiri dari sepuluh unsur gerak kaki. Mempunyai enam belas motif gerak. Mempunyai ragam empat belas ragam gerak. Analisis pengembangan struktur bentuk gerak tari Renggarini terdiri dari dua aspek yaitu: penambahan struktur bentuk gerak dan perubahan struktur bentuk gerak. Pengembangan tersebut dilakukan berdasarkan komposisi desain gerak dan konstruksi dasar tari dengan mempertimbangkan unsur keindahan, penyesuaian anatomi tubuh, perwujudan ekspresi yang berbeda, dan penyajian bentuk gerak yang berbeda. Beberapa saran yang ditulis penulis, yaitu bagi guru tari SMA Negeri 5 Malang agar tetap meneruskan program pembelajaran tari dengan melibatkan siswa untuk mengembangkan struktur bentuk gerak sehingga dapat melatih kreatifitas siswa secara nyata melalui mata pelajaran seni tari di SMA Negeri 5 Malang. Dari penelitian ini diharapkan menjadi salah satu wacana penambah informasi tentang proses kreatifitas siswa pada mata pelajaran seni tari di SMA Negeri 5 Malang.

Gender based differences in compliment and compliment response behavior in American talk show "The Oprah Winfrey Show" / Austin Miracle Widya Sari

 

Keywords: Gender differences, compliments, compliment responses, The Oprah Winfrey Show. The present study aims at discussing compliment giving behavior based on different gender which appeared in The Oprah Winfrey Show. Besides, it also discusses the compliment responses given by the participants on that American talk show. As this study deals with compliment behavior based on gender differences, the samples of this study are all participants (host, guest stars, audience), both males and females, in ten random videos of The Oprah Winfrey Show. The research design of this study is descriptive qualitative. The primary data are taken from the conversation among participants in ten random videos of The Oprah Winfrey Show. In this study, the researcher wrote and recorded some conversations which contain compliments and compliment responses given by the participants. Then, the researcher categorized the compliment strategies employed by males and females based on Ye’s (1995: 243) and compliment responses based on Herbert’s taxonomy (1986:79). The researcher finds out 153 compliments and 157 compliment responses given by males and females participants in The Oprah Winfrey Show. From those 153 compliments, the researcher finds that 61.4% (94 compliments) are offered by females and 38.6% (59 compliments) are offered by males. Furthermore, the most common compliment strategy used by both females and males are explicit compliment strategy. There are 43.7% (67 compliments) out of 61.4% (94 compliments) compliments offered by female are explicit compliment strategy while males offered 28.1% (43 compliments) explicit compliment strategy. Meanwhile, the most used compliment topic for both males and females is ‘other’ topic, which does not belong to the 4 topics or maybe has mixed topics. This topic usually comments on movies, books, activities and so forth. There are 39.2% (60 compliment topics) employed by both males and females in giving compliment are included in ‘other’ topic. In line with compliment giving, compliment responses are mostly given by females, that is 59.2% (93 responses) while 40.8% (64 responses) are given by males. Moreover, the most commonly used response strategies for both genders are the same which is No acknowledgement. Females give 25.5% (40 responses) out of 59.2% responses while males give 21% (33 responses) out of 40.8%. In conclusion, firstly, females offer more compliment than males do and it is far different between them. Besides, both females and males tend to offer compliment to the opposite gender. Secondly, both females and males in the present study tend to offer explicit compliments. Lastly, both genders employed various strategies in responding to the compliment. Since this research only focuses on the conversation in a talk show, it needs improvement from future researchers to conduct study in wider range field of communication to find out whether it has different result. Moreover, this research also can be used in giving and responding to the compliment with appropriate strategy. The lecturers of English and personality trainers can also apply this research to teach their students and give information to them as a regard to speech act across gender. Thus, they are able to know the differences in men and women talks.

Fungsi tari tayub dalam upacara adat Longkangan di Desa Munjungan Kabupaten Trenggalek / Yekti Sinastri

 

Sinastri, Yekti. 2013. Fungsi Tari Tayub dalam Upacara Adat Longkangan di Desa Munjungan Kabupaten Trenggalek . Skripsi, Jurusan Seni dan Desain Fakultas Sastra Universitas Negeri Malang.Pembimbing: (1) Dra. E.W. Suprihatin Dyah P, M.Pd, (2) Wida Rahayuningtyas, S.Pd, M.Pd Kata kunci : Tari, Tayub, Upacara Adat, Trenggalek Jawa Timur mempunyai banyak tari tradisional yang berfungsi dalam upacara adat, sehingga pantas untuk di lestarikan dan dikembang kan. Salah satu tari tradisional yang masih hidup dan berkembang di Trenggalek dan masih berfungsi sebagai upacara adat ada lah tari Tayub. Tari Tayub di Kabupaten Trenggalek masih tetap dilestarikan sebaga i syarat wajib dalam upacara. Tari Tayub selalu digunakan dalam pelaksanaan upacara adat Longkangan . Tujuan penelitian ini yaitu: 1) Mendeskripsikan bentuk upacara adat Longkangan di Desa Munjungan Kabupaten Trenggalek; 2) Mendeskripsikan fungsi tari Tayub dalam upacara adat Longkangan di Desa Munjungan Kabupaten Trenggalek. Penelitian ini termasuk jenis pene litian deskriptif kualitatif. Teknik pengumpulan data dalam penelitian ini menggunakan teknik observasi, wawancara, dan dokumentasi. Kegiatan an alisis data dimulai dari tahap pengumpulan data, tahap reduksi, tahap peny ajian data, serta tahap penarikan simpulan dan verifikasi. Pengecekan keabsahan temuan menggunakan triangulasi sumber dan triangulasi metode. Hasil penelitian menunjukkan ba hwa 1) bentuk upacara adat Longkangan tersebut terdiri atas dua bagian yaitu: a) proses upacara yang terbagi atas lokasi penelitian, waktu pelaksanaa n, pelaku upacara, tujuan upacara dan sesaji upacara; b) tata urutan upacara yang terdiri dari: (1) pra upacara (2) Inti upacara; (3) Penutup upacara. 2) Fungsi tari Tayub dipercaya masyarakat Desa Munjungan dalam upacara adat Longkangan sebagai sarana ritual yang menjadi syarat wajib upacara. Tari Tayub merupakan simbol identitas masyarakat Desa Munjungan Kabupaten Trenggalek. Urutan upacara adat Longkangan terdiri atas: pra upacara (arak-arakan, tasyakuran dan larung tumpeng ); acara inti (pagelaran tari Tayub adat inti); penutup upacara ( ruwatan murwakolo ). Fungsi tari Tayub dalam upacara adat Longkangan merupakan sarana upacara ( ritual) yaitu sebagai syarat wajib upacara dalam rangka meng hormati roh-roh leluhur serta salah satu perwujudan permohonan terha dap roh-roh leluhur agar diberikan kemakmuran dan terhindar dari mala petaka. Berdasarkan hasil penelitian ini, dihara pkan akan ada penelitian yang lebih lanjut dan lebih menyempurnakan hasil peneli tian khususnya pada ragam gerak atau lebih spesifik pada tari Tayub ter sebut, serta kegiatan upacara adat Longkangan tetap dapat terus dile starikan oleh masyarakat setempat terutama oleh generasi muda.

Studi motif pada dekorasi kerajinan kendang jimbe di Kelurahan Tanggung Kecamatan Kepanjen Kidul Kota Blitar / Edo Pranata Putra

 

Kata Kunci: Motif dekorasi, Kerajinan kendang Jimbe. Kendang Jimbe bukanlah asli kendang Blitar, namun kendang Jimbe dijadikan salah satu ikon pariwisata kota blitar, karena sentra pembuatan kendang Jimbe yang besar ada di daerah Blitar, yaitu di desa tanggung. Kerajinan bubut kayu kendang Jimbe inidi mulai awal tahun 1980 kemudian baru tahun 2000-an banyak warga Tanggung yang mengembangkan kendang Jimbe, termasuk dekorasi motif yang digunakan untuk menghiasi tiap body kendang Jimbe. Bentuk-bentuk ragam motif yang menghiasi kendang Jimbe sangat bervariasi dan indah, sehingga dalam penelitian ini akan didiskripsikan tentang latar belakang dan visualisasi dekorasi motif kendang jimbeserta teknik dekorasi motif kendang Jimbe. Penelitian ini diharapkan dapat memberi wawasan mengenai motif kerajinan kendangJimbe dan sentra usahanya di kota Blitar. Mengingat bahwa masih banyak yang menganggap kerajinan ini berasal dari Bali, yang disebabkan oleh pusat penjualan kendang Jimbe berada di pulau Bali. Jenis penelitian yang dilakukan adalah penelitian survei dengan pendekatan deskriptif, yaitu untuk menggambarkan dan menjelaskan dekorasi motif kendang Jimbe yang diproduksi di Kelurahan Tanggung, Kecamatan Kepanjen Kidul, Kota Blitar. Proses penelitian berlangsung selama 4 bulan, yaitu mulai tanggal 25Oktober 2012 sampai sampai 2 Maret 2013. Dalam penelitian ini yang menjadi variabel adalah visualisasi dekorasi motif dan teknik dekorasi motif pada kerajinan Jimbe. Instrumen yang digunakan adalah wawancara, dan observasi, dengan subyek penelitian adalah kendang Jimbe itu sendiri. Analisis data dilakukan dengan reduksi data, mendisplaynya berdasarkan rumusan masalah, mengambil kesimpulan kemudian mengecek keabsahan datanya dengan menggunakan triangulasi data. Dari hasil analisis ditemukan jawaban bahwa dekorasi motif pada kerajinan kendangJimbe menggunakan motif hiasan geometri berupa tumpal, meander, pilin ganda, serta motif non geomerti berupa kura-kura, lumba-lumba, cicak, palem, gajah. Sedangkan teknik dekorasi motif pada kerajinan kendang jimbe terbagi menjadipainting, ukir datar dan ukir tinggi. Jenis motif yang digunakan digunakan sebagai hiasan pada tiap body kendang Jimbe dikelompokkan berdasarkan tekniknya. Barang-barang yang diproduksi di sentra bubut ini dominan terhadap kendang Jimbe saja, disarankan bila mengembangkan produk lain seperti kendang Jawa yang dapat menjadi sarana pengenal kebudayaan indonesia.

Gaya hidup tokoh remaja novel Teenlit dan potensi novel Teenlit sebagai sumber ajar bermuatan pendidikan karakter pada jenjang SMP/MTs / Anne Yuanita

 

Kata Kunci: apresiasi sastra, bahan ajar sastra, novel teenlit Pada usia remaja, seseorang berada pada tahap pencarian jati diri. Saat itulah kondisi emosinya labil, sehingga ia mudah terpengaruh oleh lingkungan di sekitar-nya. Hal-hal yang bisa memengaruhi remaja di antaranya adalah media massa dan bacaan. Salah satu bacaan yang sangat diminati oleh remaja adalah novel teenlit. Novel jenis ini sangat diminati oleh para remaja, termasuk di dalamnya adalah remaja putri yang sedang duduk di bangku SMP/MTs. Di sisi lain, pengajaran Bahasa dan Sastra Indonesia membutuhkan sumber ajar berupa novel remaja untuk menunjang pembelajaran. Salah satu novel remaja yang bisa dipertimbangkan adalah novel teenlit. Sayangnya, banyak orang menilai novel ini sebagai pemberi pengaruh negatif bagi para pembacanya yang masih remaja, termasuk pengaruh gaya hidup. Oleh karena itu, perlu dilakukan suatu penelitian tentang gaya hidup tokoh remaja dalam novel teenlit, dan potensinya sebagai sumber ajar. Penelitian ini dilaksanakan dengan tujuan untuk mengetahui gambaran gaya hidup tokoh remaja novel teenlit dan potensi novel ini sebagai sumber ajar yang bermuatan pendidikan karakter untuk jenjang SMP/MTs. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Data penelitian yang berupa unit-unit tekstual gaya hidup tokoh remaja diperoleh dari sumber data berupa novel teenlit yang mencakup Tuxedo Prince, Wonderfully Stupid, dan Bali to Remember. Penumpulan data dilakukan dengan cara pembacaan novel dan pencatatan serta pemebrian tanda pada unit-unit tekstual yang menggambarkan aspek gaya hidup tokoh remaja novel teenlit. Instrumen yang digunakan untuk mengumpulkan data berupa manusia, yaitu peneliti sendiri. Untuk menjaga keabsahan data, dilakukan kegiatan pengecekan sejawat. Kegiatan analisis data di-mulai dari identifikasi, kodifikasi, dan klasikikasi data. Hasil penelitian ini adalah sebagai berikut. Pertama, gaya hidup tokoh remaja novel teenlit yang terdiri atas gaya hidup positif, hedonis, dan negatif yang bukan hedonis. Gaya hidup hedonis merupakan gaya hidup yang mendominasi. Hal ini ter-lihat dari berbagai aspek gaya hidup yang menunjukkan adanya motif untuk menca-pai kesenangan. Kedua, potensi novel teenlit sebagai sumber ajar bermuatan pendidikan ka-rakter pada jenjang SMP/MTs yang dilihat dari berbagai sudut pandang. Novel teenlit berpotensi sebagai sumber ajar yang bermuatan pendidikan karakter untuk jenjang SMP/MTs, dengan catatan guru harus menyiapkan strategi pembelajaran yang tepat agar para siswa terhindar dari pengaruh negatif novel teenlit.

Pengembangan model latihan umpan crossing dalam permainan sepakbola untuk usia 15 tahun di Sekolah Sepakbola Trisula Perak Kabupaten Blitar / Kukuh Kurniadi

 

Kata kunci:Pengembangan, Model Latihan, UmpanCrossing, DalamPermaianSepakbola Sepakbolamerupakansalahsatucabangolahragapermainan yang sangatdigemariolehberbagailapisanmasyarakat, baikanak-anak, remaja, bahkan orang yang dewasagemarmenontondanbermainsepakbola. Olahragainimerupakangabungandaribeberapateknikindividudantim yang menyatudalamsebuahkerjasamakeseluruhan. Dalamhaliniteknik-teknikindividu yang baikakanmendukungkerjasamatim yang baik. Padadasarnyasepakbolaadalahpermainanberegu yang dimainkanolehindividu-individu Hasilobservasisertahasilangket yang disebarpenelitikepadasiswaSekolahSepakbolaTrisula Perak dilapanganKademanganKab.Blitarmenunjukanbahwa 80 % siswasudahbisamelakukanpasing, dan 78 % siswasudahbisamelakukanshooting danhampir 82% siswasudahbisamelakukankontrol bola sedangkan 75% pemainsepakbolaTrisula Perak yang berusian 15 tahunbelummempunyaikemampuanmelakukancrossing yang baikdanbenar, halinimunculsetelahpenelitimelakukanobservasilapanganpadasaatsekolahsepakbolaTrisula Perak melakukanlatihanrutin, danhasildariangket yang disebarkankepadasiswasekolahsepakbolaTrisulaperak. Penelitianinibertujuanuntukmengembangkan model-model latihancrossing dalampermainansepakboladenganmengacupadatehnikdanprinsip-prinsipcrossing yang dilakukan di sekolahsepakbolaTrisula Perak Kab.Blitar Produkininantinyaberupa model-model latihanumpan crossing yang dikemasdalamsebuahbukupanduan yang dimanabukutersebutdapatmemudahkansiswasekolahsepakboladalammempelajaridanmemahami model-model latihan crossing tersebut. Metode pengembangan dalam penelitian ini menggunakan model pengembangan dari Borg and Gall. Instrumen pengumpulan data yang digunakan dalam penelitian dan pengembangan ini berupa angket kuesioner. Angket kuesioner diberikan kepada 2 orah ahli sepakbola, uji coba (kelompok kecil) terhadap siswa sekolah sepakbola trisula perak sebanyak 6 orang dan untuk uji coba lapangan (kelompok besar) sebanyak 20 orang siswa sekolah sepakbola trisula perak kabupaten blitar. Hasil tinjauan para ahli, yaitu ahli sepakbola 1 menyatakan bahwa produk yang dikembangkan ini sebenarnya sudah layak digunakan dan memenuhi kriteria baik untuk digunakan akan tetapi saran dari uji ahli 1 adalah supaya masing-masing model latihan diberi nama dan saran yang kedua adalah dalam menjelaskan materi lebih dibenahi dalam segi bahasa dan penjelasan karena dengan penjelasan yang mudah dipahami akan memudahkan pembaca memahami tulisan tersebut. Untuk uji ahli sepakbola II sama halnya dengan uji ahli I yaitu produk sebenarnya sudah layak dan masuk dalam kriteria baik untuk digunakan akan tetapi uji ahli dua juga memeberikan masukan yaitu yang pertama adalah dalam hal variasi latihan mungkin lebih dikembangkan lagi dan yang kedua dari segi bahasa dalam menyampaikan materi diperbaiki lagi. Sedangkan hasil uji lapangan (kelompok besar) diperoleh bahwa seluruh aspek dalam Pengembangan Model Latihan Umpan Crossing Dalam Permainan Sepakbola Untuk Anak Usia 15 Tahun Di Sekolah Sepakbola Trisula Peraka Kabupaten Blitar tersebut telah memenuhi kriteria baik yaitu antara 80-100%. Berdasarkan hasil uji coba (kelompok kecil) dan uji lapangan (kelompok besar), maka diperoleh bahwa produk pengembangan. Hasilpenelitiandanpengembanganinihanyaterbataspadapengembanganproduk, makapenelitimenyarankanagar dilakukanpenelitianselanjutnya yang mengujitentangtingkatefektivitasproduk yang telahdikembangkan.

Sistem layanan Perpustakaan Fakultas Ekonomi Universitas Negeri Malang / Fitriyah

 

Kata Kunci: perpustakaan fakultas, sistem layanan. Perpustakaan perguruan tinggi adalah perpustakaan yang tergabung dalam lingkungan lembaga pendidikan tinggi, baik berupa perpustakaan universitas, perpustakaan fakultas, perpustakaan akademi, perpustakaan sekolah tinggi. Perpustakaan Fakultas Ekonomi Universitas Negeri Malang merupakan sebuah fasiltas yang bernilai tinggi dalam menunjang akademik mahasiswa yang belajar di dalamnya. Peranan Perpustakaan Fakultas Ekonomi Universitas Negeri Malang sangat erat kaitannya dengan sistem layanan perpustakaan, yang berperan serta dalam melaksanakan tercapainya visi dan misi perguruan tingginya. Pelayanan pada hakikatnya adalah serangkaian kegiatan dalam proses pemenuhan kebutuhan melalui aktivitas orang lain, karena pelayanan merupakan proses. Sebagai proses, pelayanan berlangsung secara rutin, berkesinambungan dan pemenuhan kebutuhan anggota, baik pemenuhan material maupun spiritual. Oleh karena itu, dibutuhkan suatu analisis tentang sistem layanan perpustakaan dengan tujuan dapat mendeskripsikan tetang sistem layanan di Perpustakaan Fakultas Ekonomi Universitas Negeri Malang. Sebagai satu kesatuan, sistem layanan yang terdapat di Perpustakaan Fakultas Ekonomi Universitas Negeri Malang, secara berkesimbungan memiliki hubungan yang erat dalam penyelenggaraan perpustakaan tersebut. Analisis layanan Perpustakaan Fakultas Ekonomi Universitas Negeri Malang dilakukan dengan observasi selama bulan April-Mei 2013. Selama penelitian berlangsung, peneliti mengamati lima sistem yang terdapat di Perpustakaan, yaitu (1) layanan peminjaman, (2) layanan pengembalian, (3) layanan presensi, (4) layanan fotokopi, dan (5) layanan referensi. Ditinjau dari segi keberadaannya, Perpustakaan Fakultas Ekonomi Universitas Negeri Malang termasuk perpustakaan hibrida yang menerapkan sistem layanan terbuka dengan menggabungkan antara sistem layanan manual dan otomasi perpustakaan. Perpustakaan Fakultas Ekonomi Universitas Negeri Malang dapat berkembang melalui beberapa pengembangan fasilitas dan sistem pada masing-masing bagian, salah satunya adalah dengan pengembangan koleksi, pemanfaatan sumber daya manusia dengan baik, serta adanya sumber dana yang dimiliki Perpustakaan Fakultas Ekonomi Universitas Negeri Malang.

Perencanaan pelapisan tambahan (overlay) ruas jalan Blitar-Srengat STA 5+600-9+900 / Micky Anggi Pradana

 

Kata Kunci:pelapisantambahan (overlay), ruasBlitar-Srengat, STA 5+600-9+900 PadaruasjalanBlitarsampaiSrengatmerupakanjalanutamamenujukota Malang jugamenujumakambapakprokramatoryaitu :Ir. Soekarnodariarahkota Kediri ruasjalaninisangatramaimengingatmerupakanjalanutamakendaraan yang melintascukuppadat.Sepajangruasjalantersebutmengalamiretak-retak(Cracking) I cacatpermukaan(Disintegration)Sepertiberlubang, retakbuayadanbergelombang. Inimengakibatkanparapenggunajalanmerasaterganggutidakbisamelajudenganmaksimal.Pembangunan perbaikanjalanharussegeradilakukan agar parapenggunajalanbisamelewatijalaninidengannyaman. Tujuannyauntukmemperbaikilapis permukaannya,dengancaramencariberapabesarteballapisantambahan (overlay) padaruasjalanBlitarsampaiSrengat, danmencarivolume yang digunakansaatpelaksanaanpenambahanketebalan lapis permukaan. RuasjalanBlitarsampaiSrengatinidirencanakanpada STA 5+600-9+900 denganpanjangjalan4400 m danlebarjalan7.m. Lapis PermukaanakanmenggunakanBahanLaston (LapisanAspalBeton), sedangkanuntukperhitunganstrukturperkerasanmenggunakanMetodeAnalisaKomponen yang bersumberdari“TebalPerkerasanLenturJalan Raya SNI 03-1732-1989” danbeberapaperaturan lain. Hasildariperhitunganteballapisanpermukaan yang menggunakanMetodeAnalisaKomponendiperolehketebalannyaadalah9,5 cm. Sedangkanhasildariperhitunganvolume sebesar 2926 m3

Tampilan fitur Online Public Acces Catalogue (OPAC) pada UPT Perpustakaan Universitas Negeri Malang / Winda, Hanifa

 

Kata Kunci: katalog, OPAC, otomasi perpustakaan, perpustakaanperguruantinggi UPT Perpustakaan Universitas Negeri Malang merupakan salah satu Unit Pelaksana Teknis untuk menunjang Tri Dharma Perguruan Tinggi Universitas Negeri Malang. UPT Perpustakaan Universitas Negeri Malang berperan sebagai salah satu unit atausarana kelengkapan perguruan tinggi yang bersifat akademik dalam menunjang perguruan tingginya dengan memberikan layanansecara optimal. Aktivitas kegiatanselama PKLpada UPT Perpustakaan Universitas Negeri Malangmeliputiaktivitas bagian pengadaan, aktivitas bagian pengolahan,aktivitas bagian sirkulasi, aktivitasbagian referensi,dan aktivitasbagian serial. Semua aktivitas bagian layanan ini salingterotomasi dan teritegrasi antara satu bagian dengan bagian yang lain.Sistemotomasiperpustakaandapatdigunakanuntukmenanganikegiatanrutindansebagaisaranapenelusuran (information retrieval) berupaOnline Public Access Catalogue (OPAC). OPAC merupakan sarana penghubung antara koleksi perpustakaan dengan penggunanya baik pengguna aktual dan pengguna potensial. Bagiperpustakaan, OPAC merupakanalatutama di dalamsistemtemukembaliinformasi, keuntungannya bagi pengguna adalah membuat mereka lebih mandiri dalam penelusuran dan penemuan bahanpustaka yang dibutuhkan. Tujuan dari penulisan ini meliputi:(1) mendeskripsikan tampilan fitur OPAC, (2) mendeskripsikan cara penelusuran informasi menggunakan OPAC, dan (3) mendeskripsikankesesuaian tampilan fitur OPAC UPT Perpustakaan Universitas Negeri Malang berdasarkan standar IFLA. Penulisan ini merupakan deskripsi seluruh bagian tampilan fitur OPAC dan dibatasi hanya pada OPAC di UPT Perpustakaan Universitas Negeri Malang. Adapun batasannya sampai pada fitur antarmuka (interface) dan fitur penelusuran informasi. Kesimpulan berdasarkan kegiatan PKL dan pengamatan OPAC UPT Perpustakaan Universitas Negeri Malang, yaitu: (1) tampilan OPAC terdiri dari dua bagian. Bagian header terdapat fitur berupa menu navigasi koleksi pustaka, pencarian, bantuan, usulan buku baru, cek peminjaman, dan home. Bagian konten menampilkan isi menu maupun sub menu OPAC; (2) terdapat dua cara penelusuran menggunakan OPAC. Penelusuran umum dengan menggunakan titik akses berupa judul, pengarang, dan subyek. Penelusuran khusus menggunakan logika Boolean untuk mempersempit maupun memperluas hasil penelusuran; dan (3) tampilan fitur OPAC kurang memenuhi kesesuaian prinsip dan rekomendasi IFLA. OPAC UPT Perpustakaan Universitas Negeri Malang hanya memenuhi 18 indikator dari keseluruhan 37 indikator rekomendasi IFLA. Saran untuk pengembangan teknologi informasi UPT Perpustakaan Universitas Negeri Malang khususnya OPAC, yaitu:(1) Kepala UPT Perpustakaan membuat rencana pengembangan teknologi informasi, khususnya untuk memperbaiki dan mengembangkan OPAC. Kepala UPT Perpustakaan dapat merangkul seluruh pustakawan maupun tenaga TI; (2) Pustakawan sebaiknya mengikuti perkembangan ilmu perpustakaan dan dapat menerapkan pengetahuannya di UPT Perpustakaan Universitas Negeri Malang. Selain itu, pustakawan sebaiknya menyusun pedoman atau panduan pengguna perpustakaan yang dapat diunduh secara gratis melalui website perpustakaan; dan (3) Tenaga TI sebaiknya mengembangkan diri pada bagian database administrator, network administrator, dan web designer untuk pengembangan teknologi informasi. Database administrator berperan sebagai pengatur pangkalan data. Network administrator berperan sebagai pengatur jaringan. Web designer berperan sebagai perancang dan pengatur tampilan website maupun OPAC UPT Perpustakaan Universitas Negeri Malang.

Pengaruh kinerja guru dalam mengimplementasi kurikulum dan ketersediaan sarana TIK terhadap prestasi belajar dalam mata pelajaran TIK pada siswa kelas X SMA Negeri 5 Malang / Odhitya Desta Triswidrananta

 

Kata Kunci: Kinerja Guru dalam Mengimplementasi Kurikulum, Ketersediaan Sarana TIK, Prestasi Belajar. Guru merupakan salah satu bagian yang berpengaruh terhadap terciptanya proses dan hasil pendidikan yang berkualitas. Kinerja guru dalam merencanakan dan melaksanakan pembelajaran, merupakan faktor utama dalam pencapaian tujuan pembelajaran. Sedangkan implementasi kurikulum merupakan suatu penerapan konsep, ide, program, atau tatanan kurikulum ke dalam praktik pembelajaran. Sehingga kinerja guru dalam mengimplementasi kurikulum untuk melaksanakan tugasnya sebagai pendidik meliputi merencanakan pembelajaran, pelaksanaan pembelajaran, dan evaluasi pembelajaran. Dalam proses pembelajaran juga memerlukan suatu sarana belajar yang memudahkan siswa untuk melakukan aktivitas pembelajaran. Oleh karena itu sarana yang dimiliki siswa sangat diperlukan khususnya berupa ketersediaan sarana belajar dalam mata pelajaran TIK, yang nantinya akan menciptakan motivasi bagi diri siswa dalam mengikuti pelajaran. Sehingga dalam mata pelajaran TIK siswa dapat mencapai prestasi belajar dengan maksimal. Rancangan penelitian yang digunakan dalam penelitian ini adalah deskriptif korelasional. Variabel yang diteliti dalam penelitian ini meliputi variabel bebas terdiri dari kinerja guru dalam mengimplementasi kurikulum (X1) dan ketersediaan sarana TIK (X2), variabel terikatnya adalah prestasi belajar siswa kelas X pada mata pelajaran TIK (Y). Pendekatan yang digunakan adalah pendekatan kuantitatif. Penelitian kuantitatif mencakup setiap penelitian yang didasarkan atas perhitungan presentasi, rata-rata, chi-square dan perhitungan statistik lainnya. Hasil dari penelitian ini berhasil mengungkap (1) Kinerja guru dalam mengimplementasi kurikulum (X1) memiliki kategori sangat baik sebesar 48,79%, (2) Ketersediaan sarana TIK (X2) memiliki kategori baik 55,56%, dan (3) Prestasi belajar dalam mata pelajaran TIK (Y) memiliki kategori baik sebesar 46,86%. Dari hasil analisis uji hipotesis (1) Ada pengaruh yang signifikan antara kinerja guru dalam mengimplementasi kurikulum dengan prestasi belajar dalam mata pelajaran TIK pada siswa kelas X di SMA Negeri 5 Malang. (2) Ada pengaruh yang signifikan antara ketersediaan sarana TIK dengan prestasi belajar dalam mata pelajaran TIK pada siswa kelas X di SMA Negeri 5 Malang. (3) Ada pengaruh yang cukup kuat antara kedua prediktor yaitu, kinerja guru dalam mengimplementasi kurikulum dan ketersediaan sarana TIK dengan prestasi belajar dalam mata pelajaran TIK pada siswa kelas X di SMA Negeri 5 Malang.

Pengaruh model pembelajaran kooperatif terhadap keterampilan soft skill siswa kejuruan kelas X Program Keahlian Teknik Kendaraan Ringan di SMK Negeri 1 Baureno Kabupaten Bojonegoro / Ary Teguh Febriyanto

 

Kata kunci: Kooperatif, group investigation, konvensional, dansoft skill. Soft skill merupakan perilaku personal dan interpersonal yang mengembangkan dan memaksimalkan kinerja manusia seperti membangun tim, pembuatan keputusan, inisiatif, dan komunikasi. Keberhasilan seseorang ditentukan 80% oleh soft skill, dan sisanya 20% hard skill. Di SMK Negeri 1 Baureno, kemampuan soft skill yang dimiliki siswa masih perlu dikembangkan dengan alasan masih rendahnya keterampilan soft skill yang dapat dilihat melalui sikap dan perilaku siswa yang kurang disiplin, kurang percaya diri, dan susah berbicara di depan umum. Salah satu penyebabnya adalah model pembelajaran di SMK Negeri 1 Baureno yang masih menggunakan metode ceramah. Sehingga siswa kurang aktif dalam pembelajaran di kelas. Tujuan penelitian: (1) mendeskripsikan penerapan model pembelajaran kooperatif dan model pembelajaran konvensional, (2) mendeskripsikan tingkat keterampilan soft skill, dan (c) mengetahui perbedaan keterampilan soft skill antara siswa dengan penerapan model pembelajaran kooperatif dan siswa dengan penerapan model pembelajaran konvensional. Rancangan penelitian ini menggunakan pendekatan kuantitatif dengan format Quasy Experimental. Kelas eksperimen dalam penelitian ini adalah kelas dengan penerapan model pembelajaran kooperatif, sedangkan sebagai pembanding yaitu kelas kontrol dengan penerapan model pembelajaran konvensional. Penelitian ini merupakan penelitian populasi, dengan menggunakan teknik random sampling. Berdasarkan hasil analisis dapat dilihat nilai rata-rata keterampilan soft skill setelah penerapan model pembelajaran kooperatif dengan metode Group Investigation sebesar 3,554, lebih tinggi dibandingkan model pembelajaran konvensional yaitu sebesar 3,341. Selain itu, hasil hipotesis menunjukkan bahwa ada perbedaan yang signifikan antara keterampilan soft skill siswa dengan penerapan model pembelajaran kooperatif dan siswa dengan penerapan model pembelajaran konvensional untuk siswa kejuruan kelas X Program Keahlian Teknik Kendaraan Ringan di SMK Negeri 1 Baureno Kabupaten Bojonegoro. Saran yang diajukan dalam penelitian ini yaitu: (1) bagi SMK Negeri 1 Baureno, disarankan agar mensosialisasikan pembelajaran kooperatif dengan metode Group Investigation (GI) dalam upaya peningkatan keterampilan soft skill siswa, (2) bagi guru mata pelajaran, disarankan untuk melanjutkan penerapan model pembelajaran kooperatif, dikarenakan pembelajaran ini terbukti lebih efektif, (3) bagi peneliti selanjutnya disarankan untuk menggunakan populasi atau sampel penelitian yang lebih luas, serta dengan materi yang berbeda.

Studi tentang tingkat kenyamanan kebaya modern pada berbagai bentuk tubuh wanita menggunakan pola cuppens geurs / Fitrotul Ummah

 

Kata Kunci: Kebaya, Sistem Cuppens Geurs, Tingkat Kenyamanan, Setiap proses pembuatan pakaian (kebaya) perlu diperhatikan proses pembuatan pola, karena setiap tahap dalam proses pembuatan pola terdapat perhitungan-perhitungan yang sistematis sehingga jika terdapat sedikit kesalahan maka hasil kebaya yang dibuat tidak akan nyaman ketika dipakai. Masing-masing sistem pembuatan pola dasar tentunya memiliki kelebihan dan memililiki kekurangan serta kerumitan-kerumitan yang bersifat khusus, untuk itu dalam memilih sistem pola dasar perlu disesuaikan dengan kondisi bentuk tubuh seseorang. Pola dasar sistem Cuppens Geurs termasuk sistem pola dasar yang rumit bila dibandingkan dengan pola lain yang pada umumnya memiliki satu kupnat depan dan belakang misalnya pola So-en atau pola Praktis. Jika dilihat dari jumlah kupnat yaitu pada bagian pinggang dan sisi maka pola Cuppens Geurs akan lebih cocok digunakan dalam pakaian yang press body dan hasilnya lebih nyaman dikenakan karena sesuai dengan bentuk tubuh wanita yang memiliki banyak lekukan-lekukan. Tujuan penelitian ini adalah untuk mendeskripsikan hasil dari tingkat kenyamanan kebaya modern pada berbagai bentuk tubuh wanita dengan menggunaan pola sistem Cuppens Geurs. Penelitian ini menggunakan rancangan penelitian deskriptif dengan populasi lima buah kebaya modern dengan ukuran sesuai bentuk tubuh wanita yaitu ideal, gemuk pendek, kurus pendek, tinggi gemuk dan tinggi kurus. Instrumen yang digunakan dalam penelitian ini berupa lembar pengamatan (angket). Uji instrumen (uji validitas) menggunakan validasi konstrak. Berdasarkan hasil analisis data dapat disimpulkan bahwa tingkat kenyamanan kebaya modern menggunakan pola sistem Cuppens Geurs pada berbagai bentuk tubuh wanita yaitu : a) bentuk tubuh wanita ideal termasuk dalam kategori nyaman dengan nilai rata-rata 91,45%; b) bentuk tubuh wanita tinggi kurus termasuk dalam kategori kurang nyaman dengan nilai rata-rata 76,92%; c) bentuk tubuh wanita tinggi gemuk termasuk dalam kategori nyaman dengan nilai rata-rata 90,59%; d) bentuk tubuh wanita pendek kurus termasuk dalam kategori nyaman dengan nilai rata-rata 88,03%; e) bentuk tubuh wanita pendek gemuk termasuk dalam kategori nyaman dengan nilai rata-rata 82,90%. Hasil penelitian dapat disimpulkan bahwa kebaya modern menggunakan pola sistem Cuppens Geurs nyaman digunakan pada bentuk tubuh ideal, tinggi gemuk, pendek kurus dan pendek gemuk , sedangkan untuk bentuk tubuh tinggi kurus kurang nyaman.

Pengembangan alat evaluasi pembelajaran bahasa Arab berbasis adobe flash player untuk SMA kelas XII / Nurul Wijayanti

 

Kata Kunci: alat evaluasi, Adobe flash player, bahasa arab, kelas XII. Bahasa Arab merupakan salah satu bahasa asing yang disajikan di sekolah-sekolah yang ada dalam naungan Kemendikbud. Akan tetapi, karena waktu penyajian mata pelajaran bahasa Arab yang singkat, maka perlu diimbangi dengan adanya metode pengajaran yang tepat dan penerapan alat evaluasi yang efektif. Berkaitan dengan hal tersebut, maka diperlukan pengembangan alat evaluasi pembelajaran yang praktis dan bisa digunakan sebagai pembelajaran mandiri di rumah. Tujuan umum penelitian ini adalah untuk menghasilkan produk pengembangan alat evaluasi pembelajaran bahasa Arab berbasis adobe flash player untuk SMA kelas XII. Sedangakan tujuan khusus penelitian ini adalah: (1) mendeskripsikan produk pengembangan alat evaluasi pembelajaran bahasa Arab berbasis adobe flash player untuk SMA kelas XII, (2) mendiskripsikan tingkat kelayakan produk pengembangan alat evaluasi pembelajaran bahasa Arab berbasis adobe flash player untuk SMA kelas XII, (3) mendeskripsikan model penggunaan produk pengembangan alat evaluasi pembelajaran bahasa Arab berbasis adobe flas player untuk SMA kelas XII. Metode penelitian yang digunakan dalam penelitian ini adalah metode pengembangan, dengan model pengembangan oleh Sugiono yang telah disederhanakan oleh peneliti yaitu: (1) identifikasi kebutuhan, (2) desain produk, (3) pengembangan materi pembelajaran, (4) memproduksi, (5) validasi, (6) revisi dan penyempurnaan. Hasil validasi dari ahli media bahasa Arab adalah 67,7 % dan ahli materi bahasa Arab adalah 80,5 %. Sementara itu hasil uji lapangan adalah 83,3 %.Hal ini berarti alat evaluasi pembelajaran ini cukup valid. Untuk meningkatkan tingkat validitasnya, diadakan revisi terhadap alat evaluasi tersebut.

Pengaruh economic literacy dan persepsi pola asuh orang tua dalam hal finansial terhadap pola konsumsi (studi pada siswa kelas X SMA Negeri 2 Batu) / Siti Agus Setyo Rini

 

Kata kunci: economic literacy, persepsi, pola asuh orang tua, finansial, dan pola konsumsi. Siswa SMA merupakan anak yang tergolong masih remaja yang mengalami masa perkembangan diri yang kompleks. Berkaitan dengan pemenuhan kebutuhan, remaja cenderung mengkonsumsi suatu produk dengan menitikberatkan pada status sosial, mode dan kemudahan daripada pertimbangan ekonomis. Beberapa hal yang harus dipelajari para siswa adalah bagaimana membangun kemampuan nalar dan logika, serta bagaimana mengambil keputusan yang tepat. Kemampuan tersebut telah dipelajari siswa di sekolah dan di rumah. Di sekolah siswa memperoleh economic literacy. Di rumah, orang tua menerapkan pola asuh dalam hal finansial sejak dini. Penelitian ini bertujuan untuk mengetahui pengaruh economic literacy dan persepsi pola asuh orang tua dalam hal finansial terhadap pola konsumsi yang dilakukan pada siswa kelas X di SMA Negeri 2 Batu sebagai populasinya. Penelitian yang dilakukan termasuk penelitian deskriptif korelasional. Teknik pengambilan sampel yang digunakan dalam penelitian ini adalah propotional random sampling, yaitu sebesar 30% dari jumlah populasi masing-masing kelas. Sampel yang digunakan dalam penelitian ini adalah 70 responden. Metode analisis data yang digunakan untuk menguji hipotesis dalam penelitian ini adalah analisis deskriptif dan analisis kuantitatif dengan menggunakan analisis regresi linear berganda, uji t dan uji F. Analisis data dilakukan dengan bantuan program SPSS for Windows versi 16 dengan taraf signifikansi 5%. Hasil analisis regresi linear berganda, uji t menunjukkan bahwa economic literacy berpengaruh positif dan signifikan terhadap pola konsumsi. Begitu pula dengan variabel persepsi pola asuh orang tua dalam hal finansial. Uji F menunjukkan bahwa secara bersama-sama variabel economic literacy dan persepsi pola asuh orang tua dalam hal finansial berpengaruh secara positif dan signifikan terhadap pola konsumsi. Variabel yang mempunyai pengaruh lebih dominan terhadap pola konsumsi adalah economic literacy, yaitu sebesar 21,5%. Sedangkan pengaruh persepsi pola asuh orang tua dalam hal finansial terhadap pola konsumsi adalah 15,2%. Dari penjumlahan sumbangan efektif tersebut diketahui 36,7% pola konsumsi dipengaruhi oleh economic literacy dan persepsi pola asuh orang tua dalam hal finansial. Sedangkan sisanya sebesar 63,3% ditentukan oleh variabel lain yang tidak diteliti dalam penelitian ini. Berdasarkan temuan-temuan tersebut maka penulis memberikan saran yang dapat dijadikan pertimbangan yaitu guru mata pelajaran ekonomi hendaknya memberikan dorongan kepada siswa untuk meningkatkan economic literacy siswa dengan cara memberikan pembelajaran yang bervariasi dan bagi peneliti selanjutnya sebaiknya menambah variabel di luar variabel pada penelitian ini yang memberikan konstribusi terhadap pola konsumsi siswa. Misalnya, kelompok acuan, iklan, dan lain sebagainya.

Pengembangan media evaluasi istima' dan qira'ah menggunaan hot potatoes 6 dalam pembelajaran bahasa Arab pada kelas VIII di MTs / Hurul Jinani

 

Kata kunci: Media evaluasi pembelajaran, menyimak, membaca, Hot Potatoes 6, MTs. Teknologi terus berkembang seiring dengan perkembangan zaman menuntut manusia untuk turut memanfaatkan teknologi tersebut dalam berbagai bidang, diantaranya bidang pendidikan. Guru perlu menggunakan variasi media pembelajaran agar dapat meningkatkan motivasi belajar siswa. Variasi media tersebut dapat dikembangkan dengan memanfaatkan teknologi yang telah dikembangkan oleh para ahli IT salah satunya adalah Hot Potatoes 6. Program tersebut dapat digunakan untuk mengembangkan media evaluasi menyimak dan membaca dalam pembelajaran bahasa Arab di kelas VIII MTs. Dengan menggunakan media evaluasi interaktif siswa akan lebih bersemangat dalam mengerjakan latihan baik bersama guru di kelas maupun secara mandiri di rumah. Tujuan penelitian ini adalah (1) Memproduksi media evaluasi menyimak dan membaca dalam pembelajaran bahasa Arab dengan menggunakan Hot Potatoes 6 pada kelas VIII di MTs, (2) Mendeskripsikan kelayakan media evaluasi menyimak dan membaca dalam pembelajaran bahasa Arab dengan menggunakan Hot Potatoes 6 pada kelas VIII di MTs. Model pengembangan yang digunakan pada penelitian ini adalah model model pengembangan produk pendidikan yang dikembang oleh Borg dan Gall dengan sedikit perbaikan dan sedikit penyesuaian pada komponen-komponennya. Langkah-langkah penelittian pengembangan media pembelajaran ini adalah sebagai berikut: (1) potensi masalah, (2) mengumpulkan informasi, (3) desain produk, (4) validasi produk, (5) uji coba produk, (6) revisi dan penyempurnaan, dan (7) produksi akhir. Penelitian ini menghasilkan produk berupa media pembelajaran membaca berbasis Hot Potatoes 6 yang telah divalidasi. Media pembelajaran tersebut adalah media pembelajaran yang dirancang khusus untuk kemahiran menyimak dan membaca bahasa Arab kelas VIII MTs dengan menggunakan software Hot Potatoes 6 yang dikemas dikemas dalam CD. Berdasarkan hasil uji ahli media, diketahui tingkat validitas media pembelajaran yaitu 82.1%. Untuk hasil uji ahli materi, produk pengembangan memiliki tingkat validitas 82,7%. Dengan demikian pada tahap uji ahli secara keseluruhan media ini memilki tingkat validitas 82,4 %. Berarti media pembelajaran tersebut cukup layak digunakan dalam pembelajaran. Namun untuk menyempurnakan media ini peneliti merevisi produk berdasarkan saran ahli media dan materi. Dan secara keseluruhan, persentase penilaian yang didapat dari hasil jawaban siswa dan guru adalah 91,2%. Maka media pembelajaran menyimak dan membaca dengan program Hot Potatoes 6 ini valid dan dapat digunakan dalam pembelajaran. Dari hasil pengembangan dalam penelitian ini, peneliti memberikan saran kepada peneliti selanjutnya mengembangkan evaluasi yang berupa penilaian angka dan yang berbasis online atau internet. Dengan begitu semua sekolah bisa memakainya secara online. Peneliti juga memberikan saran kepada pengajar bahasa Arab dan siswa kelas VIII MTs untuk menggunakan media ini dengan baik karena dengan sering berlatih siswa akan terbiasa dan mau berlatih secara mandiri dengan kehendaknya sendiri. Selain itu peneliti juga memberikan saran kepada mahasiswa JSA UM agar dapat menjadikan hasil pengembangan media ini sebagai bahan kajian agar dapat memajukan pendidikan terutama mata kuliah Media Pembelajaran Bahasa Arab ataupun mata kuliah lain yang disajikan di Program Studi Pendidikan Bahasa Arab.

Pengaruh ukuran perusahaan, struktur aktiva, profitabilitas dan risiko bisnis terhadap struktur modal: studi empiris pada perusahaan manufaktur yang terdaftar di BEI periode 2005-2009 / Handoko Dwi Christiyanto

 

Kata Kunci: Struktur Modal, Ukuran Perusahaan, Struktur Aktiva, Profitabilitas, Risiko Bisnis Permasalahan yang dibahas dalam penelitian ini adalah 1) Apakah terdapat pengaruh secara simultan antara ukuran perusahaan, struktur aktiva, profitabilitas, dan risiko bisnis terhadap struktur modal perusahaan?; 2) Apakah terdapat pengaruh parsial antara ukuran perusahaan, struktur aktiva, profitabilitas, dan risiko bisnis terhadap struktur modal perusahaan?. Penelitian ini menggunakan rancangan kausal dengan sifat ex post facto untuk menjawab pertanyaan di atas. Populasi dalam penelitian ini adalah perusahaan manufaktur yang listing di Bursa Efek Indonesia (BEI) selama lima tahun yaitu periode 2005-2009. Sampel penelitian terdiri dari 40 perusahaan yang ditentukan berdasarkan teknik purposive sampling dengan teknik pengumpulan data menggunakan teknik dokumentasi. Jenis data yang digunakan adalah data cross section data adalah satu set pengamatan atau lebih variabel yang dikumpulkan pada waktu yang sama untuk menggambarkan keadaan pada waktu yang bersangkutan dalam penelitian ini data yang dipakai yaitu data rata-rata pada periode tertentu. Analisis data menggunakan model regresi linear berganda. Pengujian hipotesis dilakukan dengan uji statistik yaitu uji signifikansi simultan (uji F) dan uji signifikansi parsial (uji t) dengan tingkat signifikansi 0,05. Analisis data menggunakan software pengolahan data statistik SPSS 15.0 for windows. Hasil dari penelitian ukuran perusahaan, struktur aktiva, profitabilitas, dan risiko bisnis secara simultan berpengaruh terhadap struktur modal, dengan sig uji F sebesar 0,000 < 0,05. Hasil pengujian secara parsial menunjukkan bahwa ukuran perusahaan, struktur aktiva, profitabilitas, dan risiko bisnis secara parsial berpengaruh terhadap struktur modal, dengan sig uji t masing-masing variabel < 0,05. Secara parsial ukuran perusahaan, struktur aktiva, dan risiko bisnis berpengaruh positif signifikan terhadap struktur modal, dan profitabilitas berpengaruh negatif signifikan terhadap struktur modal. Kontribusi keseluruhan variabel terhadap struktur modal sebesar 38,1% dan sisanya 61,9% dipengaruhi oleh faktor-faktor lain. Berdasarkan hasil penelitian ini, disarankan kepada manajer keuangan untuk tetap memperhatikan struktur modal perusahaan dan bagi peneliti yang lain diharapkan dalam penelitian selanjutnya menambah faktor-faktor yang lain yang mampu mempengaruhi struktur modal mengingat penelitian ini hanya mampu membuktikan 38,1% dari total pengaruh yang ada.

Identifikasi konflik dan strategi pengelolaan konflik pada SMA Negeri 02 Batu / Siti Agus Setyo Rini

 

Kata kunci: tipe konflik, sumber konflik, dampak konflik, dan strategi pengelolaan konflik Sekolah merupakan organisasi yang kompleks sama seperti organisasi yang lain, namun memiliki keunikan tersendiri. Sifat unik tersebut ditunjukkan dengan adanya proses belajar mengajar, yaitu tempat terselenggaranya pembudayaan kehidupan manusia. Sekolah sebagai satu institusi, di dalamnya terdapat sekumpulan orang yang terdiri dari berbagai personel dengan latar belakang, status, kepribadian, persepsi dan tujuan yang berbeda. Perbedaan tersebut mampu memicu adanya konflik. Oleh karena itu, dibutuhkan manajemen yang baik dalam sekolah. Penelitian ini bertujuan untuk mengetahui (1) Identifikasi sumber konflik pada tenaga pendidik dan kependidikan di SMA Negeri 02 Batu. (2) Identifikasi tipe konflik pada tenaga pendidik dan kependidikan di SMA Negeri 02 Batu. (3) Identifikasi dampak konflik pada tenaga pendidik dan kependidikan di SMA Negeri 02 Batu. (4) Strategi pengelolaan konflik oleh pihak manajemen sekolah yang diwakili oleh kepala SMA Negeri 02 Batu. Jenis penelitian yang digunakan adalah deskriptif kualitatif dengan pendekatan studi kasus. Teknik Pengambilan datanya menggunakan observasi, wawancara, dan dokumentasi. Hasil temuan lapangan menyatakan bahwa dalam Konflik yang ditemukan dalam SMA Negeri 02 Batu adalah konflik intrapersonal, konflik antarpersonal dan konlfik peran. Konflik intrapersonal bersumber pada kurangnya jam mengajar guru terkait dengan kebijakan SKB Lima Menteri. Konflik antarpersonal bersumber pada adanya ketidaksepahaman suatu hal. Konflik peran bersumber pada kurang jelasnya uraian tugas dan pekerjaan yang diberikan oleh atasan. Secara keseluruhan, dampak yang muncul dari konflik di atas berpengaruh pada kinerja pegawai yang menurun. Dalam menyelesaikan konflik atau permasalahan yang terjadi di SMA Negeri 02 Batu, dilakukan oleh kepala sekolah bersama-sama dengan para pegawai. Hal ini dilakukan untuk mencapai hasil keputusan yang terbaik, mufakat dan tidak berat pada salah satu pihak. Berdasarkan hasil analisis dapat disimpulkan bahwa pihak pimpinan telah mampu menangani konflik yang terjadi dengan baik. Namun pada dasarnya konflik tidak dikelola, hanya diselesaikan saja. Dalam hal ini kepala sekolah sebagai pemimpin, diharapkan mampu mengelola konflik, dalam artian mengendalikan dan mengubah konflik sehingga menciptakan konflik yang menguntungkan. Sehingga akan akan mengembangkan kreativitas dan inovasi dalam organisasi.  

Analisis psikologis tokoh utama dalam novel Mudzakkira: T Thabi: Bah karya Nawa: L As-Sa;da: Wiy / Luky Setia Widianti

 

Peningkatan motivasi dan hasil belajar melalui penerapan model rallytable dengan media papan flanel pada standar kompetensi membuka usaha eceran/ritel (studi pada siswa kelas XI Pemasaran di SMK Islam Batu) / Bintari Trirahmatia

 

Kata Kunci: Model RallyTable, Media Papan Flanel, Motivasi Belajar, Hasil Belajar Pada kegiatan pembelajaran, guru harus mampu berperan sebagai fasilitator dan motivator. Salah satu usaha yang dapat dilakukan guru yaitu dengan menggunakan variasi model dan media pembelajaran. Berdasarkan observasi yang dilakukan di kelas XI Pemasaran SMK Islam Batu pada standar kompetensi Membuka Usaha Eceran/Ritel diperoleh data mengenai motivasi dan hasil belajar siswa masih rendah. Faktor yang menyebabkan yaitu metode pembelajaran yang diterapkan di kelas dan jam pelajaran yang berlangsung siang hari pukul 12.30 sampai 17.00 WIB. Berdasarkan hasil observasi terhadap motivasi siswa di kelas menunjukkan siswa yang aktif saat pembelajaran hanya setengah dari jumlah siswa dalam kelas. Menurut angket motivasi pra tindakan, menunjukkan hasil motivasi belajar siswa sebesar 69%. Sedangkan hasil tes harian siswa sebelum penelitian menunjukkan persentase ketuntasan belajar dalam kelas hanya 53%. Penelitian ini merupakan Penelitian Tindakan Kelas (PTK) dengan pendekatan kualitatif. Metode pengumpulan data dalam penelitian ini menggunakan lembar observasi, pedoman wawancara, tes, angket, lembar catatan lapangan, dokumentasi. Adapun tujuan penelitian ini: (1) mendeskripsikan penerapan model RallyTable dengan media papan flanel, (2) peningkatan motivasi belajar setelah penerapan model RallyTable dengan media papan flanel, (3) peningkatan hasil belajar siswa setelah penerapan model RallyTable dengan media papan flanel. Subyek penelitian ini adalah siswa kelas XI Pemasaran SMK Islam Batu tahun pelajaran 2012/2013 berjumlah 30 siswa. Hasil penelitian menunjukkan keberhasilan tindakan guru menerapkan model pembelajaran pada siklus I memperoleh persentase 82% sehingga kriteria tingkat keberhasilan tindakan mendapat nilai B+. Sedangkan siklus II menjadi 97% dengan kriteria tingkat keberhasilan tindakan mendapat nilai A. Motivasi belajar siswa setelah penerapan model RallyTable dengan media papan flanel cukup meningkat dengan persentase rata-rata siklus I sebesar 78% sedangkan siklus II sebesar 85%. Hasil belajar ranah kognitif juga mengalami peningkatan dimana pada siklus I persentase ketuntasan hasil belajar kelas yaitu 55% dan pada siklus II persentase ketuntasan hasil belajar kelas meningkat sebesar 89%. Pada penelitian ini dapat disimpulkan bahwa penerapan pembelajaran model RallyTable dengan media papan flanel berhasil dilaksanakan guru, dimana persentase peningkatan keberhasilan guru menerapkan tindakan pada siklus I dan siklus II sebesar 15%. Motivasi belajar siswa sebelum penelitian dan setelah penelitian mengalami peningkatan yang cukup baik yaitu 16%. Sedangkan hasil belajar ranah kognitif juga mengalami peningkatan setelah penerapan model RallyTable dengan media papan flanel pada siklus I dan siklus II sebesar 36%. Berdasarkan hasil penelitian ini, peneliti menyarankan (1) Bagi siswa, hendaknya membiasakan diri untuk belajar berkelompok, berkomunikasi dan bersosialisasi dengan baik antar teman di kelas. (2) Bagi guru, dapat menjadikan model pembelajaran RallyTable dengan media papan flanel sebagai alternatif pilihan dalam pembelajaran dan dapat menerapkan model pembelajaran lain yang sejenis dengan model pembelajaran ini misalnya model RoundTable, RoundRobin, atau RallyRobin, dengan menggunakan media pembelajaran yang lebih inovatif. (3) Bagi sekolah, hendaknya mendukung guru baik dari segi sarana maupun prasarana dalam mengembangkan model pembelajaran RallyTable dengan media papan flanel dan menerapkan model pembelajaran lainnya yang dapat meningkatkan motivasi dan hasil belajar siswa. (4) Bagi peneliti lain, dapat meneliti model pembelajaran lain yang sejenis dengan model pembelajaran RallyTable atau dapat meneliti model pembelajaran ini dengan mengunakan media pembelajaran lain yang lebih kreatif dan inovatif pada standar kompetensi yang sama atau berbeda.

Studi tentang pelaksanaan kegiatan pameran seni rupa di SMP Negeri 2 Bantur pada tahun ajaran 2012/2013 / Yuli Irawan

 

Irawan, Yuli. 2013. Studi Tentang Pelaksanaan Kegiatan Pameran Seni Rupa di SMP Negeri 2 Bantur pada Tahun Ajaran 2012/2013. Skripsi, Jurusan Seni dan Desain, Fakultas Sastra, Universitas Negeri Malang. Pembimbing (1) Drs. Triyono Widodo, M. Sn. (2) Drs. Didiek Rahmanadji. Kata Kunci: Studi, Pameran, Seni Rupa, SMP, Bantur Kegiatan pameran seni rupa di SMP Negeri 2 Bantur pada tahun ajaran 2012/2013 merupakan acara penyelenggaraan yang ke-16 sejak tahun 1997. Pameran seni rupa di SMP Negeri 2 Bantur merupakan kegiatan intrakurikuler yang diadakan secara rutin setiap tahun sebagai salah satu kegiatan evaluasi dan ujian praktik mata pelajaran Seni Budaya. Kegiatan ini dibimbing oleh guru yang berkompeten dalam bidang seni. Adanya dukungan dari pihak sekolah. Selain itu, sekolah lain belum pernah mengadakan pameran yang sejenis. Namun, hal tersebut tidak didukung oleh jumlah guru yang hanya berjumlah satu orang. Sehingga diperlukan pembahasan mengenai hal ini. Penelitian ini menggunakan pendekatan deskriptif kualitatif yang bertujuan untuk mendeskripsikan kegiatan pameran seni rupa di SMP Negeri 2 Bantur, baik dari segi manajemen organisasi, pelaksanaan mulai dari pra pameran, pameran hingga pasca pameran, serta faktor-faktor pendukung dan penghambat dalam kegiatan pameran seni rupa di SMP Negeri 2 Bantur. Sumber data berupa kata-kata, tindakan, dan sumber tertulis dari narasumber. Pengumpulan data menggunakan teknik wawancara, observasi, dan dokumentasi. Tahap analisis data dimulai dari tahap reduksi data, paparan data, sampai penarikan kesimpulan. Kemudian melakukan trianggulasi sumber data untuk menjaga keabsahan data. Peneliti berharap mampu menghasilkan gambaran secara holistik sebagai jawaban atas permasalahan yang ada melalui data-data yang terkumpul. Berdasarkan observasi, diperoleh hasil bahwa kegiatan ini diadakan pada tanggal 28 Februari-02 Maret 2013 di ruang kelas, karena sekolah masih belum memiliki ruangan khusus untuk kegiatan pameran seni rupa. Manajemen kegiatan pameran seni rupa di SMP Negeri 2 Bantur didasarkan pada Rencana Kerja dan Anggaran Sekolah (RKAS). Pendanaan, sarana prasarana, sistem penentuan jenis dan jumlah karya, dan peserta pameran telah direncanakan dan diatur sebelum kegiatan berlangsung. Perencanaan, persiapan, perangkat pameran hingga pelaksanaan pameran telah dirancang dalam Rencana Pelaksanaan Pembelajaran (RPP). Pada akhirnya, siswa harus mampu menerapkan ilmu dan teori yang diperoleh dengan baik dan benar. Faktor pendukung kegiatan pameran seni rupa di SMP Negeri 2 Bantur antara lain: pihak sekolah menyediakan alokasi dana dan sarana prasarana penunjang. Faktor penghambat dalam pelaksanaan kegiatan pameran seni rupa di SMP Negeri 2 Bantur antara lain belum adanya ruang khusus dll. Dalam jangka panjang, sekolah hendaknya menyediakan ruangan khusus dan sarana prasarana untuk kegiatan pameran seni rupa di SMP Negeri 2 Bantur.

Studi tentang seni lukis karya Yon Wahyono tahun 2011-2012 / Baskara Ardhy Perkasa

 

Kata Kunci: Studi, SeniLukis, Yon Wahyuono Yon Wahyuonomerupakansalahsatupelukis senior di kota Malang yang sudahsangatberpengalaman. KaryaLukis Yon Wahyuonolebihbanyakmenggambarkanperasaandaridankeindahanalam, Sepertiempatkarya yang di telitidalampenelitianiniyaituDinamikaAlam 1, DinamikaAlam 3, DinamikaAlam 6 danDinamikaAlam 7. Lukisan Yon Wahyuonomemlikiperwujudanabstrakyang ekspresifdengangoresan yang tegasdanwarna yang sederhana. Masalah yang ditelitidalampenelitianiniadalahlatarbelakangkehidupan Yon Wahyuonosebagaifaktorgenetik.Selainitukaryalukis Yon WahyunoyaituDinamikaAlam 1(2011), DinamikaAlam 3 (2011), DinamikaAlam 6 (2012), danDinamikaAlam 7 (2012). Kemudianinterpretasipenelititerhadaplukisan Yon Wahyuono yang berjudulDinamikaAlam 1(2011), DinamikaAlam 3 (2011), DinamikaAlam 6 (2012), danDinamikaAlam 7 (2012). Serta hubunganantaralatarbelakankehidupan Yon Wahyuono, karyalukis Yon Wahyuonodaninterpretasipengamatterhadapkaryalukis Yon Wahyuono yang disebutsebagaisintesakritikholistik. Jenispenelitianiniadalahpenelitiankualitatifdenganpendekatankritikholistikdenganmetode, (a) pendekatandanjenispenelitian, (b) kehadiranpeneliti, (c) lokasipenelitian, (d) sumber data, (e) prosedurpengumpulan data, (f) analisis data, (g) pengecekankeabsahantemuan, (h) tahap-tahappenelitian. Sumber data dalampenelitianiniadalahseniman Yon Wahyuono, informanpendukung, data biografisenimandanfoto-fotodokumenpenulisuntukmemperolehinformasigenetiksubjektifdangenetikobjektif.Karyasenilukisuntukmemperolehinformasiobjektif, danpenelitiuntukmemperolehinformasiafektif.Prosedurpengumpulan data yang digunakanadalahobservasi, wawancaradandokumentasi. Sintesa yangdiperolehdarihasilpenelitianiniadalahnilai yang dalamketikamenghayatikeindahanalam, mengolah rasa dalamdirisebagaiungkapan rasa syukurpada Sang Pencipta.Sebuahkaryasenibukanhanyaindahsecara visual, namunjugaharusmemiliki ide dankeinginan yang tulusdaridalamhati.

Penerapan kolaborasi model pembelajaran Student Teams Achievement Divisions (STAD) dan mix pair share untuk meningkatkan motivasi dan hasil belajar siswa pada mata diklat kewirausahaan (studi pada siswa kelas XI-APK di SMK Tekstil Pandaan) / Fanti Kusuma Wardhani

 

Kata Kunci - Model Pembelajaran Student Teams Acheievement Divison (STAD), Mix Pair Share, Motivasi Belajar, Hasil Belajar Tujuan dari penelitian ini adalah untuk mengetahui: (1) penerapan kolaborasi model pembelajaran Student Teams Achievemnt Division (STAD) dan Mix Pair Share; (2) motivasi belajar siswa pada saat diterapkan model; (3) hasil belajar siswa setelah penerapan model; (4) hambatan-hambatan dan solusi pada saat penerapan model. Jenis penelitian ini adalah penelitian tindakan kelas atau PTK. Subjek penelitian ini adalah siswa kelas XI Program Keahlian Administrasi Perkantoran di SMK Tekstil Pandaan yang berjumlah 25 siswa. Pelaksanaan penelitian tindakan kelas ini dilakukan dua siklus yang terdiri dari empat tahap yaitu, menyusun rancangan tindakan, pelaksanaan tindakan, pengamatan, dan refleksi. Data penelitian dikumpulkan melalui observasi, wawancara, catatan lapangan, angket, dokumentasi, dan tes. Analisis data penelitian meliputi tiga hal: (1) reduksi data dimulai pada saat observasi sebelum membuat latar belakang penelitian, dilanjutkan saat pelaksanaan penelitian dan setelah penelitian dilakukan; (2) penyajian data dilakukan setelah melakukan pengamatan yaitu setelah melakukan observasi dan pada saat pelaksanaan penelitian; dan (3) penarikan kesimpulan dilakukan pada saat awal sampai akhir pelaksanaan penelitian. Hasil penelitian menunjukkan bahwa hasil data angket motivasi belajar siswa yang diberikan kepada siswa setelah penerapan model pembelajaran pada siklus I presentase rata-rata yang diperoleh adalah 65,53% sedangkan pada siklus II presentase rata-rata yang diperoleh adalah 69,3%. Peningkatan motivasi belajar siswa pada siklus I dan siklus II meningkat sebesar 3,77%. Nilai rata-rata hasil belajar siswa aspek afektif pada siklus I yaitu 66,07% sedangkan pada siklus II yaitu 79,46%, jadi peningkatan nilai rata-rata hasil belajar siswa pada aspek afektif adalah 13,39%. Sedangkan nilai hasil rata-rata belajar siswa aspek psikomotorik pada siklus I yaitu 60% pada siklus II yaitu 83,75%, jadi peningkatan nilai rta-rata hasil belajar siswa aspek psikomotorik adalah 23,75%. Beberapa saran yang dapat diberikan antara lain: (1) Bagi guru SMK Tekstil Pandaan, khususnya guru Mata Diklat Kewirausahaan, kolaborasi model pembelajaran Student Teams Achievement Divisions dan Mix Pair Share dapat dijadikan alternatif pilihan dalam kegiatan belajar mengajar dengan materi yang lebih menekankan pada kegiatan praktik, agar siswa mendapatkan kesempatan untuk aktif dan sekaligus melatih percaya diri siswa dalam mengemukakan pendapat; (2) Bagi siswa khususnya kelas XI Administrasi Perkantoran SMK Tekstil Pandaan sebaiknya siswa mempersiapkan diri dengan belajar dahulu sebelum pelajaran di mulai; dan (3) Bagi peneliti khususnya mahasiswa Universitas Negeri Malang, hasil penelitian dapat dijadikan bahan referensi.

Aplikasi analisis regresi komponen utama terhadap faktor-faktor yang mempengaruhi penyakit diabetes mellitus (studi kasus di Puskesmas Tempeh Kab. Lumajang) / Livia Arif Vita

 

Kata kunci: Diabetes Mellitus, analisis regresi linier berganda, multikolinearitas, regresi komponen utama. Diabetes atau kencing manis adalah penyakit yang ditandai dengan meningkatnya tingkat gula darah yang disebabkan oleh beberapa faktor, diantaranya usia, berat badan, tekanan darah sistolik, tekanan darah diastolik, kolesterol LDL, kolesterol HDL, asam urat, hemoglobin, dan denyut nadi. Pada penelitian ini akan dilakukan analisis untuk mengetahui model hubungan terbaik yang menggambarkan faktor-faktor yang berpengaruh signifikan terhadap penyakit Diabetes Mellitus. Faktor-faktor yang diamati dalam penelitian ini meliputi faktor usia (X_1), berat badan (X_2), tekanan darah sistolik (X_3), tekanan darah diastolik (X_4), kolesterol LDL (X_5), kolesterol HDL (X_6), asam urat (X_7), hemoglobin (X_8), dan denyut nadi (X_9). Dalam menganalisis faktor-faktor tersebut digunakan metode regresi berganda. Analisis regresi berganda adalah suatu metode untuk menyelidiki hubungan antara satu variabel terikat (kadar gula darah) dan beberapa variabel bebas (usia, berat badan, tekanan darah sistolik, tekanan darah diastolik, kolesterol LDL, kolesterol HDL, asam urat, hemoglobin, dan denyut nadi). Dari variabel - variabel bebas tersebut diidentifikasi adanya kasus multikolinearitas. Untuk mengatasi multikolinearitas maka digunakan analisis regresi komponen utama. Regresi komponen utama manghasilkan variabel-variabel bebas baru yang tak saling berkorelasi sehingga dapat mengatasi kasus multikolinearitas. Dengan analsis regresi komponen utama diperoleh persamaan regresi sebagai berikut: Jadi, penyebab penyakit Diabetes Mellitus mampu disebabkan oleh faktor usia, berat badan, tekanan darah sistolik, tekanan darah diastolik, kolesterol LDL, kolesterol HDL, asam urat, hemoglobin, dan denyut nadi sebesar 79,2%.

Menghitung bilangan dominasi pada graph grid n x n, n < 7 / Mucharomatut Toyyibah

 

Kata kunci : graph grid, himpunan pendominasi, bilangan dominasi, algoritma BFS (breadth-first search), algoritma pemrograman dinamis. Salah satu topik yang dibahas dalam teori graph ialah himpunan pendominasi (dominating set). Himpunan pendominasi ialah suatu himpunan bagian S dari himpunan titik V(G) dimana titik-titik yang tidak berada pada S terhubung langsung dengan minimal satu titik pada S. Ukuran dari himpunan pendominasi terkecil disebut bilangan dominasi. Bilangan dominasi pada graph G dinotasikan dengan γ(G) dan bilangan dominasi pada graph grid G_(n×n) dinotasikan dengan γ_(n,n) Banyak sekali manfaat penggunaan himpunan pendominasi dan bilangan dominasi dalam kehidupan sehari-hari diantaranya untuk menentukan rute bus sekolah, menentukan posisi stasiun radio, survey lahan, dan sistem jaringan komputer. Oleh karena itu studi mengenai bilangan dominasi telah berkembang sejak lama. Banyak usaha-usaha yang telah dilakukan dalam menentukan himpunan pendominasi dan bilangan dominasi untuk memecahkan permasalahan dalam kehidupan. Salah satu metode dalam menetukan bilangan dominasi pada graph grid ialah dengan pendekatan bilangan kromatik sampai ditemukan suatu rumus umum untuk bentuk graph grid tertentu. Selain dengan rumus umum bilangan dominsi dapat dicari melalui algoritma pencarian. Dengan menggunakan algoritma BFS (breadth-first search) dengan ciri khas algoritma pemrograman dinamis diperoleh bahwa γ_1,1=1; γ_2,2=2; γ_3,3=3; γ_4,4=4; γ_5,5=7; γ_6,6=10; γ_7,7=12; dengan diberikan salah satu contoh himpunan pendominasi minimum untuk masing-masing ukuran. Baik perhitungan dari Chang, Clark, dan Hare (1995) dan algoritma pencarian diperoleh hasil yang sama untuk masing-masing ukuran.

Kritik holistik terhadap tiga lukisan Dlamet Hendro Kusumo tahun 2009 / Punjung Samudro

 

Kata Kunci: Lukisan, Kritik Holistik, SlametHendroKusumo Kreativitas merupakan suatu hal yang penting dimiliki oleh pribadi seorang seniman. Seorang seniman yang kreatif akan mampu untuk selalu mengolah ide, gagasan, dan tekniknya dalam menciptakan suatu karya seni.Lewat sebuah karya seni, seniman dapatmengkomunikasikan segala kegelisahannya dengan orang lain. Slamet Hendro Kusumo adalah seorang pelukis yang berasal dari kota Batu. Kehidupannya berasal dari sebuah keluarga yang kurang mampu, dan sejak kecil hidup di lingkungan masyarakat yang memiliki tingkat perekonomian di bawah rata-rata. Duniapolitikjugasempatbeliauterjunidanmenjadisalahsatuinspirasi yang turutmewarnaikaryalukisnya.Karya lukis Slamet Hendro Kusumo tahun 2009 lebih mengarah pada tema-tema kritik sosial yang terjadi pada masyarakat, seperti dalam tiga lukisan yang dikaji dalam penelitian ini yang berjudul Museum, Is Me, dan Democracy zero.Ketiga karya yang diteliti tersebut diciptakan untuk menggambarkan kecarut-marutan dan berbagai permasalahan sosial yang sering terjadi di Negara Indonesia, khususnya di kota Batu. Masalah yang diteliti dalam penelitian ini adalah latar belakang kehidupan Slamet Hendro Kusumo.Karya lukis Slamet Hendro Kusumo yang berjudul Museum, Is Me, dan Democracy zero. Disamping itu juga interpretasi terhadap karya lukis Slamet Hendro Kusumo yang berjudul Museum, Is Me, dan Democracy zero. Serta hubungan latar belakang kehidupan Slamet Hendro Kusumo, karya lukis dan interpretasi terhadap karya lukis Slamet Hendro Kusumo. Jenis penelitian ini adalah penelitian kualitatif dengan pendekatan kritik Holistik. Sedangkan metode yang digunakan adalah (a) pendekatan dan jenis penelitian, (b) kehadiran peneliti, (c) lokasi penelitian, (d) sumber data, (e) prosedur pengumpulan data, (f) analisis data, (g) pengecekan keabsahan temuan, (h) tahap-tahap penelitian. Sumber data dalam penelitian ini adalah seniman bernama Slamet Hendro Kusumo, informan pendukung, katalogpameran lukis, dan dokumentasi foto-foto untuk memperoleh informasi genetik subjektif dan genetik objektif. Karya seni lukis untuk memperoleh informasi objektif. Selain itu, peneliti untuk memperoleh informasi afektif. Prosedur pengumpulan data yang digunakan adalah observasi, wawancara dan dokumentasi. Sintesa yang dapatdiperolehdarihasilpenelitianiniyaitunilaikecintaan terhadap lingkungan, nilai perjuangan pada pada seorang petani, nilai adat-istiadat yang saat ini mulai luntur, dannilai keTuhanan yang saat ini kurang untuk dipegang teguh pada diri manusiadalammenjalankansegalaaktivitas.

Penerapan metode regresi new strpwise untuk mengetahui faktor-faktor yang mempengaruhi kekuatan metallic box (studi kasus di PT. Pindad (Persero) Turen) / Nisa Hidayatul Ilmi

 

Kata kunci: Metallic Box, kekuatan, regresi New Stepwise. Metallic Box adalah suatu kotak berwarna putih keperakan yang terbuat dari Baja St 37 yaitu campuran Besi, Mangan, Nikel, Silikon serta Karbon. Metallic Box merupakan salah satu produk yang penting bagi PT. PINDAD (Persero) karena Metallic Box digunakan untuk mengemas produk-produk lain yang dihasilkan PT. PINDAD (Persero).Standar khusus yang diberikan PT. PINDAD (Persero) terhadap kualitas metallic box yang dihasilkan harus memiliki kekuatan yang baik dalam menahan benturan. Oleh karena itu pengujian kekuatan metallic box perlu dilakukan dengan melihat nilai kekerasan bahan material metallic box. Kekuatan pada metallic box dipengaruhi oleh unsur-unsur yang terkandung didalamnya. Dengan mengetahui unsur-unsur yang memiliki pengaruh dominan terhadap kekuatan metallic box diharapkan dapat meningkatkan kualitas metallic box yang dihasilkan PT. PINDAD (Persero). Tujuan dari penelitian ini adalah untuk menentukan model regresi New Stepwise terbaik yang menggambarkan faktor-faktor yang berpengaruh secara signifikan terhadap kekuatan Metallic Box.Faktor-faktor yang diamati dalam penelitian ini meliputi Kandungan Besi (〖 X〗_1), Kandungan Karbon (〖 X〗_2), Kandungan Mangan (X_3), Kandungan nikel (X_4), dan Kandungan Silikon (X_5). Hasil perhitungan model regresi linier berganda terhadap X_1,X_2,X_3,X_4dan X_5 menunjukkan terjadi multikolinearitas. Oleh karena itu digunakan metode regresi New Stepwise untuk mengatasi kasus multikolinearitas tersebut. Metode regresi New Stepwise merupakan pengembangan dari metode regresi komponen utama yang dikombinasikan dengan metode stepwise. Dari hasil analisis data,diperolehmodel regresiY = - 155 + 2,02 X_1 + 9,51 X_3 dengan nilai R-sq sebesar 64,7%. Berdasarkan model tersebut, diketahui setiap penambahan kandungan besi sebesar satu satuan akan meningkatkan kekuatan metallic box sebesar 2,02 HRB dan setiap penambahan kandungan mangan sebesar satu satuanakan meningkatkan kekuatan metallic box sebesar 9,51 HRB. Jadi, faktor yang mempengaruhi kekuatan metallic box adalah kandungan besi dan mangan. Variabel-variabel tersebut secara serentak memberikan kontribusi sebesar 64,7% terhadap kekuatan Metallic Box sedangkan sisanya sebesar 35,3% dipengaruhi oleh variabel lainnya.

Studi desain kerajinan kain perca pelangi craft di Singosari Malang / Larasti Putri

 

Kata Kunci: Desain, Kerajinan, Kain Perca, Pelangi Craft, Singosari, Malang. Kerajinan kain perca sudah sangat terkenal di Indonesia banyak pengrajin yang menciptakan produk dari bahan kain perca ini. Di Malang sendiri ada beberapa rumah produksi yang mengolah kain perca menjadi produk yang bernilai jual, salah satunya adalah Pelangi Craft yang terletak di Singosari Malang. Penelitian ini dilaksanakan dengan tujuan untuk mendeskripsikan proses perencanaan, alat dan bahan yang digunakan, proses pembuatan, dan hasil desain produk kerajinan kain perca di Pelangi Craft. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Sumber data diperoleh dari narasumber pemilik Pelangi Craft, benda dan beragam gambar produk kerajinan kain perca, serta dokumen dan arsip yang berkaitan. Pengumpulan data diperoleh dari hasil observasi dan wawancara kepada Ir. E. Noor Suryanti dan karyawan Pelangi Craft. Teknis analisis data dimulai dari reduksi data, kemudian disajikan pada tahap sajian data. Selanjutnya ditarik kesimpulan dan verifikasi. Pengecekan keabsahan dari temuan yang telah diperoleh dimulai dari trianggulasi data, trianggulasi metode, dan trianggulasi teori. Berdasarkan analisis diperoleh empat simpulan hasil penelitian. Pertama mengenai proses perancanaan desain, bahwa dalam perencanaannya dimulai dari menentukan bentuk, ukuran, desain pola, biayas, alat dan bahan, serta fungsi kegunaan produk. Kedua tentang alat dan bahan yang digunakan, bahwa alat yang digunakan berupa alat khusus yaitu mesin jahit dan alat dasar berupa alat-alat pendukung yang digunakan dalam proses pembuatannya. Sedangkan bahan yang digunakan berupa bahan utama kain perca dan kain yang digunakan dalam proses pengaplikasiannya. Sedangkan bahan pendukungnya adalah bahan yang melengkapi dalam proses finishing produknya. Ketiga yaitu proses pembuatan bahwa dalam proses pembuatannya melalui tiga tahapan, yaitu tahap awal, tahap inti, dan tahap akhir. Dalam proses pembuatannya menggunakan teknik jahit perca yang berbeda-beda menyesuaikan dengan pola yang dipakai. Keempat mengenai hasil produk bahwa produk yang dihasilkan dipengaruhi oleh unsur-unsur desain yang melengkapi keestetikaan produk yang dihasilkan. Selain unsur desain masih ada faktor-faktor desain yang mempengaruhi hasil desain produknya, yaitu faktor performansi, faktor fungsi, faktor produksi, faktor pemasaran, dan faktor kepentingan produsen. Kemudian yang terakir dipengaruhi nilai-nilai produk, yaitu ada nilai ekonomi dan nilai fungsi kerajinan.

Peramalan nilai harga saham dan perhitungan Value at Risk (VaR) dengan menggunakan Garch-M / Kartika Arisadewi

 

Kata kunci: Peramalan, GARCH-M, Value at Risk, Harga saham Transaksi jual-beli saham biasanya mempertimbangkan tingkat pengembalian (return) dan risiko (risk) dalam berinvestasi. Dengan tingkat pengembalian diasumsikan sebagai mean dan risiko diasumsikan sebagai volatilitas dari harga saham. Model GARCH in mean (GARCH-M) merupakan perkembangan dari model GARCH telah dikembangkan oleh Engle, Lilien, dan Robins pada tahun 1987. Model ini menjelaskan bahwa tingkat pengembalian (return) dari suatu harga saham mungkin tergantung pada risiko (risk), karena dengan risiko yang lebih tinggi akan memberikan return yang lebih tinggi juga pada rata-ratanya. Volatilitas merupakan ukuran penyebaran besarnya perubahan harga suatu saham keuangan dan tidak menginformasikan tentang jumlah kerugian. Oleh karena itu, salah satu alat untuk mengukur jumlah kerugian tersebut adalah Value at Risk (VaR). Jenis penelitian ini adalah kuantitatif dengan tujuan menentukan model GARCH-M yang paling sesuai, menentukan hasil peramalan nilai return harga saham, dan menentukan hasil perhitungan VaR. Dengan data yang digunakan dalam penelitian ini adalah data return harga saham PT. Bank Negara Indonesia (PERSERO) Tbk. dalam kurun waktu bulan Januari 2007 sampai bulan Februari 2013. Hasil penelitian ini diperoleh model GARCH(0,1)-M yaitu: y_t=-0,022701+0,415870σ_t+0,177738ε_(t-1)+ε_t σ_t^2=0,000521+〖0,204787ε〗_(t-1)^2+0,785480σ_(t-1)^2. Hasil peramalan nilai return harga saham untuk periode bulan Maret 2013 sebesar -0,0098461, sedangkan hasil peramalan nilai harga sahamnya sebesar 4208. Hal ini berarti bahwa pada bulan Maret 2013 kemungkinan terjadi penurunan. Dan jika diasumsikan investasi dana sebesar Rp150.000.000,00 dengan peluang tingkat kerugian sebesar 5%, maka diperoleh Value at Risk (VaR) sebesar Rp14.524.989,54. Hal ini berarti kemungkinan kerugian yang terjadi pada bulan Maret 2013 lebih rendah dibandingkan bulan sebelumnya. Berdasarkan penelitian ini, dapat disarankan agar dilakukan penelitian lebih lanjut untuk membandingkan metode GARCH-M dengan metode lain seperti metode EGARCH-M atau APARCH-M dengan harapan diperoleh model yang sesuai.

Analisis proses dan hasil menggambar bentuk siswa kelas VIII E SMP Negeri 2 Lamongan / Yollanda Karin Garcinia

 

Kata Kunci, Kelemahan, Proses dan Hasil, Menggambar Bentuk Siswa. Proses dan hasil menggambar bentuk yang mempertimbangankan prinsip-prinsip seni akan menghasilkan suatu gambar yang sesuai dengan yang dilihat atau diamati. Hal tersebut menggambarkan bahwa menggambar bentuk bukanlah menggambar biasa atau hanya sekedar latihan keterampilan menggambar tanpa di landasi oleh teori. Berdasarkan penelitian sebelumnya yang berjudul “Hubungan Antara Minat, Aktivitas Belajar Seni Budaya dengan Hasil Gambar Bentuk Siswa Kelas VIII di SMP Negeri 1 Pakel Kab. Tulungagung” diperoleh gambaran bahwa terdapat minat siswa yang kurang dalam pembelajaran menggambar bentuk. Penelitian ini dimaksudkan untuk mengetahui kelemahan proses dan kelemahan hasil menggambar bentuk siswa kelas VIII. Hal ini dimaksudkan untuk mengetahui kelemahan dari siswa dan peluang memperbaiki pembelajaran gambar bentuk, baik oleh guru di sekolah maupun siswa itu sendiri. Penelitian ini menggunak an pendekatan deskriptif kualitatif, dimana data-data yang diperoleh melalui observasi, dokumentasi dan wawancara akan dianalisis bersama. Objek utama penelitian adalah siswa-siswi SMP Negeri 2 Lamongan. Analisis data yang dilakukan melalui reduksi data, sajian data, penarikan simpulan dan verifikasi. Untuk pengecekan keabsahan temuan melalui trianggulasi data. Tahap penelitian yang dilakukan adalah persiapan, tahap penelitian dan penyusunan laporan. Berdasarkan data yang dikumpulkan, diperoleh temuan penelitian sebagai berikut: kelemahan proses pada saat pembelajaran gambar bentuk siswa kelas VIII adalah saat memilih sudut pandang kebanyakan siswa selalu berjalan ke depan kelas tanpa membawa kertas gambarnya ditunjukan dengan semua gambar siswa sama padahal posisi duduk mereka berbeda. Pada saat membagi bidang gambar kelemahan siswa terlihat pada memulai membagai langsung dari tengah. Pada saat membagan kelemahannya terdapat pada pemakaian pensil yang langsung dengan pensil tebal. Kelemahan pada hasil gambar bentuk siswa kelas VIII ditunjukkan dari beberapa aspek yaitu ketepatan bentuk pada hasil gambar siswa kebanyakan masih kurang mirip dengan objek gambar, proporsinya masih tidak sesuai perbandingan ukuran yang benar, komposisi yang tidak disusun sendiri melainkan disusun oleh gurunya sendiri, dan yang terakhir dalam teknik arsir yang digunakan oleh siswa kebanyakan teknik arsir serta teknik arsir dusel kelemahannya terdapat pada garis-garis arsir yang masih tampak meskipun sudah didusel. Dari kesimpulan kelemahan-kelemahan dalam proses dan hasil menggambar bentuk yang ditulis peneliti, maka terdapat beberapa saran untuk siswa maupun guru seni budaya untuk memperbaiki pembelajaran gambar bentuk, baik oleh guru di sekolah maupun siswa itu sendiri.

Peramalan data nilai ekspor non migas Indonesia ke wilayah ASEAN menggunakan model Egarch / Adi Santo Prasetyo

 

Kata kunci: nilai ekspor non migas Indonesia, ASEAN, model EGARCH Indonesia merupakan salah satu negara pengekspor terbesar di dunia, khususnya di wilayah Asia. Salah satu hasil ekspor Indonesia adalah ekspor non migas seperti hasil perkebunan, hasil pertanian, hasil peternakan dan lain-lain. Beberapa negara yang menjadi tujuan ekspor non-migas Indonesia adalah negara-negara ASEAN. Sebagai langkah awal untuk menentukan kebijakan dalam mempertahankan atau meningkatkan hasil ekspor non-migas Indonesia ke wilayah ASEAN, maka diperlukan beberapa prediksi nilai hasil ekspor non-migas Indonesia ke wilayah ASEAN untuk periode berikutnya. Untuk itu diperlukan suatu metode yang tepat digunakan dalam mengatasi hal tersebut. Metode yang digunakan adalah metode deret waktu. Dalam hal ini akan digunakan proses EGARCH untuk mencari model terbaik dan menentukan hasil peramalan nilai ekspor non-migas Indonesia ke wilayah ASEAN untuk periode berikutnya. Metode EGARCH merupakan metode yang dikembangkan oleh Nelson (1991) .Metode ini merupakan pengembangan dari metode GARCH. Kelebihan dari model EGARCH yaitu model ini mampu mengatasi varian yang tidak konstan. Selain itu, metode ini juga bisa diterapkan untuk mengatasi adanya pengaruh asimetrik pada data, yaitu data yang memiliki nilai cross correlation antara residual kuadrat dan lag galatnya signifikan. Sedangkan metode GARCH tidak bisa diterapkan untuk data asimetrik. Dalam menentukan model EGARCH, harus dilakukan beberapa uji parameter dan dilanjutkan dengan uji kenormalan residual. Setelah memenuhi uji tersebut, diperoleh model EGARCH terbaik dan selanjutnya dilakukan peramalan. Pada penelitian ini digunakan pendekatan kuantitatif dengan menggunakan data nilai ekspor non-migas Indonesia terhadap ASEAN pada bulan Januari 2007 sampai bulan oktober 2012 dengan banyak pengamatan adalah 70. Dari hasil penelitian diperoleh bahwa model EGARCH(1,1) adalah model yang memenuhi uji asumsi dan parameter. Pada model ini diperoleh persamaan varian sebagai berikut: ln(σ_t^2)=36,68099+1,074250 |e_(t-1) |-0,530456ln(〖σ_(t-1)〗^2 ). Untuk meramalkan nilai ekspor non-migas Indonesia ke wilayah ASEAN pada periode selanjutnya digunakan rumus Z_t=(1-ρ)δ+(1+ρ) Z_(t-1)-ρZ_(t-2)+θε_(t-1) dengan AR(1) = ρ = 0.919570, MA(1) = θ = -0.448246, C = δ = 2159288. Model EGARCH (1,1) menunjukkan bahwa hasil peramalan dari model ini memiliki persentase kesalahan yang relatif kecil. Hal ini mengindikasikan bahwa model EGARCH(1,1) adalah model yang baik diterapkan dalam meramalkan nilai ekspor non-migas Indonesia ke wilayah ASEAN untuk periode selanjutnya.

Peramalan nilai ekspor dan nilai impor Indonesia ke Jepang menggunakan model Varima / Desi Yulvia Pradini

 

Kata Kunci : Vektor Autoreggressive Integrated Moving Average, Peramalan, Ekspor, Impor. Medel Vector Autoregressive Integrated Moving Average (VARIMA) adalah salah satu model analisis deret waktu yang melibatkan data deret waktu multivariat. Model VARIMA ini adalah pengembangan dari model ARIMA yang merupakan suatu metode yang digunakan untuk menganalisis data deret waktu univariat. Model VARIMA merupakan bentuk vektor dari model ARIMA. Sehingga dalam aplikasinya diperlukan data-data yang telah stasioner sebelum menganalisis lebih lanjut. Model VARIMA memiliki kelebihan antara lain yaitu mudah untuk diterapkan dalam jenis data multivariat dan hasil peramalan dengan menggunakan model VARIMA memiliki pendekatan yang sesuai dengan data asli pada periode sebelumnya. Penulisan skripsi ini bertujuan untuk mempelajari Model VARIMA serta membentuk dan menerapkan suatu Model VARIMA pada peramalan nilai ekspor Indonesia ke Jepang dan nilai impor Indonesia ke Jepang. Model yang sesuai untuk peramalan nilai ekspor Indonesia ke Jepang, dan nilai impor Indonesia ke Jepang yaitu Model VARIMA (3,1,1) dengan persamaan X_(1,t)=〖1,0001X〗_(1,t-1)-〖0,0001X〗_(1,t-2)+a_(1,t)+0,0001a_(1,t-1)+0,0001a_(2,t-1) X_(2,t)=〖-1,0001X〗_(1,t-1)+〖0,0001X〗_(1,t-2)+1,0001X_(2,t-1)-0,0001X_(2,t-2)+a_(2,t)+0,0001a_(1,t-1) dengan X_(1,t) adalah nilai ekspor Indonesia ke Jepang pada periode ke t, X_(2,t) adalah nilai impor Indonesia ke Jepang pada periode ke t, a_(1,t) merupakan nilai residual ekspor pada periode ke t, serta a_(2,t) adalah nilai residual impor pada periode t. Dari model tersebut dapat diperoleh hasil peramalan untuk nilai ekspor Indonesia ke Jepang dan nilai impor Indonesia ke Jepang untuk beberapa periode ke depan. Hasil peramalan ini diharapkan bisa menjadi dasar untuk pengambilan kebijakan berikutnya untuk meningkatkan nilai ekspor Indonesia terutama ke Jepang, dan mengurangi nilai impor Indonesia terutama ke Jepang.

Perancangan website Araya Golf and Family Club Malang sebagai media promosi / Moh. Cholisatur Rizaq

 

Kata Kunci : perancangan, website, Araya Golf and Family Club, media promosi. Araya Golf and Family Club merupakan perusahaan penyedia fasilitas golf, sport center, dan restaurant. Dalam hal promosi Araya Golf and Family Club dirasa kurang. Masyarakat hanya mengetahui melalui mulut ke mulut. Informasi tentang Araya Golf and Family Club juga sangat sedikit. Oleh karena itu dirancang suatu media promosi berupa website dengan tujuan untuk mempromosikan Araya Golf and Family Club serta menjadi wadah informasi agar masyarakat dapat dengan mudah mendapatkan informasi mengenai fasilitas Araya Golf and Family Club. Website adalah salah satu media promosi. Keunggulan website yaitu dapat diakses dimanapun dan kapanpun juga selama terhubung dengan internet, website juga bisa mencakup target pasar yang luas. Selain sebagai media promosi, website juga digunakan sebagi salah satu wadah informasi dan customer care. Tipe desain website yang digunakan yaitu static design dengan fixed layout, repetitive layout, dan dominative layout untuk mempermudah pengunjung dalam mengakses website. Perancangan website Araya Golf and Family Club ini menggunakan metode prosedural yang bersifat deskriptif. Pengumpulan data melalui metode (1) pustaka (2) wawancara (3) observasi. Analisis data menggunakan metode penelitian kualitatif deskriptif dan memperhatikan teori tentang website, perancang membuat sebuah media promosi yang berbentuk website untuk mempromosikan fasilitas yang disediakan Araya Golf and Family Club. Hasil perancangan berupa media website ini memuat informasi mengenai fasilitas yang tediri dari 3 kategori, yaitu Araya Golf, Araya Family Club, dan Taman Indie Restaurant. Media website bagi Araya Golf and Family Club bisa menjadi media promosi untuk menarik minat masyarakat dan memberi kemudahan bagi masyarakat dalam mencari informasi mengenai fasilitas di Araya Golf and Family Club.  

Penerapan model pembelajaran quantum teaching untuk meningkatkan motivasi dan hasil belajar siswa kelas VIII-H SMP Negeri 17 Malang pada materi garis singgung lingkaran / Matin Enggar Putri

 

Kata Kunci : Quantum Teaching, motivasi, hasil belajar siswa Berdasarkan hasil observasi dan wawancara dengan guru Matematika Kelas VIII di SMP Negeri 17 Malang diperoleh bahwa motivasi belajar siswa selama mengikuti proses pembelajaran masih kurang, hal ini dapat dilihat dari konsentrasi siswa yang mudah terpecah dikarenakan siswa cepat merasa bosan. Selain itu, Pembelajaran selama ini terutama materi garis singgung lingkaran masih menggunakan metode konvensional. Hal ini mengakibatkan siswa cenderung menghafal rumus untuk menentukan panjang garis singgung lingkaran. Penelitian ini dilaksanakan di SMP Negeri 17 Malang, dengan subjek siswa kelas VIII-H tahun ajaran 2012/2013 yang berjumlah 31 siswa. Jenis penelitian ini termasuk Penelitian Tindakan Kelas. Dalam penelitian ini mendeskripsikan langkah-langkah penerapan model pembelajaran Quantum Teaching yang dapat meningkatkan motivasi dan hasil belajar siswa pada materi garis singgung lingkaran. Hasil penelitian menunjukkan bahwa langkah-langkah model pembelajaran Quantum Teaching yang dapat meningkatkan motivasi dan hasil belajar siswa yaitu: (1) Tumbuhkan, guru memberikan pertanyaan-pertanyaan singkat yang berhubungan dengan materi yang akan dipelajari dengan bantuan media, (2) Alami, guru membimbing siswa memperoleh suatu konsep melalui LKS yang diberikan, (3) Namai, siswa berdiskusi untuk menyelesaikan LKS dan melalui LKS siswa akan memperoleh konsep yang akan dipelajari (4) Demonstrasikan, siswa diberi kesempatan untuk mempresentasikan hasil diskusinya, (5) Ulangi, siswa mengulangi konsep yang telah dipelajari dengan pengerjaan soal dengan media permainan, (6) Rayakan, guru memberikan penghargaan berupa tepuk tangan, poin atau hadiah kepada siswa yang aktif dalam pembelajaran. Berdasarkan hasil analisis data menunjukkan skor motivasi siswa siklus I rata-rata 2,78 termasuk dalam taraf keberhasilan cukup baik dan pada siklus II dengan skor hasil motivasi belajar siswa sebesar 3,41 termasuk dalam kategori sangat baik. Sedangkan hasil belajar siswa pada siklus I menunjukkan persentase keberhasilan sebesar 56,67% dari keseluruhan siswa. Hasil belajar pada siklus II mempunyai persentase keberhasilan 80% dari keseluruhan siswa. Berdasarkan hasil penelitian tersebut diperoleh bahwa penerapan model pembelajaran Quantum Teaching dapat meningkatkan motivasi dan hasil belajar siswa kelas VIII-H SMP Negeri 17 Malang pada materi garis singgung lingkaran.

Perancangan booklet Augmented Reality sebagai media publikasi Jurusan Seni dan Desain Fakultas sastra Universitas Negeri Malang / Ferry Irawan

 

Kata Kunci : Perancangan, Booklet, Augmented Reality, Publikasi, Seni dan Desain. Sebagai lembaga tinggi yang lahir untuk menanggulangi masalah tenaga pendidikan maupun non-pendidikan Jurusan Seni dan Desain Fakultas Sastra Universitas Negeri Malang tentunya masih memerlukan media publikasi untuk lebih mengenalkan kepada masyarakat secara lebih luas, untuk tetap menanamkan image/ branding ke khalayak masyarakat sebagai jurusan yang dapat menghasilkan tenaga pendidikan dan non kependidikan trampil dibidang Seni dan Desain. Untuk memecahkan permasalahan tersebut dilakukan perancangan media publikasi Jurusan Seni dan Desain yang efektif dan informatif serta mudah diakses. Tujuan dari perancangan ini adalah menghasilkan media publikasi bagi Jurusan Seni dan Desain untuk lebih dikenal dan menjaring mahasiswa baru.Metode perancangan yang digunakan adalah model perancangan prosedural, yaitu bersifat deskriptif. Adapun proses perancangan media publikasi ini tersusun dalam pencarian data dengan melakukan observasi, wawancara, angket dan dokumentasi. Teknis perancangan meliputi pra produksi dengan melakukan perancangan media booklet pada Adobe InDesign, produksi dengan melakukan perancangan media augmented reality pada Unity3D dan vuforia SDK serta tahap ketiga yaitu judgment program yaitu dengan melakukan verifikasi dan tingkat akurasi software augmented realitypada android smartphone. Pesan yang ingin disampaikan melalui media publikasi booklet augmented reality ini yaitu menginformasikan Jurusan Seni dan Desain mulai dari visi dan misi, sejarah, program studi, hasil karya mahasiswasajian matakuliah serta jenjang karir;bahwa Jurusan Seni dan Desain sebagai jurusan yang dapat menghasilkan tenaga pendidikan dan non kependidikan trampil dibidang Seni dan DesainHasil perancangan utama media publikasi ini yaitu media booklet dan software augmented reality android, sedangkan media pendukung perancangan yaitu berupa ebook, multimedia interaktif, TVC, video tutorial, dan aplikasi augmented reality untuk windows. Kekuatan dari media booklet augmented reality yaitu mampu menyampaikan informasi yang tidak dapat disampaikan dengan menggunakan gambar yaitu dengan visualisasi 3D, audio-video narasi, portable dan mudah diakses.

Perancangan corporate identity dan aplikasinya bagi objek wisata Ranu Klakah di Kabupaten Lumajang / Gigih Prihandono

 

Kata Kunci : Corporate Identity, Wisata Ranu Klakah, Kabupaten Lumajang Ranu Klakah adalah wisata alam berupa danau yang terletak di Kabupaten Lumajang Jawa timur, tepatnya di Desa Tegalrandu Kecamatan Klakah. Wisata ini memiliki potensi alam yang indah, infrastruktur jalan yang bagus, mudah dijangkau, dan memiliki fasilitas serta sarana yang lengkap. Fasilitas tersebut meliputi pengingapan, sarana olahraga futsal, pemancingan, sepeda air, motor ski, taman bermain, dan pelelangan ikan. Namun Wisata ini kurang memiliki karakter dan citra positif di mata masyarakat, sehingga kurang begitu dikenal dan diminati oleh masyarakat Lumajang. Dari permasalahan tersebut, diperlukan sebuah perancangan Corporate Identity dan aplikasinya sebagai media promosi. Tujuannya yaitu untuk mendeskripsikan perancangan logo, bagaimana menghasilkan sebuah perancangan Corporate Identity yang efektif dan komunikatif beserta dengan aplikasinya sebagai upaya untuk membangun citra Wisata Ranu Klakah, sehingga dapat meningkatkan kunjungan wisata. Perancangan Corporate Identity ini menggunakan prosedur deskriptif. Prosedural penyusunan yang digunakan adalah menggunakan prosedur Sanyoto dan Rustan yang telah dimodifikasi sesuai dengan kebutuhan. Teknik pengumpulan data menggunakan metode observasi, wawancara dan studi dokumentasi. Setelah itu data diidentifikasi dan dianalisis menggunakan analisis deskriptif kualitatif yang dijadikan dasar dalam konsep perancangan selanjutnya.

Analisis semiotika visual desain katakter videogame ragnarok online / Adam Subiantoro Muhsinin

 

Kata Kunci: Penelitian, Analisis, Semiotika, Visual, Videogame, Online, Karakter, Ragnarok, Seni dan Desain. Ragnarok Online merupakan videogame online yang berasal dari Korea. Videogame online ini paling digemari oleh pemain-pemain game di Indonesia pada tahun 2003 sampai sekitar tahun 2005. Ragnarok menjadi populer di kalangan pemain-pemain game Indonesia adalah dari gaya ilustrasinya yang berupa ilustrasi Anime, atau kartun gaya Jepang yang memang sangat digemari oleh anak-anak muda di Indonesia. Dalam videogame tersebut terdapat sistem klasifikasi karakter yang yang cukup kompleks namun tetap menarik, masing-masing karakter memiliki kelebihan dan kelemahan di bidangnya masing-masing, serta kostum-kostumnya pun unik. Kostum yang unik itu juga dapat mewakili sifat-sifat masing-masing karakter, karena secara kostum-kostum karakter tersebut sudah didesain secara semiotika seperti itu. Teori yang dipakai untuk menganalisis desain-desain klasifikasi karakter tersebut adalah teori semiotika visual Roland Barthes. Teorinya yang dipilih adalah teori lima kode pembacaan makna di balik tanda yang terdiri dari kode hermeneutik, kode proairetik, kode simbolik, kode semik dan kode kebudayaan. Karakter-karakter tersebut dipisah-pisah berdasarkan leksianya yang berupa potongan-potongan visualisasi kostum masing-masing karakter, kemudian dianalisis berdasarkan lima kode pembacaan makna di balik tanda tersebut. Pada bagian pembahasan, karakter yang sudah dianalisis berdasarkan lima kode pembacaan makna di balik tanda tersebut di kelompokkan berdasarkan kelebihan utamanya yaitu kekuatan, kelincahan dan kecerdasan, kemudian dihubungkan antara kelebihannya tersebut dengan kostum yang dipakainya.

Persepsi guru pamong terhadap kompetensi profesional mahasiswa PPL Jurusan Sejarah Universitas Negeri Malang semester gasal tahun ajaran 2012/2013 di SMA se Kota Malang / Bayu Mulya Putra

 

Kata kunci: Persepsi, Guru Pamong, Kompetensi Mahasiswa PPL Universitas Negeri Malang (UM) merupakan salah satu perguruan tinggi yang mempunyai banyak program studi (Prodi) yang menyelenggarakan pendidikan bagi calon pendidik. Aplikasi Prodi pendidikan tersebut salah satunya ialah dengan mempersiapkan mata kuliah Praktik Pengalaman Lapangan (PPL). Kegiatan PPL tersebut dilaksanakan pada setiap awal semester. PPL ditujukan untuk pembentukan guru atau tenaga pendidik yang profesional melalui kegiatan pelatihan di sekolah. Dalam kurun waktu terakhir ini beberapa Guru Pamong mengeluhkan tentang kompetensi maupun kinerja mahasiswa PPL Jurusan Sejarah. Berkaitan dengan itu, maka diperlukan pengkajian mengenai kompetensi mahasiswa PPL Jurusan Sejarah yang dilihat dari persepsi Guru Pamong. Penelitan ini bertujuan untuk mendeskripsikan (1) persepsi guru pamong terhadap kompetensi profesional mahasiswa PPL Jurusan Sejarah pada perencanaan pembelajaran, (2) persepsi guru pamong terhadap kompetensi profesional mahasiswa PPL Jurusan Sejarah pada pelaksanaan pembelajaran, (3) persepsi guru pamong terhadap kompetensi profesional mahasiswa PPL Jurusan Sejarah pada evaluasi hasil pembelajaran. Penelitian ini menggunakan pendekatan kualitatif dengan jenis penelitian deskriptif. Data penelitian ini berupa kata-kata tertulis atau lisan. Pengumpulan data dilakukan dengan teknik wawancara dan dokumentasi. Instrumen yang digunakan untuk mengumpulkan data berupa instrumen manusia, yaitu peneliti sendiri dibantu dengan pendapat para ahli dan dokumentasi penelitian. Untuk menjaga keabsahan data, dilakukan triangulasi data dengan sumber, metode, dan pengecekan anggota (member check). Kegiatan analisis data dimulai dari tahap mereduksi data, penyajian data, dan tahap verifikasi data atau kesimpulannya. Hasil penelitian menunjukkan bahwa persepsi Guru Pamong terhadap perencanaan pembelajaran yang dibuat oleh mahasiswa Jurusan Sejarah cukup baik. komponen dalam perencanaan pembelajaran sudah dicantumkan semua. Substansi yang tercantum dalam perencanaan pembelajaran harus lebih dipahami mahasiswa PPL Jurusan Sejarah untuk dapat menghasilkan perencanaan pembelajaran yang baik. Persepsi Guru Pamong terhadap proses pembelajaran yang sudah dilakukan oleh mahasiswa PPL Jurusan Sejarah kurang baik, terlihat beberapa mahasiswa kurang percaya diri dalam menghadapi siswa. Pengelolaan dan penguasaan kelas ang dilakukan mahasiswa PPL Jurusan Sejarah masih kurang maksimal. Media dan metode pembelajaran yang digunakan mahasiswa PPL Jurusan Sejarah kurang maksimal dan kurang variatif. Selain itu, penguasaan materi mahasiswa PPL masih kurang baik. Persepsi Guru Pamong terhadap evaluasi pembelajaran yang sudah dibuat oleh mahasiswa PPL Jurusan Sejarah cukup baik, sudah terlihat kesesuaian antara evaluasi dengan perencanaan dan proses pembelajaran yang sudah dilaksanakan sebelumnya. Implikasi dari tujuan pembelajaran yang tercantum pada perencanaan pembelajaran belum sepenuhnya terlihat pada evaluasi pembelajaran yang dibuat oleh mahasiswa PPL Jurusan Sejarah. Evaluasi pembelajaran memang merupakan kesulitan bagi guru atau calon guru, sehingga dibutuhkan lebih banyak latihan dan pengalaman untuk dapat membuat evaluasi pembelajaran yang baik. Demi kesempurnaan penelitian yang serupa dengan penelitian ini, maka dapat disarankan supaya dilihat sudut pandang lain dari persepsi terhadap kompetensi mahasiswa PPL. Disarankan pula supaya peneliti berikutnya melakukan observasi yang mendalam guna menghasilkan penelitian yang lebih baik lagi.

Perancangan film dokumenter berjudul Jelajah Baluran pada Taman nasional Baluran, Situbondo Jawa Timur / Muhammad Yusuf Akbar

 

Kata kunci: Film Dokumenter, Taman Nasional Baluran. Taman Nasional Baluran merupakan satu dari satu dari empat Taman Nasional yang dimiliki provinsi Jawa Timur dan satu-satunya Taman Nasional dengan tipe vegetasi savanna. Taman Nasional ini sedang mengalami beberapa masalah seperti penurunan populasi Banteng Jawa (Bos javanicus) yang disebabkan oleh beberapa faktor seperti perburuan liar, perubahan lahan pakan menjadi habitat tanaman Akasia, gangguan manusia dan predator. Dengan menggunakan media seperti film dokumenter, kendala tersebut dapat dikupas lebih mendalam dan memberikan informasi bermanfaat bagi masyarakat. Tujuan perancangan ini adalah menghasilkan rancangan film dokumenter tentang keanekaragaman hayati dan permasalahan yang dialami Taman Nasional Baluran. Perancangan film dokumenter ini menggunakan model prosedural yaitu model dengan langkah-langkah sistematis. Terdapat tiga langkah untuk menciptakan film dokumenter meliputi tiga tahapan, yaitu pra-produksi, produksi, dan pasca produksi. Dalam pra-produksi disusun treatment dan skenario berdasarkan studi literatur dan identifikasi data lapangan. Tahap produksi meliputi perekaman gambar dan perekaman narasi. Tahap pasca produksi adalah editing dan rendering. Perancangan ini menghasilkan film dokumenter bertemakan kehidupan satwa liar untuk program acara televisi berdurasi 30 menit dan bergenre Travelling Documentary yang dimana kru terjun langsung untuk masuk dalam gambar dan menikmati suasana Taman Nasional Baluran. Diharapkan tercipta suatu awareness (kesadaran) dan motivation (motivasi) yang muncul bagi pencipta-pencipta film dokumenter terutama film dokumenter yang mengangkat isu lingkungan khususnya fauna dan dapat terdokumentasi dengan baik dan lengkap dan menjadi referensi pengetahuan dan informasi yang berguna bagi generasi selanjutnya.

Proses sosial dan pendidikan masyarakat berketerbelakangan mental di Dusun Sidowayah Desa Sidoharjo Kecamatan Jambon Kabupaten Ponorogo / Alfian Ardhiansyah

 

Kata Kunci: prosessosial, pendidikanmasyarakat, keterbelakangan mental KecamatanJambonmerupakansalahsatukecamatan di KabupatenPonorogo yang memilikimasyarakatberketerbelakangan mentalcukupbanyak. Salah satudesa di KecamatanJambon, tepatnya diDesaSidoharjoterdapatpenderitaketerbelakangan mental cukupbanyak, yakniada 118 jiwapenderitaketerbelakangan mental. Dalamkehidupanbermasyarakatdiperlukaninteraksisosialantarmasyarakatgunakelangsunganhidupnya, tanpaterkecualimasyarakatberketerbelakangan mental.Olehkarenaitubagaimanamasyarakatberketerbelakanganmental inimenjalankanfungsisosialnyadenganberbagaiketerbatasan yang merekamilikikarenamerekajugabagiandarimasyarakat.Sehinggapenelitiantentangprosesinteraksidanpendidikanmasyarakatberketerbelakangan mental dirasapentinguntukdilakukan.Adapunrumusandaripnelitianiniadalah (1) bagaimana proses sosialmasyarakatberketerbelakangan mental di DusunSidowayahDesaSidoharjoKabupatenPonorogo, (2) bagaimana proses pendidikanmasyarakatberketerbelakangan mental di DusunSidowayahDesaSidoharjoKabupatenPonorogo. Penelitianinibertujuanuntukmendeskripsikan (1) prosessosialmasyarakatberketerbelakangan mental di DesaSidoharjo (DusunSidowayah) KecamatanJambonKabupatenPonorogo, (2) prosespendidikanmasyarakatberketerbelakangan mental di DesaSidoharjo (DusunSidowayah) KecamatanJambonKabupatenPonorogo. Penelitianinimenggunakanjenispenelitiandeskriptifdenganpendekatankualitatif.Dalampenelitianini, penelitimelakukansurveydengansampelkeluarga yang memilikianggotakeluargaberketerbelakangan mental di DesaSidoharjoDusunSidowayah, warga yang berketerbelakangan mental yang bisadiajakuntukberkomunikasimenggunakanbahasa verbal ataupunbahasaisyarat.Teknikpengambilan data yang dilakukanadalahobservasi, wawancara, dandokumentasi.Teknikanalisis data menggunakananalisis data kualitatif model interaktifadalahreduksi data, display data, verifikasi data. Hasildaripenelitaninimenunjukkanprosessosial yang dilakukanmasyarakatberketerbelakanganmental denganmenggunakanbahasaisyarat. Meskisekilasmerekamemilikibanyakkekurangannamunmerekamasihmampuuntukberinteraksidenganlingkungannya (masyarakatdanalamdimanamerekatinggal).Sedangkanpendidikan yang diberikankepadamasyarakatberketerbelakangan mental usiadewasaataubiasadisebutdengan Orang DenganKeterbelakangan (ODK) diberikanpembinaankhususdirumahmasing-masingmeliputipembinaandiriuntukkehidupansehari-hari yang manadalampembinaaninibertujuan agar para ODK inibisamandiridantidakselalumenggantungkanhidupnyakepada orang lain, namunhanya ODK yang memilikiketerbelakanganringansaja yang mampudibina, karenabagimereka yang menderitakerterbelakanganberatsudahtidakdapatmelakukankegiatanapapun. Sedangkanbagimasyarakatberketerbelakagan mentalusiasekolahataubiasadisebutdenganAnakBerkebutuhanKhusus (ABK) disekolahkan di sekolahinklusi yang terdapat di DusunSidowayah yang resmididirikanpadatahun 2009 lalu.Dari hasilpenelitandapatdisimpulkanbahwadalamprosesinteraksinya, masyarakatberketerbelakangan mental mampuberinteraksidenganlingkungannya, sedangkanuntukpendidikanmasyarakatberketerbelakangan mental dibinamelaluikeluarga, bertujuanuntukkemandirian ODK. Untuk ODK usiaproduktif, merekamasuk di sekolahinklusi. Dari hasilpenelitian, saran untukpemerintahKabupatenPonorogoadalahtindakandanpenanganannyatauntukmasyarakatberketerbelakangan mental, terutamauntuksaranapendidikan ODK, untukDesaSidoharjohendaknyalebihmemaksimalkanpelayananmasyarakatterutamadibidangpendidikandansosial.Sedangkan saran untukpenelitiselanjutnyaadalahsecaraakademikdisarankanunutklebihmemahamimasalahsosialdanpendidikan di DesaSidoharjo. Hal inidikarenakanbanyakanak-anakbahkan orang tua yang butaakanpendidikan, makadariitumasalahtersebuthendakdipahamilebihlanjutkarenapendidikanmerupakanbekaluntukkehidupan yang lebihbaik.

Perancangan media interaktif berupa pengenalan asmaul husna bagi siswa Madrasah Ibtidaiyah Nurul Ulum / Nur Fitrianingsih

 

Kata Kunci : Perancangan, Media interaktif, Asmaul husna Asmaul Husna memuat nama dan sifat-sifat Allah SWT yang wajib diketahui oleh masyarakat. Asmaul Husna tidak sekedar dihafalkan, namun diterapkan, dihayati untuk diamalkan. Pada tingkat sekolah Madrasah Ibtidaiyah Nurul Ulum kelas 1-3, Asmaul Husna kurang mendapat perhatian, karena media pembelajaran yang digunakan kurang menarik sehingga materi yang disampaikan juga mudah lupa, selama ini menggunakan buku cetak. Namun data yang didapat dari hasil wawanacara tentang Asmaul Husna pada Madrasah Ibtidaiyah Nurul Ulum menunjukan bahwa masih minimnya dalam media pembelajaranya sehingga siswa pun menjadi bosan, dari pemaparaan permasalahan tersebut, maka solusi pemecahan masalah kebutuhan media melalui karya Perancangan Media Interaktif Berupa Pengenalan Asmaul Husna Bagi Siswa Madrasah Ibtidaiyah Nurul Ulum agar pesan pada siswa madrasah Ibtidaiyah dapat tersampaiakan dengan baik dan benar pada target audience yaitu Siswa Madrasah Ibtidaiyah Nurul Ulum kelas 1-3 Perancangan media interaktif diharapkan menjadi alternatif pilihan untuk mengenal Asmaul Husna data dalam perancangan ini berupa data primier yang didapat dalam wawancara dan data sekunder yanng di dapat dalam literatur buku, media online. Kegiatan Perancangan diawali dengan merumuskan latar belakang masalah,rumusan masalah, tujuan, pengumpulan data, menetapkan konsep perancangan media dilanjutkan dengan tahap perencanaan media media dan perencanaan kreatif, kemudian menghasilkan sebuah desain akhir dengan media pembelajaran Interaktif. Produk yang dihasilkan berupa media pembelajaraan interaktif yang memuat Asmaul Husna yang disertai cara membaca, cara mewarnai, cerita tentang contoh suri tauladan Asmaul Husna melalui gambar yang sederhana menggunakan warna yang ceria. Desain ini disesuaikan dengan target audience yaitu anak sekolah Madrasah Ibtidaiyah Nurul Ulum kelas 1-3. Untuk mendukung hasil perancangan dilampirkan produk berupa buku panduan, buku mewarnai, poster, dan X-banner. Pesan yang disampaikan adalah mengenai masalah kurangnya mendapat perhatian dalam pembelajaraan Asmaul Husna dengan cara Menciptakan pola pembelajaran yang menarik dengan media yang menyenangakan yang sesuai dengan target audince

Peningkatan motivasi dan hasil belajar siswa melalui media permainan monopoli pada pembelajaran sejarah semester genap tahun ajaran 2012-2013 kelas VIIIA di MTsN Wonorejo Pasuruan / Yaumil Khoiriyah

 

Kata Kunci: media permainan monopoli, motivasi, hasil belajar Fakta pembelajaran terhadap mata pelajaran sejarah di MTs.N Wonorejo cenderung konvensional yang bersifat hafalan dan cenderung menggunakan metode ceramah. Pola pengajaran yang seperti ini yang membuat siswa tidak termotivasi dalam proses pembelajaran dan akibatnya siswa cenderung mendapatkan nilai yang kurang dari Kriteria Ketuntasan Minimal. Dengan adanya hal tersebut peneliti mencoba menerapkan media pembelajaran yang dekat dengan siswa yang dapat meningkatkan motivasi dan hasil belajar siswa. Permainan Monopoli dalam pembelajaran sejarah merupakan salah satu media alternatif yang digunakan sebagai penunjang proses pembelajaran serta dapat digunakan untuk merangsang keaktifan siswa dalam belajar. Dengan permainan monopoli ini siswa dapat melibatkan lebih banyak inderanya seperti pengelihatan, peraba dan pendengaran, sehingga siswa lebih dapat mengingat materi yang telah dijelaskan. Rumusan masalah pada penelitian ini: 1) bagaimana pelaksanaan pembelajaran dengan menggunakan media permainan monopoli? 2) apakah media ini dapat meningkatkan motivasi dan hasil belajar siswa?. Penelitian ini dilakukan untuk: 1) mendeskripsikan pembelajaran sejarah yang dilaksanakan dengan menggunakan media permainan monopoli dikelas VIIIA MTs. N Wonorejo-Pasuruan; 2) mendeskripsikan pemanfaatan permainan monopoli sebagai media pembelajaran untuk meningkatkan motivasi dan hasil belajar mata pelajaran sejarah siswa kelas VIIIA MTs.N Wonorejo-Pasuruan. Penelitian ini merupakan jenis Penelitian Tindakan Kelas yang terdiri dari 2 siklus dan subyek penelitiannya yaitu siswa kelas VIIIA MTs.N Wonorejo-Pasuruan. Tiap siklus dilakukan dalam tiga kali pertemuan. Siklus I dilaksanakan 25 Januari sampai 08 Februari 2013. Siklus II dilaksanakan pada tanggal 15 Februari sampai 01 Maret 2013. Hasil belajar siswa siklus I sebesar 42.3% rata-rata kelas 71.1, siklus II sebesar 88.5% dengan rata-rata kelas 79.9. Peningkatan hasil belajar siswa dilatar belakangi oleh motivasi siswa yang meningkat disetiap siklusnya. Motivasi siswa siklus I memiliki prosentase 75%, dan meningkat di siklus II sebesar 91.6%, sehingga dapat disimpulkan bahwa pembelajaran sejarah dengan menggunakan media permainan monopoli dapat meningkatkan motivasi dan hasil belajar siswa pada kelas VIIIA MTs.N Wonorejo-Pasuruan. Bagi guru diharapkan dapat menerapkan media pembelajaran yang inovatif sehingga dapat meningkatkan motivasi dan hasil belajar siswa. Media pembelajaran yang dapat digunakan salah satunya adalah media permainan monopoli karena media permainan monopoli ini dapat meningkatkan motivasi dan hasil belajar siswa.

Penerapan model pembelajaran problem solving dalam kelompok kecil untuk meningkatkan kemampuan berfikir kritis dan hasil belajar geografi siswa kelas XI IPS di SMAN 9 Malang / Widia Ratna Sari

 

Kata Kunci : Model Pembelajaran Problem Solving, Berfikir Kritis, Kelompok Kecil, Hasil Belajar. Hasil observasi yang diperoleh peneliti menunjukkan bahwa siswa kelas XI IPS 4 SMAN 9 Malang memiliki kemampuan berfikir kritis dan hasil belajar yang masih rendah. Pada saat pembelajaran berlangsung hanya 2-3 siswa dari 21 siswa yang bertanya dan menjawab pertanyaan dari guru. Hal ini menunjukkan bahwa kemampuan berfikir kritis siswa masih rendah. Hasil pre test juga menunjukkan bahwa hanya 15% siswa yang tuntas dalam mata pelajaran geografi dan nilai ulangan semester gasal 2011/2012 menunjukkan bahwa hanya 15% siswa yang tuntas dengan standar ketuntasan minimal 76. Dalam proses pembelajaran siswa cenderung menerima semua materi yang diberikan oleh guru. Tujuan penelitian ini yaitu untuk mengetahui bahwa penerapan model pembelajaran problem solving dalam kelompok kecil dapat meningkatkan kemampuan berfikir kritis dan hasil belajar geografi siswa kelas XI IPS di SMAN 9 Malang. Jenis penelitian yang digunakan adalah jenis Penelitian Tindakan Kelas. Pengambilan data dilaksanakan dengan tes, wawancara, catatan lapangan, dan observasi. Penelitian dilaksanakan di kelas XI IPS 4 SMAN 9 Malang dengan jumlah siswa 20 orang dengan materi menganalisis pemanfaatan dan pelestarian lingkungan hidup. Berdasarkan hasil penelitian diketahui bahwa ada peningkatan kemampuan berfikir kritis dan hasil belajar siswa kelas XI IPS 4 SMAN 9 Malang. Kemampuan berfikir kritis siswa meningkat dari siklus I ke siklus II yaitu 49,76% menjadi 68,33%. Hasil belajar siswa mengalami peningkatan dari 70,75% menjadi 79%. Model pembelajaran problem solving dalam kelompok kecil cocok diterapkan pada materi yang berkaitan dengan menganalisis atau memecahkan suatu permasalahan. Dalam penerapan model pembelajaran ini guru harus memprediksi waktu yang akan digunakan dan memberikan arahan serta bimbingan kepada seluruh siswa.

Implementasi permainan bola taker untuk meningkatkan kemampuan motorik kasar anak kelompok A di TK Plus Al-Kautsar Malang / Dika Yulanda Wijaya

 

Kata Kunci : Permainan Bola Taker, Kemampuan Motorik Kasar Berdasarkan hasil observasi terhadap anak kelompok A di TK Plus Al- Kautsar Malang dalam bermain memasukkan bola keranjang cenderung rendah. Hasil yang diperoleh adalah dari 26 anak yang dapat melakukan kegiatan memasukkan bola pada keranjang sebanyak 7 anak yang mampu melakukan dengan benar. Faktor yang menyebabkan karena metode pembelajaran kurang menarik bagi anak, oleh karena itu untuk meningkatkan kemampuan motorik kasar anak di TK Plus Al-Kautsar Malang, peneliti melakukan penelitian melalui permainan bola taker. Rumusan masalah dalam penelitian ini adalah sebagai berikut : (1) Bagaimanakah implementasi permainan bola taker untuk meningkatkan kemampuan motorik kasar anak kelompok A di TK Plus Al-Kautsar Malang? (2) Bagaimanakah peningkatan kemampuan motorik kasar anak kelompok A di TK Plus Al-Kautsar Malang setelah diimplementasikan permainan bola taker? Metode penelitian yang digunakan adalah Penelitian Tindakan Kelas (PTK). Penelitian ini dilakukan pada kelompok A di TK Plus Al-Kautsar Malang. Subyek penelitian adalah anak kelompok A dengan 26 anak terdiri dari 14 anak laki-laki dan 12 anak perempuan. Instrumen penelitian yang digunakan peneliti untuk pengumpulan data berupa lembar observasi, rubrik penilaian dan dokumentasi. Peneliti terlibat secara penuh dalam kegiatan penelitian baik perencanaan, pelaksanaan, pengamatan maupun refleksi. Penelitian implementasi permainan bola taker dilaksanakan 2 siklus. Pada pra tindakan hasil observasi proses permainan bola taker sebesar 23,08% dan hasil observasi perkembangan kemampuan motorik kasar anak sebesar 26,92%. Pada siklus I hasil observasi proses permainan bola taker sebesar 46,15% dan hasil observasi perkembangan kemampuan motorik kasar anak sebesar 50%. Pada siklus II hasil observasi proses permainan bola taker sebesar 88,46% dan observasi perkembangan kemampuan motorik kasar anak sebesar 88,46%. Berdasarkan hasil tersebut dapat disimpulkan bahwa implementasi permainan bola taker dapat meningkatkan kemampuan motorik kasar anak kelompok A di TK Plus Al-Kautsar Malang. Disarankan kepada peneliti sebaiknya permainan ini dapat dijadikan referensi bagi penelitian selanjutnya, bagi Kepala Sekolah menjadi sarana untuk memotivasi guru-guru kelas agar meningkatkan mutu pembelajaran, dan bagi guru sebaiknya memberikan pembelajaran yang menarik dan kreatif bagi anak.

Penerapan model pembelajaran Two Stay Two Stray (TSTS) untuk meningkatkan keaktifan dan hasil belajar geografi siswa kelas X-1 SMA Negeri 1 Batu / Aulia Widiarti

 

Kata Kunci: two stay two stray, keaktifan, hasilbelajar Berdasarkanhasilobservasi yang dilakukanpadaawalbulanAgustus 2012 di Kelas X-1 SMA Negeri 1 Batudiketahuibahwakegiatanpembelajarangeografimenggunakanmetodeceramah yang didominasioleh guru, sehinggasiswahanyaduduk, mendengarkan, danmencatatapa yang disampaikanoleh guru. Bahkanbeberapasiswaterlihatberbicarasendiridengantemannyadanadasiswa yang mengantuk.Hal tersebutmenyebabkankeaktifandanhasilbelajarsiswarendah. Hal initerlihatdarihasilbelajarkelasdengan rata-rata 70,78, danhanya 37% siswa yang mencapai KKM yaitu 75. Penelitianinibertujuanuntukmendiskripsikan (1) peningkatankeaktifanbelajargeografisiswakelas X-1 SMA Negeri 1 Batu, (2) peningkatanhasilbelajargeografisiswakelas X-1 SMA Negeri 1 Batu.Jenispenelitian yang digunakanadalahPenelitianTindakanKelas (PTK) yang terdiridaritahapperencanaan, pelaksanaan, observasi, danrefleksi.Penelitianinidilakukandalam 2 siklusdantiapsiklusnyaterdiridari 2 kali pertemuan yang dilaksanakanpadabulanJanuaridanFebruari 2013. Model yang diterapkanadalah model pembelajarantwo stay two stray yang dilaksanakanpadakompetensidasarmenganalisisdinamikakecenderunganperubahanlitosferdanpedosfersertadampaknyatehadapkehidupan di mukabumi. Subjekpenelitianyaitusiswakelas X-1 yang berjumlah 27 siswa. HasilpenelitianmenunjukkanbahwaadapeningkatankeaktifandanhasilbelajarGeografisiswadaripratindakankesiklus I dansiklus II. Rata-rata keaktifankelaspratindakansebesar51,3padasiklus I meningkatmenjadi63,2dansiklus II meningkatmenjadi 76,2. Peningkatankeaktifandaripratindakankesiklus I sebesar 23,2% dandarisiklus I kesiklus II sebesar 20,6%. Rata-rata hasilbelajarpratindakansebesar 70,78padasiklus I meningkatmenjadi 82,7dansiklus II meningkatmenjadi 89,6.Peningkatanhasilbelajardaripratindakankesiklus I sebesar 16,9% dandarisiklus I kesiklus II sebesar 8,4%. Berdasarkanhasiltersebut, disarankan: (1) bagisekolahuntukmenerapkan model pembelajaran TSTS untukmeningkatkankeaktifandanhasilbelajar, dandisarankankepada guru-guru untukmembuatbukuringkasanmateripembelajarangeografi, (2) guruperlumemberikanringkasanmateri yang diajarkansatuminggusebelumpelaksanaanpembelajaran, mengaturpengelolaanwaktu yang tepatpadasetiaplangkahpembelajaran, dan guru perlumelakukanpengelolaankelas yang lebihbaikuntukmengatasisiswa yang seringmembuatgaduhdanramai, (3) bagipenelitiselanjutnya, model pembelajaran TSTS dapatdigunakanpadasubjek yang berbeda, menambahvariabel lain sepertimotivasibelajar, kemampuanberfikirkritis, minatbelajar, dan lain-lain, danmengkombinasikan model pembelajaran TSTS dengan model pembelajaran yang lain.

Analisis kesalahan penulisan huruf kapital dan faktor penyebab kesalahan dalam karangan narasi siswa kelas IV SDN Gugus III Kecamatan Purwosari Kabupaten Kediri / Rizky Erikawati

 

Kata Kunci: kesalahan huruf kapital, karangan narasi, siswa kelas IV, SD. Kesalahan dalam berbahasa disebabkan oleh beberapa hal, diantaranya sebagai berikut ini.1) kurang optimalnya daya serap dan tangkap seseorang dalam berbahasa, 2) kurangnya pengalaman dan pengetahuan dalam berbahasa sendiri, 3) kurangnya optimalisasi yang diberikan oleh pendidik dalam memberikan pelajaran tentang kebahasaan. Penelitian ini menggunakan pendekatan kualitatif dan jenisnya menggunakan penelitian deskripif. Lokasi penelitian pada SDN Gugus III Kecamatan Purwoasri Kabupaten Kediri yang terdiri dari delapan SD. Data yang digunakan adalah karangan narasi siswa kelas IV SDN Gugus III Kecamatan Purwoasri Kabupaten Kediri, dengan jumlah populasi 224 siswa, pada masing-masing SD akan diambil 10 sampel karangan narasi. Dalam penelitian ini juga terdapat data penunjang yaitu berupa lembar wawancara guru dan kuisioner siswa. Analisis data dilakukan dengan empat tahap, yaitu pengidentifikasian, pengkodean, pengklasifikasian, dan penghitungan persentase. Berdasarkan hasil analisis data ditemukan kesalahan penulisan huruf kapital dalam karangan siswa kelas IV SDN Gugus III Kecamatan Purwoasri Kabupaten Kediri yaitu sebanyak 306 atau 14, 90% meliputi : 1) kesalahan penulisan huruf kapital sebagai huruf pertama awal kalimat sebanyak 143 atau 9,24%, 2) kesalahan penulisan huruf kapital sebagai huruf pertama petikan langsung sebanyak 19 atau 48,72%, 3) kesalahan penulisan huruf kapital sebagai huruf pertama unsur-unsur nama orang sebanyak 29 atau 36,71%, 4) kesalahan penulisan huruf kapital sebagai huruf pertama nama tahun, bulan, hari, hari raya dan peristiwa sejarah sebanyak 23 atau 63,89%, 5) kesalahan penulisan huruf kapital sebagai huruf pertama nama geografi sebanyak 48 atau 4,71%, 6) kesalahan penulisan huruf kapital sebagai huruf pertama kata penunjuk kekerabatan sebanyak 43 atau 21,60%. Faktor penyebab kesalahan penulisan huruf kapital dalam karangan siswa kelas IV SDN Gugus III Kecamatan Purwoasri Kabupaten Kediri ada dua, yaitu : faktor ketidaktahuan siswa dan faktor kurang telitinya siswa. Dari penelitian ini dapat diberikan saran untuk guru SDN Gugus III Kecamatan Purwoasri Kabupaten Kediri agar memberikan pembelajaran tentang penulisan huruf kapital dengan benar sesuai dengan kaidah Bahasa Indonesia yang ada. Serta dalam proses komunikasi dan interaksi di sekolah hendaknya guru senantiasa melatih siswa untuk menggunakan bahasa Indonesia yang baik.

Analisis pembangunan Desa Kedungrejo dan Bomo sebagai minapolis dan hinterland kawasan minapolitan Kabupaten Banyuwangi / Ratna Wahyu Utami

 

Kata Kunci: pembangunan, minapolis, hinterland, kawasan minapolitan Pembangunan sektor kelautan dan perikanan memerlukan penyesuaian dan perubahan agar dapat memenuhi kebutuhan ekonomi yang lebih fokus pada peningkatan kesejahteraan masyarakat. Minapolitan merupakan kebijakan yang diperuntukkan untuk menata ruang kawasan pesisir agar ruang dapat mendukung kegiatan pesisir yang cukup kompleks. Pembangunan kawasan minapolitan di Kabupaten Banyuwangi harus selaras antara pembangunan fisik dan sosial, karena permasalahan yang terjadi masyarakat hanya dijadikan sebagai subyek pembangunan yang berperan pasif. Untuk mengatasi hal tersebut diperlukan upaya pembangunan partisipatif. Upaya ini didasarkan pada pembangunan fisik fungsi wilayah dan pengetahuan serta sikap masyarakat. Pentingnya upaya ini didasarkan atas kenyataaan bahwa secara psikologis, pengetahuan dan sikap seseorang cenderung berpengaruh terhadap perilakunya. Penelitian ini tergolong penelitian deskriptif kuantitatif dengan menggunakan analisis statistik deskriptif yang bertujuan untuk mendeskripsikan pengetahuan dan sikap masyarakat terhadap pembangunan kawasan minapolitan dan analisis spasial Nearest Neighbour Analysis yang bertujuan untuk mengetahui pola spasial fungsi wilayah yang sudah terbangun. Pengambilan sampel wilayah dalam penelitian ini menggunakan teknik purposive sampling dengan memperhatikan penetapan lokasi kawasan minapolitan. Sedangkan pengambilan sampel responden menggunakan proportional random sampling sejumlah 95 responden dari 7.814 kepala keluarga yang bekerja sebagai nelayan di Desa Kedungrejo dan Bomo. Variabel dalam penelitian ini adalah Fishery town, Fishery park, pengetahuan dan sikap masyarakat terhadap pembangunan kawasan minapolitan. Hasil penelitian menunjukkan bahwa pembangunan di minapolis secara umum memenuhi target capaian berupa penataan ruang zonasi laut dan pesisir yang terlihat dari fungsi desa sebagai Fishery Town sudah terbangun. Pembangunan dari aspek sosial terlihat dari 79,73% masyarakat memiliki pengetahuan sedang dan 93,24% masyarakat memiliki sikap setuju mengenai pembangunan kawasan minapolitan. Sedangkan di wilayah hinterland, pembangunan secara umum memenuhi target capaian dengan adanya peluang investasi di wilayah yang terlihat dari fungsi desa sebagai Fishery Park sudah terbangun. Pembangunan dari aspek sosial terlihat dari 57,14 % masyarakat memiliki pengetahuan rendah dan 66,67% masyarakat memiliki sikap setuju mengenai pembangunan kawasan minapolitan. Dinas Perikanan dan Kelautan selaku pembuat kebijakan sebaiknya dapat merangkul dan melibatkan seluruh nelayan minapolis maupun hinterland sebagai subyek pembangunan untuk ikut serta membangun desa sehingga upaya pemanfaatan dan pembangunan kawasan berdasarkan fungsinya tetap terjaga dengan baik dan menjadi desa mandiri.

Pengaruh model pembelajaran think pair share dengan media gambar terhadap kemampuan berpikir kritis siswa pada mata pelajaran geografi kelas XI IPS SMA Negeri 02 Batu / Desi Anccillina

 

Kata kunci: think pair share (TPS), media gambar, kemampuan berpikir kritis Kemampuan siswa dalam berpikir kritis belum begitu diperhatikan dalam pembelajaran, sedangkan pembelajaran yang dilakukan menuntut siswa untuk membangun sendiri pemahamannya.Oleh karena itu perlu adanya pembelajaran yang dapat menumbuhkan peran aktif siswa untuk ikut serta dalam kegiatan berpikir sehingga siswa dapat berpikir kritis.Hal tersebut sesuai apabila menerapkan model pembelajaran Think Pair Share (TPS) dengan media gambar. Keunggulan dari model ini adalah menghendaki siswa lebih banyak berpikir baik secara individu maupun berpasangan, menjawab, dansaling membantu untuk menyelesaikan permasalahan yang disajikan dalam bentuk gambar. Dengan demikian dapat menumbuhkan kemampuan berpikir kritis siswa. Penelitian ini bertujuan untuk mengetahui adakah pengaruh model pembelajaran Think Pair Share dengan media gambar terhadap kemampuan berpikir kritis siswa pada mata pelajaran Gografi kelas XI IPS SMA Negeri 02 Batu. Penelitian ini termasuk jenis penelitian eksperimen semu (semu (Quasi Exsperiment) dengan mengambil subjek penelitian dua kelas yaitu kelas XI IPS 3 sebagai kelas ekperimen dan kelas XI IPS 1 sebagai kelas kontrol. Instrumen penelitian berupa tes untuk pretest dan posttest. Teknik analisis yang digunakan adalah uji beda atau uji t untuk 2 sampel tidak berpasangan (Independent samples t test) yang diselesaikan dengan bantuan SPSS 16.0 for Windows. Hasil penelitian penelitian ini menunjukkan bahwa terdapat perbedaan yang signifikan kemampuan berpikir kritis siswa antara kelas ekperimen dengan kelas kontrol. Hasil analisis data diketahui bahwa kemampuan berpikir kritis siswa kelas ekperimen lebih baik dibandingkan kemampuan berpikir kritis siswa kelas kontrol. Rata-ratagain score kelas ekperimen sebesar 18,86 sedangkan pada kelas kontrol memiliki rata-rata sebesar 13,41. Hasil analisis dengan uji t menunjukkan bahwa signifikansi sebesar 0,004. Dengan demikian nilai signifikansi 0,004< 0,05, maka H0 ditolak, sehingga dapat disimpulkan bahwa terdapat pengaruh model pembelajaran Think Pair Share dengan media gambar terhadap kemampuan berpikir kritis siswa. Berdasarkan hasil penelitian, disarankan bagi Guru mata pelajaran Geografi hendaknya mencoba menerapkan model pembelajaran Think Pair Share dengan media gambar, karena model tersebut dapat berpengaruh terhadap kemampuan berpikir kritis siswa.

Pengembangan media pembelajaran komik digital bahasa Indonesia untuk meningkatkan kemampuan menulis cerita pendek (cerpen) kelas IX semester ganjil di SMP Negeri 4 malang / Tahiyatul Izza

 

Kata Kunci : Pengembangan, Media Komik Digital, Pembelajaran Bahasa Indonesia Berdasarkan hasil observasi awal pada Kelas IX SMP Negeri 4 Malang, rata-rata kemampuan menulis cerpen siswa masih kurang menarik dalam mengembangkan imajinasi. Salah satu faktor kurangnya kemampuan menulis cerpen pada siswa adalah metode pembelajaran yang digunakan. Metode pembelajaran yang digunakan dalam pembelajaran menulis cerpen adalah metode tanya jawab dan pemberian tugas sederhana. Dengan cara guru melakukan tanya jawab dengan siswa tentang penulisan kalimat-kalimat yang digunakan dalam mengembangkan cerpen, dimana siswa dituntut konsentrasi untuk memahami pertanyaan dan penjelasan guru sehingga siswa akan merasa jenuh, setelah itu guru memberi tugas siswa untuk mengembangkan cerpen secara mandiri dengan memberikan batas waktu. Dengan metode pembelajaran yang menggunakan Media Komik Digital diharapkan bagi siswa agar lebih mudah memahami cara penulisan kalimat dengan benar, kemudian juga bisa membantu siswa yang meningkatan daya kosentrasi dan perhatiannya sehingga lebih mudah untuk menemukan ide serta tidak mengalami kesulitan dalam mengembangkan imajinasi dalam menulis cerpen. Data pengembangan media komik digital ini menggunakan instrument berbentuk angket kepada ahli media, ahli materi, dan audiens (siswa). Data tersebut diolah untuk dianalisis dan disimpulkan tingkat kevalidan dan efektivitasnya. Metode pengembangan yang digunakan dengan menggunakan ADDIE (Analisis, Design, Development, Implementation, Evaluation) yang pada tahapannya hanya dilakukan beberapa tahapan saja, antara lain (1) analisis, (2) design, dan (3) development. Untuk tahapan implementasi dan evaluasi tidak dilakukan dikarenakan produk yang dibuat masih prototime bukan produk akhir. Media Komik Digital diujikan kepada ahli media sebanyak 1 orang, ahli materi sebanyak 1 orang, dan 40 peserta didik Kelas IX SMP Negeri 4 Malang sebagai audiens. Sehingga didapatkan hasil pengembangan media Komik Digital sebagai berikut. Uji coba ahli media didapat persentase 90% berdasarkan kriteria hasil kelayakan media ini termasuk kualifikasi valid, uji coba ahli materi didapat persentase 80% berdasarkan kriteria kelayakan media pembelajaran interaktif ini termasuk kualifikasi valid. Uji coba siswa perorangan didapat persentase 86% kesimpulan berdasarkan kriteria kelayakan ini termasuk kualifikasi valid, uji coba siswa kelompok kecil didapat persentase 85% berdasarkan kriteria kelayakan media ini termasuk kualifikasi valid, uji coba siswa kelompok besar didapat persentase 84% berdasarkan kriteria kelayakan media komik digital termasuk dalam kualifikasi valid. Berdasarkan hasil pengembangan yang telah dilakukan, dapat disimpulkan bahwa Pengembangan Media Pembelajaran Komik Digital Bahasa Indonesia untuk Kelas IX SMP Negeri 4 Malang valid/layak digunakan sebagai media pembelajaran yang dikembangkan untuk digunakan pada proses pembelajaran dikelas.

Pengembangan media pembelajaran PKn berbasis CAI (Computer Assisted Instruction) siswa kelas VIII di SMPN 1 Kutorejo Kabupaten Mojokerto / Imroatul Azmi

 

Azmi, Imroatul. 2013. Pengembangan Media Pembelajaran PKn Berbasis CAI (Computer Asissted Instruction) Siswa Kelas VIII di SMPN 1 Kutorejo Kabupaten Mojokero. Skripsi, Jurusan Hukum dan Kewarganegaraan, Fakultas Ilmu Sosial. Pembimbing: (I) Drs. Kt. Diara Astawa, SH, M.Si, (II) Dra. Arbaiyah Prantiasih M.Si Kata Kunci : Pengembangan Media Pembelajaran, Computer Assisted Instruction.     Media pembelajaran memiliki peran yang sangat penting dalam proses belajar mengajar, termasuk dalam pembelajaran PKn. Karena pembelajaran PKn didasarkan pada daya pikir (daya ingat) dan memungkinkan untuk mengembangkan karakter siswa berdasarkan nilai-nilai budaya bangsa Indonesia. Beberapa siswa kelas VIII SMP N 1 Kutorejo Kabupaten Mojokerto kenyataannya mengaku merasa bosan dan jenuh jika pembelajaran pendidikan kewarganegaraan terus menerus disampaikan secara komunikasi verbal melalui penuturan kata-kata oleh guru. Semangat belajar siswa semakin lama semakin menurun dalam pembelajaran PKn, siswa seringkali terlihat kurang kondusif selama mengikuti kegiatan belajar mengajar. Salah satu media pembelajaran yang banyak diperbincangkan saat ini adalah media pembelajaran berbantuan komputer. Kehadiran komputer dan aplikasinya sebagai bagian dari teknologi dan informasi ini dapat merubah pola pembelajaran yang semula tradisional dalam bentuk tatap muka, beralih menjadi pola pembelajaran yang tidak dibatasi oleh ruang dan waktu. Media pembelajaran berbasis komputer bisa dirancang dan dibuat dengan program yang sederhana dengan sistem multimedia yang baik, penggunaannya mudah dan mobilitasnya tinggi. Media pembelajaran berbasis CAI ini jika digunakan dalam proses belajar mengajar akan lebih menarik perhatian siswa dan materi pembelajaran juga akan lebih dipahami oleh para siswa, sehingga memungkinkan untuk mencapai tujuan pembelajaran yang diharapkan.     Tujuan peenelitian pengembangan ini adalah: 1) Mendeskripsikan prosedur pengembangan media pembelajaran Pkn berbasis CAI (Computer Assisted Instruction) pada siswa Kelas VIII di SMPN 1 Kutorejo Kabupaten Mojokerto, 2) Mengetahui tingkat efektivitas penggunaan media pembelajaran berbasis CAI (Computer Assisted Instruction) pada siswa Kelas VIII di SMPN 1 Kutorejo Kabupaten Mojokerto.     Pengembangan media pembelajaran ini memodifikasi model pengembangan media yang digunakan Sadiman. Adapun langkah-langkah tersebut antara lain: 1) identifikasi kebutuhan, 2) analisis perumusan tujuan, 3) pengembangan materi pembelajaran 4) mengembangkan alat evaluasi 5) produksi, 6) validasi, 7) revisi.     Hasil produk pengembangan ini adalah media pembelajaran berbasis CAI (Computer Assisted Instrucion) dengan materi konstitusi-konstitusi yang pernah berlaku di Indonesia untuk siswa kelas VIII SMP. Dari data analisis validasi diperoleh nilai presentase sebesar 86,66% untuk validator ahli materi dengan krieria layak, 93,33% ahli media, uji kelompok kecil sebesar 89,43 % dengan kriteria layak dan untuk uji coba lapangan diperoleh hasil 89,14% juga dengan kriteria layak. Sehingga dapat disimpulkan bahwa multimedia interaktif ini layak untuk digunakan sebagai media pembelajaran dalam kegiatan belajar mengajar di sekolah.

Pelaksanaan ekstrakurikuler pramuka dalam membangun sikap nasionalisme siswa di SMP Negeri 1 Watulimo Kabupaten Trenggalek / Debrina Fajarwati

 

Kata Kunci: Ekstrakurikuler, Sikap Nasionalisme, Pramuka. Semangat nasionalisme harus dimiliki oleh setiap warga negara khusunya oleh generasi muda sebagai penerus pembangunan bangsa, namun dengan munculnya virus-virus perusak kedaulatan , kemandirian, serta kepribadian bangsa adalah masalah utama dalam membangun sikap nasionalisme siswa. SMP Negeri 1 Watulimo adalah salah satu sekolah berstandar nasional di wilayah Kecamatan Watulimo Kabupaten Trenggalek. Sekolah ini memiliki beragam kegiatan ekstrakurikuler yang dapat membantu siswa dalam membangun sikap nasionalisme siswa. Salah satunya adalah pramuka, kegiatan pramuka di SMP Negeri 1 Watulimo tergolong maju, terbukti dari setiap perlombaan yang diadakan baik ditingkat ranting, cabang,daerah, maupun nasional, mereka sering memperoleh juara, selain itu anggota pramuka di gugus depan sering diikutkan sebagai anggota kontingen jambore, yang dilaksanakan baik di cabang, daerah, maupun nasional. Adapun tujuan dari penelitian ini adalah: (1) mendiskripsikan program ekstrakurikuler pramuka di SMP Negeri 1 Watulimo, (2) mendiskripsikan pelaksanaan kegiatan ekstrakurikuler Pramuka di SMP Negeri 1 Watulimo, (3) mendiskripsikan kendala-kendala apa saja yang dihadapi dalam membangun sikap Nasionalisme melalui kegiatan ekstrakurikuler Pramuka di SMP Negeri 1 Watulimo, (4) mendiskripsikan upaya mengatasi kendala dalam membangun sikap Nasionalisme melalui kegiatan ekstrakurikuler Pramuka di SMP Negeri 1 Watulimo. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif deskriptif. Lokasi penelitian yang dipilih adalah SMP Negeri 1 Watulimo. Sumber data dalam penelitian ini adalah Guru, Pembina Pramuka, Siswa, dan dokumen. Teknik pengumpulan data menggunakan wawancara, observasi, dan dokumentasi. Analisis data yang digunakan dalam penelitian ini adalah merupakan Metode analisis kualitatif. Hasil temuan penelitian menunjukkan rancangan program ekstrakurikuler pramuka adalah latihan rutin yang dilaksankan setiap hari Sabtu pukul 13.30-16.00, selain kegiatan rutin tersebut ekstrakurikuler memiliki program tambahan yaitu outbond, bakti sosial, dan pramuka peduli lingkungan. Pelaksanaan ekstrakurikuler pramuka ini dilaksanakan sesuai dengan rancangan program yang dibuat oleh dewan penggalang dengan bimbingan pembina pramuka. Upaya yang dilakukandalam mendukung kegiatan kegiatan ekstrakurikuler pramuka dalam rangka membangun sikap nasionalisme siswa ditunjukkan oleh pembina pramuka dengan memberikan rangkaian kegiatan yang menyenangkan, selain itu untuk mendukung kegiatan di luar sekolah, pembina pramuka melakukan kerjasama dengan beberapa pihak yang berhubungan dengan kegiatan kepramukaan seperti kwartir cabang Dalam pelaksanaan kegiatan ekstrakurikuler pramuka mengalami beberapa kendala, kendala tersebut berasala dari faktor intern maupun ekstern, faktor intern yaitu siswa, kurangnya minat dan motivasi siswa menjadi kendala utama karena siswa adalah subjek utama dalam kegiatan ini, faktor ekstern yaitu pembina pramuka, metode penyampaian materi yang kurang variatif yang didominasi dengan ceramah sehingga siswa menjadi jenuh, selain itu dukungan sekolah kurang maksimal. Melihat berbagai kendala tersebut, pembina pramuka dan sekolah berupaya untuk mengatasi kendala tersebut agar kegiatan ekstrakurikuler dapat mencapai tujuan yang diharapkan, upaya tersebut ditunjukkan dengan memberikan sarana dan prasarana sebagai penunjang untuk pelaksanaan kegiatan ekstrakurikuler pramuka. Untuk membangun minat siswa, guru dan pembina pramuka melakukan pendekatan guna memberikan arahan kepada siswa betapa pentingnya mengikuti kegiatan ini.

Dampak perkawinan usia muda terhadap perceraian di Desa Ampeldento Kecamatan Karang Ploso Kabupaten Malang / Yudistya Riska M.

 

Penerapan pendidikan inklusi sebagai upaya penegakan hak asasi manusia di SMP Laboratorium Universitas Negeri Malang / Putri Wahyu Kurniawati

 

Kata kunci: Pendidikan Inklusi, Hak Asasi Manusia Pendidikan merupakan hal yang penting bagi setiap orang untuk menjamin keberlangsungan hidupnya agar lebih bermartabat dan bermanfaat. Karena itu pemerintah memiliki kewajiban untuk memberikan pelayanan pendidikan yang bermutu kepada setiap warganya tanpa terkecuali termasuk mereka yang memiliki perbedaan dalam kemampuan. Seperti yang kita ketahui bahwa di dalam pendidikan inklusi termuat nilai kemanusiaan dan penegakan hak asasi manusia. Inti dari pendidikan inklusi yaitu sistem pendidikan yang terbuka, menerima keberagaman dan menghargai suatu perbedaan. Secara formal menurut undang-undang dan peraturan pemerintah dapat dikatakan bahwa pendidikan inklusi merupakan suatu penegakan hak asasi manusia. Namun yang terpenting adalah bagaimana implementasi sikap pihak-pihak yang mengelola sekolah inklusi itu sendiri, apakah semua pihak memiliki sikap yang postitif, ramah dan tidak mendeskriminasi. SMP Laboratorium UM merupakan tujuan peneliti melakukan penelitian tentang pendidikan inklusi karena SMP laboratorium UM merupakan salah satu sekolah yang menyediakan pelayanan pendidikan inklusi. Tujuan dari penelitian ini adalah: (1) Mengetahui latar belakang penerapan pendidikan inklusi di SMP Laboratorium UM; (2) Mengetahui implementasi pengelola sekolah inklusi dalam upaya penegakan HAM di SMP Laboratorium UM; (3) Mengetahui kendala-kendala pengelola sekolah dalam penerapan inklusi sebagai upaya penegakan HAM di SMP Laboratorium UM; (4) Mengetahui upaya untuk mengatasi kendala-kendala pengelola sekolah dalam penerapan inklusi sebagai upaya penegakan HAM di SMP Laboratorium UM. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan deskriptif dan jenis penelitian kualitatif. Sedangkan Metode analisis data yang digunakan dalam penelitian ini adalah analisi model Miles dan Huberman. Hasil dari penelitian menunjukan bahwa: (1) latar belakang dari pendidikan inklusi di SMP Laboratorium UM awalnya merupakan ketidaksengajaan; (2) Implementasi pengelola sekolah inklusi dalam upaya penegakkan hak asasi manusia dapat dilakukan di dalam kelas maupun di luar kelas inklusi; (3) Kendala-Kendala Pengelola Sekolah dalam Penerapan Inklusi sebagai Upaya Penegakan HAM di SMP Laboratorium Universitas Negeri Malang antara lain Kendala yang Bersumber dari dapat dilihat dari 2 aspek, yang pertama asek kurikulum dan yang kedua aspek saat pembelajaran berlangsung, kendala yang bersumber dari siswa, Kendala yang bersumber dari siswa ABK, kendala yang bersumber dari Guru; (4) Upaya untuk mengatasi kendala-kendala pengelola sekolah dalam penerapan inklusi sebagai upaya penegakan HAM di SMP Laboratorium UM yaitu dengan mengadakan jam pelajaran tambahan (JPT) dan perlakuan yang sama untuk semua siswa Berdasarkan hasil penelitian disarankan (1) Sekolah hendaknya lebih memahami lagi tentang sekolah inklusi; (2) guru harus tetap sabar bila ada kendala yang dialami saat pembelajaran. Guru juga sebaiknya lebih sering memberikan pemahaman tentang perbedaan; (3) siswa lebih harus saling menghormati dan tolong menolong satu sama lainnya; (4) Ada baiknya bila pemerintah menambah jumlah sekolah inklusi yang ada di kota malang  

Keefektifan teknik permainan kelompok untuk meningkatkan keterampilan sosial siswa sekolah dasar kelas III / Retno Ragil Kurniawati Azizah

 

Kata Kunci: efektifitas, permainan kelompok, keterampilan sosial, siswa SD kelas III Keterampilan sosial adalah keterampilan untuk menjalin hubungan dengan orang lain. Keterampilan sosial adalah kemampuan berinteraksi dengan orang lain yang berguna untuk mengembangkan hubungan sosial berkaitan dengan penerimaan masyarakat, yang meliputi aspek emosi dan aspek sosial. Individu yang memiliki keterampilan sosial akan secara mudah menyesuaikan diri dengan orang lain dan lingkungannya. Selain itu individu yang memiliki keterampilan sosial cenderung memiliki teman yang banyak dan popular di dalam kelompok sosialnya. Individu yang tidak memiliki keterampilan sosial akan sering merasa tidak nyaman saat berinteraksi dengan orang lain. Oleh karena itu keterampilan sosial sangat penting untuk dikembangkan. Dalam hal ini teknik permainan kelompok merupakan salah satu upaya untuk meningkatkan keterampilan sosial siswa. Tujuan dari penelitian ini adalah untuk mengetahui efektifitas teknik permainan kelompok untuk meningkatkan keterampilan sosial siswa SD kelas III. Rancangan penelitian ini menggunakan eksperimen semu (quasi experiment design). Subjek penelitian ini adalah siswa kelas IIIA dan IIIB SD Islam Babadan Kabupaten Blitar sebanyak 10 orang siswa sebagai kelompok eksperimen yang dipilih berdasarkan hasil observasi yang mendapatkan nilai terendah dari skala penilaian pedoman observasi. Analisis data yang digunakan dalam penelitian ini adalah statistik inferensial non-parametrik, yaitu uji beda two related tests Wilcoxon. Analisis ini dilakukan untuk mengetahui perbedaan tingkat keterampilan sosial siswa sebelum dan sesudah diberikan treatment dengan teknik permainan kelompok pada kelompok eksperimen. Hasil penelitian menunjukkan bahwa teknik permainan kelompok efektif untuk meningkatkan keterampilan sosial siswa kelas III SD Islam Babadan Kabupaten Blitar. Hal ini ditunjukkan oleh peningkatan skor keterampilan sosial kelompok eksperimen setelah diberikan perlakuan atau treatment dengan menghasilkan nilai Wilcoxon sebesar (z = -2.814a) dengan nilai Asymp. Sig. (2-tailed) sebesar 0.005, sehingga diperoleh nilai probability error (p = 0.005 < 0.05). Kesimpulan penelitian ini adalah teknik permainan kelompok efektif untuk meningkatkan keterampilan sosial siswa SD kelas III. Dari hasil penelitian ini, maka dapat disarankan agar, 1) Guru dapat membantu siswa untuk meningkatkan keterampilan sosialnya dengan menggunakan teknik permainan kelompok, 2) Orang tua dapat membimbing anak, bahwa keterampilan sosial sangat penting dimiliki anak untuk perkembangan kehidupan masa depannya, 3) Sekolah dapat mengembangkan program pembelajarannya melalui permainan kelompok untuk meningkatkan keterampilan sosial, dan 4) Peneliti selanjutnya dapat meneliti efektivitas teknik permainan kelompok untuk meningkatkan keterampilan sosial siswa SD kelas III dengan menggunakan kelompok kontrol sebagai pembanding, sehingga hasil yang diperoleh akan lebih sempurna dan bisa memperkuat hasil penelitian.  

Pemanfaatan video Bang One sebagai sumber belajar PKn pada materi kasus korupsi dan upaya pemberantasan korupsi di Indonesia kelas VIII SMP Negeri 3 Malang / Danang Ferianto

 

Kata Kunci: video Bang One, sumber belajar, PKn. Video Bang One merupakan video kartun karikatur yang memiliki tema reaksi terhadap peristiwa atau kejadian sosial politik. Video Bang One ditayangkan oleh stasiun TV swasta yaitu TVOne pada segmen apa kabar Bang One yang masuk pada sajian berita. Dengan demikian, materi yang terkandung pada video Bang One mengenai suatu peristiwa sosial politik, video Bang One dapat digunakan sebagai sumber belajar PKn yang berhubungan dengan analisis suatu peristiwa atau kejadian, hal ini sesuai dengan dimensi pengetahuan (civic knowledge) bidang studi pendidikan kewarganegaraan yang mencakup politik, hukum dan moral. Sumber belajar dapat berupa apa saja dan dimana saja asal memenuhi kriteria sumber belajar tersebut bermanfaat untuk mencapai sasaran belajar dan dapat digunakan pada pokok bahasan tertentu. Dengan demikian, video Bang One dapat dikategorikan sebagai sumber belajar, karena video Bang One memiliki materi yang dapat digunakan pada pokok bahasan tertentu. Penelitian ini bertujuan untuk : 1) mendeskripsikan alasan mengapa video Bang One dapat dimanfaatkan sebagi sumber belajar PKn pada materi kasus korupsi dan upaya pemberantasan korupsi di Indonesia kelas VIII SMP Negeri 3 Malang, 2) mendeskripsikan rancangan pembelajaran dengan memanfaatkan video Bang One sebagai sumber belajar PKn pada materi kasus korupsi dan upaya pemberantasan korupsi di Indonesia kelas VIII SMP Negeri 3 Malang, 3) mendeskripsikan pelaksanaan pembelajaran dengan memanfaatkan video Bang One sebagai sumber belajar PKn pada materi kasus korupsi dan upaya pemberantasan korupsi di Indonesia kelas VIII SMP Negeri 3 Malang, 4) mendeskripsikan kendala yang ditemui dalam pelaksanaan pembelajaran dengan memanfaatkan video Bang one sebagai sumber belajar PKn pada materi kasus korupsi dan upaya pemberantasan korupsi di Indonesia kelas VIII SMP Negeri 3 Malang, dan 5) mendeskripsikan cara mengatasi kendala dalam pemanfaatan video Bang One sebagai sumber belajar PKn pada materi kasus korupsi dan upaya pemberantasan korupsi di Indonesia kelas VIII SMP Negeri 3 Malang. Penelitian ini menggunakan rancangan penelitian deskriptif kualitatif. Kehadiran peneliti di lapangan adalah untuk mengumpulkan data setepat-tepatnya dari kasus yang diangkat dengan menggunakan prosedur pengumpulan data yaitu metode wawancara, observasi, dan dokumentasi. Lokasi Penelitian ini dilakukan di SMP Negeri 3 Malang yang terletak di Jl. Dr. Cipto No.20 Telp. (0341) 362612 Malang 65111. Sumber data dalam penelitian ini adalah guru PKn dan siswa kelas VIII SMP Negeri 3 Malang. Pengecekan keabsahan data dilakukan dengan, ketekunan pengamatan dan triangulasi. Sedangkan tahap-tahap penelitian meliputi tiga tahap, yaitu tahap persiapan, pelaksanaan, dan pelaporan. Hasil penelitian ini menunjukkan bahwa 1). Alasan video Bang One dimanfaatkan sebagai sumber belajar karena tema (isi) dari video Bang One dirasa sesuai dengan SK dan KD, 2). Rencana pelaksanaan pembelajaran (RPP) dibuat 2 kali pertemuan, sesuai dengan SK dan KD, 3). Pada pertemuan pertama, video Bang One yang ditayangkan guru ada 2 buah, video ditayangkan setelah guru menerangkan 2 pokok bahasan materi. Pada pertemuan kedua, guru melanjutkan materi dari minggu lalu dan menayangakan 2 video Bang One, kegiatan pembelajaran dimulai dari kegiatan pendahuluan-inti-penutup, 4). ada 2 faktor kendala yang ditemui dalam pelaksanaan pemanfaatan video Bang One sebagai sumber belajar PKn, 3 kendala dari faktor dari guru yaitu a). video Bang One memiliki beragam tema, sehingga perlu pemilihan dan perumusan yang tepat mengenai tema dan materi pelajaran, b). alat bantu pemutar video harus tersedia lengkap, untuk itu guru harus mampu mepersiapkan dengan baik, c) karakteristik video Bang One belum mampu dimanfaatkan pada semua materi pelajaran, guru mencari kesesuaian karakteristik materi dengan karakteristik tema video Bang One, sehingga ada hubungan tema yang diangkat video Bang One dengan materi yang dipelajari, dan 2 faktor dari siswa yaitu, a). durasi video yang singkat dan gambar yang lucu, siswa kurang memperhatikan isi (pesan) dari video Bang One, guru melakukan pengulangan pada saat penayangan video Bang One, b). beberapa siswa menuliskan komentar secara asal, pada pertemuan ke-dua, guru menunjuk siswa secara acak untuk maju ke depan kelas membacakan komentarnya mengenai video Bang One yang telah ditayangkan, dari sini diharapkan siswa tidak lagi menuliskan komentarnya secara acak. Peneliti memberi saran kepada guru PKn, sebagai berikut: 1). guru seyogyanya lebih kreatif dan inovatif dalam menentukan sumber belajar dengan memperhatikan karakteristik siswa, 2). guru seyogyanya mempersiapkan dan memeriksa fungsi dari masing-masing peralatan yang digunakan dalam kegiatan belajar mengajar, 3). guru seyogyanya mampu merumuskan materi pelajaran dengan karakteristik sumber belajar yang tepat dan menarik agar siswa merasa senang terhadap mata pelajaran PKn. Sedangkan untuk siswa, 1). Harus bisa berdaptasi terhadap hal baru yang digunakan demi kelancaran kelangsungan proses belajar-mengajar di kelas, 2). Siswa harus menjalankan tugas yang diberikan guru dengan sebaik mungkin demi tercapainya tujuan pembelajaran. Bagi pihak sekolah, harus mampu menciptakan suasana belajar yang menyenangkan sehingga proses pembelajaran dapat mecapai tujuan belajar dengan optimal.

Penanaman sikap nasionalistik melalui mata pelajaran muatan lokal wawasan kebangsaan pada siswa kelas VIII di SMP N 1 Nglegok Kabupaten Blitar / Ivan Nove Ainun Najib

 

Kata Kunci : Sikap Nasionalisme, Muatan Lokal, Wawasan Kebangsaan Mata pelajaran Wawasan Kebangsaan merupakan mata pelajaran muatan lokal wajib pada semua jenjang pendidikan di Kabupaten Blitar sehingga setiap proses aktivitas pembelajaran harus mencerminkan penanaman sikap nasionalisme. Secara garis besar materi pembelajaran mata pelajaran muatan lokal Wawasan Kebangsaan kelas VIII di SMP N 1 Nglegok mengembangkan nilai yang tercermin dalam Pancasila dan UUD 1945. Blitar terkenal sebagai tempat lahir sang Proklamator Ir. Soekarno. Berkaitan dengan itu, untuk menanamkan sikap cinta tanah air seharusnya sejak usia dini sudah dikenalkan keanekaragaman budaya yang dimiliki oleh bangsa Indonesia. Tujuan penelitian ini adalah untuk mengetahui: (1) Latar belakang pemberian mata pelajaran muatan lokal Wawasan Kebangsaan pada siswa kelas VIII di SMP N 1 Nglegok; (2) Program mata pelajaran muatan lokal Wawasan Kebngsaan pada siswa kelas VIII di SMP N 1 Nglegok; (3) Rancangan pembelajaran mata pelajaran muatan lokal Wawasan Kebangsaan pada siswa kelas VIII di SMP N 1 Nglegok; (4) Pelaksanaan pembelajaran mata pelajaran muatan lokal Wawasan Kebangsaan pada siswa kelas VIII di SMP N 1 Nglegok; (5) Kendala yang dihadapi guru dalam menanamkan sikap nasionalisme melalui mata pelajaran muatan lokal Wawasan Kebangsaan pada siswa kelas VIII di SMP N 1 Nglegok; (6) Upaya guru dalam mengatasi kendala dalam menanamkan sikap nasionalisme melalui mata pelajaran muatan lokal Wawasan Kebangsaan pada siswa kelas VIII di SMP Negeri 1 Nglegok. Penelitian ini menggunakan pendekatan deskriptif kualitatif. Lokasi penelitian di SMP N 1 Nglegok Kabupaten Blitar dengan sumber data dari manusia dan dokumen. Teknik pengumpulan data dilakukan dengan menggunakan analisis isi dokumen, observasi partisipatif, wawancara mendalam serta dokumentasi. Kegiatan analisis data dilakukan secara interaktif melalui reduksi data, penyajian data, dan verifikasi. Untuk menjaga keabsahan data dilakukan dengan perpanjangan keikutsertaan, ketekunan pengamatan, triangulasi. Hasil penelitian menunjukkan bahwa : (1) Latar belakang pemberian mata pelajaran muatan lokal Wawasan Kebangsaan pada Siswa Kelas VIII karena akibat dari pengaruh negatif teknologi informasi dan saat ini generasi muda indonesia telah banyak melakukan tawuran. Tujuan mata pelajaran Wawasan Kebangsaan mengembangkan nilai-nilai luhur seperti yang tercermin dalam pancasila dan UUD 1945; (2) Program mata pelajaran muatan lokal Wawasan Kebangsaan termuat dalam KTSP SMP N 1 Nglegok yang membentuk kompetensi siswa untuk : (a)Berpikir kritis, kreatif dan rasional, (b) Berpartisipasi, bertanggung jawab dan bertindak cerdas dalam kegiatan bermasyarakat, berbangsa dan bernegara, (c) Berkembang secara positif dan demokratis untuk membentuk diri siswa yang berkarakter Indonesia, (d) Mengembangkan nilai-nilai luhur seperti tercermin dalam pancasila dan UUD 1945, (e) Selalu setia, patuh terhadap ideologi bangsa pancasila, UUD 1945, dan Negara Kesatuan Republik Indonesia yang berbhineka Tunggal Ika; (3) Rancangan pembelajaran mata pelajaran muatan lokal wawasan kebangsaan dalam Komponen silabus yang dibuat oleh guru terdiri dari satuan pendidikan, mata pelajaran, kelas/semester, tahun pelajaran, standar kompetensi, kompetensi dasar, indikator, materi pembelajaran, kegiatan pembelajaran, penilaian, waktu, dan sumber/alat belajar. Dalam membuat RPP, indikator menyesuaikan dengan SK dan KD. tujuan pembelajaran, menyesuaikan dengan indikator, metode , dan evaluasi. materi pembelajaran, dikembangkan dengan mengaitkan materi sesuai dengan perkembangan yang terjadi dalam masyarakat. Metode pembelajaran ceramah bervariasi, penugasan, dan diskusi kelompok. langkah-langkah pembelajaran disesuaikan dengan kondisi kelas. Penilaian berbentuk tes tulis dan tes lisan; (4) Pelaksanaan pembelajaran Wawasan Kebangsaan belum tercapai maksimal karena siswa ada yang masih belum mengerjakan tugas rumah, ada siswa yang membuat ramai kelas. Serta belum terlihat guru mampu mengkondisikan kelas; (5) Kendala guru dalam menanamkan sikap nasionalisme melalui mata pelajaran Wawasan Kebangsaan dari pihak guru, (a) kurangnya materi mata pelajaran wawasan kebangsaan, (b) guru pelajaran wawasan kebangsaan kurang fokus mengajar, (c) Metode terkadang tidak sesuai dengan kondisi kelas, (d)Alokasi waktu 1 jam pelajaran dalam seminggu, (e) guru masih menggunakan metode ceramah, (f) guru menggunakan perangkat tahun lalu. pihak siswa, (a) Siswa kurang disiplin dan ramai sendiri, (b) untuk berdiskusi, siswa terkadang membicarakan hal diluar materi; (6) Upaya guru mengatasi kendala dalam menanamkan sikap nasionalisme melalui mata pelajaran Wawasan Kebangsaan, (a) guru menambahkan materi PKn kedalam materi pelajaran Wawasan Kebangsaan, (b) Guru berdiskusi dengan guru pelajaran Wawasan Kebangsaan dari SMP lain agar materi nya bertambah, (c) Guru menggunakan Metode pembelajaran yang lebih variatif, (d) Guru membuat metode dengan menyesuaikan karakteristik siswa, (e) Menjadi contoh yang baik untuk siswa dengan kedisiplinan, (f) Guru meningkatkan motivasi belajar siswa, (g) Guru membuat perangkat pembelajaran baru. Berdasarkan temuan penelitian di atas, saran yang diajukan yaitu : (1) diharapkan guru secara kreatif merancang pembelajaran yang menyenangkan sesuai dengan kondisi siswa namun tetap relevan untuk menanamkan sikap nasionalisme kepada siswa, (2) Kepala Sekolah diharapkan dapat selalu memberikan motivasi dan kesempatan kepada guru untuk mengembangkan potensi dan meningkatkan kompetensinya dalam melaksanakan pembelajaran, (3) kepada Kepala Dinas Pendidikan Daerah Kabupaten Blitar, Diharapkan dapat mengembangkan secara rutin pelatihan MGMP Wawasan Kebangsaan, penataran, pelatihan dan workshop bagi guru.

Keefektifan cinema therapy untuk meningkatkan resiliensi siswa sekolah menengah pertama kelas akselerasi / Anisatul Muthi'ah

 

Kata kunci: cinema therapy, resiliensi, akselerasi Pelaksanaan program akselerasi untuk siswa SMP ternyata menyebabkan berbagai masalah, salah satunya berkaitan dengan resiliensi siswa akselerasi. Resiliensi merupakan kemampuan individu yang mencakup pengaturan emosi (emotion regulation), pengendalian dorongan (impulse control), optimis, pengidentifikasian penyebab masalah, empati, efikasi diri (self-efficacy), dan pencapaian kesuksesan (reaching out) yang berguna untuk menghadapi, memperkuat diri, atau bahkan mengubah kondisi kehidupan yang tidak menyenangkan menjadi suatu hal yang wajar untuk diatasi. Resiliensi dapat dipelajari melalui berbagai latihan. Latihan ini bisa diberikan kepada siswa, khususnya siswa SMP akselerasi dengan mengamati orang-orang di sekitarnya yang menjadi role models. Role models dapat berupa symbolic model yang salah satunya berupa film yang dapat diberikan melalui cinema therapy. Penelitian ini bertujuan untuk mengetahui keefektifan cinema therapy untuk meningkatkan resiliensi siswa SMP kelas akselerasi yang dilengkapi dengan pedoman eksperimen. Desain penelitian yang digunakan dalam penelitian ini adalah eksperimen semu, dengan rancangan equivalent time series. Subjek penelitian ini adalah siswa SMP kelas akselerasi yang memiliki resiliensi tergolong rendah dan sangat rendah sebanyak 7 siswa. Instrumen penelitian yang digunakan adalah skala resiliensi yang telah diuji validitas dan reliabilitasnya. Data skala resiliensi dianalisis dengan uji statistik non parametrik Wilcoxon. Hasil uji Wilcoxon menunjukkan adanya perbedaan tingkat resiliensi sebelum dan sesudah pemberian treatment secara berulang dengan nilai z = -2,366 pada tingkat signifikansi 0,018 < 0,05, artinya H0 ditolak. Dapat disimpulkan bahwa cinema therapy efektif untuk meningkatkan resiliensi siswa SMP kelas akselerasi. Berdasarkan hasil penelitian ini, diajukan saran untuk konselor dan peneliti lain. Bagi konselor dapat menggunakan teknik cinema therapy untuk meningkatkan resiliensi siswa SMP kelas akselerasi. Sedangkan untuk peneliti lain jika ingin meneliti dengan variabel yang sama disarankan menggunakan desain lain, seperti single subject design, penelitian eksperimen yang menggunakan kelompok kontrol, dan memperluas subjek penelitian di SMP di Kota Malang yang memiliki kelas akselerasi dengan jenjang berbeda yang berciri memiliki resiliensi rendah dan sangat rendah. Selain itu, cuplikan film pada pedoman eksperimen dalam penelitian ini tidak melalui tahap uji materi. Oleh karena itu, disarankan untuk melakukan uji materi dan media terlebih dahulu dan melatih konselor yang akan menggunakan pedoman eksperimen ini agar pemberian treatment bisa terlaksana dengan tepat.

Hubungan antara persepsi tentang jam pelajaran tambahan dan prerstasi belajar siswa kelas unggulan dan reguler di SMP Laboratorium Universitas Negeri Malang / Christella

 

Kata kunci: prestasi belajar, jam pelajaran tambahan (JPT), kelas unggulan, kelas reguler. Dalam kehidupan, pendidikan memegang peranan penting karena pendidikan merupakan wahana untuk meningkatkan dan mengembangkan kualitas sumber daya manusia. Seiring perkembangan dunia pendidikan yang semakin pesat, menuntut adanya lembaga pendidikan untuk menyesuaikan perkembangan ilmu pengetahuan. Salah satu cara yang dilakukan untuk meningkatkan kualitas pendidikan adalah dengan peningkatan kualitas kegiatan belajar. Pengadaan pelajaran tambahan yang difungsikan untuk mengurangi resiko-resiko yang tidak diinginkan. Sekolah berharap dengan adanya pelajaran tambahan siswa menjadi lebih siap dalam kegiatan belajar mengajar, sehingga siap juga dalam menempuh ujian, baik ujian yang diadakan sekolah maupun ujian yang diadakan pemerintah. Prestasi belajar merupakan proses yang dilakukan dalam mencapai perubahan tingkah laku yang lebih baik dari sebelumnya dan dapat mencapai suatu hasil yang diperoleh setelah melalui aktivitas belajar berupa kemampuan yang memberikan perubahan pada segenap aspek dalam diri siswa. JPT merupakan penambahan jam belajar di luar jam belajar reguler yang biasanya diberikan setelah jam sekolah. Kelas unggulan merupakan pelayanan istimewa yang disediakan oleh sekolah untuk siswa yang memiliki kecerdasan dan bakat yang yang luar biasa. Siswa kelas reguler adalah siswa yang umumnya memiliki kemampuan rata-rata dengan siswa yang lain. Tujuan penelitian ini adalah (1) untuk mengetahui seberapa tinggi persepsi tentang jam pelajaran tambahan (JPT) siswa Kelas Unggulan; (2) untuk mengetahui seberapa tinggi persepsi tentang jam pelajaran tambahan (JPT) siswa Kelas Reguler; (3) untuk mengetahui seberapa tinggi prestasi belajar siswa Kelas Unggulan; (4) untuk mengetahui seberapa tinggi prestasi belajar siswa Kelas 9 Reguler; (5) untuk mengetahui apakah ada hubungan antara persepsi tentang jam pelajaran tambahan (JPT) dan prestasi belajar siswa Kelas Unggulan; (6) untuk mengetahui apakah ada hubungan antara persepsi tentang jam pelajaran tambahan (JPT) dan prestasi belajar siswa Kelas Reguler; (7) untuk mengetahui perbedaan persepsi tentang jam pelajaran tambahan (JPT) siswa Kelas Unggulan dan Reguler; dan (8) untuk mengetahui perbedaan prestasi belajar siswa Kelas Unggulan dan Reguler di SMP Laboratorium UM. Jenis penelitian ini adalah deskriptif korelasional dn komparatif. Penelitian ini dilakukan di SMP Laboratorium Universitas Negeri Malang dengan populasi berjumlah 162 orang untuk siswa kelas reguler dan 16 orang untuk siswa kelas unggulan. Sampelnya berjumlah 110 untuk siswa kelas reguler dan 16 untuk siswa kelas unggulan. Teknik pengambilan sampel yang digunakan dalam penelitian ini adalah simpel random sampling. Teknik pengumpulan data dalam penelitian ini menggunakan instrumen angket dan dokumentasi. Teknik analisis data yang digunakan adalah analisis deskriptif, korelasi product moment, dan analisis uji beda t test untuk sampel tidak berhubungan. Hasil penelitian menunjukkan bahwa (1) tingkat persepsi tentang Jam Pelajaran Tambahan (JPT) siswa Kelas Unggulan termasuk dalam klasifikasi tinggi; (2) tingkat persepsi tentang JPT siswa Kelas Reguler termasuk dalam klasifikasi tinggi; (3) tingkat prestasi belajar siswa Kelas Unggulan termasuk dalam klasifikasi baik.; (4) tingkat prestasi belajar siswa Kelas Reguler termasuk dalam klasifikasi cukup; (5) tidak ada hubungan yang signifikan antara persepsi tentang JPT dan prestasi belajar siswa Kelas Unggulan; (6) tidak ada hubungan yang signifikansi antara persepsi tentang JPT dan prestasi belajar siswa Kelas Reguler; (7) tidak ada perbedaan yang signifikan antara JPT siswa Kelas Unggulan dan Reguler; dan (8) ada perbedaan yang signifikan antara prestasi belajar siswa Kelas Unggulan dan Reguler di SMP Laboratorium UM. Saran-saran yang dapat dikemukakan (1) bagi kepala SMP Laboratorium UM penelitian ini dapat dijadikan masukan dalam pelaksanaan proses pembelajaran agar prestasi belajar antara siswa kelas unggulan dan kelas reguler dapat lebih meningkat kemampuan akademiknya, dan pelaksanaan JPT siswa kelas 9 di SMP Laboratorium UM lebih diperhatikan dalam proses pembelajarannya agar siswa mengerti akan tujuan diadakannya JPT. Sehingga siswa dapat lebih memanfaat pelaksanaan JPT untuk mengoptimalkan prestasi belajar; (2) bagi guru SMP Laboratorium UM dapat menjadi masukan agar siswa memperhatikan dan meningkatkan proses pembelajaran khususnya untuk variasi dan inovasi yang dilakukan dalam mengajar; (3) bagi siswa unggulan agar lebih menggali potensi yang ada dalam dirinya sehingga pelaksanaan JPT dapat membantu meningkatkan prestasi belajar; (4) bagi siswa reguler dapat memanfaatkan waktu dan kesempatan dalam pelaksanaan JPT sehingga dapat membantu meningkatkan prestasi belajar di sekolah; dan (5) bagi peneliti lain penelitian ini dapat dijadikan bahan referensi dan masukan untuk penelitian selanjutnya, dalam hal pengaruh pengadaan sarana prasarana JPT, pengaruh kinerja guru dalam pelaksanaan JPT yang dikaitkan dengan prestasi belajar siswa.

Manajemen sarana dan prasarana Sekolah Menengah Kejuruan (SMK) Negeri 2 Turen Kabupaten Malang / Alinda Qusmaitika

 

Kata kunci: manajemen, sarana dan prasarana Sebagai lembaga pendidikan, sekolah memerlukan dukungan sarana dan prasarana pendidikan karena sarana dan prasarana pendidikan merupakan aspek yang sangat penting dalam menunjang proses pendidikan di sekolah. Kelengkapan sarana dan prasarana harus dipenuhi dan diperbaharui secara berkelanjutan berdasarkan kebutuhan dan sesuai dengan perkembangan zaman. Oleh karena itu manajemen sarana dan prasarana bertujuan untuk memberikan layanan secara profesional dalam bidang perlengkapan atau fasilitas kerja bagi personil sekolah. Fokus permasalahan penelitian ini adalah (1) proses manajemen sarana dan prasarana di SMKN 2 Turen; (2) faktor pendukung dalam proses manajemen sarana dan prasarana di SMKN 2 Turen; (3) faktor penghambat dalam proses manajemen sarana dan prasarana di SMKN 2 Turen; (4) upaya mendayagunakan faktor pendukung dalam proses manajemen sarana dan prasarana di SMKN 2 Turen; (5) upaya mengatasi faktor penghambat dalam proses manajemen sarana dan prasarana di SMKN 2 Turen. Tujuan penelitian ini adalah untuk mendeskripsikan tentang (1) proses manajemen sarana dan prasarana di SMKN 2 Turen; (2) faktor pendukung dalam proses manajemen sarana dan prasarana di SMKN 2 Turen; (3) faktor penghambat dalam proses manajemen sarana dan prasarana di SMKN 2 Turen; (4) upaya mendayagunakan faktor pendukung dalam proses manajemen sarana dan prasarana di SMKN 2 Turen; (5) upaya mengatasi faktor penghambat dalam proses manajemen sarana dan prasarana di SMKN 2 Turen. Penelitian ini dilakukan di Sekolah Menengah Kejuruan (SMK) Negeri 2 Turen Kabupaten Malang. Pendekatan yang digunakan dalam penelitian ini adalah pendekatan kualitatif, jenis studi kasus tunggal. Penelitian ini dilakukan tanpa mempengaruhi subjek penelitian dan dilakukan langsung di lapangan. Untuk mengumpulkan data yang relevan guna menjawab fokus penelitian, maka skripsi ini menggunakan beberapa teknik pengumpulan data yaitu wawancara, observasi, dan studi dokumentasi. Temuan hasil penelitian diperoleh sebagai berikut: (1) proses manajemen sarana dan prasarana yaitu: (a) perencanaan sarana dan prasarana dilakukan setiap satu tahun sekali dan lima tahun sekali dengan mengacu pada visi, misi, kebijakan mutu sekolah, dan sasaran mutu sarana dan prasarana; (b) pengadaan sarana dan prasarana bukan hanya tugas bidang manajemen sarana prasarana sekolah, melainkan melibatkan semua Kaprog (Kepala Program) jurusan yang ada di sekolah; (c) inventarisasi dibedakan menjadi dua yaitu barang milik pemerintah dan barang bukan milik pemerintah, dengan prosedur pelaksanaan yang sesuai dengan ketentuan masing-masing: (d) pendistribusian dilakukan secara langsung dan tidak langsung; (e) perawatan sarana dan prasarana dilakukan secara kontinyu, kondisional, dan berkala serta disesuaikan dengan jenisnya yaitu perawatan gedung, perawatan lingkungan, dan perawatan perabot atau peralatan; (f) pelaporan sarana dan prasarana dilaksanakan setiap tiga bulan sekali (triwulan) dengan merekapitulasi semua laporan kegiatan yang telah dilakukan: (g) penghapusan sarana dan prasarana dibedakan menjadi dua yaitu penghapusan barang milik pemerintah dan penghapusan barang bukan milik pemerintah dengan prosedur yang berbeda; (2) faktor pendukung dalam proses manajemen sarana dan prasarana adalah (a) penerapan SMM ISO 9001:2008; (b) lahan yang luas; (c) memiliki staf khusus bidang sarana dan prasarana dan keterlibatan seluruh personil sekolah; (3) faktor penghambat dalam proses manajemen sarana dan prasarana adalah (a) penghapusan sarana dan prasarana yang masih belum maksimal; (b) belum adanya ruang khusus bidang sarana dan prasarana; (4) upaya mendayagunakan faktor pendukung dalam proses manajemen sarana dan prasarana adalah (a) menjalin komunikasi dan koordinasi dengan baik; (b) melakukan perbaikan secara berkelanjutan; (c) selalu menerima saran dan kritik; (5) upaya mengatasi faktor penghambat dalam proses manajemen sarana dan prasarana adalah (a) melakukan penghapusan sarana dan prasarana yang sudah tidak befungsi secepatnya; (b) pengadaan ruang khusus untuk tim sarana dan prasarana. Berdasarkan penelitian ini, dapat disarankan kepada: (1) kepala SMKN 2 Turen agar melakukan tindakan pemberian penghargaan terhadap kinerja dari personil yang mampu melaksanakan perawatan sarana dan prasarana dengan baik; (2) diharapkan tim sarana dan prasarana memberikan penyuluhan terhadap siswa-siswi yang ada dan semua personil sekolah mengenai kesadaran saling memiliki sarana dan prasarana yang ada; (3) bagi pihak terkait yaitu Kepala Pangkalan Tentara Nasional Indonesia Angkatan Laut (LANAL) disarankan mampu menjalin kerjasama yang lebih intensif dan efektif dengan SMKN 2 Turen Kabupaten Malang.

Manajemen kurikulum berbasis lingkungan hidup (Studi kasus di SDN Panggungrejo 04 Kepanjen Kabupaten Malang) / Ana Makhfiyah

 

Kata Kunci: manajemen kurikulum, berbasis lingkungan hidup Pembangunan nasional pada hakekatnya merupakan pembangunan manusia Indonesia yang berkualitas. Salah satu upaya yang strategis untuk meningkatkan kualitas manusia Indonesia yakni melalui pendidikan. Kualitas pendidikan berkaitan erat dengan sumber daya manusia yang berkualitas pula. Upaya yang strategis untuk meningkatkan kualitas manusia Indonesia yakni melalui pendidikan dan kesehatan. Upaya ini paling tepat dilakukan melalui institusi pendidikan yakni sekolah. Melalui pendidikan yang dilaksanakan di setiap sekolah, program lingkungan hidup dapat diimplementasikan dalam kurikulum sekolah. Implementasi program lingkungan hidup dalam kurikulum diharapkan dapat menciptakan perubahan, baik perubahan sikap maupun pengetahuan serta mampu membentuk kepribadian peserta didik untuk menjadi lebih baik. Upaya yang dilakukan sekolah untuk mewujudkan kepedulian peserta didik terhadap lingkungan hidup yakni, sekolah berupaya untuk memasukkan program lingkungan hidup ke dalam kurikulum. Pendidikan diarahkan untuk pencapaian tujuan nasional yang telah digariskan di dalam Undang-Undang Republik Indonesia Nomor 20 Tahun 2003 tentang Sistem Pendidikan Nasional Pasal 3 Ayat 1 menyatakan, bahwa “Pendidikan nasional berfungsi mengembangkan kemampuan dan membentuk watak serta peradaban bangsa yang bermartabat dalam rangka mencerdaskan kehidupan bangsa, bertujuan untuk berkembangnya potensi peserta didik agar menjadi manusia yang beriman dan bertakwa kepada Tuhan Yang Maha Esa, berakhlak mulia, sehat, berilmu, cakap, kreatif, mandiri, dan menjadi warga negara yang demokratis serta bertanggung jawab”. Lebih dari itu sekolah juga merupakan wahana pembelajaran sebagai pembentuk kepribadian peserta didik yang tidak hanya menekankan pada kecerdasan intelektual tetapi juga membentuk kecerdasan emosional. Kecerdasan emosional ini diantaranya membentuk sikap atau perilaku untuk peduli terhadap lingkungan. Dalam pelaksanaannya Kementerian Negara Lingkungan Hidup bekerjasama dengan Kementerian Pendidikan dan Kebudayaan untuk mengimplementasikan program lingkungan hidup dalam kurikulum di sekolah. Penelitian ini memiliki fokus yaitu: (1) perencanaan kurikulum berbasis lingkungan hidup; (2) pengorganisasian kurikulum berbasis lingkungan hidup; (3) pelaksanaan kurikulum berbasis lingkungan hidup; (4) evaluasi kurikulum berbasis lingkungan hidup; dan (5) faktor penghambat dan faktor pendukung dalam pelaksanaan kurikulum berbasis lingkungan hidup. Penelitian ini menggunakan pendekatan kualitatif dengan rancangan studi kasus karena studi kasus berusaha mengungkap secara deskriptif suatu fenomena atau kejadian di suatu lokasi yang mengutamakan kealamiahan atau natural. Teknik pengambilan data yang digunakan dalam penelitian ini meliputi: (1) wawancara; (2) observasi; dan (3) dokumentasi. Adapun teknik yang digunakan untuk mengecek keabsahan data meliputi: (1) ketekunan pengamatan; (2) triangulasi; dan (3) pengecekan data. Kesimpulan penelitian yang dihasilkan yaitu: (1) kegiatan perencanaan kurikulum di SDN Panggungrejo 04 Kepanjen meliputi pembentukan tim penyusunan kurikulum, perencanaan kurikulum dan dokumen kurikulum. Mekanisme penyusunan kurikulum berbasis lingkungan hidup di SDN Panggungrejo 04 Kepanjen sudah sesuai dengan penyusunan kurikulum tingkat satuan pendidikan (KTSP); (2) kegiatan pengorganisasian kurikulum berbasis lingkungan hidup di SDN Panggungrejo 04 Kepanjen dilakukan secara terintegrasi dengan lingkungan hidup pada semua mata pelajaran. Sedangkan untuk muatan lokal yakni mata pelajaran pendidikan lingkungan hidup dilakukan secara monolitik; (3) pelaksanaan kurikulum berbasis lingkungan hidup di SDN Panggungrejo 04 Kepanjen dapat diketahui dalam kegiatan belajar mengajar di dalam kelas; (4) evaluasi terhadap kurikulum berbasis lingkungan hidup dilakukan dengan cara mengevaluasi kurikulum di sekolah melalui jurnal kegiatan harian guru dan buku penilaian peserta didik. Sedangkan untuk mengevaluasi kurikulum berbasis lingkungan hidup, kepala sekolah memantau secara langsung kegiatan belajar mengajar di kelas dan melihat hasil pekerjaan peserta didik di kelas serta menanyakan secara langsung kepada peserta didik mengenai mata pelajaran yang sudah diajarkan oleh guru. Selain itu evaluasi kurikulum di sekolah juga dilaksanakan pada akhir tahun ajaran baru yang dilakukan oleh semua guru dan kepala sekolah; dan (5) faktor pendukung dalam pelaksanaan kurikulum berbasis lingkungan hidup di SDN Panggungrejo 04 Kepanjen yakni adanya dukungan dari orang tua peserta didik dan juga adanya dukungan dari dinas yang terkait. Kemudian faktor penghambat dalam pelaksanaan kurikulum berbasis lingkungan hidup yakni pihak sekolah kurang mensosialisasikan pendidikan lingkungan hidup kepada warga sekolah khususnya kepada orang tua peserta didik. Saran yang bisa disampaikan dari hasil penelitian ini yakni bagi (1) kepala Sekolah SDN Panggungrejo 04 Kepanjen, dapat dijadikan sebagai bahan acuan untuk melakukan program adiwiyata yang dilaksanakan melalui kurikulum sekolah dalam penyelenggaraan pendidikan agar lebih baik lagi. Dengan adanya manajemen kurikulum yang baik diharapkan dapat meningkatkan prestasi peserta didik, baik prestasi akademik maupun non akademik; (2) guru SDN Panggungrejo 04 Kepanjen diharapkan dapat meningkatkan pelaksanaan kegiatan belajar mengajar yang sudah terintegrasi dengan lingkungan hidup agar kegiatan belajar mengajar di dalam kelas dapat dilaksanakan dengan lebih baik lagi; (3) ketua Jurusan Administrasi Pendidikan diharapkan dapat menjadi referensi dalam ruang lingkup yang memiliki keterkaitan dengan manajemen kurikulum berbasis lingkungan hidup; dan (4) peneliti lain juga dapat melakukan penelitian sejenis dalam manajemen kurikulum berbasis lingkungan hidup pada berbagai aspek dengan latar belakang sekolah yang berbeda.

Implementasi program perenting dalam lembaga PAUD An-Nurlaili Desa Sumber Poh Kecamatan Maron Kabupaten Probolinggo / Uswatun Hasanah

 

Kata kunci: Implementasi, Program Parenting, PAUD. Praktek Kerja Industri (Prakerin) adalah program wajib yang diselenggarakan oleh sekolah menengah kejuruan dan pendidikan luar sekolah serta wajib diikuti oleh siswa/warga belajar. Kualifikasi tempat Prakerin memiliki pengaruh terhadap keterpenuhan kompetensi Prakerin siswa. Tempat Prakerin yang baik mampu meningkatkan perolehan kompetensi Prakerin. Penelitian ini bertujuan untuk (1) mendeskripsikan perolehan kompetensi berdasarkan kurikulum yang dicapai oleh siswa kelas XI jurusan Mesin Otomotif-Teknik Kendaraan Ringan SMK Negeri 12 Malang yang melaksanakan Praktek Kerja Industri (Prakerin) di bengkel resmi, (2) mendeskripsikan perolehan kompetensi berdasarkan kurikulum yang dicapai oleh siswa kelas XI jurusan Mesin Otomotif-Teknik Kendaraan Ringan SMK Negeri 12 Malang yang melaksanakan Praktek Kerja Industri (Prakerin) di bengkel tidak resmi dan (3) mengetahui apakah ada perbedaan yang signifikan antara perolehan kompetensi Praktek Kerja Industri (Prakerin) pada bengkel resmi dengan bengkel tidak resmi oleh siswa kelas XI jurusan Mesin Otomotif - Teknik Kendaraan Ringan SMK Negeri 12 Malang. Jenis penelitian ini ditinjau dari tujuannya merupakan penelitian kuantitatif yang menggunakan rancangan penelitian deskriptif dan komparatif. Populasi penelitian ini adalah siswa kelas XI program keahlian Teknik Mekanik Otomotif tahun pelajaran 2011/2012 yang melaksanakan praktek kerja industri (Prakerin) yang berjumlah 144 orang siswa, yang terdiri dari 11 siswa yang melaksanakan Prakerin di bengkel resmi dan 133 siswa yang melaksanakan Prakerin di bengkel tidak resmi. Sedangkan sampel pada penelitian ini berjumlah 44 responden, dengan rincian 11 siswa yang melaksanakan Prakerin di bengkel resmi dan 33 siswa yang melaksanakan Prakerin di bengkel tidak resmi yang diambil dengan cara Teknik Random Sampling. Hasil penelitian menunjukkan dari 11 orang sebagai responden yang prakerin di bengkel resmi, terdapat 8 orang (72,73%) yang memiliki perolehan kompetensi tinggi, yang berada dalam kategori sedang sebanyak 3 orang (27,27%) sedangkan yang berada dalam kategori rendah sebanyak 0 orang (0%) dan dari 33 orang responden yang prakerin di bengkel tidak resmi, terdapat 7 orang (21,21%) yang memiliki perolehan kompetensi tinggi, yang berada dalam kategori sedang sebanyak 22 orang (66,67%) sedangkan yang berada dalam kategori rendah sebanyak 4 orang (12,12%). Dari hasil penelitian tersebut, dapat diperoleh kesimpulan bahwa perolehan kompetensi siswa yang prakerin di bengkel resmi lebih tinggi jika dibandingkan dengan perolehan kompetensi siswa yang prakerin di bengkel tidak resmi. Dan sebaliknya perolehan kompetensi siswa yang prakerin di bengkel tidak resmi lebih rendah jika dibandingkan dengan perolehan kompetensi siswa yang prakerin di bengkel resmi. Dari hal di atas dapat diambil kesimpulan bahwa ada perbedaan perolehan kompetensi siswa SMK Negeri 12 jurusan mekanik otomotif-teknik kendaraan ringan yang melaksanakan prakerin di bengkel resmi dan bengkel tidak resmi.

Hubungan pekerjaan orang tua dengan motivasi orang tua memilih lembaga Pendidikan Anak Usia Dini (PAUD) di bawah Yayasan Pendidikan Muslimat Nahdlatul Ulama (YPMNU) di Kecamatan Lumajang Kabupaten Lumajang / Ulil Inayah

 

Kata kunci: pekerjaan, motivasi orang tua, lembaga PAUD Pekerjaan merupakan suatu aktivitas yang dilakukan seseorang dengan tujuan tertentu yang nantinya akan mendapat upah/gaji dari yang dikerjakan. Motivasi diartikan sebagai dorongan yang berasal dari diri (intrinsik) maupun luar (ekstrinsik) untuk menggerakkan seseorang dengan perubahan perilaku untuk mencapai tujuan tertentu. Motivasi intrinsik terdiri dari kebutuhan dan minat, motivasi ekstrinsik terdiri dari pengaruh lingkungan, prestise, dan faktor ekonomi. Tujuan penelitian ini adalah untuk mengetahui hubungan antara pekerjaan orang tua dengan motivasi memilih lembaga PAUD di bawah YPMNU di Kecamatan Lumajang-Kabupaten Lumajang. Penelitian ini termasuk penelitian korelasional dengan pendekatan kuantitatif. Penelitian ini terdiri dari dua variabel yaitu pekerjaan (X) dan motivasi (Y) yang dijabarkan dalam sub-sub motivasi dilihat dari aspek kebutuhan (Y1), minat (Y2), pengaruh lingkungan (Y3), prestise (Y4), faktor ekonomi (Y5). Populasi penelitian ini adalah orang tua wali murid berjumlah 108 responden dengan jumlah sampel berjumlah 54 responden. Teknik pengambilan sampel yang digunakan adalah random sampling. Teknik pengumpulan data menggunakan angket dan dokumentasi. Teknik analisis data menggunakan analisis deskriptif dan korelasi point serial. Hasil penelitian menunjukkan (1) orang tua yang memilih lembaga PAUD di bawah YPMNU di Kecamatan Lumajang-Kabupaten Lumajang sebagian besar bekerja sebagai swasta sebanyak 23 orang dengan persentase 42,6% (2) tingkat motivasi orang tua umumnya tinggi, motivasi dari aspek kebutuhan, pengaruh lingkungan, dan prestise tergolong tinggi, motivasi dari aspek minat dan faktor ekonomi tergolong sangat tinggi (3) tidak terdapat hubungan antara pekerjaan orang tua dengan motivasi secara umum, motivasi dilihat dari aspek kebutuhan, minat, prestise,dan faktor ekonomi memilih lembaga PAUD di bawah YPMNU di Kecamatan Lumajang-Kabupaten Lumajang dikarenakan ada variabel yang lebih dominan misalnya faktor ideologi, madzab, yang dianut oleh responden, pemilihan sampel yang homogen (4) terdapat hubungan yang signifikan antara pekerjaan orang tua dengan motivasi dilihat dari aspek pengaruh lingkungan memilih lembaga PAUD di bawah YPMNU di Kecamatan Lumajang-Kabupaten Lumajang. Saran-saran yang dapat dikemukakan sehubungan dengan hasil penelitian yang diperoleh adalah (1) bagi lembaga PAUD, hasil penelitian lingkungan memiliki hubungan yang lebih yaitu korelasi sebesar 2,62, maka perbaikan baik sarana prasarana pembelajaran sangat dianjurkan, lembaga hendaknya melakukan publikasi untuk lebih mengenalkan lembaga PAUD kepada masyarakat sekitar melalui tenaga pendidik atau media lain dan tetap mempertahakan ciri khas lembaga agar masyarakat tidak ragu untuk mempercayakan anaknya di lembaga PAUD tersebut dan tetap menjadi pilihan masyarakat. (2) karena hasil tingkat motivasi orang tua tinggi, maka bagi orang tua tetap mempertahankan motivasinya pemenuhan dalam pendidikan anak (3) bagi peneliti selanjutnya, lebih teliti dalam memilih variabel penelitian, dalam pembuatan instrumen lebih mengena kepada responden, penentuan sampel lebih diperhatikan, dalam penelitian ini sampelnya memiliki karakteristik yang homogen (memiliki ideologi, mahdzab, yang sama) sehingga untuk selanjutnya sampel lebih heterogen, karena ketiga komponen tersebut natinya akan berpengaruh pada hasil penelitian.

Pengelolaan program kelompok bermain (Studi kasus di KB Muslimat NU 14 Polowijen Kecamatan Blimbing Kota Malang) / Achmad Pradana Purnama

 

Kata Kunci : pengelolaan, kelompok bermain (KB). Pengelolaan program Kelompok Bermain (KB) merupakan usaha bersama untuk mencapai tujuan yang baik serta dapat berguna untuk orang lain. Pengelolaan meliputi hal-hal yang menyangkut penyelenggaraan program mulai dari perencanaan sampai evaluasi kelompok bermain. Program kelompok bermain sekarang ini dirasa penting dalam pembelajaran sebelum memasuki jenjang berikutnya karena anak dapat bereksplorasi sesuai dengan minat karakteristik anak masing-masing. Kelompok Bermain Muslimat NU 14 yang berlokasi di Kecamatan Blimbing Kota Malang yang berjalan selama 7 tahun, namun sudah mengalami banyak perubahan baik positif maupun negatif, oleh karena itu perlu diketahui pengelolaan KB Muslimat NU 14 sebagai wadah pendidikan untuk anak usia dini. Penelitian ini bertujuan untuk mendeskripsikan pengelolaan dalam program Kelompok Bermain yang meliputi 5 tahap yaitu tahap perencanaan, tahap pengorganisasian, tahap pelaksanaan, tahap pengawasan, dan tahap evaluasi program. Pengelolaan tersebut dibagi dalam sumber daya manusia, sarana dan prasarana, pembiayaan, administrasi, dan pembelajaran. Peneliti ingin melaksanakan tahapan penelitian secara mendalam dengan metode penelitian deskriptif yang terarah melalui pendekatan studi kasus tertuju pada pengelolaan program KB pada KB-TK Muslimat NU 14 Polowijen. Alat pengumpul data yang digunakan adalah pedoman wawancara dan analisis yang digunakan adalah analisis deskriptif yang mendeskripsikan dan menggambarkan pengumpulan data dalam bentuk narasi atau uraian. Hasil penelitian ini menunjukan bahwa pengelolaan program Kelompok Bermain pada tahap perencanaan tidak ada kriteria untuk penentuan pengelola dan pendidik. Pada tahap pengorganisasian dirasa masih rendah karena tidak ada spesifikasi khusus dalam pengelompokan struktur organisasi. Pada tahap pelaksanaan sempat terjadi penurunan warga belajar karena pergantiaannya tenaga pendidik dan masih kurangnya dalam buku keadministrasian seperti buku inventaris barang. Pada tahap pengawasan hanya sekali saja dikunjungi pengawas TK/SD sehingga menjadi masalah informasi untuk pengakreditasian. Tahap evaluasi masih mengalami beberapa kekurangan mulai dari keterlambatan tenaga pendidik dalam menyerahkan tugas karena juga mengenyam jenjang S1 dan dalam proses belajar kurang kreatifnya tenaga pendidik dalam memanfaatkan media belajar sekitas karena kurangnya pelatihan dari dinas pendidikan.

Hubungan pekerjaan orang tua dengan tingkat partisipasi dalam parenting education di PAUD Tunas Cendekia 17-2 Kota Madiun / R. Anggia Listyaningrum

 

Kata kunci: pekerjaan orang tua, tingkat partisipasi, parenting education Pendidikan anak usia dini (PAUD) merupakan salah satu topik penting dalam dunia pendidikan. Pelaksanaan pendidikan anak usia dini tidak hanya tanggung jawab sekolah saja, tetapi peran orang tua dalam keluarga juga menjadi faktor yang penting. Untuk itu setiap orang tua harus memiliki kemampuan, keterampilan dan pengetahuan tentang bagaimana mendidik anak usia dini. Sesuai dengan kebutuhan orang tua tersebut maka dilaksanakanlah program parenting education di sekolah. Tingkat partisipasi orang tua dalam kegiatan parenting education masih terkendala dengan adanya perbedaan pekerjaan yang dimiliki oleh orang tua masing-masing peserta didik. Pekerjaan yang dimaksud adalah matapencaharian orang tua sehari-hari yang meliputi pegawai negeri dan swasta. Penelitian ini bertujuan untuk mengetahui hubungan antara jenis pekerjaan orang tua dengan tingkat partisipasi dalam parenting education baik berupa tenaga, pikiran/pendapat, dan uang. Penelitian ini termasuk penelitian kuantitatif dengan rancangan penelitian korelasional, yaitu mencari hubungan antara variabel X (jenis pekerjaan orang tua) dengan variabel Y (tingkat partisipasi). Metode pengumpulan data yang digunakan adalah kuesioner/angket. Sampel dalam penelitian ini yaitu orang tua peserta didik PAUD Tunas Cendekia 17-2 Kota Madiun sebanyak 60 orang. Analisis data yang digunakan adalah analisis data kuantitatif yang bersifat korelasional dengan menggunakan teknik point serial. Hasil penelitian menunjukkan bahwa: (1) orang tua peserta didik yang bekerja sebagai pegawai negeri sebanyak 24 orang atau 40%, sedangkan yang bekerja swasta sebanyak 36 orang atau 60%, (2) dari pengujian hipotesis diketahui tidak ada hubungan antara jenis pekerjaan orang tua dengan tingkat partisipasi, dengan hasil t hitung 1,31 < t tabel 2,00, (3) tidak ada hubungan antara jenis pekerjaan orang tua dengan tingkat partisipasi berupa tenaga, dengan hasil t hitung 1,31 < t tabel 2,00, (4) tidak ada hubungan antara jenis pekerjaan orang tua dengan tingkat partisipasi berupa pikiran/pendapat, dengan hasil t hitung 0,61 < t tabel 2,00, dan (5) tidak ada hubungan antara jenis pekerjaan orang tua dengan tingkat partisipasi berupa uang, dengan hasil t hitung 0,30 < t tabel 2,00. Peneliti mengemukakan saran sebagai berikut: (1) bagi lembaga PAUD Tunas Cendekia 17-2, diharapkan mampu menemukan metode baru dalam meningkatkan partisipasi orang tua dalam pelaksanaan parenting. Misalnya dengan membuat perjanjian dengan orang tua saat awal memasukkan anak mereka dalam PAUD yang isinya menunjukkan bahwa orang tua diwajibkan berpartisipasi pada setiap kegiatan parenting yang diadakan sekolah, dan membuat majalah sekolah tentang parenting education yang dilaksanakan di sekolah dan dikemas secara menarik dan dibagikan pada seluruh orang tua peserta didik agar mereka tertarik untuk mengikuti parenting education di sekolah, (2) bagi orang tua, diharapkan memiliki kesadaran untuk meluangkan waktunya dalam mengikuti parenting education, karena faktor kesadaran diri seseorang lebih berpengaruh pada tingkat partisipasinya terhadap suatu kegiatan. Selain itu diharapkan dari masing-masing orang tua untuk mengajak orang tua lain dalam parenting education, karena selain kesadaran diri sendiri pengaruh lingkungan juga berkaitan dengan partisipasi seseorang, (3) bagi peneliti selanjutnya yang ingin mengembangkan penelitian sejenis hendaknya memperluas ruang lingkup penelitian dengan membagi pekerjaan lebih dari dua kategori, melakukan pemilihan intsrumen dengan tepat, pembuatan instrumen dengan teliti, melakukan validitas isi dan konstruk pada instrumen dan lebih fokus saat pengumpulan data karena hal itu dapat berpengaruh pada hasil dari penelitian yang dilakukan.

Reading ability of eight graders and teaching reading strategy in SMP N 2 Malang / Cindy Swastika

 

Kata kunci : kemampuan membaca, reguler, bilingual Bahasa Inggris adalah salah satu mata pelajaran yang diajarkan di Indonesia. Bahasa Inggris merupakan pelajaran utsma di sekolah seperti SD, SMP, dan SMA. Di dalam ujuian nasional, Bahasa Inggris, menjadi salah satu mata pelajaran penentu kelulusan seorang murid. Dengan kata lain bahasa Inggris merupakan mata pelajaran yang sangat penting. Kemampuan dalam menggunakan Bahasa Inggris sangat penting. Ada empat macam keahlian dalam bahasa Inggris yang seorang murid harus pelajari. Diantaranya, membaca, mendengarkan, berbicara dan menulis. Masing-masing keahlian memegang peranan penting. Tetapi, dalam pendidikan, sepertinya keahlian membaca yang memegang peranan yang lebih besar. Buktinya ialah, dalam ujian nasional, soal yang diujikan kebanyakan hanya menguji kemampuan membaca murid. Dalam rangka mengoptimalkan kemampuan membaca Bahasa Inggris seorang murid, banyak sekolah yang menyediakan kelas bilingual disamping kelas reguler. Di sekolah tersebut memberikan berbagai macam program tambahan untuk kelas bilingual. Diharapkan bahwa kelas bilingual tersebut dapat meraih prestasi yang lebih tinggi. Dengan melihat fenomena ini, akhirnya peneliti memilih untuk mengangkatnya ke dalam penelitian. Penelitian ini dilaksanakan dengan menggunakan metode deskriptif kualitatif. Peneliti mencoba untuk mengidentifikasi, memecahkan masalah dan menjabarkan kemampuan membaca dan strategi mengajar reading yang digunakan di SMPN 2 Malang. Instrument yang digunakan dalam penelitian ini adalah catatan lapangan, interview, kuesioner dan tes. Penemuan data menunjukkan bahwa (1 )kemampuan membaca bahasa Inggris kelas 8 bilingual lebih tinggi dari pada kelas reguler. (2) strategi mengajar membaca yang digunakan guru kelas bilingual hampir sama dengan guru kelas reguler. Akan tetapi ada beberapa strategi yang tidak digunakan oleh guru kelas reguler. Begitu pula sebaliknya.(3) Terdapat beberapa program tambahan yang diperuntukkan khusus murid- murid kelas bilingual Akhirnya, disarankan kepada guru untuk tidak menggunakan strategy yang sama di setiap saat. Guru – guru bisa saling berbagi strategy yang mereka rasa bisa meningkatkan kemampuan membaca murid. Penelitian ini diharapkan dapat membantu kepala sekolah dalam menentukan kebijakan untuk meningkatkan prestasi murid.

Ketatalaksanaan dan strategi pendidikan dan latihan dasar-dasar perkoperasian di UPT Diklat Koperasi dan UMKM Jawa Timur / Wahyu Habiyan Setiawan

 

Setiawan, Wahyu H. Ketatalaksanaan dan Strategi Pendidikan dan Latihan Dasar-dasar Perkoperasian di UPT Diklat Koperasi dan UMKM Jawa Timur. Skripsi, Jurusan Pendidikan Luar Sekolah, Fakultas Ilmu Pendidikan, Universitas Negeri Malang. Pembimbing (I) Dr. H. M. Ishaq, M.Pd, (II) Drs. Urib Urbiyanto, M.S. Kata Kunci: tatalaksana, strategi, diklat, koperasi     Diklat merupakan hal penting bagi karyawan baru ataupun yang sudah bekerja sebagai upaya peningkatan kinerja, perbaikan sumber daya manusia, dan perkembangan koperasi di Indonesia. Salah satu lembaga yang bergerak di bidang pelatihan ialah UPT Diklat Koperasi dan UMKM Jawa Timur.     Fokus penelitian ini adalah tatalaksana dan strategi diklat koperasi tentang dasar-dasar perkoperasian. Tujuan penelitian ini mendeskripsikan tentang ketatalaksanaan diklat, skenario diklat dasar-dasar perkoperasian, dan metode yang diterapkan dalam proses diklat di UPT Diklat Koperasi dan UMKM Jawa Timur. Penelitian ini menggunakan pendekatan kualitatif dengan desain penelitian studi kasus. Peneliti hadir di lokasi penelitian untuk melakukan observasi partisipasi. Pengumpulan data dalam penelitian ini menggunakan teknik observasi, wawancara, dan studi dokumentasi. Teknik analisis data: data reduction, data display, conclusion.     Temuan penelitian ini meliputi: ketatalaksanaan, skenario, dan metode diklat. Ketatalaksanaan diklat: kehadiran peserta, mekanisme registrasi peserta mulai dari peserta datang sampai penyerahan kunci kamar inap; asrama: kebersihan kamar asrama dan lingkungan, kebersihan kamar mandi/WC asrama, kebersihan air kamar mandi/WC, penerangan dan kelengkapan kamar, dan pelayanan petugas asrama. Konsumsi dan ruang makan: variasi menu makanan dan menu rehat, kebersihan makanan, kebersihan peralatan makan dan minum, kebersihan ruang makan, dan pelayanan petugas ruang makan. Prasarana lainnya, meliputi: kebersihan ruang kelas dan perlengkapannya, alat bantu latihan, penyajian bahan serahan/modul, sarana ibadah, sarana olahraga, pelayanan toko/foto copy dan wartel, ketersediaan kebutuhan peserta yang bukan kewajiban balai diklat, dan fasilitas pelayanan perpustakaan. Kesiapan tatalaksana diklat, meliputi pengelolaan: pembukaan diklat, widyaiswara, warga belajar diklat, tempat/gedung, ruang kelas, penunjang proses pembelajaran, asrama, dan konsumsi. Ketatalaksanaan diklat di atas termasuk kegiatan persiapan ketatausahaan atau non-akademik. Skenario diklat dasar-dasar perkoperasian, widyaiswara memiliki skenario yang jelas dan terarah khususnya dalam perancangan diklat yang bersifat change of behavior dan problem solving guna pelaksanaan diklat berjalan sesuai dengan tujuan. Dalam skenario, diklat menggunakan metode ceramah, tanya jawab, brainstorming, diskusi, dan praktik dengan berbagai metode di atas widyaiswara menyalurkan ilmu pengetahuan agar peserta diklat menguasai knowledge, skill, dan attitude, karena sasaran peserta memang seluruhnya adalah orang dewasa. Peningkatan kemampuan diklat tidak dapat dipisahkan dari peranan widyaiswara sebagai pengajar diklat. Widyaiswara harus mengerti bagaimana menciptakan situasi dan lingkungan belajar bagi setiap orang agar terangsang untuk memperoleh sesuatu, manfaat fungsi alat peraga agar membantu memperlancar tugasnya, serta menguasai keterampilan manajemen dan administrasi guna memahami hubungan antar-pribadi khususnya dalam dinamika kelompok. Metode yang diterapkan terkait dengan seluruh proses diklat, setiap widyaiswara memiliki gaya-gaya pembelajaran tersendiri untuk meningkatkan kemampuan dasar-dasar perkoperasian peserta diklat, selain itu kemampuan masing-masing widyaiswara disesuaikan dengan materi bidang yang digelutinya. Pesan pembelajaran tidak akan dapat diterima dengan baik oleh peserta diklat, jika pengajar, kurang menguasai metode pembelajaran. Berbagai metode yang diterapkan seperti: ceramah dan tanya jawab, brainstorming atau curah pendapat dan diskusi, serta penugasan dan praktik, dapat diterapkan, namun terdapat beberapa faktor yang mempengaruhi penggunaan metode seperti: kemampuan personal widyaiswara dan alokasi waktu yang diberikan. Keberadaan metode dalam diklat perkoperasian merujuk pada prinsip andragogi, dengan sedikit variasi berupa inovasi pembelajaran model pembelajaran partisipatori seperti diskusi kelompok atau brainstorming.     Berikut saran dari peneliti: widyaiswara perlu memberikan tes-lisan, untuk mengetahui pemahaman peserta diklat secara keseluruhan dan perlu diselingi humor agar suasana pembelajaran tidak kaku atau monoton, widyaiswara dalam proses pembelajaran supaya menyisipkan game dan ice-breaking yang berhubungan dengan materi diklat, untuk motivasi agar peserta tidak bosan selama mengikuti diklat, widyaiswara hendaknya ketika berbicara di hadapan peserta diklat menganalisis terlebih dahulu peserta yang mengikuti diklat berasal dari mana, agar bahasa yang disampaikan dapat dimengerti oleh peserta. Selain itu, widyaiswara juga menghibur, memotivasi, memberikan inspirasi, memberikan informasi yang sesuai dengan kondisi di lapangan, dan mempersuasif, selain itu widyaiswara harus memberikan materi di modul ke arah pengembangan untuk implementasi praktik kehidupan nyata koperasi. Kepala UPT Diklat Koperasi dan UMKM Jawa Timur perlu mencoba kebijakan untuk menyelenggarakan diklat per-materi, maksudnya tidak semua materi dalam diklat yang ada enam materi diajarkan lima hari dalam diklat, tetapi per-materi dialokasikan waktu satu atau dua hari yang dirasa penting dan dibutuhkan oleh pengurus koperasi agar langsung bermanfaat dalam pengaplikasikan ilmu yang dipelajari tentunya dari hasil identifikasi kebutuhan peserta diklat. Kebijakan yang kedua adalah mengajukan proposal kepada pemerintah untuk menyelenggarakan diklat bagi calon kader pengurus, agar calon kader pengurus memahami gambaran kepengurusan koperasi. Dalam panduan diklat hendaknya diberi denah lokasi fasilitas, sarana dan prasarana, agar peserta minimal tahu letak lokasinya, dan mengalokasikan anggaran untuk penyamaratakan fasilitas kamar inap dirasa lebih penting agar kecemburuan sosial dapat diminimalisasi.

Developing supplementary reading materials of functional text for the 7th graders in SMPN 2 Malang / Mega Astya

 

Kata kunci: pengembangan, tambahan materi mambaca, kelas 7 Penelitian dan Pengembangan ini bertujuan untuk mengembangkan tambahan materi membaca untuk kelas 7 di SMPN 2 Malang. Studi pendahuluan menunjukkan bahwa sekitar 50% materi yang terdapat didalam buku teks yang digunakan dalam proses belajar mengajar tidak sesuai dengan kurikulum KTSP. Para siswa kekurangan materi khususnya untuk teks fungsional.Maka dari itu, diharapkan materi tersebut dapat terpenuhi dengan baik dengan disediakannya tambahanmateri membaca teks fungsional ini. Agar tujuan dari penelitian ini terpenuhi, peneliti mengadaptasi model dari penelitian dan pengembangan yang didesain oleh Dick and Carey (2001).Terdapat 5 langkah dalam model ini, yaitu (1) Analisis masalah, (2) Pengembangan materi membaca, (3) Validasi teoritis, (4) Validasi empiris, dan (5) produk akhir. Analisis masalah dilaksanakan untuk menemukan perbedaan antara kebutuhan siswa and materi yang disediakan oleh pihak sekolah.Hasil dari analisis masalahtersebut selanjutnya digunakan sebagai dasar untuk mengembangkan materi membaca. Dalam penelitian ini, materi membaca dibagi menjadi 3 bab dengan 3 tema yang berbeda, yaitu Shopping list, dengan tema Let’s Shop, Greetings card dengan tema Friendship, dan Announcement dengan tema School Environment. Masing-masing bab dilengkapi dengan Warming Up Activity, Connection, Language Focus, Vocabulary Enrichment, and Exercises, and Extension. Agar tambahan materi membaca ini absah, peneliti menyerahkan tambahan materi membaca tersebut kepada para ahli untuk dievaluasi dalam proses validasi ahli. Kemudian, tambahan materi membaca ini direvisi sebagaimana mestinya berdasarkan saran dari ahli tersebut.Setelah tahap revisi I, tambahan materi membaca ini di uji cobakan kepada peserta didik kelas7 di SMPN 2 Malang. Data dari hasil proses uji coba produk tersebut digunakan sebagai dasar untuk melakukan revisi II. Hasil dari revisi II disebut sebagai produk akhir. Tambahan materi membaca yang dikembangkan dalam penelitian ini mampu memenuhi kebutuhan peserta didik dan desain sebuah produk. Maka dari itu, diharapkan tambahan materi reading ini dapat digunakan sebagai alternatif untuk mengajar teks fungsional, khususnya Shopping list, Greetings card, and Announcement oleh guru. Namun demikian, karena keterbatasan waktu, tambahan materi membaca yang dikembangkan dalam penelitian ini hanya mencakup satu topik dalam satu bab. Maka dari itu, penelitian sejenis yang betujuan untuk mengembangkan produk untuk pendidikan sangat diperlukan.

Pembelajaran outbound untuk pengembangan aspek sosial emosional anak usia dini di TK Pertiwi DWP Setda Kabupaten Trenggalek / Hendra Fredy Asmara

 

Asmara, Hendra Fredy. 2013. Pembelajaran Outbound untuk Pengembangan Aspek Sosial Emosional Anak Usia Dini di TK Pertiwi DWP SETDA Kabupaten Trenggalek. Skripsi Jurusan Pendidikan Luar Sekolah Fakultas Ilmu Pendidikan Universitas Negeri Malang. Dosen Pembimbing (I) Dr. M. Djauzi Moedzakir, M.A., Dosen Pembimbing (II) Drs. Lasi Purwito, M.S. Kata kunci: pembelajaran outbound, pengembangan aspek sosial emosional anak usia dini.     Permasalahan sosial emosional anak terlihat pada keengganan bersosialisasi dengan teman sebaya akibat kebiasaan bermain sendiri dengan alat permainan canggih di era kemajuan teknologi dan kurangnya pengarahan orang tua. Oleh karena itu, pembelajaran outbound difungsikan sebagai upaya preventif terhadap gejala-gejala yang menghambat perkembangan anak. Penelitian ini bertujuan untuk mengetahui; alasan penggunaan pembelajaran outbound, pelaksanaan pembelajaran outbound, serta dampak pembelajaran outbound terhadap perkembangan aspek sosial emosional anak usia dini.     Peneliti memilih jenis penelitian kualitatif dengan desain studi kasus. Penelitian dilakukan di TK Pertiwi DWP SETDA Kabupaten Trenggalek. Informan kunci penelitian ini antara lain: (1) Kepala Sekolah, (2) koordinator outbound, (3) koordinator kelas A, dan (4) koordinator kelas B. Peneliti menggunakan teknik wawancara, observasi, dan dokumentasi. Triangulasi sumber dan triangulasi teknik dilakukan untuk memperkuat keabsahan data.     Temuan penelitian ini adalah: (1) alasan penggunaan pembelajaran outbound; untuk menciptakan suasana belajar sambil bermain, melatih keberanian, ketangkasan, kognitif, dan kekompakan anak dalam bekerjasama, (2) pelaksanaan pembelajaran outbound; dilaksanaan di halaman TK, pos 1, 2, 3, 4, dan 7 permainan individu, sedangkan pos 4 dan 5 permainan kelompok diakhiri dengan refleksi kegiatan, (3) dampak pembelajaran outbound terhadap perkembangan sosial emosional anak; permasalahan anak cenderung pendiam, kurang berinteraksi, dan pasif, bentuk perkembangan meliputi kerjasama saling membantu, mandiri dan tanggungjawab, berani percaya diri, sportif disiplin.     Saran untuk keperluan teoritis, (1) Jurusan PLS dapat melengkapi kajian sumber dan media; (2) Mahasiswa PLS dapat memperkaya wawasan melalui hasil penelitian; (3) Peneliti lain perlu mengembangkan fungsi outbound untuk aspek lain. Secara praktis, (1) Kepala Sekolah perlu menambah jadwal outbound; (2) Koordinator sebaiknya meningkatkan keahlian melalui diklat instruktur; (3) Koordinator kelas perlu tindak lanjut melalui materi di kelas; dan (5) Orang tua sebaiknya diarahkan kepada kegiatan yang lebih membangun.

Homosexual love expressions addressed to a hermaphrodite in Shakespeare's Sonnets / Farid Bhaktiar

 

Kata Kunci:cinta homoseksual, ekspresi, sonet-sonet Shakespeare Sedari awal mulanya, sonet merupakan sebuah bentuk puisi yang dulunya digunakan oleh kalangan kerajaan, sonet juga sebenarnya ditujukan pada wanita dari lingkungan kerajaan dengan suatukekaguman dan pemujaan. Ada beberapa karakteristik dari subyek atau topik, terkhususnya cinta. Pada abad ke-enam belas sonet dibawa oleh Thomas Wyatt dan Henry Howard ke Inggris, dan pada akhirnya mencapai puncaknya pada masa kepenguasaan Ratu Elizabeth. Shakespeare terlibat dalam tradisi menulis sonet dengan menciptakan sejumlah 154 sonet. Para pakar telah menemukan jika terdapat dua pembagian pada sonet-sonet Shakespeare. Pembagiannya berdasarkan pada kepada siapa sonet-sonet itu ditujukan. Yang teralamat pertama dikenal sebagai ‘the fair youth’, 126 sonet pertama dipercaya ditujukanpadanya. Yang teralamat kedua adalah dikenal sebagai the dark lady, sonet 127 sampai sonet 152 dipercaya ditujukan padanya. Setelah mengetahui bahwasanya Shakespeare mengalamatkan sebagian sonet-sonetnya kepada seorang figur pria membuat para ahli terheran-heran.Oleh karenanyapenelitian ini ingin membahas tentang ekspresi-ekspresi cinta homoseksual yang berada di dalam sonet-sonet Shakespeare.Oleh karena itu penelitian ini mengaplikasikan desain penelitian deskriptif-kualitatif dalam melaksanakan penelitian dan karena penelitian ini termasuk sebagai kritik sastra maka penelitian ini menggunakan pendekatan hermeneutik.Data yang digunakan bersumber dari kumpulan sonet-sonet Shakespeare yang telah dikompilasi dan telah menggunakan transkripsi yang modern.Semenjak penelitian ini menggunakan metode deskriptif-kualitatif maka peneliti berperan sebagai instrument utama dalam mengumpulkan data.Dalam menganalisa data peneliti memformulasikannya ke dalam 2 langkah.Langkah yang pertama adalah membaca dengan seksama, setelah menentukan sonet-sonet tertentu yang dicurigai mengandung ekspresi-ekspresi cinta homoseksual peneliti membaca sonet-sonet tersebut dengan seksama dengan memepertimbangkan konteks dari sonet-sonet secara menyeluruh.Membaca secara seksama ditujukan untuk memahami sonet dengan baik.Langkah kedua adalah interpretasi, setelah memiliki pemahaman yang baik dari sonet-sonet tersebut peneliti mengiterpretasikan sonet-sonet itu dengan bantuan berupa argument-argumen dari peneliti-peneliti lain. Setelah menginterpretasikan teks peneliti akhirnya dapat menilai apakah sonet-sonet Shakespeare mengandung ekspresi-ekspresi cinta homoseksual. Secara ringkas dari hasil analisa yang telah dilakukan, peneliti telah memahami jika (1) sang penutur di dalam sonetmendesak ‘the fair youth’ untuk menikah dan mewariskan keelokannya kepada anaknya sebagai manisfestasi cintanya kepada sang penutur. Peneliti menemukan jika (2) sang penutur dari sonet mengekspresikan cinta dan baktinya pada ‘the fair youth’ dengan caramengabadikan keelokannya di dalam sonet-sonetnya. Sebagai tambahan, (3) sang penutur menganggap pria muda itu sebagai seorang yang menawan yang memiliki fitur-fitur yang merupakan kesempurnaan sintesis dari fitur-fitur dari laki-laki dan perempuan.Juga telah diketahui kalau (4) status ‘the fair youth’sebagai laki-laki tidak dianggap sebagai halangan terhadap cintanya.Di dalam sonet-sonet Shakespeare (5) terdapat sebuah jalinan segitiga, sebuah jalinan yang melibatkan sang penutur, ‘the fair youth’, dan ‘the dark lady’. Walaupun sang penutur mencintai ‘the fair youth’dan juga ‘the dark lady’, sang penutur menunjukkan rasa kehilangan ketika mengetahui ‘the dark lady’ memiliki ‘the fair youth’. Pada akhirnya, peneliti sampai pada suatu pemahaman jika sang penutur mendambakan ‘the fair youth’yang digambarkan sebagai figure androgini.Oleh karenanya, ini mengkonfirmasikan jika sonet-sonet Shakespeare mengandung ekspresi cinta homoseksual yang dialamatkan kepada seorang laki-laki yang figurnya direpresentasikan sebagai seorang hermaprodit.

A study on English extracurricular activities at SMPN 2 Pandaan / Asfarinah Hidayah

 

Hidayah, Asfarinah. 2013. A Study on the English Extracurricular Activities at SMPN 2Pandaan. Skripsi.JurusanBahasaInggris, FakultasSastra, UniversitasNegeri Malang: Drs. H. Murdibjono, M.A. Key words: English club, pembinaan, kegiatanekstrakurikuler, instruktur Saat ini, pengajaran bahasa Inggris di Indonesia menjadi sangat penting. Hal ini tidak hanya disebabkankarena bahasa Inggris masih menjadi bahasa yang paling banyakdipakai di dunia, namun karena pemerintah telah menjadikan pelajaran bahasa Inggris sebagai mata pelajaran wajib di sekolah menengah, baik SMP dan SMA. Selain itu, pemerintah menetapkan tujuan yang spesifik dalam standar isi (standar kompetensi dan kompetensidasar) bahwa siswa harus dapat menggunakan bahasa dalam literasi tertentu berdasarkan tingkat pendidikan mereka. Untuk memenuhi target tersebut, beberapa sekolah memfasilitasi para siswa mereka dengan kegiatan ekstrakurikuler bahasa Inggris karena guru tidak dapat bergantung hanyapada pengajaran bahasa Inggris di kelas formal karena waktu sangat terbatas. Membentuk kegiatan ekstrakurikuler bahasa Inggris tampak menguntungkan karena para siswa akan memiliki lebih banyak waktu dan eksposur lebih banyak tentang bahasa Inggris. Oleh karena itu, penelitian ini dilakukan dalam rangka untuk mengakui bagaimana pelaksanaankegiatan ekstrakurikuler bahasa Inggris. Untuk memperoleh data, desain penelitian deskriptif kualitatif digunakan dalam penelitian ini. Subyek penelitian adalah siswa yang mengikuti kegiatan ekstrakurikuler Bahasa Inggris di SMPN 2 Pandaan. Data yang dikumpulkan peneliti adalah tujuan mengadakan kegiatan ekstrakurikuler bahasa Inggris, fasilitas yang disediakanolehsekolahuntuk kegiatan ekstrakurikuler bahasa Inggris, media dan materi belajar dalam kegiatan ekstrakurikuler bahasa Inggris, teknikmengajar yang digunakandalamkegiatanekstrakurikulerbahasaInggris, dan pendapat para siswa mengenai kegiatan ekstrakurikuler bahasa Inggris. Data diperoleh dengan menggunakan wawancara, kuesioner, catatan lapangan, dan dokumentasi.Data dianalisis secara deskriptif. Data yang dijelaskan kemudian dituangkan ke dalam beberapa kesimpulan. Hasil penelitian menunjukkan bahwa terdapat dua kegiatan ekstrakurikuler bahasa Inggris di SMPN 2 Pandaan. Mereka adalah English Club and Pembinaan. Setiap kegiatan memiliki tujuan yang berbeda. English Club memiliki tujuan untuk mempersiapkan siswa untuk hari bahasa Inggris dan Pembinaan memiliki tujuan untuk mempersiapkan siswa untuk kompetisi bahasa Inggris atau Olimpiade. Fasilitas yang disediakan untuk duakegiatan tersebuthampir sama. Fasilitastersebut adalah laboratorium bahasa, perpustakaan, dan sebuah ruang kelas untuk kegiatan belajar mengajar. Media yang digunakan di English Club dan Pembinaan sebagian besar berupatechnical media seperti LCD, laptop, proyektor, dan speaker. Instruktur memilih media dengan mempertimbangkan bahan yang akandiajarkan. Materi yang diajarkan di English Club didasarkan pada standar isi untuk SMP dan materi yang diajarkan di Pembinaan didasarkan pada materiOlimpiade bahasaInggris. Sayangnya, materiyang diajarkandi English Club tidak sejalan dengan tujuan pendirian program. Teknik pengajaran yang diterapkan di English Club terdiri dari tiga controlled techniques, empat semi controlled techniques, dan dua free techniques. Controlled techniques terdiridari(1) setting, (2) dialogue/narrative recitation, and (3) review. Semi controlled techniques terdiridari (1) brainstorming, (2) cued narrative dialogues, (3) information transfer, and (4) wrap-up. Free techniques terdiridari (1) role play, (2) games, (3) discussion, and (4) a propos. Sementara itu, teknik pengajaran yang diterapkan di Pembinaan terdiri dari sembilan controlled techniques, tiga semi controlled techniques, dan dua free techniques. Controlled techniques terdiriatas(1) setting, (2) organizational, (3) content explanation, (4) dialogue or narrative presentation, (5) reading aloud, (6) checking, (7) question answer, (8) review, and (9) testing. Semi controlled techniques terdiriatas (1) story-telling, (2) question answer, and (3) wrap up. Free techniques terdiriatas (1) role plays and (2) propos. Pendapat para siswa terhadap kegiatan ekstrakurikuler bahasaInggris baik. Para siswa senang bergabung dengan kegiatan ekstrakurikuler bahasa Inggris baik Pembinaan atau English club. Pendapat mahasiswa terhadap teknik pengajaran yang diterapkan oleh instrukturpositif. Pendapat para siswa tentang fasilitas yang diberikan oleh sekolah jugapositif. Pendapat para siswa tentang media dan materibelajar yang digunakan dalam English club dan Pembinaan baik, meskipun ada beberapa siswa yang berpendapat bahwa terdapatbeberapamateribelajar yang dianggap sulit. Penelitian ini memberikan beberapa saran. Pertama-tama, instruktur disarankan untuk memilih bahan ajar dan teknik pengajaran yang dapat mempromosikan tujuan dari dibentuknya program ekstrakurikuler bahasa Inggris. Kedua, kepala sekolah disarankan untuk memberikan fasilitasyang dianggap kondusif untuk kegiatanbelajarmengajarbahasa Inggrissepertiself-accesscenter. Ketiga, para guru dari sekolah lain yang memiliki minat sama dalam membentuk kegiatan ekstrakurikuler bahasa Inggris disarankan untuk menentukan tujuan daripendirian program dan memastikan bahwa program tersebutsesuai dengan kebutuhan para siswa yang belajar bahasa Inggris. Selain itu, para guru juga disarankan untuk memastikan bahwa siswa mengetahui dengan jelas tentang tujuan dariprogramtersebut. Guru harus menjelaskan target kompetensiyang harus dicapai olehsiswayang mengikuti programtersebut. Akhirnya, guru juga harus memilih bahan ajar, teknik pengajaran, dan media yang dapat memicu siswa untuk mencapai tujuanpelaksanaan program tersebut.

Developing role-play cards as the media for assessing speaking skill of seventh grade students / Bila Nastiti Tasaufi

 

Keywords: pengembangan, kartu bermain peran, kemampuan berbicara, sekolah menengah pertama Keterbatasan media dan tugas dalam berbicara bahasa Inggris di SMP Negeri 1 Tumpang adalah alas an utama dilaksanakannya penelitian ini.Tujuan dari penelitian ini adalah untuk mengembangkan satu paket kartu bermain peran yang dapat digunakan sebagai media untuk menilai kemampuan berbicara. Jumlah kartu bermain peran yang dibuat adalah tiga puluh pasang kartu. Kartu yang dikembangkan meliputi kemampuan untuk meminta dan memberi jasa, barang dan fakta yang tercantum dalam kompetensi dasar berbicara dari kelas tujuh di semester dua. Penelitian ini terklasifikasikan dalan penelitian dan pengembangan karena hasil akhir dari penelitian ini adalah produk untuk tujuan pendidikan. Model dari penilitian dan pengembangan ini menggunakan model ADDIE (Analysis, Design, Development, Implementation, and Evaluation). Prosedur yang digunakan mengacu pada model penelitian yang terdiri dari lima tahap yaitu: analisis, desain, pengembangan, implementasi, dan evaluasi. Analisis atau dapat disebut sebagai analisis kebutuhan bertujuan untuk mengidentifikasi masalah yang dihadapi siswa dan guru berkaitan dengan activitas berbicara bahasa Inggris. Tahap desain berupa proses pembuatan draf awal dari produk yang terdiri atas mendesain materi dan draf gambar. Tahap pengembangan adalah proses perwujudan dan produksi produk. Implementasi terdiri dari validasi teoritis dan empiris. Validasi empiris terdiri atas validasi ahli beserta revisi. Instrumen yang digunakan adalah lembar validasi ahli yang meliputi saran dan komentar. Validasi empiris meliputi try out product dan revisi. Try out dilaksanakan dua kali. Evaluasi adalah proses untuk menentukan kepantasan dari produk yang dikembangkan. Hasil dari analisis (analisis kebutuhan) adalah tugas untuk aktivitas berbicara bahasa Inggris yang pernah dilakukan siswa adalah mendeskripsikan benda menggunakan peta. Siswa belum pernah berlatih tansaksional dan interpersonal dialog pada semester pertama. Peneliti memutuskan untuk mendesain dan mengembangkan produk untuk kompetensi dasar tersebut. Try out pertama dilakukan di kelas VII B di SMP Negeri 1 Tumpang pada tanggal 27 Februari 2013. Try out kedua dilakukan di kelas VII A di sekolah yang sama pada tanggal 7 Maret 2013. Data yang diperoleh berdasarkan komentar guru, siswa, dan peneliti itu sendiri. Secara general, siswa dan guru memberikan kesan positif terhadap produk ini. Mereka mengatakan bahwa kartu bermain peran memiliki gambar yang menarik dan teknik yang digunakan membantu untuk berlatih berbicara dalam bahasa Inggris. Produk ini juga dapat menambah kepercayaan diri siswa sehingga guru dapat dengan mudah menilai performa siswa. Produk akhir pengembangan ini berupa kotak yang berisi tiga puluh pasang kartu bermain peran, panduan yang terdiri atas tujuan pembelajaan, spesifikasi produk, petunjuk penggunaan, contoh percakapan, dan rubric penilaian berbicara. Berdasarkan penelitian yang telah dilakukan, hasil yang diperoleh adalah kartu bermain pean berguna dan menarik bagi siswa untuk berlatih berbicara dalam bahasa Inggris. Siswa merasa terbantu karena produk ini terdapat situasi untu bermain peran yang dapat digunakan sebagai alat bantu. Beberapa saran ditambahkan untuk guru bahasa Inggris dan peneliti selanjutnya. Guru bahasa Inggris dapat merencanakan kegiatan lanjutan untuk mendiskusikan hasil performa siswa yang bertujuan agar siswa “berkembang” dari umpan balik guru. Untuk peneliti selanjutnya, disarankan untuk mengembangkan produk kartu bermain peran yang lebih menarik untuk topik yang lain dan angkatan yang berbeda.

1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 | 18 | 19 | 20 | 21 | 22 | 23 | 24 | 25 | 26 | 27 | 28 | 29 | 30 | 31 | 32 | 33 | 34 | 35 | 36 | 37 | 38 | 39 | 40 | 41 | 42 | 43 | 44 | 45 | 46 | 47 | 48 | 49 | 50 | 51 | 52 | 53 | 54 | 55 | 56 | 57 | 58 | 59 | 60 | 61 | 62 | 63 | 64 | 65 | 66 | 67 | 68 | 69 | 70 | 71 | 72 | 73 | 74 | 75 | 76 | 77 | 78 | 79 | 80 | 81 | 82 | 83 | 84 | 85 | 86 | 87 | 88 | 89 | 90 | 91 | 92 | 93 | 94 | 95 | 96 | 97 | 98 | 99 | 100 | 101 | 102 | 103 | 104 | 105 | 106 | 107 | 108 | 109 | 110 | 111 | 112 | 113 | 114 | 115 | 116 | 117 | 118 | 119 | 120 | 121 | 122 | 123 | 124 | 125 | 126 | 127 | 128 | 129 | 130 | 131 | 132 | 133 | 134 | 135 | 136 | 137 | 138 | 139 | 140 | 141 | 142 | 143 | 144 | 145 | 146 | 147 | 148 | 149 | 150 | 151 | 152 | 153 | 154 | 155 | 156 | 157 | 158 | 159 | 160 | 161 | 162 | 163 | 164 | 165 | 166 | 167 | 168 | 169 | 170 | 171 | 172 | 173 | 174 | 175 | 176 | 177 | 178 | 179 | 180 | 181 | 182 | 183 | 184 | 185 | 186 | 187 | 188 | 189 | 190 | 191 | 192 | 193 | 194 | 195 | 196 | 197 | 198 | 199 | 200 | 201 | 202 | 203 | 204 | 205 | 206 | 207 | 208 | 209 | 210 | 211 | 212 | 213 | 214 | 215 | 216 | 217 | 218 | 219 | 220 | 221 | 222 | 223 | 224 | 225 | 226 | 227 | 228 | 229 | 230 | 231 | 232 | 233 | 234 | 235 | 236 | 237 | 238 | 239 | 240 | 241 | 242 | 243 | 244 | 245 | 246 | 247 | 248 | 249 | 250 | 251 | 252 | 253 | 254 | 255 | 256 | 257 | 258 | 259 | 260 | 261 | 262 | 263 | 264 | 265 | 266 | 267 | 268 | 269 | 270 | 271 | 272 | 273 | 274 | 275 | 276 | 277 | 278 | 279 | 280 | 281 | 282 | 283 | 284 | 285 | 286 | 287 | 288 | 289 | 290 | 291 | 292 | 293 | 294 | 295 | 296 | 297 | 298 | 299 | 300 | 301 | 302 | 303 | 304 | 305 | 306 | 307 | 308 | 309 | 310 | 311 | 312 | 313 | 314 | 315 | 316 | 317 | 318 | 319 | 320 | 321 | 322 | 323 | 324 | 325 | 326 | 327 | 328 | 329 | 330 | 331 | 332 | 333 | 334 | 335 | 336 | 337 | 338 | 339 | 340 | 341 | 342 | 343 | 344 | 345 | 346 | 347 | 348 | 349 | 350 | 351 | 352 | 353 | 354 | 355 | 356 | 357 | 358 | 359 | 360 | 361 | 362 | 363 | 364 | 365 | 366 | 367 | 368 | 369 | 370 | 371 | 372 | 373 | 374 | 375 | 376 | 377 | 378 | 379 | 380 | 381 | 382 | 383 | 384 | 385 | 386 | 387 | 388 | 389 | 390 | 391 | 392 | 393 | 394 | 395 | 396 | 397 | 398 | 399 | 400 | 401 | 402 | 403 | 404 | 405 | 406 | 407 | 408 | 409 | 410 | 411 | 412 | 413 | 414 | 415 | 416 | 417 | 418 | 419 | 420 | 421 | 422 | 423 | 424 | 425 | 426 | 427 | 428 | 429 | 430 | 431 | 432 | 433 | 434 | 435 | 436 | 437 | 438 | 439 | 440 | 441 | 442 | 443 | 444 | 445 | 446 | 447 | 448 | 449 | 450 | 451 | 452 | 453 | 454 | 455 | 456 | 457 | 458 | 459 | 460 | 461 | 462 | 463 | 464 | 465 | 466 | 467 | 468 | 469 | 470 | 471 | 472 | 473 | 474 | 475 | 476 | 477 | 478 | 479 | 480 | 481 | 482 | 483 | 484 | 485 | 486 | 487 | 488 | 489 | 490 | 491 | 492 | 493 | 494 | 495 | 496 | 497 | 498 | 499 | 500 | 501 | 502 | 503 | 504 | 505 | 506 | 507 | 508 | 509 | 510 | 511 | 512 | 513 | 514 |