Penelitian Tindakan Kelas :: UPT Perpustakaan UM

JudulPengaruh penempatan kerja terhadap kinerja karyawan PT. PLN (persero) distribusi Jawa Timur Area Malang oleh Syifa Kirana Syahputri
PenulisSyahputri, Syifa Kirana
Pembimbing1. H. Mohammad Arief; 2. I Nyoman Saputra
Penerbitan2016, S1 Program Studi Manajemen.
LabelRs 658.31422 SYA p


Syahputri,SyifaKirana. 2016. PengaruhPenempatanKerjaterhadapKinerjaKaryawan PT. PLN PerseroDistribusiJawaTimur Area Malang.Skripsi, JurusanManajemenFakultasEkonomiUniversitasNegeri Malang. Pembimbing (1) Drs. H. Mohammad Arief, M.Si (2) Drs. I NyomanSuputra, M.Si.

Kata Kunci : PenempatanKerja, KinerjaKaryawan

Penempatankerjamerupakansalahsatufaktorpenting yang tidakbolehdiabaikandalammencapaitujuanperusahaan.Penempatansangatpentingbagisuatuperusahaanatauorganisasikarenamenempatkankaryawanpadaposisi yang tepatmerupakansuatuhal yang berkaitaneratdengankinerjakaryawan. Jikapenempatanpegawaisudahbaikdantepat, sangatbesarkemungkinannyakinerjakaryawan pun akanmemuaskandantujuanperusahaanmenjadiefektifdanefisien,sebaliknyajikapenempatantersebutkurangatautidaktepat, tidakmenutupkemungkinankinerjadarisetiapkaryawan pun tidaksetinggi yang diharapkan.

Penelitianinibertujuanuntukmengujidanmenganalisispengaruhpenempatankerjaterhadapkinerjakaryawan PT. PLN (Persero) DistribusiJawaTimur Area Malang.

Sampel yang digunakandalampenelitianiniberjumlah 65 respondendari 65 karyawan, sehinggapenelitianinimerupakanpenelitianpopulasi.Teknikpengujian data yang digunakanmeliputiujivaliditasdanujireliabilitas.Metodeanalisis yang digunakanadalahanalisisregresisederhana.

Hasilanalisis data menunjukkanbahwavariabelpenempatankerjaberpengaruhsignifikandanpositifterhadapkinerjakaryawan, dibuktikandengannilai β = 1,128dansig t = 0,000<0,05. Hasilpenelitianmenunjukkanbahwapenempatankerjamerupakansalahsatufaktor yang sangatberpengaruhterhadapkinerjakaryawan yang dibuktikandenganpersentasesebesar 72,2% dansisanya 27,8% dipengaruhiolehfaktor-faktor lain.

Saran yang diberikankepada PT PLN (Persero) DistribusiJawaTimur Area Malang adalahsebaiknyakegiatanpenempatankerja yang dilakukanlebihditingkatkanlagi, halitukarenaadabeberapakaryawan yang merasabahwaposisi yang diatempatisaatinikurangsesuaidenganaspek-aspek yang adapadadirikaryawantersebut. Hal itudilakukansebagaiusahauntukmengoptimalkankegiatanpenempatankerja di PT. PLN (Persero) DistribusiJawaTimur Area Malang, sehinggakaryawanlebihgiatdalambekerjadandapatmenghasilkan output yang bagusbagiperusahaan.

P.T.K yang memiliki kemiripan dengan diatas

Tidak ada.

P.T.K yang memiliki keterhubungan dengan diatas

1Pengaruh merek dan kemasan terhadap keputusan pembelian produk teh Sari Wangi (studi kasus pada ibu-ibu rumah tangga Desa Tanjung Anom Kabupaten Nganjuk) / Ahmad Fahim Hilmi
2Analisis SWOT sebagai dasar keputusan strategi pemasaran (Studi kasus pada perusahaan sepatu bola Terus Maju di Kecamatan Bangil Kabupaten Pasuruan) / Risky Rochmadilah
3Pengaruh debt to equity ratio, debt to asset ratio dan total asset turnover terhadap return on equity koperasi (Studi pada Koperasi Serba Usaha se-Kota Malang tahun 2010) / Wahyu Albrian
4Pengaruh struktur modal dan struktur kekayaan terhadap rentabilitas pada perusahaan mining (Pertambangan) yang listing di Bursa Efek Indonesia (Periode tahun 2003-2007) / Siti Fatimah Sabarina Azzahra
5Analisis SWOT (strengths, weaknesses, opportunities, threats) dalam menetukan strategi pemasaran UD. Cemarasari Karangsari Kota Blitar / Nita Mayangsari
6Pengaruh persepsi kualitas produk terhadap keputusan pembelian sari roti (studi pada konsumen sari roti jenis roti tawar gandum di Kelurahan Kidul Dalem, Kecamatan Bangil, Kabupaten Pasuruan) / M. Zakki Mubarok
7Analisis perbedaan kompetensi manajerial pengurus koperasi berdasarkan tingkat pendidikan (studi pada Koperasi Simpan Pinjam dan Koperasi Kredit di Kota Malang) / Eva Fierda Simanungkalit
8Pengaruh persepsi bauran promosi terhadap proses keputusan konsumen dalam membeli motor honda (Studi di RW 7 Kelurahan Dinoyo kota Malang) / Alpi Sahar Sani
9Pengaruh kualitas pelayanan terhadap loyalitas pelanggan (studi pada pelanggan Hotel Santika Premiere Malang) / Nila Fauziah
10Pengaruh harga dan atribut me too product terhadap keputusan konsumen dalam membeli handphone merek Blueberry (studi pada pengguna handphone merek blueberry di Malang Plaza) / Alfan Jauhari
11Pengaruh atribut produk terhadap keputusan konsumen dalam membeli mie sedaap (studi pada konsumen di Kelurahan Bendogerit Blitar) / Happy Nugrah Hapsari
12Pengaruh iklan pasta gigi Pepsodent di televisi terhadap keputusan pembelian konsumen (studi pada masyarakat RW 03 Kelurahan Dampit Kecamatan Dampit Kabupaten Malang) / Meralda Anggun Mumpuni
13Pengaruh kontrol supervisor terhadap kinerja melalui komitmen organisasi (studi kasus pada karyawan bagian administrasi Kantor Pos Kota Malang) / Risqo Augusta F.
14Penerapan personal selling pada dealer mobil Suzuki PT. Mitra Putra Profitamas Sampit / Ossy Putri Rahayu
15Pengaruh atribut terhadap proses pengambilan keputusan pembelian konsumen (studi pada pengguna kartu seluler prabayar XL bebas di Kelurahan Sumbersari Kecamatan Lowokwaru Kota Malang) / Arista Honaeni Wanda
16Pengaruh capital adequncy ratio (Car), loan to deposit ratio (LDR), return on asset (ROA), dan beban operasional atas pendapatan operasional (Bopo) terhadap perubahan laba pada PT. Bank Central Asia TBk. periode 2001-2008 / Joko Setyono
17Pengaruh media advertising, brand image. Dan customer refernce terhadap keputusan konsumen dalam membeli laptop merek acer (Studi kasus pada pengguna laptop Acer di kedai kopi RKB hotspot area Perumahan Sawojajar) / Restiana Oktaviany
18Pengaruh Debt To Asset (DAR) dan Debt To Equity Ratio (DER) terhadap Return saham melalui net profit margin (NPM) pada perusahaan otomotif dan komponen yang listing di Bursa efek Indonesia Periode 2009-2011 / Yusiak Deaka Santri
19Pengaruh arus kas (cash flow) dari aktivitas investasi dan aktivitas pendanaan terhadap return saham perusahaan melalui return on equity (ROE) (studi pada perusahaan manufaktur yang listing di BEI periode Desember 2007) / Fandhy Oktofa Likwanda
20Pengaruh gaya kepimimpinan terhadap semangat kerja karyawan (Studi pada karyawan PT. PLN (Persero) APJ Ponorogo) / Rahma Puspita N.F.D.
21Pengaruh atribut produk terhadap keputusan pembelian handphone samsung (studi pada mahasiswa jurusan manajemen fakultas ekonomi Universitas Negeri Malang angakatan 2009-2010) / Rizky Primadhani
22Pengaruh debt to Assets Ratio (DAR) terhadap Return on Assets (ROA) yang domoderasi oleh kepemilikan manajerial (studi pada perusahaan yang masuk dalam kelompok Jakarta Islamic Indeks (JII) periode 2013-2014 / Cenderawasih Suhana Santana
23Penerapan dimensi kualitas layanan di Poli Umum Rumah Sakit Dr. Radjiman Wediodiningrat Lawang / Mifdah Khoirinnisah
24Penerapan pembelajaran kooperatif model Teams Games Tournament untuk meningkatkan motivasi dan hasil belajar siswa kelas X pada mata diklat kewirausahaan Program Keahlian Penjualan di SMK PGRI 6 Malang tahun ajaran 2008/2009 / Fitriana
25Analisis perbedaan kinerja keuangan bank pemerintah dan bank swasta dengan metode eagles pada periode 2004-2007 / Ratih Indra novianti
26Pengaruh kualitas produk dan pelayanan terhadap loyalitas melalui kepuasan konsumen pada UKM kaca hias ria Glass Singosari Malang / Priyo Iswantoro
27Pengaruh budaya organisasi terhadap kinerja karyawan (studi pada karyawan Mal Olympic Garden Malang) / Yuli Astiwahanani
28Pengaruh iklan televisi terhadap keputusan pembelian kopi nescafe (studi pada mahasiswa jurusan Manajemen Fakultas ekonomi Universitas Negeri Malang) / Dinantiar Satria Wiraga
29Pengaruh motivasi kerja karyawan dan kepuasan kerja terhadap komitmen organisasi (Studi para karyawan perum jasa tirta 1 Malang) / Salma
30Pengaruh persepsi citra toko terhadap kepuasan konsumen distro Inception99 Kediri / Ronald Budi Setya
31Pengaruh bauran pemasaran terhadap keputusan pembelian konsumen (Studi kasus di Distro The Reds Jl.MT.Haryono No. 116 Malang) / Vicky Mahardhika
32Pengaruh kualitas produk dan citra merek terhadap proses keputusan pembelian produk notebook merek Asus / Pindo Zera Al Abid
33Pengaruh faktor pribadi terhadap keputusan konsumen dalam membeli sepeda motor merek Suzuki (studi pada konsumen sepeda motor Suzuki di wilayah Kelurahan Bunulrejo Kecamatan Blimbing Malang) / Firman Arif Wijaya
34Pengaruh pelayanan purna jual terhadap kepuasan konsumen produk sepeda motor merek suzuki ( studi pada PT. HERO SAKTI MOTOR Malang) / Nuraidya Fajariah
35Pengaruh keselamatan dan kesehatan kerja terhadap kepuasan kerja karyawan (studi pada karyawan PR. Alfi Putra Trenggalek) / Lugas Asmarani Kartiko
36Pengaruh pemasaran word of mouth terhadap brand awareness perusahaan jasa (studi pada pengunjung taman rekreasi Batu Night Spectacular) / Ristyan Fitrianto
37Penggunaan analisis z-score untuk menilai tingkat kebangkrutan perusahaan sebelum dan sesudah akuisisi (studi pada perusahaan yang listing di Bursa Efek Indonesia periode tahun 1998-2006) / Andy Prasetyo Wati
38Pengaruh kepuasan terhadap loyalitas pelanggan pos express di kantor pos besar malang / Bangkitlahia Wira Egara
39Pengaruh kepuasan kerja terhadap komitmen organisasi (studi pada karyawan PT. Lestari Agro Kencana Tulungagung) / Tomy Arief Wicaksono
40Faktor-faktor yang dipertimbangkan dalam keputusan pembelian (studi pada pembeli fashion di New Golden Turen Malang) / Erwin Wahyudi
41Analisis variabel keuangan dan non keuangan yang mempengaruhi tingkat underpricing pada saat IPO tahun 2011-2015 / Rifka Fatimah Sari
42Pengaruh rasio kecukupan model, dana pihak ke tiga, dan kredit bermasalah terhadap penyaluran kredit (studi pada PT Bank Tabungan Negara (Persero) Tbk Periode 2002-2011) / Binti Shofiatul Jannah
43Pengaruh gaya kepemimpinan partisipatif terhadap semangat kerja pada kaaryawan Hotel Wisata Tidar Malang / Arfenila Fitri Widana
44Pengaruh Inflansi, Tingkat Suku Bunga Dan Rupiah Terhadap Indeks LQ45 Di Bursa Efek Jakarta oleh Hari Wicaksono
45Pengaruh produk fitur terhadap perilaku konsumen dalam menggunakan jasa pelayanan telekomunikasi: studi kasus pada pelanggan PT. Telkom Kancatel Blitar oleh Fahruddin Yusuf
46Pengaruh penerapan konsep pemasaran terhadap keberhasilan usaha industri kecil keripik tempe di Sanan Malang oleh Yuniar Rochmawati
47Pengaruh EVA (Economic Value Added) dan MVA (Market Value Added) terhadap harga saham perusahaan manufaktur yang listing di BEI periode 2006-2008 / Abdullah
48Pengaruh jiwa kewirausahaan terhadap pengembangan karis distributor multi level marketing (Studi pada Dostributor MLM Oriflame Member Group Sevenblast Malang) / Amalia Istiqomah
49Pengaruh brand equity dan brand image terhadap minat beli produk smarthphone Samsung (studi pada mahasiswa Jurusan Teknik Mesin Universitas Negeri Malang) / Sofi Nur Aini
50Pengaruh keterlibatan kerja dan pengembangan karir terhadap komitmen organisasional melalui kepuasan kerja (Studi pada karyawan tidak tetap Bank BRI Unit Cabang Martadinata Kota Malang) / Adri Gigih Febriyanto Utomo S.
51Pengaruh profitabilitas dan asset growth terhadap Dividen Payout Ratio (DPR) yang dimoderasi oleh current ratio (studi pada perusahaan manufaktur Syariah yang listiung di BEI periode 2013) / Erwina Suraida Rohudiana
52Pengaruh atribut poduk terhadap keputusan konsumen dalam membeli produk mie isntan: studi pada mahasiswa fakultas ekonomi Universitas Negeri Malang oleh Endah Susanti
53Analisis efisiensi kinerja keuangan KPRI di Kota Malang dengan metode Data Envelopment Analysis (DEA) / Qurrota A'yuni
54Analisis perbedaan return, abnormal return, trading volume activity (TVA), dan security return varibility (SRV) saham perusahaan asuransi di BEJ sebelum dan sesudah peristiwa gempa di Yogyakart 27 Mei 2006 / Chanki Defrianta
55Pengaruh current ratio, debt to equity ratio, dan debt to asset ratio terhadap rentabilitas koperasi (studi pada Koperasi Pegawai Republik Indonesia se Kota Malang tahun 2010) / Kartika Ayu Pratiwi
56Pengaruh kepuasan terhadap loyalitas pelanggan kartu prabayar simpati (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Kholilurrohman
57Pengaruh keadilan distribusi dan sikap kerja positif terhadap komitmen organisasi melalui kepuasan kerja (Studi pada tenaga pengajar pusat bimbingan belajar Ganesha Operation Malang) / Rizky Rahmita Airindah
58Pengaruh strategi bauran pemasaran terhadap perilaku nasabah: studi kasus pada PT. Bank Rakyat Indonesia Malang-Kawi oleh Satrya Yudha Hartanto
59Pengaruh tingkat kepentingan pelanggan yang dapat dikendalikan terhadap kualitas layanan (studi pada peserta kursus CSN Brawijaya Malang) / Ahmad Thufail Budiyanto
60Analisis reaksi pasar modal Indonesia terhadap penerbitan obligasi ritel Indonesia 001 (studi kasus saham LQ-45) / Buntaran Prakoso Jati W.P.
61Pengaruh selisih inflasi Indonesia dengan Thailand terhadap nilai tukar rupiah dengan baht (THB) tahun 2004 s/d/ 2006 (pengujian paritas daya beli relatif) / Abdullah
62Pengaruh suasana toko (Store Atmosphere) terhadap keputusan pembelian konsumen di Indomaret (Studi pada konsumen Indomaret Sukorejo Selatan) / Ardhi Sidharta
63Penerapan model regresi ordinal untuk mengidentifikasi pengaruh bauran pemasaran terhadap banyaknya pembelian Dodol Rumput Laut / Dia Rini Pristianti
64Pengaruh faktor-faktor motivasi terhadap kinerja karyawan di PT. PLN (Persero) distribusi Jatim APJ Malang oleh Triastuti
65Pengaruh lingkungan kerja fisik, psikologi dan sosial terhadap semangat kerja melalui keselamatan dan kesehatan kerja (studi pada PR. Galuh Perkasa Wagir-Malang) / Kartika Chandra Putri Andriani
66Pengaruh kondisi tata ruang kantor tata usaha dan karakteristik pekerjaan terhadap kinerja karyawan pada sekolah menengah kejuruan kelompok bisnis dan manajemen di kota malang oleh Sulistiyaningsih
67Pengaruh current ratio, ROE, DER dan ukuran perusahaan terhadap kebijakan dividen (studi pada perusahaan sektor infrastruktur, utilitas & transportasi yang terdaftar di BEI periode 2008-2013) / Sinta Riski Puspitaningrum
68Faktor-faktor yang mempengaruhi konsumen dalam pembelian kerajinan keramik: studi pada Niza Souvenir Dinoyo Malang oleh Maziyatun Nisak
69Pengaruh debt to equity ratio dan return on equity terhadap harga saham yang dimoderasi oleh ukuran perusahaan (studi pada [perusahaan property dan real estate yang listing di BEI tahun 2014) / Muhammad Reza Alfianto Siregar
70Analisis brand awareness, perceived quality dan loyalitas merek obat sakit maag Promag (studi pada pengguna di Kelurahan Gading Kasri Kecamatan Klojen Kota Malang) / Nur Fauzi
71Pengaruh kualitas layanan terhadap loyalitas melalui kepuasan pelanggan pada ugo salonn' spa / Riski Aprilia Dwi Susanti
72Pengaruh penerapan konsep total quality management (TQM) terhadap kinerja karyawan melalui kepuasan kerja (studi kasus pada monthly labour PT Sampoerna Printpack Sukerojo) / Dian Maya Finasariia
73Pengaruh budaya organisasi terhadap motivasi kerja melalui kepuasan kerja karyawan PT. Anugerah Abadi Cahaya Sejati Surabaya / Oktaviana Rosidasakti
74Penerapan strategi bersaing pada toko konveksi Marlboro Collection Pasar Besar Malang / Friza Safitri
75Pengaruh selisih tingkat suku bunga terhadap forward rate di Indonesia tahun 2001-2006 (pengujian paritas suku bunga) / Aditia Novembrianto
76Pengaruh bauran promosi terhadap keputusan pembelian konsumen PT. Columbia di Blitar / Reni Ira Melati
77Pengaruh atribut produk terhadap proses keputusan pembelian handphone: studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang UPP-3 Blitar pengguna handphone Nokia / M. Safrudin Yahya
78Pengaruh strategi diferensiasi terhadap loyalitas konsumen (studi pada mahasiswa pengguna kartu IM3 Fakultas Ekonomi Universitas Negeri Malang) / Dian Purwantiasari
79Pengaruh atribut produk terhadap loyalitas konsumen dalam membeli sepeda motor merek Honda (studi pada mahasiswa Program S-1 Non Kependidikan Fakultas Ekonomi Universitas Negeri Malang) / Erik Savira
80Analisis motivasi dan kepuasan kerja karyawan KPRI Universitas Negeri Malang yang berstatus tenaga kerja kontrak / Dandega Aldilaga
81Pengaruh personal selling dan citra toko terhadap keputusan pembelian konsumen (studi pada Bandung Sport) / Slamet H. Pradhana
82Pengaruh pengetahuan konsumen tentang status merek pionir terhadap sikap konsumen pada sepeda motor merek Honda (studi pada siswa Menengah Atas Negeri 1 Kota Batu) / Chandra Kusuma Arta
83Pengaruh faktor internal dan eksternal terhadap keputusan siswa dalam memilih lembaga bimbingan belajar (studi pada lembaga bimbingan belajar Totalwin College Jl. Bandung Nomor 18 Malang) / Ananingsih Nurlita Pristiwi
84Pengaruh kualitas pelayanan terhadap kepuasan konsumen pada Gama Ayam Goreng Resto & Steak Cabang Kalpataru Malang / Lia Marliana
85Pengaruh konflik peran terhadap keinginan untuk tetap bekerja melalui komitmen pada organisasi (Studi pada karyawan PT Global Persada Santosa Utama Pandaan) / Silvia Zunaida
86Pengaruh stres kerja terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan bagian produksi UD. Rizka Boxindo Mojokerto) / Adi Surya Pradhana
87Pengaruh deversifikasi produk terhadap keputusan pembelian (studi pada perusahaan tegel CV. Penataran Blitar / Miftakhul Fadli
88Pengaruh atribut toko terhadap perilaku konsumen dalam berbelanja di Bentar Dipayana Swalayan Blitar / Nanang Fidrul Azizi
89Pengaruh persepsi brand image terhadap keputusan pembelian konsumen produk Pond's (studi kasus mahasiswa Fakultas Ekonomi angkatan tahun 2008-2009 Universitas Negeri Malang) / Galuh Ratna Puri
90Perbedaan abnormal return dan trading volume activity sebelum dan sesudah pemilihan umum presiden 2014 (studi kasus pada perusahaan yang termasuk dalam indeks LQ-45) / Furqondari Cahyani Anjarsari
91Pengaruh tingkat suku bunga dan tingkat inflasi terhadap indeks harga saham gabungan (IHSG) pada bursa efek Indonesia (BEI) (Periode 2004-2007) / Jefri Afandi Kumbara
92Pengaruh bauran promosi terhadap keputusan pembelian konsumen kartu IM3 (studi pada mahasiswa Fakultas Sastra Universitas Negeri Malang) / Silvia Eka Jayanti
93Pengaruh citra merek terhadap kepuasan konsumen dalam menggunakan sepeda motor merek Yamaha (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Muhammad Ichel Zamroni
94Pengaruh maturitas obligasi, kupon obligasi dan yiels to maturity terhadap harga obligasi negara RI seri fixed rate (FR) yang listing di BEI periode 2006-2008 / Dwi Kusumaningtyas
95Pengaruh budaya oraganisasi terhadap kinerja karyawan melalui komitmen oraganisasi (Studi pada karyawan PT Telkom Kancatel Blitar) / Binti Huriyah
96Pengaruh return on equity (ROE), price earning ratio (PER), dan price book value (PBV) terhadap return saham pada perusahaan property dan real estate yang listing di BEI periode 2005-2009 / Donny Pradinata
97Pengaruh kualitas layanan terhadap loyalitas yang dimediasi kepuasan nasabah PT. BPR Mitra Catur Mandiri Malang tahun 2012 / Sony Wijaya
98Pemilihan strategi pemasaran berbasis analisis SWOT pada Grand Pujon View Hotel and Resort Malang / Rinda Agus Mawarti
99Analisis keberhasilan program reengineering SDM sebagai upaya peningkatan kualitas layanan di Kantor Bersama Samsat Kota Malang / Indah Wulansari
100Pengaruh gaya kepemimpinan transformasional dan kepuasan kerja terhadap komitmen karyawan pada PT. Indra Karya Malang / Derry Sefriansyah
101Pengaruh kemasan terhadap keputusan pembelian (Studi pada pembeli obat mylanta di apotik Tongan Kota Malang) / Vela Seraya Beru Munthe
102Pengaruh capital adequacy ratio, financing to deposits ratio, dan non performing finance terhadap return on asset Bank Syariah di Indonesia tahun 2010-2011 / Faisol Muammar Hadafi
103Pengaruh bauran pemasaran terhadap keputusan pembelian kartu seluler (studi pada pengguna kartu seluler IM3 di Kelurahan Sumber Sari Malang) / Sandy Arintoko
104Praktek pelaksanaan pengawasan dan penerapan disiplin kerja (pada kantor pelayanan pajak pratama Malang Utara) / Gunaria Citra Adi Wijaya
105Pengaruh Debt to Asset Ratio (DAR), Debt to Equity Ratio (DER), Return On Asset (ROA) dan Return On Investment (ROI) terhadap harga saham (studi pada perusahaan otomotif yang listing di BEI periode 2007-2011) / Muhamad Rizki Lamba
106Pengaruh economic value added (EVA), arus kas operasi, arus kas inventasi, dan arus kas pendanaan terhadap return saham pada perusahaan yang listing di bursa efek Indonesia tahun 2004-2006 / Erik Yuliana
107Pengaruh kepuasan kerja terhadap niat untuk keluar dengan mediasi stres kerja (studi pada karyawan kontrak AJB Bumiputera 1912 Cabang Dieng Malang) / Yustitia Sersiana Islamia
108Pengaruh brand equity terhadap keputusan pembelian pelembab Pond's White Beauty (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Jevti Novitawati
109Pengaruh leader-member exchange, keadilan prosedural dan keadilan distributif terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan produksi PT. cool Clean Malang) / Dinny Kusuma Prahasti
110Pengaruh lingkungan toko terhadap keputusan pembelian konsumen (studi pada pembeli produk daur ulang di toko Daoer Oelang-Malang Town Square) / Nahria Rossita
111Pengaruh kualitas pelayanan terhadap loyalitas konsumen (studi pada konsumen Raden Lesehan di Blitar) / Muhamad Machrus Syafi'i
112Analisis pengaruh variabel fundamental terhadap harga saham (studi kasus pada perusahaan otomotif yang go publik di PT. Bursa Efek Indonesia) / Shellina Margi Rahayu
113Pengaruh faktor psikologis terhadap keputusan pembelian laptop acer (Studi pada mahasiswa pengguna laptop acer di Universitas Negeri Malang) / Fitria Wulandari
114Pengaruh financial leverage, likuiditas dan earnings per share terhadap harga saham di Bursa Efek Jakarta (BEJ) / Retno Widyarini
115Pengaruh kesehatan dan keselamatan kerja terhadap produktivitas kerja karyawan (pada karyawan bagian produksi di P.G Krebet Baru Malang) / Dovirul Ardi Nugroho
116Pengaruh biaya personal selling dan biaya advertising terhadap pendapan sewa kamar pada hotel Montana 1 Malang / Yusa Wibisono
117Pengaruh store image terhadap keputusan pembelian (studi pada konsumen Alfamart Kelurahan Ngaglik, Kota Batu) / Prima Setyo Nugroho
118Faktor-faktor yang mempengaruhi keputusan mahasiswa kuliah pada program non kependidikan Fakultas Ekonomi Universitas Negeri Malang / Dodi Jatmiko
119Hubungan investment opportunity set (IOS) dengan realisasi pertumbuhan serta perbedaan perusahaan tumbuh dan tidak tumbuh terhadap kebijakan pendanaan dan dividen pada perusahaan yang go public / Emi Yulianti
120Pengaruh pemberdayaan dan kepemimpinan terhadap kinerja melalui kepuasan kerja (studi pada tenaga perawat rumah sakit umum daerah Dr. Soegiri Lamongan) / Permadi Indra Kusuma
121Pengaruh motivasi kerja dan komunikasi organisasi terhadap produtivitas kerja melalui kepuasan kerja (Studi pada karyawan bagian pabrikasi PT. PG Kebon Agung Malang) / Kristin Juwita
122Persepsi karyawan tentang tipe kepemimpinan dan pengaruhnya terhadap kinerja karyawan Hotel Montana I Malang / Sucik Andarwati
123Pengaruh bauran promosi (promotion mix) terhadap keputusan pembelian pada golden swalayan di Kabupaten Tulungagung oleh Bayu Cahyoadi
124Pengaruh promosi konsumen terhadap keputusan konsumen dalam membeli yamaha vega-R di dealer Roda Mas Motor Lawang oleh Koko Wijil Cahyana
125Pengaruh kualitas pelayanan terhadap loyalitas pelanggan jasa servis sepeda motor Honda Ahass Asia Pakisaji / Denis Ariska Putri
126Faktor-faktor yang dipertimbangkan konsumen dalam pengambilan keputusan pembelian bakso kota Cak Man Malang / Rizqi Maulana
127Pengaruh budaya organisasi terhadap komitmen organisasi melalui kepuasan kerja karyawan bagian produksi PR. Gudang Sorgum Malang / M. Arif Budiman
128Pengaruh rasio lancar, perputaran piutang, dan perputaran persediaan terhadap profitabilitas pada perusahaan food and beverage yang listing di BEI periode 2004-2006 / Mufti Imaniar
129Pengaruh pesan iklan terhadap keputusan pembelian kartu prabayar IM3 (Studi pada pelanggan di Kelurahan Sumbersari, Kecamatan Lowokwaru, Kota Malang) / Citra Dewi Setyowati
130Pengaruh gaya kepimpinan terhadap semangat kerja karyawan (Studi pada Perusahaan Rokok Alfi Putra Trenggalek) / Annas Dzulfikar
131Pengaruh ekuitas merek terhadap loyalitas nasabah simapn pinjam (Studi pada PT. Danamon, Tbk di Kota Pasuruan) / Effendi Zainurahman
132Pengaruh bauran promosi terhadap proses keputusan untuk menjadi nasabah pada AJB Bumiputera 1912 Cabang Kayutangan Malang / Karlita
133Pengaruh customer delight trhadap customer loyality pada siswa lembaga bahasa dan pendidikan profesianal LIA Malang / Putri Anindita A.
134Pengaruh kepemimpinan transformasional tehadap komitmen organisasional melalui budaya organisasi (studi pada supervisor PT. Kertas Leces (Persero) Probolinggo) / Muhammad Nur Kholish
135Pengaruh kualitas layanan terhadap kepuasan konsumen (Studi kasus: pada konsumen Jasa Travel Pos di Kota Madiun) / Esty Bintari Kurnianingtyas
136Pengaruh modal sendiri, modal hutang, jumlah anggota dan volume usaha terhadap sisa hasil usaha pada koperasi simpan pinjam di Kota Malang tahun 2009-2011 / Dini Nurnaning Pratiwi
137Analisis kelayaan finansial pada investasi premajaan armada bus Widji Lamongan jurusan Surabaya Semarang periode tahun 2007-2011 / Allif Hudianto
138Pengaruh layanan purna jual terhadap kepuasan pelanggan (studi pada konsumen PT. Astra Daihatsu Motor Malang) / Muhammad Ribath Wibisono
139Pengaruh jumlah kredit, jangka waktu kredit dan jumlah simpanan terhadap bagian sisa hasil usaha anggota KPRI Wira Bhakti Lumajang / Wirawan Listyo Prabowo
140Pengaruh bauran pemasaran terhadap keputusan pembelian konsumen (Studi pada Bentar Dipayana Toserba Blitar) / Yanwar Wahyu Kristanto
141Pengaruh dimensi kualitas layanan terhadap tingkat loyalitas pelanggan Hypermart Malang Town Square / Frida Yuliawati
142Pengaruh kualitas komunikasi interpersonal terhadap komitmen organisasional melalui stres kerja (studi pada karyawan PT. Rodasakti Suryaraya Malang) / Rizki Wahyu Putri Pertiwi
143Pengaruh bauran promosi terhadap keputusan pembelian (Studi pada pembeli Rokok Djarum L.A Lights di warung Pulosari Malang) / Lilik Sulistyorini
144Pengaruh promotion mix kartu seluler merek non Indosat terhadap keputusan perpindahan merek (Brand Switching) dari kartu seluler Indosat (Studi pada mahasiswa S1 Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Ratna Harlia
145Analisis perbedaan profitabilitas dan likuiditas Bank Rakyat Indonesia Unit Porong sebelum dan sesudah bencana lumpur panas Lapindo / Abdullah Akbar
146Pengaruh penempatan (positioning) produk terhadap citra produk (studi pada pengguna kartu handphone simPATI di Kota Blitar) / Chandra Yudha Adhi Purnama Putra
147Pengaruh kinerja keuangan perbankan berdasarkan analisis eagles terhadap harga saham dan return saham (Studi kasus pada Bank Umum Swasta Nasional uang listing di Bursa Efek Jakarta periode 2002-2006) / Emy Ristyani
148Pengaruh variabel-variabel kualitas layanan perbankan terhadap loyalitas nasabah tabungan PT. Bank Muamalat Indonesia, Tbk. Cabang Malang / Rizqon Nasrullah
149Analisis pengaruh kualitas produk Ongisnade terhadap niat membeli konsumen di Ongisnade Store Malang / Adindana Yunendra Prabawanta
150Analisis efektifitas distribusi beban kerja karyawan pada Biro Sumber Daya manusia (SDM) dan Umum di Kantor Wilayah Perum Jasa Tirta 1 Malang / Firdaus Kharisma Febriyanto
151Pengaruh EVA (Econonic Value Added), EPS (Earning Per Share) dan PER (Price Earning Ratio) terhadap return saham pada perusahaan manufaktur yang lsiting di Bursa Efek Indonesia 2010 / Bagus Adi Wardhani
152Faktor penentu keputusan pembelian produk Blackberry: studi pada karyawan Bank Tabungan Negara (BTN) Syariah Cabang Malang / Astrid Novianita Putri
153Penerapan bauran pemasaran pada produk sandal merek Master di Desa Toyomarto Singosari Malang / Uji Kurniawan
154Pengaruh rasio arus kas terhadap return saham perusahaan manufaktur kelompok basic industry and chemicals (tahun 2008-2009) / M. Khoirul Anam
155Pengaruh faktor ekstern dan intern konsumen terhadap keputusan pembelian produk handphone Samsung (Studi pada PT. Graha Service Indonesia) / Handito Canggih Prabowo
156Analisis dimensi kualitas pelayanan yang dirasakan nasabah produk Tabunganku pada bank syariah Mandiri KCP Mojokerto / Fahmi Yusitasari
157Pengaruh bauran promosi terhadap perpindahan merek (brand switching) produk rokok Sampoerna A Mild (studi pada pengunjung Apresio Coffe Shop Malang) / Ainun Mustakhlafin
158Pengaruh suku bunga SBI, suku bunga the fed, kurs Rp-US$ dan inflasi terhadap suku bunga deposito berjangka 1 bulan pada bank umum emerintah pada tahun 2003-2007 / Citra Aji Sanjaya
159Persepsi nasabah tentang relationship marketing dan pengaruhnya terhadap loyalitas (Studi pada nasabah Tabungan Britama di BRI Cabang Blitar) / Yuli Ajeng Ratna N.
160Pengaruh motivasi dan kepuasan kerja terhjadap kinerja melalui stres kerja karyawan (Studi pada karyawan ruang rawat inap kelas IV RSU Dr. Saiful Anwar Malang) / Ria Lestari Pangestuti
161Pengaruh pengelolaan modal kerja dan debt to equity ratio (DER) terhadap return on investment perusahaan food and beverages yang terdaftar di BEI periode 2006-2008 / Khoirun Ni'mah
162Pengaruh atribut produk terhadap keputusan konsumen dalam membeli air mineral isi ulang (studi pada konsumen pelanggan air mineral OE Water di Blitar) / Andries Setiawan
163Pengaruh faktor psikologis terhadap keputusan pembelian (studi pada konsumen pembeli dan pengguna televisi Sharp di Kelurahan Rembang Kecamatan Sananwetan Kota Blitar) / Dewi Setiyoningsih
164Pengaruh nilai yang dirasakan terhadap niat untuk membeli melalui kepercayaan konsumen (Studi pada konsumen Yamaha di PT. Roda Sakti Surya Raya) / Hendra Suharjana
165Pengaruh struktur modal terhadap harga saham (studi pada perusahaan automotive an allied product yang listing di Bursa Efek Indonesia tahun 2005-2007) / Oni Arbiantari
166Pengaruh atmosfer toko terhadap keputusan pembelian pelanggan (studi pada pelanggan Distro Inspired Malang) / Kisvangga Enjaquare
167Pengaruh debt to equity ratio, return on equity dan ukuran perusahaan terhadap nilai perusahaan (studi kasus pada Perusahaan Pulp and Paper yang listing di BUrsa Efek Indonesia periode 2008-2012) / Tita Ervionita
168Pengaruh Current Ratio, Debt To Equity Ratio, Net Profit Margin dan transaksi usaha koperasi dengan usaha anggota terhadap perubahan sisa hasil usaha pada KPRI di Kota Malang tahun 2010 / Mochammad Syahroni
169Pengaruh faktor kualitas layanan melalui kepuasan pelanggan (Studi pada jasa servis sepeda motor Yamaha pada CV. Vahaya Sakti Motor) / Swastika Indra Listyono
170Analisis SWOT sebagai dasr perumusan strategi pemasaran produk makanan (Studi di Bakso Mama 1 Jombang) / Sayuti
171Pengaruh right issue terhadap return saham dan abnormal return (Studi pada perusahaan yang listing di Bej tahun 2004-2008) / Hendrik Aan Johano
172Pengaruh Debt to Equity Ratio (DER) dan Return On Asset (ROA) terhadap return saham pada perusahaan property and real estate yang listing di BEI pada tahun 2014 / Fajrin Hanafiah
173Pengaruh Brand Image terhadap kepuasan konsumen (Studi pada pengguna sepeda motor merek Honda pada klub-klub otomotif di Kota Malang) / Galih Pratitiweni
174Analisis perbedaan return, abnormal return, dan trading volume activity (TVA) saham sebelum dan sesudah right issue pada perusahaan publik di Indonesia (periode pengamatan 2003-2007) / Weny Ferawati
175Pengaruh kepemimpinan transformasional terhadap organizational citizenship behavior melalui kepuasan kerja (studi pada karyawan Departemen Pabrikasi PT PG Krebet Baru Malang) / Riza Andi Ardiansyah
176Pengaruh kurs rupiah pada US dollar terhadap indeks harga saham gabungan melalui volume perdagangan saham periode Juli-Desember 2012 / Andri Prasetyo
177Pengaruh kepemimpinan transformasional terhadap Organizational Citizenship Behavior (OCB) melalui komitmen organisasi pada PG Kebon Agung Malang / Dimas Mahendra Wicaksono
178Pengaruh selisih tingkat inflasi dan selisih tingkat suku bunga terhadap nilai tukar rupiah di Indonesia (pengujian model PPP dan model IFE) / Asmaul Khusna
179Analisis pengadaan dan pemberdayaan karyawan di PT. Repoeblik Telo Kabupaten Pasuruan / Usella Irvan Tiyanti
180Prediksi return saham setelah IPO (Initial Public Offering) pada perusahaan yang listing di BEI antara tahun 2003-2007 / Yosi Arinta Firmandia
181Analisis perbedaan abnormal return, risiko, dan trading volume activity saham sebelum dan sesudah dikeluarkannya Perda DKI Jakarta No. 2/2006 pada perusahaan rokok yang listing di BEI / Ali Mas'ud
182Studi stres kerja, kepuasan kerja, komitmen organisasi dan niat untuk keluar di PT Pabrik Gula Krebet Baru / Sandhi Rahadian
183Pengaruh token economy dan loyalitas konsumen terhadap proses pengambilan keputusan dalam membeli produk pada Matahari Department Store Kota Madiun / Anggris Nuarasyita
184Analisis SWOT sebagai dasar penerapan strategi pemasaran jasa pada obyek wana wisata Balekambang di Kabupaten Malang / Puguh Wiranto
185Perbedaan risiko, return, abnormal return (AR), cummulative abnormal return (CAR), trading volume activity (TVA), security return variability (SRV) sebelum dan sesudah kenaikan harga gas bagi industri dasar & kimia yang listing di BEI periode pengamatan 2
186Pengaruh EVA (Economic Value Added), EPS (Earning Per Share) dan PER (Price Earning Ratio) terhadap return saham pada perusahaan manufaktur yang go public di Bursa Efek Indonesia periode 2004-2006 / Anggraeni Mustiko Widianingrum
187Pengaruh profitabilitas, struktur aktiva, tingkat pertumbuhan penjualan, dan kepemilikan manajerial terhadap struktural modal pada perusahaan Food and Beverage yang Listing di Bei Periode 2007-2010 / Taufik Pondra P
188Pengaruh diversifikasi dan diferensiasi terhadap keputusan pembelian produk PT. Coca-Cola Bottling Indonesia (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Rina Manistatho'a
189Analisis faktor-faktor yang menentukan kualitas layanan pada Kantor Pelayanan Pajak (KPP) Malang / Utik Prabawati
190Pengaruh brand reinforcement terhadap brand loyalty pada kartu simpati (studi pada pengguna kartu simpati di Desa Munjungan Trenggalek) / Ekin Framitasari
191Studi komparatif kinerja reksadana saham konvensional dengan reksadana saham syariah menggunakan metode Sharpe, Treynor, dan Jensen di Pasar Modal Indonesia tahun 2006 / Novi Yudhanik
192Pengaruh iklan sepeda motor Yamaha Jupiter Z di telivisi terhadap keputusan pembelian konsumen (Studi kasus pada anggota Klub Motor "SEMOK" Malang) / Dody Herlambang
193Pengaruh asimetri informasi dan disclosure terhadap cost of capital (Studi pada perusahaan yang listing di BEI) / Ika Fitriasih
194Pengaruh suku bunga, nilai tukar rupiah (Terhadap dollar Amerika Serikat), dan volume penjualan saham terhadap harga saham sebelum dan sesudah pemotongan suku bunga Bank Sentral Amerika Serikat (Studi kasus pada PT Bank Rakyat Indonesia (Persero) Tbk) / Triaji Nanang Ku
195Perbedaan kinerja keuangan Bank Syariah Mandiri dan Bank Muamalat Indonesia dengan metode eagles (tahun 2008-2012) / Kiki Rizqi Amalia
196Pengaruh Bid-Ask spread dan trading volume activity (TVA) terhadap abnormal return pada perusahaan industri property and real estate yang go public di bursa efek Indonesia periode Januari - Desember 2007 / Isti Ainur
197Pengaruh bauran pemasaran jasa (service marketing mix) terhadap proses pengambilan keputusan konsumen dalam melakukan service dan maintenance (studi pada konsumen GE Computer Malang) / Muharti Femmi Wulandari
198Pengaruh ekuitas merek terhadap keputusan pembelian (studi pada konsumen air mineral merek Aqua kemasan galon di perumahan Panorama Megah Blitar) / Rika Sayu Fitriana
199Pengaruh positioning terhadap pembentukan brand image (studi kasus pada pengguna kartu prabayar IM3 di Kelurahan Gadingkasri, Kecamatan Klojen, Kota Malang) / Widi Astuti
200Pengaruh kualitas layanan terhadap loyalitas nasabah (Studi pada nasabah simpan pinjam PT. BPR. "Armindo Kencana" Kantor Kas Wajak) / Fika Hafidatul Rofi'ah
201Pengaruh dimensi-dimensi kualitas layanan terhadap kepuasan pengunjung Hotel Montana Dua Malang / Gracia Ika Kusumawati
202Pengaruh customer relationship management (CRM) terhadap kepuasan nasabah (Studi pada PT. BPR Aswaja, Ponorogo) / Yunita Rahmawati
203Penerapan strategi promosi pada travelink tour & travel Kota Malang / Wartanindita
204Pengaruh gaya kepemimpinan general manager terhadap semangat kerja karyawan (Studi pada Hotel Sahid Montana Malang) / Farida
205Pengaruh kualitas produk, kualitas layanan dan customer value terhadap konsumen Legend Coffee Malang / Haryo Suryo Prabowo
206Pengaruh kurs rupiah terhadap harga saham PT. H.M. Sampoerna, Tbk dan harga saham PT. Gudang Garam, Tbk di Bursa Efek Jakarta / Hendri Irawan
207Perbedaan abnormal return, trading volume activity, security return variability dan Bio-ask spread saham sebelum dan sesudah akuisisi pada Perusahaan yang listing di Bursa Efek Indonesia (REI) periode 2002-2006 / Ana Lestari
208Kebijakan penempatan kerja untuk menciptakan kinerja individu yang optimal pada karyawan (studi kasus pada PT. Bank Rakyat Indonesia, Tbk Cabang Sutoyo Malang) / Ferdian Eka Pramudita
209Pengaruh pelaksanaan servive quality terhadap tingkat kepuasan konsumen: studi kasus pada hotel mustika Tuban oleh Arief Rachman
210Pengaruh persepsi atribut produk terhadap proses keputusan pembelian (studi pada Distro Brokenskool Kepanjen, Kab. Malang) / Dimas Danil Abimanto
211Pengaruh dimensi kualitas jasa terhadap loyalitas peserta didik di Lembaga Bimbingan Belajar Kiraku Turen / Septi Erlianti
212Pengaruh motivasi dan disiplin kerja terhadap produktivitas kerja karyawan (Studi kasus pada karyawan bagian personalia pada PT Kutai Timber Indonesia Probolinggo) / Febri Cipto Hadi
213Pengaruh kualitas produk terhadap kepuasan konsumen dalam membeli daging sapi (Studi pada konsumen depot daging Mubarokah, Mojokerto / Dewi Nurun Nisfiana
214Pengaruh kualitas layanan terhadap keputusan pembelian (Studi pada Hotel Sri Lestari Blitar) / Puji Ernawati
215Pengaruh profitability, size, dan tangible asset terhadap leverage perusahaan pertambangan yang terdaftar di Bursa Efek Indonesia: perspektif pecking order theory tahun 2006-2010 / M. Fahmi Zakka
216Pengaruh motif pembelian dan faktor lingkungan terhadap keputusan perpindahan merek (Brand Switching) shampo sunsilk (Studi pada siswi kelas XI SMK Negeri 3 Malang) / Evi Susanti
217Pengaruh trust in brand terhadap brand loyality kartu pra bayar simpati pada karyawan Dinas Pendidikan Jombang / Retnaning Tyas
218Pengaruh relationship marketing terhadap loyalitas pengguna ATM BNI (Studi pada pengguna ATM BNI di Universitas Brawijaya dan Universitas Negeri Malang) / Tatang Ermawan
219Pengaruh faktor-faktor eksternal terhadap keputusan konsumen dalam pemilihan Bank Perkreditan Rakyat (Studi pada nasabah simpan pinjam Bank Perkriditan Rakyat Danaputra Sakti Pandaan) / Dina Merinda Effendi
220Pengaruh variabel fundamental terhadap harga saham pada Perusahaan Rokok yang Go Public di Bursa Efek Jakarta / Miftahul Munir
221Pengaruh return on asset dan return on equity terhadap harga saham melalui earning per share (studi pada perusahaan pertambangan yang tercatat di BEI periode 20011-2012) / Tifani Ikasari
222Pengaruh faktor eksternal terhadap proses keputusan pembelian untuk menggunakan jasa warung internet (survei pada pengguna jasa warnet Raya Dinoyo Net Malang) / Rahmat Setiawan
223Pengaruh gaya kepimpinan transformasional terhadap kepuasan kerja melalui kepercayaan karyawan pada atasan (Studi pada karyawan PT. Semanggimas Sejahtera Kota Surabaya cabang Kediri) / Ahmad Fauzy
224Pengaruh disiplin kerja terhadap produktivitas kerja karyawan studi pada PT.Pos Indonesia (Persero) Malang / Diky Hardiyanto
225Pengaruh perputaran modal kerja terhadap profitabilitas perusahaan otomotif dan komponen yang listing di BEI periode 2011-2013 / Nor Mar'atul Azizah
226Pengaruh penayangan iklan di telivisi terhadap keputusan konsumen dalam membeli sabun lux (Studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Nur Laili Handayani
227Pengaruh komitmen karyawan pada perusahaan terhadap kinerja karyawan (studi pada karyawan Jawa Timur Park) / Agus Surianto
228Pengaruh tayangan iklan kartu seluler Telkom Flexi di televisi terhadap keputusan pembelian konsumen (studi kasus pada anggota flexter Kota Malang) / Akta Nurdian Putra Anundhita
229Pengaruh pemberian kompensasi terhadap kinerja karyawan melalui komitmen organisasi (studi pada karyawan bagian produksi pabrik kertas CV Setia Kawan Tulungagung) / Theresia Rahayu
230Pengaruh atmosfir toko terhadap perilaku menjauh-mendekat pelanggan Rumah Busana Nur Arafah Bugul Kidul Pasuruan / Brilian Nourouzzaman
231Pengaruh initial dividen terhadap volume penjualan saham dan return saham pada perusahaan yang listing di BEI periode tahun 2002-2011 / Mauryn Jevie Kumala
232Pelaksanaan strategi saluran distribusi untuk meningkatkan volume penjualan pada perusahaan saus CV Jempol Jaya Kediri / Ivin Setiani
233Efisiensi penerapan metode pengendalian persediaan pada Bagus Agriseta Mandiri Kota Batu / Eva Agustina
234Pengaruh pelatihan tenaga kerja terhadap peningkatan produktivitas karyawan (studi pada PT PLN (PERSERO) area Malang) / Yodith Satria
235Hubungan antara disiplin kerja dengan prestasi kerja: studi pada karyawan bagian produksi di perusahaan kontraktor PT Tanah Air Mas Malang oleh Soppi Kristina Mariana
236Analisis konflik dan manajemen konflik karyawan pada komunitas Ngawi Organik Center di Kabupaten Ngawi / Teguh Widodo
237Pengaruh bauran promosi terhadap proses keputusan pembelian (studi pada konsumen di perumahan Griya Tirta Aji Malang) / Muhammad Fatoni
238Pengaruh dimensi kualitas layanan jasa terhadap keputusan pembelian (studi pada konsumen Araya Golf & Family Club) / Ita Riana Ardhiani
239Pengaruh faktor psikologis konsumen terhadap keputusan pembelian secara online pada shopee Id (studi pada mahasiswa Manajemen angkatan 2014/2015 dan 2015/2016 Fakultas Ekonomi Universitas Negeri Malang) / Melyanie Mandasari
240Pengaruh variabel budaya, sosial, pribadi, dan psikologis terhadap proses keputusan konsumen dalam membeli sepeda motor Honda (studi pada konsumen dealer Aris Motor Jombang) / Atik Rohmawati Mafrudhoh
241Analisis desain pekerjaan dan kesadaran personil terhadap keselamatan dan kesehatan kerja untuk mendukung zero accident pda tim PDKB (Pekerjaan Dalam Keadaan Bertegangan) PT. PLN (Persero) Area Malang / Dhimas Wahyu Wicaksono
242Pengaruh perilaku keluhan pelanggan terhadap niat menyampaikan keluhan (studi pada pelanggan Perusahaan Daerah Air Minum (PDAM) Kota Malang) / Tias Arie Puspasari
243Pengaruh rasio lancar, rasio perputaran modal kerja, rasio perputaran total aktiva terhadap return on investment pada perusahaan food and beverages yang listing di BEI periode 2006-2009 / Irvan Fachrudin
244Pengaruh bauran promosi (promotion mix) terhadap keputusan konsumen dalam berwisata di Batu Night Spectacular (BNS) / Agung Satriawan
245Pengaruh stres kerja terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan PT. Industri Sandang Nusantara Cabang Lawang) / Reza Marbyana
246Pengaruh gaya kepemimpinan transformasional dan budaya organisasi terhadap kinerja karyawan (pada Perusahaan AJB Bumiputra 1912 Kantor Cabang Malang Singosari) / Afrizal Ramdhani
247Pengaruh faktor psikologis terhadap keputusan pembelian produk fashion (studi pada konsumen Redzone Distro di Kota Blitar) / Nur Happy Wijayanti
248Pengaruh faktor lingkungan terhadap keputusan pembelian (studi pada swalayan KUD Tri Jaya Desa Sraten Kecamatan Cluring Kabupaten Banyuwangi) / Lutfiana Mufidah
249Pengaruh rasio-rasio keuangan terhadap return saham di industri perbankan yang listing BEI periode 2007-2010 / Ika Dewi Purwati
250Analisis perbedaan return, risiko, volume perdagangan saham dan bid ask spread sebelum dan sesudah stock split pada perusahaan yang listing di Bursa Efek Indonesia periode 2005-2007 / Indra Rudy Stiawan
251Pengaruh citra merek (brand image) terhadap minat beli pada pembeli potensial mobil Toyota di Auto 2000 Sukun Malang / Wuri Lestari Cahyaningrum
252Pengaruh karakteristik pekerjaan terhadap kinerja melalui komitmen organisasi (Studi kasus pada karyawan PT PLN (Persero) Distribusi Jawa Timur Area Malang) / Titi Sulistyaningtyas
253Pengaruh advertising dan pengembangan produk terhadap volume penjualan pada perusahaan kopi "Sumber Agung" Malang / Dine Transetyo
254Pengaruh kualitas layanan terhadap loyalitas pelanggan pada rumah makan lesehan dan galeri Joglo Dau Malang / Irvananta Aditya P.
255Pengaruh selisih inflasi Indonesia dengan beberapa negara anggota G8 terhadap nilai tukar rupiah pada tahun 2006-2009 / Merry Tri Yuana Dewi
256Perbedaan profitabilitas, price earning ratio, dividend payout ratio, earning per share sebelum dan sesudah stock split pada perusahaan manufaktur yang listing di BEI periode 2000-2002 / Dhidit Prasetya Adi
257Analisis kesadaran merek dan asosiasi merek ponsel Samsung (studi di Malang Plasa Handphone Centre) / Niki Kurnia Pramana
258Pengaruh personal selling dan citra toko terhadap keputusan pembelian konsumen / Jazairotin Nikma
259Pengaruh iklan media televisi terhadap keputusan konsumen dalam membeli sepeda motor yamaha (study pada pemilik motor yamaha di desa Baye, kecamatan Kayen Kidul, kabupaten Kediri) / Susi Retno Wulandari
260Pengaruh kualitas produk dan harga terhadap proses keputusan pembelian konsumen pada ponsel merk sony ericsson (Studi pada siswa mahasiswa fakulitas ekonomi Universitas Negeri Malang) / Hasim As Ari
261Pengaruh penggunaan celebrity endorser pada iklan sabun mandi lux terhadap pembentukan brand image (Studi kasus pada mahasiswi S1 manajemen fakultas ekonomi Universitas Negeri Malang) / Arik Nur Qomariyah
262Pengamatan fenomena gaya hidup dan faktor psikologis pria metroseksual dalam menentukan keputusan pembelian produk-produk kosmetika khusus pria/ Dinda Wahyuning Setya
263Pengaruh aspek-aspek pelatihan kerja terhadap prestasi kerja karyawan pada hotel pelangi malang./Anugrah Dwi Cahyadi
264Penentuan strategi pemasaran produk Freshy Accessories Malang Town Square berbasis analisis SWOT / Muhammad Ilyasak
265Pengaruh bauran promosi terhadap keputusan pembelian pada toko star fashion Rejotangan Tulungagung / Agus Eko Supriono
266Pengaruh kualitas produk terhadap word of mouth promotion melalui kepuasan konsumen (studi pada mahasiswa S1 Manajemen Fakultas Ekonomi Universitas Negeri Malang yang menggunakan smartphone Samsung) / Muhammad Indra Fahrudin
267Analisis faktor kualitas layanan pada hotel Puri Perdana Blitar / Rio Jajang Indra Wijaya
268Pengaruh ROE, EPS, dan EVA terhadap harga saham perusahaan manufaktur yang listing di bursa efek Indonesia periode 2006-2008 / Pritafani Destina
269Pengaruh current ratio dan debt to equity ratio terhadap kebijakan dividen melalui net profit margin (studi pada perusahaan manufaktur yang listing di BEI periode 2013) / Gresylia Ekawati
270Perngaruh budaya organisasi terhadap komitmen organisasi (Studi pada karyawan Bagian Produksi PT. Patal Lawang) / Dwi Aryanto W
271Pengaruh komponen arus kas dan arus kas bebas terhadap harga saham perusahaan industri makanan dan minuman yang lsiting di Bursa Efek Indonesia periode 2010-2012 / Karina Putri Wulandari
272Pengaruh promotion mix terhadap proses keputusan pembelian smartphone Iphone (studi pada mahasiswa Fakultas Ekonomi Jurusan Manajemen Universitas Negeri Malang) / Caesar Putra Agung
273Pengaruh laba akuntansi (laba kotor, laba operasi dan laba bersih) terhadap cumulative abnormal return saham perusahaan manufaktur kelompok basic industry and chemicals (tahun 2008-2009) / Deniza Ika Trisnawati
274Pengaruh Beberapa Faktor Fundamental Emitmen, Suku Bunga Bebas Resiko Dan IHSG Terhadap Harga Saham Pada Perusahaan Yang Terdaftar Di Bursa Efek Jakarta oleh Gugun Febriyanto
275Pengaruh persepsi bauran promosi terhadap keputusan pembelian smartphone Sony Xperia Series (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Lidya Farhah Wakamala
276Pengaruh kualitas pelayanan terhadap loyalitas nasabah (studi kasus di PT BCA Tbk Cabang Pamekasan) / Merina Yuda Retno
277Pengaruh strategi bauran pemasaran terhadap keputusan konsumen berbelanja di swalayan Avan Sawojajar Malang / Swacahyani R. Pradani
278Pengaruh ekuitas merek terhadap niat membeli sari roti (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2011) / Aldella Prima B.P.
279Analisis faktor-faktor yang mempengaruhi loyalitas merek dan pengaruhnya terhadap perilaku konsumen mahasiswa Universitas Negeri Malang dalam membeli produk kosmetik oleh Muhamad Novizal
280Pengaruh bauran pemasaran terhadap perilaku konsumen dalam membeli kartu handphone: studi pada penggunan kartu handphone pro-XL di Kodya Malang oleh Rahmat Arif Nasution
281Pengaruh dimensi kualitas jasa terhadap kepuasan nasabah: studi PT. Bank Rakyat Indonesia (Persero) Retail Cabang Malang Kawi oleh Andhang Budhy Harsa
282Pengaruh kemasan terhadap keputusan konsumen dalam membeli produk kosmetik: studi pada mahasiswa S1 Jurusan Manajemen Fakultas Ekonomi Universiitas Negeri Malang oleh Ahmad Fatoni
283Pengaruh kualitas jasa terhadap kepuasan konsumen (Pelanggan) pada PT. Telkom Kancatel Lumajang oleh Mamik Endriyani
284Pengaruh aspek psikologis terhadap pembentukan loyalitas konsumen produk pasta gigi pepsodent: studi pada ibu rumah tangga di Perumnas Sawojajar Malang oleh Tasnim N. R
285Pengaruh kualitas jasa terhadap kepuasan nasabah pada PT. BPR Buduran Delta Purnama Sidoarjo oleh Sumartik
286Pengaruh kemasan terhadap perilaku komsumen dalam membeli parfum pada avon supermarket Malang oleh Duana Susanti
287Perilaku konsumen dalam mengkosumsi produk kafe veteran: studi kasus pada kafe smooth jalan Veteran Malang oleh Dedy Syaufiq Riza
288Pengaruh diversifikasi produk terhadap perilaku konsumen dalam membeli produk furniture di meubel Al-Amin Malang oleh Nurbayanti
289Pengaruh brand image terhadap loyalitas pelanggan mobil merek Toyota Avanza (studi pada pengguna mobil Toyota Avanza di Probolinggo) / Fykie Myantha Sharosie
290Pengaruh Penempatan (postioning) produk terhadap citra produk terhadap citra produk : studi kasus pada penggunaan kartu handphone simpati di Kota Malang oleh Andry Robbiansyah
291Pengaruh bauran promosi terhadap keputusan konsumen dalam membeli telepon SMS: studi kasus pada planggan PT. Telkom Kancatel Blitar oleh Acik Triastuti
292Pengaruh pemberian insentif terhadap prestasi kerja pegawai: studi pada pegawai Balai Taman Nasional Bromo Tengger Semeru Malang oleh Yni Kurniawati
293Hubungan tata ruang kantor dengan semangat kerja pegawai tata usaha (TU) Dinas Pendidikan Nasional Kota Malang oleh Ita Kusrini
294Pengaruh perputaran persediaan dan total assets turnover (TATO) terhadap return ion investment (ROI) melalui net profit margin (NPM) pada perusahaan manufaktur yang listing di Bursa Efek Indonesia tahun 2005-2009 / Ayu Ersia Firsada
295Pengaruh faktor fundamental dan rasio harga saham atas nilai buku (price to book value) terhadap return saham pada perusahaan real estate & property yang listing di BEJ periode 2003-2005 / Rosa Ekawati
296Pengaruh brand image produk terhadap keputusan pembelian melalui sikap konsumen dalam membeli pembalut wanita merek Laurier (studi pada mahasiswa di Kelurahan Sumbersari Kecamatan Lowokwaru Kota Malang) / Dian Erfina Nur'aini
297Pengaruh tayangan iklan motor Yamaha di televisi terhadap keputusan pembelian (studi pada dealer sentral Yamaha Malang) / Adi Ardiansyah
298Pengaruh copporate social responsibility internal terhadap komitmen organisasi melalui kepuasan kerja karyawan (Studi pada karyawan PT PG Rajawali II Unit PG Krebet Baru Bululawang Malang) / Wreda Triwitosari
299Hubungan efektivitas pelaksanaan mutasi intern dengan kinerja pegawai di Kantor Pajak Bumi dan Bangunan Kota Malang oleh Eko Yaketiana
300Pengaruh kualitas produk terhadap keputusan pembelian konsumen mahasiswa Universitas Negeri Malang dalam membeli produk sabun mandi LUX oleh Suhermin
301Pelaksanaan strategi bauran pemasaran pada perusahaan sepatu "House of Mr. Pienk" Malang oleh Wahyu Novitasari
302Pengaruh diferensiasi produk terhadap omzet penjualan pada koperasi intako Tanggulangin Sidoarjo oleh Achmad Zainuddin
303Analisis variabel-variabel yang berpengaruh terhadap kunjungan wisatawan arung jeram dengan menggunakan jasa PT. Regulodi Sungai Pekalen Probolinggo oleh Wiwik Sulistiani
304Pengaruh minat, masa kerja, latar belakang pendidikan dan status sosial ekonomi terhadap gaya kepemimpinan wali kelas di SMK Negeri I Malang oleh Lilik Suryani
305Analisis kinerja keuangan perusahaan sebelum dan sesuadah terdaftar di Bursa Efek jakarta: studi kasus PT. Sari Husada Tbk. oleh Indramayu
306Pengaruh pengelolaan modal kerja terhadap tingkat rentabilitas pada PT. Gudang Garam Tbk. oleh Retno Wulandari
307Pengaruh citra produk terhadap proses pengambilan keputusan pembelian sepeda motor Honda (studi pada UD Marga Kartika Motor Wlingi - Blitar) / Ika Findasari
308Pengaruh country of origin dan brand image terhadap minat beli konsumen produk Asus Smartphone (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi angkatan 2015/2016 Universitas Negeri Malang / Annisha Nur Indah Sari
309Pengaruh bauran promosi terhadap keputusan konsumen untuk menggunakan layanan Internet Hotspot Speedy (Studi pada penggunan layanan internet hotspot speedy di Malang Town Square) / Ahmad Syaifudin
310Analisa break even point (IMPAS) dengan pendekatan activity based costing (ABC) sebagai alat perencanaan laba jangka pendek: studi kasus pada PT Mentari Massen Toys Indonesia, Jombang oleh Yunani Sandria
311Analisis rasio keuangan sebagai alat untuk mengukur efisiensi pengelolaan modal kerja: studi kasus pada PT. Peseona Remaja Malang oleh Heriyanto
312Analisis rasio keuangan sebagai alat untuk menilai kinerja keuangan pada perusahaan makanan yang go publik di BEJ: PT. Indofood suksesmakmur, Tbk dan PT. Siantar Top, Tbk oleh Chandra Dian Syaiful
313Evaluasi kinerja keuangan dengan sistem pont: studi PT Sari Husada, Tbk dan PT Ultrajaya Milk Industry, Tbk oleh Chotifa Umul Sabikis
314Pengaruh faktor fundamental perusahaan terhadap return dan volume perdagangan saham blu chips di PT. Bursa Efek Jakarta oleh Beni Catur Sasongko
315Analisis resistensi kinerja keuangan bank perkreditan rakayat syariah selama dan sesuadah krisis moneter di wilayah kerja Bank Indonesia Malang oleh Wiwik Ariyanti
316Analisis rasio keuangan sebagai alat untuk mengukur kinerja perusahaan: studi kasus pada PT British American Tobacco Indonesia, Tbk oleh Wahyu Susilawati
317Implementasi keselamatan dan kesehatan kerja (K3) karyawan pada PT. Mega Jaya Plastik Jombang / Agus Sulistyawan
318Pengaruh penilaian kinerja terhadap motivasi kerja karyawan melalui kepuasan kerja (Studi pada karyawan PT. Taspen (Persero) cabang Malamg) / Iis Irawati Lestari
319Pengaruh manajemen saluran distribusi terhadap volume penjualan pada UD. Indah Blitar / Ludya Ambar Wahyu
320Analisis perbedaan kinerja keuangan dengan metode Du Pont pada perusahaan manufaktur sebelum dan sesudah go public (studi pada perusahaan manufaktur yang listing di BEJ tahun 2001) / Yany Purnamasari
321Kajian tentang penjelasan analogis dalam buku pelajaran kimia SMA kelas II yang digunakan di SMA Kota Malang oleh Oktaviana Sulistina
322Pengaruh persepsi bauran promosi terhadap keputusan pembelian (studi pada konsumen sepeda motor Honda Dealer Tirto Agung Blitar) / Mei Yanti
323Pengaruh brand extension terhadap proses keputusan pembelian smartphone Lenovo (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2014) / Masrifah Auliya
324Pengaruh persepsi citra merek terhadap loyalitas pelanggan (studi pada pelanggan Eardah Kosmetik di Toserba Apollo Pamekasan) / Reni Puji Astutik
325Pengaruh market timing, stock selection, dan umur reksa dana terhadap kinerja reksa dana saham periode 2010-2013 / Ratna Wahyuningsih
326Pengaruh persepsi bauran pemasaran jasa terhadap kepuasan pelanggan (studi pasa Warung Ayam bakar Lintang Malang) / Muhammad Manshur Murtadhi
327Pengaruh harga dan kualitas pelayanan terhadap loyalitas konsumen pada Warung Apung Rahmawati Cabang Lontar Surabaya / Arik Puri Rahayu
328Pengaruh ekuitas merek (Brand Equity) terhadap loyalitas konsumen dalam membeli produk air minum kemasan galon merek Aqua (Studi pada mahasiswa Universitas Negeri Malang yang tinggal di Kelurahan Sumbersari Kecamatan Lowokwaru Malang) / Nanin Karlina
329Pengaruh kualitas jasa terhadap loyalitas pelanggan (Studi pada pelanggan servis mobil merek Toyota di Auto 2000 Malang Soetoyo) / Anis Wiji Rahayu
330Analisis perbedaan persepsi konsumen tentang strategi promosi penualan, strategi harga dan strategi promosi penjualan, strategi harga dan strategi layanan purna jual, antara dealer sepeda motor Honda, Yamaha, dan Suzuki di Perumahan Blitar Panorama Megah Kelurahan Gedog
331Pengaruh kualitas layanan terhadap loyalitas konsumen: studi pada Atlantic Movie Rental Original Dinoyo Malang / Rosarita Arsyad
332Pengaruh persepsi bauran promosi terhadap ketertiban konsumen dalam proses pembuatan keputusan pembelian kosmetik Pon's White Beauty (Survey pada mahasiswi Universitas Negeri Malang yang tinggal di Kelurahan Subersari RT 5 RW 3 Kecamatan Lowokwaru kota Malang) / Alfonsi
333Pengaruh kualitas pelayanan terhadap loyalitas pelanggan (studi pada pelanggan rumah makan Retno Kota Blitar) / Ayu Ramadhani
334Pengaruh kualitas pelayanan terhadap loyalitas nasabah tabungan simpedes (studi pada PT. Bank Rakyat Indonesia Tbk. Unit Pakisaji Cabang Martadinata Malang) / Vicky Sekti Prayudi
335Pengaruh kinerja keuangan perbankan berdasarkan analisis Camels terhadap harga saham dan return saham (studi kasus pada bank umum swasta nasional yang listing di Bursa Efek Jakarta Periode 2002-2006) / Ardian Chaprina Kusumasari
336Pengaruh leverage, rasio aktivitas, dan rentabilitas ekonomi terhadap rentabilitas modal sendiri pada perusahaan food and beverages periode tahun 2004-2006 / Nathalia Dian Prasetyani
337Pengaruh ketidakpuasan konsumen terhadap keputusan perpindahan merek (brand switching) mie instan (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Amala Sholicha
338Pengaruh bauran promosi terhadap minat beli ulang perdana kuota data Always On (AON) Provider 3 (Tri) (studi pada siswa kelas X SMAN 1 Kota Batu) / Edo Yon Perkasa
339Pengaruh faktor psikologis terhadap keputusan pembelian laptop Axioo (Studi pada mahasiswa TEknik Universitas Negeri Malang) / Okvianita Ekawati
340Penerapan pembelajaran kooperatif model struktural think-pair-share (TPS) untuk meningkatkan motivasi dan hasil belajar siswa pada mata pelajaran ekonomi (studi kasus pada siswa kelas X.3 SMAN 9 Malang) / Herlin Kusmawati
341Pengaruh kualitas produk terhadap keputusan pembelian (studi pada pemakai oli Top 1 di bengkel Toyo Motor Lodoyo Blitar) / Fikri Rofi'udin
342Pengaruh perputaran piutang dan persediaan terhadap profitabilitas pada perusahaan manufaktur yang listing di Bursa Efek Jakarta (BEJ) tahun 2004-2006 / Endang Sulistiowati
343Pengaruh eksposur ekonomi terhadap kinerja saham pada perusahaan manufaktur yang terdaftar di BEJ / Nova Sylvania
344Pengaruh brand trust terhadap brand loyalty konsumen sepeda motor Honda pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang / Fitriani
345Pengaruh dimensi kualitas layanan terhadap keputusan pembelian nasabah PT. Asuransi Jiwasraya (Persero) Cabang Blitar / Widhi Arsono Harimurti
346Pengaruh kualitas pelayanan jasa terhadap loyalitas pengunjung taman wisata Jatim Park di Kota Batu / Anip Rikayati Dwi R.
347Pengaruh kualitas layanan dan atribut produk perbankan terhadap kepuasan nasabah BNI Cabang Pamekasan / Laili Fauziyah
348Pengaruh kualitas produk terhadap proses keputusan pembelian konsumen dalam membeli produk handphone Nokia (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang pengguna handhone Nokia) / Nurul Khoiriyah
349Pengaruh earning per share (EPS), return on equity (ROE) dan price earning ratio (PER) terhadap return saham pada perusahaan manufactur yang listing di Bursa Efek Jakarta (BEJ) tahun 2004-2006 / Mita Santi Yuniastri Bandi
350Pengaruh struktur modal dan financcial leverage terhadap harga saham pada perusahaan manufaktur yang listing di BEI tahun 2006-2008 / Syaiful Anwar
351Pengaruh kualitas pelayanan terhadap kepuasan konsumen (studi pada Patria Plaza Hotel Blitar) / Muhamad Baihaqi
352Pengaruh kualitas pelayanan dan citra merek terhadap loyalitas pelanggan Kirana Travel Malang (studi pada Kirana Tour and Travel Malang rute Malang-Surabaya) / Lucy Dian Rahmawati
353Analisis rasio arus kas sebagai sistem peringatan dini dalam memprediksi kegagalan bank (studi kasus pada perusahaan perbankan yang listing di BEI) / Enggar Wusanani Chrisya Putri
354Pengaruh kompensasi finansial dan non finansial terhadap produtivitas kerja karyawan (Studi pada karyawan produksi bagiab linting PR. Jaya Makmur Malang) / Indra Kusuma Wardhana
355Pengaruh return on equity (ROE) dan return on assets (ROA) terhadap return saham melalui dividend payout ratio (DPR) pada perusahaan manufaktur yang listing di BEI tahun 2006-2008 / Yoyok Setio Nugroho
356Pengaruh pengumuman ROA dan NPM terhadap return saham pada perusahaan manufaktur sub-sektor makanan dan minuman yang listing di Bursa Efek di Indonesia periode 2012-2014 / Anisa Baitul Jannah
357Pengaruh bauran promosi terhadap keputusan pembelian konsumen di dealer Sentral Yamaha Blitar / Saputra Satriya
358Pengaruh bauran pemasaran jasa terhadap keputusan pembelian konsumen pada restoran cepat saji (Fast Food) McDonald's Malang / Elly Fibrianti
359Pengaruh green marketing terhadap keputusan pembelian konsumen mobil Daihatsu Ayla di Daihatsu Sales Operation Blimbing Malang / Fery Puji Nova Kurniawan
360Pengaruh kualitas pelayanan terhadap kepuasan psien (Studi pada pasien rawat inap BPK RSUD Mardi Waluyo Kota Blitar) / Sandi Eka Suprajang
361Pengaruh kepemilikan institusional, likuiditas, ukuran perusahaan, convexity, dan peringkat obligasi terhadap yield to maturity obligasi perusahaan periode 2009-2011 / Fani Sugeng Pramono
362Pengaruh likuiditas terhadap kebijakan dividen yang dimediasi oleh investment opportunity set pada perusahaan LQ45 listing di BEI periode tahun 2006-2009 / Intan Dwi Pristiari Trisna Restanti
363Pengaruh dimensi kualitas layanan jasa terhadap kepuasan konsumen (studi pada pengguna jasa edOTEL Senior SMK Negeri 2 Malang) / Thoni Setyo Prabowo
364Pengaruh persepsi konsumen tentang kualitas produk terhadap keputusan pembelian (studi kasus pada konsumen motor Yamaha Mio di Kota Malang) / Nela Piska Aprilia
365Analisis kinerja keuangan bank umum swasta nasional devisa dan non devisa di Indonesia periode 2008-2011 / Harfiqi Novriyanti Rahmi
366Pengaruh kepemimpinan dan kepercayaan karyawan pada atasan terhadap komitmen afektif melalui kepuasan kerja karyawan (studi kasus di Rumah Sakit Bala Keselamatan Bokor) / Elia Wahyuningtyas
367Pengaruh kepuasan gaji terhadap komitmen organisasi melalui motivasi kerja (Studi pada karyawan Perum Jasa Tirta I Malang) / Wiwin Agustina
368Pengaruh kinerja pemasaran kerelasian terhadap loyalitas nasabah (studi pada PT Asuransi Jiwasraya Cabang Kota Malang) / Rizky Fajrillia
369Pengaruh prestasi kerja terhadap kenaikan pangkat pegawai PT Pos Indonesia (Persero) Kantor Cabang Lamongan / Moh. Ali Nur Huda
370Faktor-faktor pembentuk keputusan pembelian konsumen KFC Coffee Cafe Sarinah Malang / Didiet Eka Kusmayadi
371Analisis faktor-faktor penentu citra merek produk KFC (studi pada konsumen KFC di Kawi Malang) / Evy Puspitasari Tanjung
372Pengaruh budaya organisasi dan motivasi spiritual terhadap kinerja karyawan (studi pada karyawan PT. Delta Surya Textile Pasuruan) / Hilal Abraham Permana
373Analisis peningkatan kinerja karyawan bagian frontliner melalui pelatihan di Bank BRI Cabang Martadinata Kota Malang / Yunita Ratna Artanti
374Pengaruh dana pihak ketiga, pemberian kredit dan biaya intermediasi terhadap efisiensi operasional bank perkreditan rakyat konvensional Kota Malang periode 2007-2009 / Nurmainnah
375Pengaruh iklan melalui media televisi terhadap proses keputusan pembelian konsumen dalam membeli sepeda motor Yamaha (studi kasus pada dealer Armada Motor Tulungagung) / Guritna Adi Nugraha
376Pengaruh atribut produk terhadap keputusan pembelian produk rexona : (Studi pada Mahasiswa Dakultas Teknik Angkatan 2005 reguler Universitas Negeri Malang) / Adiek Dirgantara Sondie
377Pengaruh atribut produk terhadap kepuasan pelanggan pada produk laptop Acer (studi pada mahasiswa Jurusan Manajemen, Fakultas Ekonomi, Universitas Negeri Malang angkatan 2013 dan 2014) / Johan Mahendra
378Pengaruh atribut produk terhadap keputusan perpindahan merek (Brand Swithhing) Kartu seluler Indosat (Studi pada Mahasiswa S-1 Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Shohebur Rahman
379Pengaruh pelatihan terhadap prestasi kerja karyawan bagian SDM dan organisasi PT. PLN (Persero) distribusi Bali / Ni Luh Sita Ariestia
380Pengaruh bauran promosi terhadap keputusan pembelian konsumen pada produk Smartfren (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / M. Rizky Pratama
381Pengaruh kualitas layanan terhadap loyalitas nasabah (Studi pada nasabah Tabungan PT. Bank Rakyat Indonesia (Persero) Tbk. Cabang Pasuruan) / Lidia Wanti
382Penerapan pembelajaran problem based learning pada mata diklat melakukan negosiasi untuk meningkatkan hasil belajar siswa kelas XI Program Keahlian Penjualan di SMKN 1 Boyolangu Tulungagung / Yusdiana Fatmawati Fitroh
383Pengaruh bauran promosi terhadap keputusan memilih lembaga bimbingan belajar (studi pada LBB Mahesa Institute Pare) / Aditya Kristianto
384Pengaruh Kinerja Keuangan Terhadap Harga Saham Pada Perusahaan Yang Masuk Dalam Indeks LQ-45 oleh Yasir Dliyauddin
385Pengaruh strategi diferensiasi terhadap loyalitas konsumen (studi pada pengguna kartu prabayar CDMA Flexi Trendy di Desa Krebet Senggrong Kecamatan Bululawang Kabupaten Malang) / Wiega Lya Septania
386Pengaruh persepsi atribut produk terhadap keputusan pembelian handphone Nokia (studi pada konsumen yang membeli dan menggunakan handphone Nokia di perumahan dosen Politeknik Negeri Malang) / Rauf Mega Sarjono
387Pengaruh kualitas layanan terhadap keputusan pembelian (studi pada anggota koperasi Bahtera Kencana Blitar) / Dwi Puji Lestari
388Pengarug brand image terhadap keputusan konsumen dalam membeli ponsel merek Nokia (Studi kasus pada counter Oke Shop di Dhoho Plaza Kediri) / Agus Harsono
389Analisis biaya-volume-laba pada koperasi wanita serba usaha Setia Budi Wanita Malang 1990-2004 / Muhammat Abdul Munir
390Analisis faktor lingkungan dan perbedaan individu dalam memilih sepeda motor merek Yamaha di SMAN 1 Gondanglegi / Affan Afian
391Faktor-faktor yang mempengaruhi perilaku konsumen dalam menonton pertandingan Ps. Arema: studi pada suporter Arema di Kelurahan Merjosari Kec. Lowokwaru Kota Malang oleh Iis Tuliani
392Pengaruh efisiensi pengendalian biaya dan tingkat perputaran modal kerja terhadap rentabilitas ekonomi pada KPRI Kota Malang tahun 2011 / Rizki Anisa
393Pengaruh brand awareness dan brand image terhadap loyalitas merek (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang pengguna kartu Flexi Trendy) / Astri Widiarini
394Analisis faktor-faktor yang dipertimbangkan konsumen dalam pembelian smartphone android merek Samsung (studi pada pemebeli di Plaza Malang) / Miftahul Darmawan
395Pengaruh sikap konsumen terhadap keputusan terhadap keputusan pembelian minuman merk Aqua berkaitan dengan penerapan program CSR (Corporate Social Responsibility); (Studi pada Mahasiswa Fakultas Ekonomi Universitas Negri Malang) / Pujo Lasmono
396Pengaruh variabel makroekonomi terhadap profitabilitas perusahaan pertambangan yang terdaftar pada LQ-45 periode 2004-2008 / Raynanda Devita Caroline
397Pengaruh bauran promosi terhadap keputusan pembelian produk Telkomflexi Trendy di Kota Malang / Taufik Arman
398Pengaruh periklanan dan promosi penjualan terhadap keputusan pembelian konsumen di Distro eat 347 Malang / Yuestha Dina Safitri
399Pengaruh corporate social responsibility terhadap nilai perusahaan melalui profitabilitas perusahaan yang listing di Jakarta Islamic Index tahun 2011-2012 / Rina Susanti
400Faktor-faktor yang mempengaruhi perilaku konsumen melakukan pembelian air minum dalam kemasan (AMDK):studi pada mahasiswa fakultas ekonomi Universitas Negeri Malang oleh Fransiskus Bayu Tri Kristianto
401Analisis pengaruh faktor-faktor fundamental terhadap perubahan harga saham pada perusahaan dalam kelompok LQ-45 / Dhenik Elok Fatmasari
402Pengaruh selisih suku bunga dan selisih tingkat inflasi terhadap nilai tukar rupiah di Indonesia (pengujian international fisher effect dan purchasing power parity) / Afifudin Nurfatoni
403Pengaruh capital adequacy ratio, earning per share, net profit margin, dan return on assets terhadap return saham pada perbankan yang listing di BEI (Bursa Efek Indonesia) periode 2009-2012 / Tutus Veronika
404Pengaruh laba akuntansi dan arus kas operasi terhadap return saham pada perusahaan food and beverages dan basic industry and chemicals yang go public di Bursa Egek Indonesia periode 2008-2009 / Ismayantika Dyah Puspasari
405Analsisis rasio keuangan untuk menilai kinerja keuangan dan analisis z-score untuk memprediksi kebangkrutan pada perusahaan rokok yang go public di Bursa Efek Jakarta oleh Laila Mufida
406Identifikasi kebangkrutan dengan menggunakan model Altman (Z-Score) dan model Zavren (Logit) (Studi pada Perusahaan Tekstil yang Go Public di Bursa Efek Indonesia Periode 2005-2007) / Phiping Santi Puspita
407Pengaruh brand equity Mie Sedaap terhadap keputusan pembelian konsumen (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Catur Sigit Pambudi
408Pengaruh pemberian kompensasi terhadap kinerja karyawan pada perusahaan Gondorukem dan Terpentin Trenggalek / Fando Hari Susetyo
409Pengaruh customer delight terhadap loyalitas pelanggan salon B & Y (studi pada pelanggan salon kecantikan B & Y Gajayana Malang) / Siska EL. Pramita
410Pengaruh pemberian kompensasi finansial dan kompensasi non finansial terhadap kinerja karyawan (studi pada PT. Somawi Surya Semesta, Kediri) / Dian Sukma Novita Sari
411Pengaruh atribut produk terhadap keputusan konsumen dalam membeli sepeda Motor Honda (Study rehadap perilaku konsumen sepeda Motor Honda di lingkungan Combong Kecamatan Garum Kabupaten Blitar) / Aris Wijayana
412Pengaruh struktur kemilikan saham terhadap kebijakan hutang pada Perusahaan Properti dan REal Estate yang listing di Bursa Efek Indonesia (BEI) periode 2004-2006 / Rizaniyah
413Pengaruh struktur kepemilikan dan struktur modal terhadap nilai perusahaan melalui kebijakan inisiasi dividen / Ismiatul Kamila
414Pengaruh persepsi konsumen pada brand image terhadap keputusan pembelian kartu seluler IM3 (studi pada mahasiswa S1 Akuntansi Fakultas Ekonomi Universitas Negeri Malang) / Ardissa Majiid
415Pengaruh kepimpinan transformational terhadap turnover melalui kepuasan kerja (Studi pada karyawan Hotel Tugu Malang) / Novi Christanti
416Analsisis promosi jabatan dan dampaknya pada komitmen organisasional karyawan di Pabrik Gula Ngadiredjo Kediri / Farkan Udin Arif
417Pengaruh rasio likuiditas, leverage, dan provitabilitas terhadap harga saham melalui dividend payout ratio (Study kasus pada Perusahaan Manufaktur yang listing di BEJ tahun 2005-2007) / Dwi Sebti Laily Agustini
418Penerapan pembelajaran konstruktivitisme model problem based learning (PBL) untuk meningkatkan hasil mbelajar siswa pada mata diklat ekonomi (Studi pada siswa kelas X SMK Arjuna 01 Malang) / Senjaning Festiyanti
419Analisis faktor dimensi kualitas layanan yang dipertimbangkan pelanggan dalam keputusan pemilihan hotel (studi pada pelanggan Hotel The Graha Cakra Malang) / Diyah Pratiwi
420Pengaruh tayangan iklan terhadap citra merek pada motor bajaj (studi pada klub bikers of bajaj Malang) / Andung Wahyu Sasongko
421Perbedaan return saham, risiko saham dan trading volume activity (TVA) sebelum dan sesudah stock spilit di perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2004-2007 / Avitha Ayu Hermawati
422Pengaruh listing time, financial leverage, dan persentase penawaran saham terhadap underpricing pada penawaran saham perdana (di Bursa Efek Indonesia periode 2009-2011) / Mochamad Andi Hakim
423Analisis perbedaan abnormal return, trading volume activity, dan security return variability sebelum dan sesudah peristiwa devaluasi Yuan China (studi kasus pada saham perusahaan yang tergabung dalam indeks LQ45) / Linia Debby Agustina
424Pengaruh atribut produk terhadap keputusan pembelian konsumen (Studi pada konsumen produk fashion di Matahari Departemen Store Malang Town Square) / Ika Rahayu Justitianingsih
425Pengaruh faktor psikologis terhadap keputusan konsumen dalam memilih hotel sebagai tempat menginap (studi pada Hotel Margosuko Malang) / Mochammad Rifki
426Pengaruh kepribadian terhadap Organizational Citizenship Behavior (OCB) melalui komitmen organisasional (studi pada PT. Pindad (Persero) Turen Malang) / Heny Yusman
427Faktor-faktor yang menentukan perilaku pembelian mi instan merek Sedaap di desa Sekarpuro, Kecamatan Pakis, Kabupaten Malang / Diarci Hagayuna
428Pengaruh profitabilitas, pertumbuhan aktiva, dan kepemilikan institusional terhadap keputusan pendanaan (studi pada Perusahaan Real Estate and property yang listing di Bursa Efek Indonesia (BEI) periode 2010-2012 / Anisah Romadaniah
429Pengaruh karateristik pembalap motogp sebagai endorser iklan terhadap brand image motor yamaha (Studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Rizky Widyanto
430Pengaruh persepsi ekuitas merek (Brand Equity) terhadap keputusan pembelian dodoran rexona (Studi pada siswa kelas XI di SMA Laboratorium UM Malang) / Reni Adiyanti
431Faktor-faktor psikologis yang mempengaruhi keputusan konsumen dalam membeli sepeda motor Yamaha (studi pada dealer Armada Pagora Jaya Tulungagung) / Henik Setyawati
432Pengaruh profitabilitas dan leverage terhadap nilai perusahaan yang dimoderasi kebijakan dividen pada perusahaan manufaktur yang listing di BEI tahun 2014 / M. Tholibul Arif
433Pengaruh budaya organisasi terhadap komitmen organisasi melalui kepuasan kerja (studi kasus pada hotel Pelangi Malang) / Setyoningrum MR.
434Pengaruh customer relationship management (CRM) terhadap loyalitas nasabah / Hendri Widodo
435Pengaruh biaya dana bank, penyaluran kredit, dan likuiditas terhadap rentabilitas pada bank umum yang listing di BEI 2007-2009 / Ina Iramayani
436Pengaruh faktor kebudayaan dan faktor sosial terhadap keputusan pembelian konsumen di ritel modern (studi pada pengunjung Alfamart di Kelurahan Ngaglik Kota Batu) / Nurul Lia Hidayati
437Pengaruh marketing mix terhadap loyalitas pelanggan (studi pada pelanggan PT. Asuransi Jiwa Bumi Asih Jaya Distrik Malang) / Yuanita Yanuar Rachmad
438Pengaruh ekuitas merek terhadap loyalitas konsumen pengguna kartu seluler Indosat M3 (studi kasus pada mahasiswa Akuntansi Fakultas Ekonomi Universitas Negeri Malang) / Bagus Wiyanta Sukma B.A.
439Pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan deviden, ukuran perusahan, struktur aktiva, dan resiko terhadap kebijakan hutang perusahaan (Pada perusahaan yang listing di BEI pada tahun 2003-2007) / Betyy Oktaviana Wanty
440Pengaruh ketidakpuasan konsumen terhadap brand switching (studi kasus pada mahasiswa pengguna Smartphone Samsung di Fakultas Ekonomi Universitas Negeri Malang) / Mochamad Toyib
441Pengaruh leader member exchange terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan Hotel Kartika Graha Malang) / Ummi Habibah
442Pengaruh lingkungan kerja dan motivasi kerja terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan PT. Telkom Indonesia, Tbk. Witel Malang) / Hendy Hermawan Andrianto
443Pengaruh harga dan kualitas pelayanan terhadap loyalitas pelanggan bengkel mobil "KUN" di Malang / Yaniarti Ulfiah
444Pengaruh pengembangan karir terhadap kinerja melalui motivasi kerja dan kemampuan karyawan pada PT. Telekomunikasi Indonesia, Tbk. Witel Malang / Aminatus Sholikah
445Perencanaan strategi pemasaran berbasis analisis SWOT (strenth, weakness, oppotunity, threat) pada ayam bakar wong solo Malang oleh Exam Kurniawan
446Analisis portofolio optimal selection dengan single index model pada perushaan katagori bisnis 27 pada periode 1-31 Agustus 2011 / Puspita Margareta
447Pengaruh motivasi dan persepsi konsumen terhadap keputusan pembelian produk Yakult di Desa Kendalpayah, Kecamatan Pakisaji, Kabupaten Malang / Halida Rachmawati
448Pengaruh bauran promosi terhadap keputusan pembelian konsumen (studi pada ibu - ibu PKK konsumen tupperware di RW XIII Sawojajar Malang / Rahmania Wijayanti
449Pengaruh motif berbelanja konsumen terhadap keputusan pembelian pada Bentar Dipayana Swalayan di Blitar / Wiji Tri Lestari Ningsih
450Pengaruh hasil pelatihan dan motivasi kerja terhadap kinerja karyawan di Bagian Produksi Sigaret Kretek Mesin (studi pada PT Karya Dibya Mahardika, Pasuruan) / Raiza Nora Dahana
451Pengaruah dimensi kualitas layanan terhadap loyalitas pelanggan (Studi pada Dinda salon & spa Malang) / Imas Kusumadewi
452Analisis faktor-faktor brand equity produk deterjen bubuk yang menjadi pertimbangan konsumen (studi pada masyarakat Kelurahan Merjosari Kecamatan Lowokwaru Malang) / Zaenul Syamsudin
453Pengaruh return on asset dan current ratio terhadap initial return (studi pada saham perusdahaan yang melakukan initial publik offering di Bursa Efek Indonesia periode 2011-2015) / Danang Risdianto
454Pengaruh leader member exchange dan kepercayaan terhadap komitmen organisasi melalui kepuasan kerja pada karyawan PT. Telekomunikasi Indonesia Witel Kota Malang / Esti Prasetyaning Triasmiwi
455Penerapan strategi relationship marketing pada Hotel Sahid Montana Dua Malang / Agung Wirawan
456Pengaruh kualitas produk terhadap keputusan pembelian konsumen dalam membeli produk kecap Bango (studi pada ibu rumah tangga warga Glintung, Kelurahan Purwantoro Kecamatan Blimbing, Kota Malang) / Mike Ratnasari
457Capital budgeting sebagai alat analisis investasi aktiva tetap pada perusahaan mebel "Maidi" Blitar / Okta Saktia Fitri
458Pengaruh brand equity notebook Acer terhadap keputusan pembelian konsumen (studi pada konsumen pengguna fasilitas hot spot kedai kopi AB3 Kota Malang) / Yogi Setiawan
459Pengaruh celebrity endorser iklan Sunsilk terhadap pembentukan brand image (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Isa Ansori
460Pengaruh atribut produk terhadap keputusan pembelian sabun mandi Lifebuoy (studi pada ibu-ibu rumah tangga di Kelurahan Tamanan Kecamatan Mojoroto Kota Kediri) / Nikmatus Surur
461Pengaruh kinerja keuangan dengan pendekatan metoda EVA (Economic Value Added) dan MVA (Market Value Added) terhadap harga saham pada perusahaan real estate & property yang go public di Bursa Efek Indonesia periode tahun 2006-2009 / Dara Fitrisia Wardhany
462Pengaruh rasio leverage dan perputaran modal kerja terhadap return saham melalui Return On Equity (ROE) pada perusahaan food and beverages yang listing di BEI periode tahun 2008-2010 / Indra Kurniawan
463Pengaruh motif berbelanja konsumen terhadap pengambilan keputusan pembelian pada Hypermart Malang Town Square (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Nur Hamidah
464Pengaruh economic value added, residual income, earnings dan arus kas operasi terhadap return saham (studi kasus pada perusahaan manufaktur yang terdaftar di BEI periode 2005-2007) / Fa'iq Ahmadin
465Pengaruh Keselamatan dan Kesehatan Kerja (K3) terhadap kinerja karyawan (studi pada karyawan Bagian Produksi PT. Sumbertaman Keramika Industri Probolinggo) / Bayu Anggara
466Pengaruh bauran promosi terhadap keputusan konsumen dalam membeli laptop (studi pada pengguna laptop Toshiba di Program Pascasarjana Universitas Negeri Malang) / Denti Armayanti
467Faktor-faktor yang mempengaruhi keputusan pembelian shampo pantene (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Stepfanie Yuanita
468Pengaruh kepercayaan konsumen terhadap loyalitas merek telepon seluler Nokia (studi pada mahasiswa Universitas Negeri Malang) / Rully Oetomo
469Pengaruh motivasi kerja dan disiplin kerja terhadap kinerja karyawan PT. Terafulk Mergantara Design Surabaya / Fanda Nuriansyah
470Pengaruh personal involvement terhadap relational response behaviors melalui perceived relatioanal benefits (Studi pada konsumen salon kecantikan Johnny Andrean Malang) / Asri Tyagita
471Pengaruh rasio arus kas operasi dan Price to Book Value (PBV) terhadap return saham (studi pada perusahaan sektor Property dan Real Estate yang lsiting di BEI periode 2011-2013) / Ika Novita Probowati
472Pengaruh tingkat suku bunga SBI, Inflasi, dan jumlah uang beredar terhadap indeks harga saham LQ 45 dan Jakarta Islamic Index (JII) di Bursa Efek Indonesia periode Januari 2007-Juni 2010 / Elsa Melani Agustina
473Pengaruh karakteristik celebrity endorser pada website Petersaysdenim terhadap brand image (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Muwarik Riski Kubro
474Pengaruh citra toko terhadap kepuasan belanja konsumen (studi pada konsumen Bentar Dipayana Swalayan Blitar) / Saiful Anwar
475Pengaruh kinerja keuangan metode Z-score Altman terhadap return saham pada perusahaan Real Estate and Property yang terdafatar di BEI (periode 2012) / Devi Dwi Rahmawardani
476Pengaruh persepsi konsumen tentang periklanan IM3 pada media televisi terhadap pembentukan kesadaran merek (Studi kasus Mahasiswa Pengguna Kartu Seluler Prabayar IM3 di Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Galih Purwo Nugroho
477Pengaruh strategi bauran pemasaran ritel (retailing mixed) terhadap loyalitas konsumen (Studi pada konsumen Mayang Collection cabang WR. Supratman dan Dinoyo) / Agung Kurniawan
478Pengaruh cita toko terhadap kepuasan konsumen (Studi pada konsumen distro no way out Malang) / EM Octofiansyah F
479Pengaruh atribut produk terhadap keputusan pembelian kartu seluler IM3 (Studi pada mahasiswa UM UPP 3 Blitar) / Tantri Norina Ayu Ningtias
480Penerapan green economy sebagai corporate social responsibility dalam rangka meningkatkan citra perusahaan (studi kasus pada PT Tiara Megah Indah Jaya) / Rudy Sondang Sinaga
481Penerapan bauran pemasaran jasa pada Eco Green Park di Kota Batu Jawa Timur / Irfan Rofiansyah
482Pengaruh customer-based brand equity terhadap customer loyalty Djarum; L.A. Lights (penelitian pada mahasiswa Universitas Negeri Malang) / Muchammad Fahmi
483Analisis kinerja koperasi serba usaha "Muawanah" Kabupaten Pamekasan berdasarkan Peraturan Menteri Koperasi Tahun 2009 / Kamilia Wahidatus Soliha
484Pengaruh kualitas produk terhadap proses keputusan pembelian handphone Nokia (studi pada mahasiswa UM UPP 3 Blitar) / Ayu Widyafati Rokhmah
485Pengaruh kualitas layanan terhadap loyalitas melalui kepuasan pelanggan (studi pada konsumen toko buku Restu di Kota Blitar) / Elsa Oktaviasari
486Faktor-faktor yang membpengaruhi Eva (Economic Valua Added) sebagai alat ukur kinerja keuangan pada perusahaan rokok oleh Ahlul A'ini
487Pengaruh leverage, roi (Return on investment), dan roe (Return on equity) terhadap return sahan pada perusahaan food and beverages yang terdaftar di bei periode 2005-2008 / Dhika Rosiana
488Pengaruh bauran promosi terhadap keputusan pembelian produk minuman coca cola ( Studi kasus pada mahasiswa jurusan D-III akuntansi politeknik negeri Malang ) /Astrid Kusuma Putri
489Pengaruh profitabilitas terhadap retrunt saham melalui deviden payout ratio (DPR) pada perusahaan LQ35 periode 2006-2007 / Reny Eka Kurniawati
490Pengaruh kecerdasan emosional ( Emotional Quotient ) dan kecerdasan spiritual ( Spiritual Quotient ) tehadap motivasi kerja karyawan ( Studi pada karyawan KPSP setia kawan Nongkojajar ) / Lidyana Nirmala Dewi
491Pengaruh gaya kepemimpinan terhadap semangat kerja karyawan ( Studi pada lembaga bimbingan belajar neutron Yogyakarta cabang Malang ) / Randy Rahardy
492Pengaruh tingkat pertumbuhan modal dan kredit terhadap return saham melalui rehabilitas pada bank konvensional yang listing di BEI periode 2005-2008 / Saraya Asa Adieny
493Perbedaan kinerja keuangan dan harga saham perusahaan yang listing di BEI sebelum dan sesudah akuisis pada tahun 2003-2005 / Nur Aisah
494Analisis perbedaan kinerja keuangan badan usaha milik negara dan badan usaha milik swasta pada perusahaan pertambangan yang listing di BEI periode 2004-2008 / Yunita Airul
495Pengaruh iklan TV dan promosi penjualan terhadap lpyalitas pelanggan Telkomsel (studi pada mahasiswa Fakultas Ekonomi Universitas Tulungagung) / Leo Prasetya Intan Permadi
496Pengaruh budaya organisasi terhadap komitmen afektif melalui kepuasan kerja (Studi pada karyawan PT. TELKOM Malang) / Lidia Oktavia
497Analisis tingkat kebangkrutan sebelum dan sesudah stock split pada perusahaan go public yang listing di BEI tahun 2006-2007 (Dianalisis dengan menggunakan metode Altman (Z-Score) dan metode Zmijewski (X-Score) / Widianah
498Pengaruh kualitas pelayanan terhadap kepuasan konsumen pada bromo view hotel Probolinggo / Ayu Dwi Septiana
499Pengaruh dimensi kualitas jasa terhadap loyalitas melalui kepuasan pekanggan (studipada siswa lembaga pendidikan bahasa asing EF English First Malang)
500Implementasi model pembelajaran kolaborasi Jigsaw dan team games turnament (TGT) untuk meningkatkan hasil belajar siswa pada mata diklat kewirausahaan (studi pada siswa kelas XI program keahlian pemasaran SMK Negeri 1 Turen) / Iftitah Lisnasari
501Pengaruh dimensi kualitas jasa terhadap kepuasan peserta didik di lembaga bimbingan balajar Kasyful Aqli Malang / Ubaidillah
502Pengaruh kualitas pelayanan terhadap lovalitas pelanggan pada ajb bumi putera 1912 kantor operasional celaket Malang / Andi Chamaludin
503Pengaruh current ratio (CR), debt to equity ratio (DER), dan earning per share (EPS) terhadap devidend payout ratio (DPR) pada perusahaan manufaktur yang listing di bei periode 2005-2007 / Ari Nugroho Wicaksono
504Pengaruh current ratio, debt to total assets ratio, dan inventory turnover terhadap return saham perusahaan makanan dan minuman yang listing di BEI periode 2005-2007 / A Rizal Hidayat
505Analisis pengaruh EPS (Earning Per Share), volume penjualan saham, dan tingkat suku bunga SBI terhadap harga saham pada perusahaan property dan real estate yang listing di BEI periode 2004-2008 / Rosalina
506Pengaruh debt to equity ratio, total asset turnover dan struktur aktiva terhadap ROI dan ROE pada perusahaan real estate dan property yang listing di BEI tahun 2009 / Galuh Mardhika Damayanti
507Pengaruh spiritualitas karyawan terhadap kinerja karyawan melalui motivasi kerja (studi pada klinik Prima Husada Singosari) / Ayub Wirasukma
508Studi kasus suksesi keluarga pada perusahaan perlengkapan ABRI CV Tumiran / Febi Ainun Najib Safi'i
509Pengaruh debt to equity ratio dan debt to asset ratio terhadap return on equity yang dimoderasi oleh current ratio (studi pada perusahaan properti dan real estat yang listing di BEI periode 2013) / Khoirunnisa Rizki Wahidah
510Analisis pola hubungan modal sosial dengan Organizational Citizenship Behavior (OCB) sebagai penopang kinerja produksi pada karyawan bagian produksi Koperasi Serba Usaha Brosem Kota Batu / Lutfi Haviluddin Najib
511Analisis Pengaruh Kinerja Keuangan Terhadadp Return Saham (Studi Kasus 6 Rasio Keuangan Pada Perusahaan LQ 45 di Bursa efek Jakarta) oleh Zulis Intifatul Farida
512Pengaruh Pemecahan Saham (Stock Split) Trhadap Aktivititas Volume Perdagangan (Trading Volume Activity atau TVA) Studi pada Perusahaan Manufaktur yang Terdaftar di BEJ) oleh Dewi Virgiaswari Putri
513Studi komparatif peranan serikat pekerja dalam memperjuangkan hak-hal pekerja (studi kasus serikat pekerja pada BRI Kantor Cabang Martadinata dan Bank Permata Kantor Cabang Bromo Kota Malang) / Nur Aini
514Pengaruh kompensasi finansial dan karakteristik pekerjaan terhadap kinerja karyawan melalui kepuasan kerja (studi pada karyawan bagian produksi PT. Guna Atmaja Jaya, Tulungagung) / Dwi Cahyati
515Pengaruh dana pihak ketiga, CAR dan LDR terhadap kinerja keuangan pada sektor perbankan yang go public di BEI periode 2012-2014 / Aziz Ramadhan Aryaswara
516Hubungan kondisi fisik tempat kerja dengan prestasi kerja pegawai PT. Pos Indonesia (Persero) Malang oleh Khurrotul A'yun
517Penentuan besarnya modal kerja yang optimal guna menunjang kontinuitas usaha pada perusahaan setir dan assesoris mobil "Mw. Sport Line" Pasuruan oleh Hastin Riva Nugraheni
518Pengaruh pemberian insentif terhadap kinerja melalui kepuasan kerja (studi pada karyawan Persada Swalayan Malang) / Arindiah Citra Dewi Agustin
519Pengaruh rasio likuiditas, rasio aktivitas dan rasio leverage terhadap rentabilitas ekonomi dan rentabilitas modal sendiri pada perusahaan makanan dan minuman yang go publik di BEJ / Ratna Puspitasari
520Pengaruh program pengembangan karier terhadap prestasi kerja Pegawai Negeri Sipil / Haris Fajar Hamdani
521Pengaruh kualitas layanan terhadap kepuasan pengunjung taman rekreasi sengkaling Malang oleh Zinatul Ma'wa
522Pengaruh kualitas layanan terhadap kepuasan pelanggan: studi pada hotel Santika Surabaya oleh Gayuh Trisna Deviyanti
523Pengaruh iklan di televisi terhadap perilaku konsumen mahasiswa Universitas Negeri Malang dalam membeli pembalut wanita oleh Handri Dian Wahyudi
524Perilaku membeli konsumen dan persepsi atas atribut produk celana panjang jean di Universitas Negeri Malang oleh Aliv Victoria
525Pelaksanaan strategi pemasaran bisnis franchise cokelat klasik dalam perspektif analisis SWOT (studi kasus pada bisnis franchise Cokelat Klasik Mall Dinoyo City) / Ratu Tita Quritama Putri
526Pengaruh stres kerja terhadap niatan untuk keluar kerja melalui kepuasan kerja (Studi pada karyawan hotel Tugu Malang) / Dony Tri Ardiana
527Pelaksanaan saluran distribusi dalam upaya peningkatan volume penjulan pada perusahaan rokok suket teki tahun 2003: studi kasus pada perusahaan rokok suket teki malang oleh Andy Dwi Novian
528Peranan analisis pekerjaan dalam upaya mengefektifkan rekrutmen karyawan pada Departemen Sumber Daya Manusia: studi kasus pada PT. Otsuka Indonesia, Lawang - Lawang oleh Ika Wahyuni
529Pengaruh motivasi terhadap kepuasan kerja di The Singhasari Resort / Najib Mada
530Pengaruh strategi pemasaran defensif terhadap kepuasan pelanggan di Tsananiya Minimarket Kediri oleh Dyana Widiastuti
531Pengaruh iklan media tv terhadap proses keputusan pembelian konsumen dalam membeli sepeda motor yamaha (studi pada konsumen dealer yamah sarana mas sejahtera Malang) / Putri Dina Masita
532Pengaruh kinerja keuangan terhadap Promosi Ekonomi Anggota (PEA) pada Koperasi Simpan Pinjam (KSP) di Kota Malang tahun 2013-2014 / Uus Susanti
533Pengaruh kepercayaan dan kepuasan pelanggan terhadap loyalitas pelanggan pada Gerai Bakso Kota Cak Man Malang / Hendri Hermanto
534Faktor-faktor internal yang berpengaruh terhadap perilaku konsumen dalam pengambilan keputusan pembelian: studi pada perumahan Griya MelatiIndah Blitar oleh Ahmad Fatoni
535Pengaruh current ratio, debt to equity ratio, dan rewturn on equity terhadap kebijakan dividen pada perusxahaan manufaktur yang lsiting di Bursa Efek Indonesia periode 2012-2014 / Lia Rifa'atul Laili
536Analisa pergerakan valas menggunakan analisis teknikal untuk memperoleh profit dalam forex online trading / William Calvin Loilewen
537Pengaruh suasana toko (store atmosphere) terhadap proses keputusan pembelian (Studi pada Cafe Legend Coffe Malang) / Resti Dwi Agustina
538Pengaruh tayangan iklan axe di televisi terhadap keputusan pembelian konsumen: studi kasus pada mahasiswa Fakultas Ekonomi Universitas negeri Malang oleh Lilik Rianasari
539Pengaruh realtiuonship marketing terhadap loyalitas pelanggan (studi pada pelanggan NOIJ Shop Malang) / Irwandika Wicaksono
540Pengaruh program pengembangan karir terhadap kinerja pegawai melalui motivasi kerja (studi pasa pegawai BPTP Jawa Timur) / Sheila Apriliawati
541Pengaruh pengetahuan konsumen terhadap perilaku pengambilan keputusan penggunaan jasa internet: studi pada pengguna jasa internet di LIBnet Universitas Negeri Malang oleh Deni Ekawati
542Pengaruh Debt to Equity Ratio (DER) terhadap Dividend Payout Ratio (DPR) melalui Return on Equity (ROE) pada perusahaan manufaktur yang terdaftar di BEI periode 2010-2012 / Achmad Nur Syaifulloh
543Pengaruh pelatihan kerja (training) terhadap produktivitas kerja karyawan: studi pada karyawan Departemen Maintenance PT. Sorini Corporation Tbk. di desa Ngerong, Pasuruan oleh Ekawati Sri Wulandari
544Analisis kesesuaian kompetensi individu karyawan dengan kompetensi jabatan pada Departemen Konstruksi, Departemen Perencanaan dan Evaluasi PT. PLN (Persero) Distribusi Jawa Timur Area Malang / Azizah
545Penentuan struktur modal optimal untuk memaksimalkan nilai perusahaan: studi kasus pada PT Indofood Sukses Makmur Tbk oleh Nurhayati
546Pengaruh persepsi atribut produk kartu seluler CDMA Smartfren terhadap proses keputusan pembelian (studi pada mahasiswa Jurusan Manajemen angkatan 2012/2013 Fakultas Ekonomi Universitas Negeri Malang) / Edo Prasetya
547Pengaruh perputaran modal kerja terhadap profitabilitas melalui likuiditas dan solvabilitas (studi perusahaan manufaktur di Bursa Efek Indonesia tahun 2014) / Nurul Asmaul Husna Wiryanto
548Pengaruh atribut produk terhadap keputusan pembelian konsumen (studi pada pembeli detergen rinso di Indomaret Kartini Blitar) / Sayidati Madhifatin Nisfi Laili
549Persepsi siswa SMU Swasta di Kota Malang tentang bimbingan belajar kimia dan pengaruh keikutsertaan siswa dalam bimbingan belajar terhadap prestasi belajar kimia di sekolah oleh Mukti Ali
550Pengaruh citra toko terhadap loyalitas pelanggan (studi pada Smesco Mart Al Hikam Malang) / M. Nizar Rojabi
551Pengaruh rasio likuiditas, rasio aktivitas, rasio leverege terhadap profitabilitas pada perusahaan real estate dan property yang terdaftar di BEJ (periode pengamatan tahun 2002-2005) / Sri Handayani
552Pengaruh desain kemasan model pouch terhadap keputusan pembelian (Studi pada konsumen teh botol sosro di SMA Negeri 1 Malang) / Siti Marlena Sari
553Pengaruh bauran pemasaran terhadap perilaku konsumen dalam pengambilan keputusan pembelian (Studi pada konsumen Rumah Makan Green Garden Pasuruan) / Aireen Restiana Nugraha
554Pengaruh bauran pemasaran terhadap keputusan pembelian (studi pada pengunjung Apresio Coffee Shop Malang) / Zanuroji Zulvita Warman
555Perbedaan return, risiko, trading volume activity, dan bid-ask spread sebelum dan sesudah stock split pada perusahaan yang listing di Bursa Efek Indonesia periode 2006-2008 / Muhammad Maliki A.
556Pengaruh kinerja keuangan terhadap return saham pada perusahaan perbankan yang listing di BEI periode tahun 2007-2009 / Bagoes Galih Satria
557Pengaruh debt to equity ratio (DER) dan long-term debt to equity ratio )LDER) terhadap return saham melalui earnings per share (EPS) pada perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2006-2008 / Bambang Wijanarko
558Pengaruh gaya kepemimpinan transformasional terhadap motivasi kerja karyawan (studi pada karyawan PT PLN (Persero) APJ Malang) / Rega Kony Fauzi
559Pengaruh financial leverage, dan struktur modal terhadap return on equity pada perusahaan food and beverages yang go public di BEI (periode pengamatan tahun 2006-2009) / Galuh Yudha Adhi Tama
560Pengaruh persepsi bauran promosi terhadap ketelibatan konsumen dalam proses keputusan pembelian rumah (studi pada pemilik rumah di Griya Tawangsari Indah Blitar) / Henny Widia Sari
561Pengaruh kompensasi finansial dan non finansial terhadap kinerja karyawan (studi pada PT. Karya Tugas Anda Sukorejo) / Wahyu Eka Pradana
562Pengaruh persepsi konsumen tentang pesan iklan televisi terhadap keputusan pembelian kartu perdana simpati (studi pada mahasiswa sastra Jurusan Seni dan Desain Universitas Negeri Malang) / Adi Setiawan
563Pengaruh citra terhadap keterlibatan konsumen dalam pengambilan keputusan pembelian (Studi pada konsumen persada swalayan Malang) / Hervy Kurnianingtiyas
564Pengaruh atribut produk terhadap keputusan pembelian notebook merek Axioo (Studi pada mahasiswa Fakultas Teknik Universitas Negeri Malang) / Anda Teguh Amanda
565Pengaruh bauran pemasaran terhadap keputusan konsumen dalam pembelian handphone Nokia di Kecamatan Blimbing Malang / Listyorini Pramuningtyas
566Pengaruh persepsi asosiasi merek handphone Nokia terhadap loyalitas pelanggan (studi pada pengguna HP Nokia di Dinas Pendapatan Pengelolaan Keuangan dan Aset Daerah Kabupaten Tulungagung) / Ferdian Hartanto
567Pengaruh kompensasi finansial dan lingkungan kerja terhadap kepuasan kerja karyawan (studi pada PT. Sakti Setia Santosa Malang) / Ribka Putri Mahardini
568Pengaruh kualitas layanan terhadap kepuasan nasabah bank syariah Mandiri Cabang Pasuruan / Erike Youlandha
569Pengaruh atribut produk, dan kebutuhan mencari variasi terha- dap perpindahan merek air minum dalam kemasan Aqua ke Cleo (studi pada pelanggan agen AMDK UD. Inti Jaya di Kab. Lumajang) / Mochammad Ariful Syahdan
570Pengaruh perputaran kas, perputaran piutang, dan perputaran persediaan terhadap profitabilitas pada perusahaan food and beverage yang terdaftar di BEI periode 2012-2015 / Diah Ayu Cahyaningsih
571Pengaruh kualitas pelayanan terhadap kepuasan konsumen pada swalayan Mustika Blitar / Yessy Widya Pratiwi
572Pengaruh struktur modal (DAR, DER, dan LDER) terhadap ROE pada perusahaan manufaktur size besar dan kecil yang listing di Bursa Efek Indonesia tahun 2009 / Redy Khoirianto
573Pengaruh debt to equity ratio (DER) dan debt to asset ratio (DAR) terhadap price book value (PBV) melalui dividen payout ratio (DPR) pada perusahaan manufaktur yang listing di BEI periode 2006-2008 / Prasetya Wisuda
574Pengaruh gaya kepemimpinan demokratis terhadap disiplin kerja melaui motivasi kerja (studi pada karyawan Bagian Produksi PR AA Malang) / Ircham Abdurrachim
575Analisis perbedaan kinerja keuangan perusahaan sebelum dan sesudah merger dan akuisisi pada perusahaan yang listing di BEI tahun 2010-2014 / Retno Tri Wulandari
576Pengaruh kualitas layanan terhadap loyalitas nasabah bank-bank BUMN (studi kasus pada pedagang di Pasar Induk Gadang Malang) / Achmad Fahrul Rozi
577Analisis komparatif kinerja keuangan bank devisa dengan bank non devisa di Indonesia (2007-2009) / Prima Ardi Kusuma
578Pengaruh kompensasi finansial dan motivasi kerja terhadap kinerja karyawan Bagian Produksi PT. Merdeka Nusantara di Kabupaten Tuban / Renno Novianto Putra
579Pengaruh program pemasaran internal dan kualitas layanan internal terhadap kepuasan pelanggan internal (studi pada Dinas Pariwisata Kabupaten Probolinggo) / Reni Roviatul Laily
580Analisis SWOT sebagai dasar perumusan strategi pemasaran di PT Roda Hamerindo Jaya / Satrio Danardana
581Faktor-faktor yang mempengaruhi wisatawan berkunjung di obyek wisata Roro Kuning Kabupaten Nganjuk / Yunus Harioko
582Pengaruh humas terhadap citra perusahaan (Studi pada persepsi konsumen telkomsel di GraPari telkomsel Jember) / Dewi Puspitasari
583Analisis pengaruh bauran pemasaran terhadap proses keputusan konsumen dalam memilih hotel Pelangi Malang / Danang Satriya Wicaksono
584Penerapan anggaran fleksibel biaya produksi atas dasar biaya standar sebagai alat pengendalian biaya (studi kasus pada PG. Meritjan Kediri) / Hendri Rustanto
585Analisis kinerja karyawan PT. PLN (Persero) Area Malang / Angga Surya Amirullah
586Pengaruh relationship marketing terhadap loyalitas konsumen sepeda motor Yamaha (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Liza Amalia Rezka
587Pengaruh atmosfer toko dan kebijakan harga terhadap impulse buying (studi pada Giant Mall Malang Olympic Garden) / Ingka Agilia
588Pengaruh kepemilikan institusional terhadap nilai perusahaan yang dimoderasi oleh kebijakan dividen (studi pada perusahaan sektor property, real estate, dan building construction yang listing di BEI periode 2012-2013) / Intan Larasati
589Perbedaan tingkat kesehatan bank antara bank konvensional dan bank syariah periode sebelum dan setelah krisis ekonomi global / Ralengga Soqmanoreqa
590Pengaruh atribut produk terhadap keputusan pembelian air mineral Aqua (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Kurnia Fatma S.
591Pengaruh lingkungan dan perbedaan individu konsumen terhadap proses keputusan konsumen berbelanja (studi pada ibu rumah tangga konsumen Hypermart Malang Town Square) / Herlin Maretasari
592Pengaruh intellectual capital terhadap kinerja keuangan perusahaan (studi pada perusahaan food and bererages yang listing di BEI periode 2010-2013) / Ninda Dwi Rahayu
593Pengaruh ROE (Return on Equity), DPR (Dividend Payout Ratio), EPS (Earning Per Share), dan CAR (Capital Adequacy Ratio) terhadap harga saham perusahaan perbankan di Indonesia tahun 2006-2009 / Firda Amiria
594Analisis kebermanfaatan pendidikan dan pelatihan dalam jabatan terhadap pengembangan pegawai di Dinas Kependudukan dan Pencatatan Sipil Daerah Kota Blitar / Ayu Prastiwi
595Pengaruh kepercayaan konsumen terhadap layalitas merek telepon seluler nokia tipe qwerty (Studi pada mahasiswa Universitas Negeri Malang) / Tri Ajie Purwantoro
596Pengaruh citra toko terhadap loyalitas konsumen (studi pada konsumen toko buku diskon Togamas Malang) / Rizqi Nugraheni
597Pengaruh bauran pemasaran terhadap keputusan pembelian konsumen (studi pada konsumen toko roti Citra Kendedes Cake and Bakery Sawojajar Malang) / Ghea Prawitha Dewi
598Pengaruh bauran pemasaran terhadap loyalitas pelanggan pupuk organik petroganik (studi pada petani pengguna pupuk organik petroganik di Kecamatan Rejoso) / Merselia Widowati
599Analisis pengaruh Loan to Deposit Ratio (LDR), Non Performing Loan (NPL), Net Interest Margin (NIM) dan Debt to Equity Ratio (DER) terhadap Return On Asset (ROA) pada bank Perkriditan Rakyat Kota Malang periode 2013-1014 / Risang Laurentia Siswi
600Pola Rekrutmen, seleksi, dan pengembangan karir karyawan di industri resto dan cafe di Kota Malang / Julian Feri Laksono
601Pengaruh servicescape terhadap niat beli konsumen di Houtenhand Malang (studi pada komunitas sepeda Friday Biking Love (FBL) Malang) / Agustino Jape
602Pengaruh kualitas layanan terhadap loyalitas konsumen pada bengkel SS Jaya Motor Malang / Guruh Herlambang
603Pengaruh kebijakan hutang, return on equity dan kebijakan deviden terhadap harga saham pada perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2007-2009 / Nur Rachmawati
604Pengaruh brand image (Citra Merek) terhadap keputusan pembelian laptop merek Axioo (Studi pada pemilik laptop merek Axioo di kedai kopi hotspot AB3 Dinoyo Malang) / Sindy Mita Kusumawardani
605Pengaruh brand trust terhadap brand loyalty telepon seluler Nokia (Studi pada pengguna telepon seluler nokia di Kelurahan Sumbersari Malang) / Juwita Nawang Sari
606Pengaruh informasi rasio likuiditas, aktivitas, profit margin, dan nilai pasar terhadap return saham pada perusahaan real estate and property yang listing di BEI periode 2007-2009 / Indri Novitasari
607Pengaruh pengembangan produk "ponsel Nokia" terhadap kepuasan konsumen (studi pada konsumen ponsel Nokia di Pusat Penjualan Ponsel Malang Plasa Lantai 2) / Christian Afandi
608Diversifikasi produk pada rumah makan ayam bakar Wong solo Cabang Malang / Adam Khasbullah Mawantoro
609Pengaruh kualitas pelayanan terhadap kepuasan pasien (studi pada pasien rawat inap kelas III RSUD Kanjuruhan Kepanjen) / Dian Purwasih
610Pengaruh kepemilikan institusional dan ukuran perusahaan terhadap nilai perusahaan melalui profitabilitas (studi kasus pada perusahaan manufaktur sektor industri barang konsumsi yang listing di BEI tahun 2013) / Imam Azis Galang Wicaksono
611Analisis terhadap karakter individu pembelajar pegawai sebagai dasar [embentuk budaya learning organization (studi pada pegawai di Kantor Pelayanan Pajak Pratama Pare) / Kiky Amalia Primastuti Putri
612Pengaruh kinerja keuangan model Camel terhadap harga saham melalui risiko sistematis pada bank umum swasta nasional yang listing di BEI periode 2006-2008 / Nimas Sekar Putri
613Persepsi konsumen larissa skin care & hair treatment Malang terhadap customer relationship management dan pengaruhnya pada loyalitas pelanggan / Asteria Mutiara Sari
614Pengaruh rotasi pekerjaan, stres kerja dan kepuasan kerja terhadap komitmen organisasi (studi pada karyawan Biro Administrasi Universitas Widyagama Malang) / Humairah
615Pengaruh kepemimpinan transformasional dan budaya organisasi terhadap kinerja karyawan melalui komitmen organisasi (Studi pada karyawan Departemen Mines and Exploration PT. Vale Indonesia Tbk) / Andriani Kalalembang
616Pengaruh kepemimpinan transformasional terhadap disiplin kerja karyawan melalui motivasi kerja (studi pada karyawan di PT Kariangau Indojaya Balikpapan, Kalimantan Timur) / Dimas Chandra Kusuma
617Pengaruh kualitas layanan dan citra merek terhadap loyalitas konsumen melalui kepuasan konsumen sebagai variabel intervening (studi pada konsumen Cafe Ria Jenaka Malang) / Andri Novianto
618Faktor-faktor penentu preferensi konsumen (studi pada Rumah Makan "Gang Jangkrik" Malang) / Eline Prastiwi)
619Pengaruh capital adequacy ratio (CAR), dana pihak ketiga (DPK), return on asset (ROA) dan non performing loan (NPL) perbankan terhadap jumlah penyaluran kredit kepada sektor UMKM (studi pada perbankan yang listing di BEI 2007-2009) / Siti Nur Anisah
620Pengaruh lingkungan kerja terhadap komitmen organisasi melalui keputusan kerja (studi pada lingkungan kerja karyawan Eco Green Park) / M. Fadlli Nur Arzaqi
621Pengaruh financial leverage terhadap return on equity (ROE) dan earning per share (EPS) pada perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia tahun 2007-2009 / Raditya Erdi Kaswaratantra
622Pengaruh iklan media cetak dan brand image (citra merek) terhadap keputusan konsumen dalam membeli handphone merek Nokia (studi pada mahasiwa Fakultas Ekonomi Universitas Negeri Malang) / Nico Hardian Nugroho
623Pengaruh program pelatihan BPC (better process controlling) karyawan terhadap produktivitas kerja karyawan bagian produksi mushroom (studi pada PT. Surya Jaya Abadi Perkasa Kabupaten Probolinggo tahun 2014) / Nila Andriani
624Pengaruh persepsi atmosfer toko terhadap keputusan pembelian pelanggan (studi pada Juliette Beach Cafe & Resto Malang) / Alitha Natriezia R.P.
625Pengaruh kualitas pelayanan terhadap kepuasan konsumen McDonald (studi pada konsumen McDonald Dinoyo, Malang) / Satriya Arum Ganandhi
626Pengaruh faktor internal terhadap keputusan pembelian air minum dalam kemasan galon merek Aqua pada konsumen di wilayah RW 11 Kelurahan Tulusrejo Kecamatan Lowokwaru Kota Malang / Rizki Maulina
627Pengaruh current ratio dan debt to equity ratio terhadap return on equity dimoderasi CSR pada perusahaan manufaktur yang listing di BEI Tahun 2014 / Nuriyatul Laily
628Pengaruh kompensasi finansial langsung dan motivasi terhadap kinerja pegawai (studi pada Kantor Pengawasan dan Pelayanan Bea dan Cukai Tipe Madya Pabean Ngurah Rai) / Ratri Hardian Proboningrum
629Analisis karakter kepemimpinan sebagai upaya peningkatan motivasi kerja karyawan (studi pada Hotel Mutiara Malang) / Pundhi Ramandha Khuldi
630Analisis faktor-faktor bauran promosi yang dipertimbangkan dalam melakukan pembelian di Realizm Store Malang / Dani Hidayatur Rohman
631Pengaruh iklim organisasi dan komitmen organisasi dalam pembentukan Organizational Citizenship Behavior (OCB) pada perawat RSUD Dr. R. Soedarsono Pasuruan / Fitrotul Ilmia
632Pengaruh struktur modal terhadap profitabilitas yang dimoderasi oleh firm size (studi pada perusahaan sektor properti dan real estate yang listing di BEI periode 2012-2014 / Novita Astivasari
633Kepemimpinan manajer unit dalam mensinergikan teamwork dan kaitannya dengan kinerja tim (studi kasus pada Pt. Asuransi Jiwasraya Persero Kantor Area se-Malang) / Putri Hakiki
634Pengaruh self efficacy dan pengembangan karir terhadap komitmen organisasional melalui motivasi pekerja (studi pada karyawan Citra Motoris Malang) / Abdullah Mukhammad Rizal
635Penerapan multi level marketing pada perusahaan Tiens Internasional beserta permasalahan dan solusinya (studi pada Stokis 670, Jl. Joyo Raharjo 281, Malang) / Nur Laili Rosyidah
636Pengaruh fasilitas dan lokasi terhadap keputusan menginap (studi pada pengguna jasa Hotel Pelangi Dua Malang) / Indra Muttaqin
637Analisis faktor-faktor yang mempengaruhi tingkat produktivitas kerja karyawan di CV. Setia Niaga Malang / Nia Sudiarin Sisyatnawati
638Pengaruh gaya kepemimpinan terhadap motivasi kerja karyawan (studi pada karyawan PDAM Kabupaten Probolinggo) / Agung Sulaksono
639Pengaruh variabel atribut produk terhadap proses keputusan pembelian produk sepeda motor Yamaha Mio (studi pada komunitas Mio Fans Club Malang) / Fachrizal
640Pengaruh pertumbuhan, ukuran, dan profitabilitas terhadap peringkat obligasi (studi pada perusahaan finance yang listing di Bursa Efek Indonesia) / Tetty Widiyastuti
641Pengaruh atribut produk terhadap loyalitas pelanggan produk hand & body lotion Citra (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Yurike Oktarika Perdanasari
642Pengaruh pemberian kompensasi finansial dan kompensasi non finansial terhadap kinerja karyawan (studi pada Perum Jasa Tirta I Malang) / Hanna Zahrah
643Pengaruh retail mix (bauran ritel) terhadap keputusan pembelian (studi pada konsumen Kafe Lai-lai Malang) / Teguh Arisma
644Pengaruh bauran promosi terhadap pengambilan keputusan pembelian motor Suzuki (studi pada konsumen motor Suzuki di dealer Hero Sakti Motor Malang) / Helru Cahyo Setiadi
645Customer relationship management dan aplikasinya pada Bimbingan Belajar Ganesha Operation Cabang Kabupaten Tuban / Rahayu Dwi Andini
646Pengaruh penayangan iklan televisi Yamaha Mio terhadap keputusan pembelian (studi kasus pada Mio Fan's Club Malang) / Wijaya Hayuningrat
647Penilaian kinerja dan kepuasan kerja pegawai pada PT. Bank Papua Cabang Surabaya / Kathrin Bethania Huwae
648Pengaruh keadilan distributif dan keadilan prosedural terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan PT. PLN Persero Area Pelayanan dan Jaringan Malang) / Miftahul Huda
649Pengaruh promotion mix terhadap minat membeli ulang Tahitian Noni Joice (studi pada pelanggan Tahitian Noni Juice di Kota Malang) / Maulana Revianto
650Pengaruh return on equity (ROE) terhadap harga saham melalui economic value added (EVA) pada perusahaan LQ45 yang listing di Bursa Efek Indonesia tahun 2009-2010 / Rizky Mei Kustya
651Strategi pemasaran berbasis analisis SWOT pada Diamond In You Hipnoterapi Malang / Habib Basuseno
652Pengaruh atribut produk terhadap keputusan pembelian: studi terhadap pembelian kartu seluler prabayar oleh mahasiswa Fakultas Ekonomi Universitas Negeri Malang oleh Fitri Effendy
653Pengaruh citra merk dan harga terhadap kepuasan konsumen kamera DSLR merk Canon (studi pada mahasiswa Desain Komunikasi Visual Fakultas Sastra Universitas Negeri Malang) / Dian Kurniawan
654Analisis perbedaan kebangkrutan (model Altman dan Springate) sebelum dan sesudah krisis global 2008 pada perusahaan manufaktur yang listing di BEI / Intan Suryaning Natalia
655Pengaruh dividen inisiasi dan dividen omisi terhadap return, abnormal return, trading volume activity, dan security return variability perusahaan manufaktur yang listing di BEi tahun 2014 / Asri Ardani
656Pengaruh service quality dan trust terhadap loyalitas nasabah tabungan Shar-E Bank Muamalat Cabang Malang / Ndaru Perdhana
657Pengaruh rasio likuiditas, rasio solvabilitas terhadap rasio profitabilitas banking, credits agencies other thanbank, securities yang listing di BEI sebelum dan sesudah krisis global 2008 / Alindra Yanuardi
658Pengaruh budaya organisasi dan keterlibatan kerja terhadap kinerja karyawan bagian agen pada PT. Asuransi Jiwasraya (Persero) Kantor Cabang Malang Kota / Cindera Fatikha
659Pengaruh bid-ask spread dan trading volume activity terhadap abnormal return pada perusahaan manufaktor yang listing di BEI tahun 2010 / Dwinanda Pria Kharisma
660Pengaruh layout toko terhadap keputusan pembelian pelanggan hypermarrt, Malang Town Square (Matos) / Dzulfikar Zaki Fuad
661Pengaruh gaya kepimpinan terhadap kinerja karyawan melalui kepuasan kerja pada karyawan pabrik rokok bagian produksi PT. Cakra Guna Cipta malang / Citra Purbasari
662Pengaruh kepercayaan terhadap minat beli melalui persepsi risiko pada transaksi jual beli online melalui media sosial (studi pada mahasiswa Program Studi S1 Manajemen angkatan 2014) / Ratna Maulida Rachmawati
663Pengaruh atribut produk terhadap proses pengambilan keputusan pembelian pelumas (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Didi Nugraha
664Pengaruh soft competency karyawan terhadap kinerja karyawan (studi pada karyawan PT. Taspen Cabang Malang) / Devi Maya Rosa
665Pengaruh dana pihak ketiga, capital adequacy ratio, pendapatan pembiayaan, dan non performing finance terhadap jumlah pembiayaan pada bank syariah (studi pada PT Bank Syariah Mandiri periode 2007-2009) / Aldilla De Vega
666Pengaruh kepuasan komunikasi terhadap komitmen organisasi (Studi pada karyawan BRI Cabang Martadinata Malang / Agung Wijayanto
667Pengaruh kualitas produk terhadap keputusan pembelian konsumen (studi pada warga Perumnas Sawojajar pelanggan koran Jawa Pos Radar Malang) / Arifin
668Pengaruh tayangan iklan di media televisi terhadap keputusan pembelian honda absolute revo 110CC (studi pada PT. Eka Jaya Motor Batu) / Ronggo Suhandoko
669Analisis pengaruh financial leverage, net profit margin (NPM), dan return on equity (ROE) terhadap earning per share (EPS) pada perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia tahun 2007-2009 / Nimas Ajeng Pradnya Paramita
670Pengaruh kredibilitas celebrity endorser Sule pada iklan kartu as terhadap keputusan pembelian konsumen ( setudi pada mahasiswa angkatan 2010 pengguna kartu as di Fakultas Ekonomi Universitas Negeri Malang) / Dita Riskasari
671Pengaruh lingkungan kerja dan motivasi kerja terhadap kepuasan kerja karyawan PT. PLN (Persero) Distribusi Jawa Timur Area Malang / Gita Selviandari
672Pengaruh earning per share, return on equity dan dividend per share terhadap harga saham perusahaan BUMN yang listing di Bursa Efek Indonesia tahun 2007-2009 / Haya Iddha Anestsysca Ortri
673Analisis perbedaan kinerja reksadana pendapatan tetap konvensional dengan reksadana pendapatan tetap syariah menggunakan indeks Sharpe, Treynor, dan Jensen periode 2010 / Ratna Mustika Utomo
674Pengaruh kupon, maturitas, yield to maturity obligasi dan tingkat suku bunga terhadap harga obligasi negara seri fixed rate yang listing di BEI periode 2006-2008 / Rosa Rismayanti
675Pengaruh psikologi konsumen terhadap keputusan pembelian konsumen handphone qwerty pada mahasiswa Universitas Negeri Malang / Heroe Fitri Mega Nur Malinda
676Pengaruh kepemilikan saham manajerial, kepemilikan saham institusional dan kebijakan dividen terhadap kebijakan hutang perusahaan (studi kasus pada perusahaan manufaktur yang listing di Bursa Efek Indonesia tahun 2006-2009) / Chrisnanto Adityo Nugroho
677Pengaruh iklan dan layanan purna jual terhadap keputusan pembelian motor Yamaha (studi kasus di Dealer Gondanglegi Motor Kabupaten Malang) / Shochibul Aziz Zaelani
678Pengaruh atribut produk terhadap keputusan pembelian konsumen (studi kasus pada pengguna produk So Klin Pewangi di Desa Gaprang Kecamatan Kanigoro Kabupaten Blitar) / Lena Choirul Mala
679Pengaruh Economic value added (eva), market value adde (mva), return on investment (roi) dan return on equity (roe) terhadap harga saham perusahaan manufaktur yang listing di bei periode 2006-2008 / Happy Oki Hardiyanto
680Pengaruh kecerdasan emosional (emotional quotient) dan motivasi kerja terhadap kinerja karyawan (studi kasus pada karyawan bagian Frontliner di Baker's King Malang) / Rendy Perdana Putra
681Pengaruh price earning ratio (PER), current ratio (CR), dan return on equity (ROE) terhadap harga saham perusahaan property & real estate yang listing di Bursa Efek Jakarta / Budi Pratikno
682Stres kerja dan keputusan kerja sebagai pemediasi pengaruh konflik peran terhadap komitmen oragnisasi (Studi pada karyawan bagian produksi PR. Gudang Sorgum Malang) / Yulian Dwi Cahyana
683Pengaruh motivasi kerja terhadap produktivitas kerja melalui kepuasan kerja dan komitmen oraganisasional pada PT. Sinar Magnit Malang / Yulian Dwi Pramana
684Kepercayaan sebagai pemediasi gaya kepemimpinan transformasional terhadap kepuasan kerja (studi pada Hotel Pelangi Malang) / Widya Tri Purnamasari
685Pengaruh keadilan organisasi terhadap organizational citizenship behavior (OCB) melalui leader-member exchange (LMX) studi sada PT. Anindo Bertahannuts Perkasa Malang / Febrina Cindy Hari Krisna
686Pengaruh identitas visual (Aspek seni arsitektural, kemahasiswaan, dan logo) terhadap reputasi yang terbentuk di kalangan mahasiswa Universitas Negeri Malang (Studi pada Mahasiswa Fakultas ekonomi jurusan Manajemen Angkatan 2006 reguler) / Santi
687Pengaruh perceived usefulness, perceived ease of use dan perceived enjoyment terhadap niat pembelian: studi kasus pada Ray-Band Virtual Mirror / Santri Arum Pratnya Radita
688Pengaruh komunikasi organisasi terhadap kinerja karyawan melalui motivasi kerja (studi pada PT Putri Panda Unit II Tulungagung) / Haris Dwi Rukmana
689Pengaruh daya tarik dan kredibilitas celebrity endorser terhadap brand image pada website I Love Indonesia (studi pada mahasiswa Jurusan Manajemen angkatan 2010 Fakultas Ekonomi Universitas Negeri Malang) / Sa'id Hamdan Wahdani
690Pengaruh return on asset, debt to equity ratio, dan current ratio terhadap return saham (studi pada perusahaan property dan real estate yang listing di Bursa Efek Indonesia periode 2013-2014) / Mustika Kusuma Wardani
691Pengaruh profitabilitas terhadap initial return dilihat dari aspek cash basis dan accrual basis (studi pada perusahaan yang melakukan Initial Public Offering (IPO) di Bursa Efek Indonesia periode tahun 2011-2015) / Miranti Dewi Febriani
692Pengaruh gaya kepemimpinan dan motivasi kerja terhadap kinerja pegawai pada Badan Pelayanan Perizinan Terpadu Kota Malang / Dana Warnusa
693Pengaruh kualitas pelayanan terhadap kepuasan pelanggan (studi pada pelanggan JNE Cabang Utama Malang) / Wahlul Umam
694Pengaruh kinerja keuangan perusahaan terhadap return saham pada perusahaan food and beverage di Bursa Efek Jakarta periode tahun 2000-2002 / Medinia Nurul Aini
695">Pengaruh struktur modal terhadap profitabilitas pada UMKM "Bagus Agriseta Mandiri" / Rina Oktavia
696Pengaruh kompensasi dan motivasi terhadap kinerja karyawan (studi pada PT. PLN (Persero) Area Malang) / Manggala Putra Alembana
697Pengaruh insentif terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan PT PLN (Persero) APJ Malang) / Camelia Maharani Koesoema
698Pengaruh inflansi, suku bunga, kurs rupiah, dan tingkat likuiditas terhadap risiko investasi saham perusahaan yang terdaftar di Jakarta Islamic ndex tahun 2008-2010 / Nurmalitasari
699Pengaruh atribut produk terhadap minat beli ulang konsumen (studi pada UKM Kedai Susu di Malang) / Gucia Arniaga
700Pengaruh kejenuhan dan kepuasan gaji terhadap komitmen organisasi (Studi pada karyawan PT. Adira Kredit Cabang Surabaya) / Bayu Setiawan
701Pengaruh Return On Asset (ROA) dan Economy Value Added (EVA) terhadap return saham melalui Market Value Added (MVA) pada perusahaan otomotif dan otoparts yang listing di BEI periode 2012-2014 / Ifan Nur Yahya
702Pengaruh promosi onliine melalui media sosial facebook terhadap keputusan pembelian pada konsumen Mimi Bakery Denpasar / Nyoman Tassia Rosiani Wiratha
703Pengaruh citra merek dan kualitas produk terhadap keputusan pembelian produk sepatu Adidas (studi pada Adidas Store Mall Olympic Garden Malang) / Mario Herlan Prakasa
704Pengaruh capital adequacy ratio, non performing loan, dan loan to deposit ratio terhadap return on asset (studi pada bank umum yang listing di Bursa Efek Indonesia periode 2012-2014) / Diah Ratnasari
705Pengaruh kualitas pelayanan terhadap loyalitas nasabah tabungan Britama PT. Bank Rakyat Indonesia (Persero) Tbk. KC Malang Martadinata / Rosyida Nailul Muna
706Pengaruh bauran promosi terhadap proses pengambilan keputusan pembelian rokok Filo (studi pada konsumen di Kecamatan Kepanjen Kidul Kota Blitar) / Wiwin Nur Abika
707Analisis manajemen piutang terhadap kinerja keuangan primer koperasi kepolisian resort Blitar (Primkoppol Resort Blitar) / Pudji Tyas Rahayu
708Penyusunan anggaran kas untuk meningkatkan rentabilitas pada perusahaan meubel UD. Jaya Bhakti Kendalrejo, Kecamatan Talun Kabupaten Blitar / Septa Daniarta
709Analisis pengaruh total asset turnover dan return on asset terhadap price earning ratio (studi pada industri makanan dan minuman yang listing di BEJ tahun 2001-2003) / Rina Pristiani
710Pengaruh Non Performing Loan (NPL), Capital Adequacy Ratio (CAR) dan Loan to Deposite Ratio (LDR) terhadap profitabilitas bank umum swasta nasional devisa yang terdaftar di BEI Periode 2012-2014 / Ulfi Umi Nadziroh
711Analisis kinerja keuangan perusahaan semen sebelum dan sesudah go public di Bursa Efek Jakarta oleh Heni Fitriana
712Hubungan antara persepsi karyawan tentang lingkungan kerja fisik dengan faktor penentu produktivitas kerja karyawan (studi kasus pada AJB Bumiputera 1912 Malang) / Kuna'ah
713Pengaruh kualitas layanan terhadap kepuasan konsumen pada toko buku diskon toga mas Malang oleh Farida Ermawati
714Pengaruh kualitas pelayanan penanganan komplain terhadap kepuasan nasabah Bank BRI Cabang Kediri / Djalur Wasi Adji
715Pengaruh pemberian kompensasi finansial terhadap kinerja karyawan (studi kasus pada Bagian Medis Laboratorium Klinik Utama "PRAMITA" Cabang Yogyakarta) / Novaria Hudawati Devy
716Persepsi pelanggan tentang kualitas produk (pembeli apple ipad di Metro Digital Store Mall Olympic Garden ) / Lintang Manero
717Pengaruh experiental marketing terhadap loyalitas pelanggan (studi pada komunitas "Yamaha Riders Federation Indonesia" Wilayah Malang) / Chintata Ardisa
718Analisis faktor-faktor yang dipertimbangkan konsumen dalam membeli kartu seluler prabayar IM3 (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Rohman Bangkit Pratama
719Pengaruh gaya kepemimpinan transformasional terhadap kepuasan kerja melalui kepercayaan pada atasan (Studi kasus karyawan PT. Catur Elang Perkasa KMota Surabaya) / Yogi
720Hubungan antara sikap badan pada waktu mengetik dengan kecepatan manual pada siswa kelas I semester II tahun pelajaran 2002/2003 Sekolah Menengah Kejuruan Negeri I Malang oleh Erlina Tresnaningtyas
721Pengaruh similar name terhadap keputusan pembelian konsumen pada produk Tolak Angin dan Antangin (studi pada warga Desa Kejapaan Kecamatan Gempol Kabupaten Pasuruan) / Ardhiansyah Probo Nugroho
722Pengaruh citra merek dan harga terhadap loyalitas pelanggan samrphone Samsung Galaxy Series (studi kasus pengunjung Counter Rahma Cell Malang) / Raditya Iwannanda
723Pengaruh current ratio, NPL dan pertumbuhan aset terhadap profitabilitas Bank Perkreditan Rakyat Kota Malang periode 2013-2014 / Adib Aprilianur
724Penerapan etika periklanan sebagai upaya perlindungan terhadap konsumen (studi pada Jawa Pos Radar Malang) / Rika Ookii Putri
725Pengaruh diferensiasi (produk dan pelayanan) terhadap keputusan pembelian (studi pada Outlet Waralaba Kaf's Dorayaki) / Dhinar Catur Rahmawan
726Pengaruh brand image terhadap loyalitas konsumen Smartphone Iphone (studi kasus pada Komunitas iPhone Malang) / Achmad Husni
727Pengaruh budaya organisasi terhadap kepuasan kerja melalui komitmen organisasi (Studi pada karyawan CV. Citra Mitra Boxindo Singosari Malang) / Mustafa Ramadhan
728Pengaruh persepsi atmosfer toko terhadap keputusan konsumen membeli pakaian (Studi kasus pada Toko Apolo Jln. Cokro Aminoto 22 Blitar) / Ageng Satriyono
729Pengaruh kualitas layanan terhadap kepuasan pelanggan (Studi pada pengunjung Taman Wisata Jawa Timur Park Batu) / Nur Alifatul CH.
730Pengaruh bauran pemasaran terhadap loyalitas melalui kepuasan pelanggan (studi kasus pada "1920 Ice" Kota Malang) / Robithul Umam
731Pengaruh faktor internal dan eksternal terhadap keputusan pemilihan sekolah (Studi pada siswa Madrasah Aliyah Negeri Genukwatu, Ngoro Jombang) / Yayuk Murtia Dhani
732Pengaruh kualitas pelayanan terhadap kepuasan pelanggan pada Snapy Digital Printing di Malang / Rani Wijaya Nuwantari
733Pengaruh budaya organisasi terhadap kinerja karyawan melalui motivasi kerja (study kasus pada karyawan PT. Pattindo Malang) / Sualimin
734Pengaruh konflik peran terhadap kinerja melalui stres kerja (studi pada perawat RS Aisyiyah Bojonegoro) / Ahmad Riskhi F.R.
735Analisis metode penetapan job grade sebagai dasar penetapan kompensasi (studi pada PT Bumi Lamongan Sejati Maharani Zoo & Goa) / Sholihul Herfandi
736Pengaruh budaya organisasi dan jiwa intrapreneurship terhadap kinerja karyawan (studi pada karyawan PT. Hero Sakti Motor Gemilang Malang) / Wahyu Agung Handono
737Analisis perbedaan hari perdagangan terhadap return saham: pengujian monday effect, week four effect, dan April effect di BEI (studi pada perusahaan LQ-45 periode 2007 sampai dengan 2008) / Sonya Ayu Anggraini
738Pengaruh kesadaran merek, kualitas merek dan asosiasi merek terhadap loyalitas konsumen pengguna HP Samsung (study pada mahasiswa Jurusan Manajemen Fakultas Ekonomi angkatan 2014 Universitas Negeri Malang) / Bogi Waskito Jati
739Pengaruh resiko sistematis (BETA) dan earning per share (EPS) terhadap return saham pada perusahaan yang tergabung dalam indeks liquid (LQ-45) tahun 2009 / Mukhlas Riyadhoh
740Pengaruh pelayanan prima terhadap kepuasan pelanggan pada UD. Barokah Kota Batu / Rudi Kurniawan
741Pengaruh kualitas layanan terhadap loyalitas pelanggan melalui kepuasan pelanggan (studi pada member McKids McDonald's Watugong Malang) / Kidung Yogyaswara
742Pengaruh pengawasan dan penilaian kinerja terhadap motivasi kerja karyawan pada PT Telekomuniasi Indonesia Tbk Area Malang / Bagus Brahmantya
743Pengaruh service quality terhadap loyalitas pelanggan (studi pada Bank Muamalat Indonesia Cabang Malang) / Rani Fahmi
744Hubungan pemberian kompensasi finansial dengan kinerja karyawan PR. Delapan Wijaya Malang / Herman Panjaitan
745Penerapan demplot sebagai integrated marketing communication guna meningkatkan penjualan pupuk pada PT Petrokimia Gresik / Rachmad Eka Prasetia
746Pengaruh variabel makroekonomi terhadap return indeks Kompas 100 periode Agustus 2007-Desember 2010 / Reni Astutik
747Pengaruh bauran eceran (retailing mix) terhadap keputusan pembelian konsumen (studi pada Apolo Swalayan Jombang) / Retno Sari Dewanti
748Pengaruh kualitas layanan (Servis quality) terhadap loyalitas (Stufy pada anggota unit simpan piagam "Bina Bersama") / Fahmi Amrullah
749Pengaruh Brand image dan faktor psikologis konsumen terhadap keputusan pembelian produk merek luar Negeri (Studi pada konsumen Planet Surf Store di Kota Malang) / Rizki Ardy Pratama
750Pengaruh atribut produk terhadap proses keputusan pembelian helm merek INK (Studi Pada Mahasiswa Fakultas Ekonomi Prodi Pendidikan Ekonomi Angkatan 2010 Universitas Negeri Malang) / Jefri Herdianto
751Pengaruh lingkungan kerja terhadap kinerja karyawan melalui kepuasan kerja pada Perum Jasa Tirta I Malang / Nur Khanifan
752Pengaruh brand image dan harga terhadap kepuasan konsumen produk kosmetik merek Wardah (studi pada konsumen Wardah Toko Kosmetik Raya dan Counter Wardah di Matos) / Hayuning Mukti Dwi Purnamasari
753Faktor-faktor yang dipertimbangkan konsumen untuk melakukan pembelian secara online (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Novy Indarsih
754Pengaruh relationship marketing terhadap kepuasan nasabah (studi pada nasabah Asuransi Jiwa Bersama Bumiputera 1912 Cabang Singosari) / Aditya Priyo Handoko
755Pengaruh penempatan kerja terhadap kinerja karyawan PT. PLN (persero) distribusi Jawa Timur Area Malang / Syifa Kirana Syahputri
756Faktor - faktor yang mempengaruhi keputusan struktur modal (perspektiif pecking order theory) studi pada industri food and beverage periode 2003- 2007 / Femilia elita
757Penerapan analisis SWOT sebagai salah satu cara dalam menentukan strategi pemasaran (studi pada Sekolah Dasar Islam Plus Lembaga Sosial Pendidikan Islam Arrosyiid di Kota Mojokerto) / Arie Akbar Nugroho
758Pengaruh persepsi konsumen tentang selebriti pendukung (celebrity endorser) terhadap brand equity shampo pantene (studi kasus pada mahasiswa manajemen fakultas ekonomi Universitas Negeri Malang tahun 2011) / Nevita Tridiana
759Pengaruh inflasi, suku bunga, dan perubahan kurs terhadap indeks harga saham gabungan perusahaan yang listing di BEI tahun 2007-2009 / Ali Anwar
760Pengaruh tayangan iklan mie Indomie ditelevisi terhadap citra merk (Studi pada masyarakat Tegal Gondo Asri di desa Tegal Gondo Kabupaten Malang) / Gerry Dimas Mahesa Surya
761"Pengaruh kualitas produk terhadap minat beli produk minuman Coca-Cola" (studi pada mahasiswa Fakultas Ekonomi Jurusan Manajemen 2014/2015 Universitas Negeri Malang) / Aditya Sutrisna Putra
762Pengaruh konflik peran terhadap kepuasan kerja melalui stres kerja (studi pada karyawan Bagian Administrasi Keuangan dan Umum PG Meritjan Kediri) / Muhammad Lutfi
763Faktor-faktor yang mempengaruhi proses pengambilan keputusan konsumen dalam berlangganan koran Jawa Pos (Studi kasus pada konsumen yang berlangganan koran Jawa Pos di Wilayah Kelurahan Ketawang Gede Kota Malang) / Apriani Mike Palamba
764Pengaruh return on equity (ROE), Earning Per Share (EPS), Dividen Payout Ratio (DPR), terhadap harga saham pada perusahaan manufaktur yang listing di bei periode 2005-2007 / Taufiq Fatkhur Rahman
765Pengaruh risiko sistematis dan likuiditas saham terhadap return saham pada industri perbankan yang go public di Bursa Efek Indonesia tahun 2007-2009 / Novianti Kusumaningrum
766Penerapan kolaborasi model problem based learning dan mind mapping untuk meningkatkan hasil belajar siswa (studi pada siswa kelas X APK SMK Cendika Bangsa Kepanjen dalam mata pelajaran menerapkan K3LH) / David Anggik Anggada
767Persepsi karyawan tentang gaya kepemimpinan dan budaya organisasi serta pengaruhnya terhadap disiplin kerja karyawan (studi kasus pada PT. BTrav International, Malang)" / Akbar Widhi Romansyah
768Pengaruh kompensasi non financial terhadap kinerja karyawan melalui komitmen organisasional di PT. Telekomunikasi Indonesia cabang Banyuwangi / Septia Diah Eka Bakti
769Pengaruh komunikasi interpersonal dan internal locus of control terhadap kinerja karyawan melalui stres kerja (studi pada karyawan PT. PLN Persero APJ Malang) / Ayu Angelita Chairul Putri
770Pengaruh brand equity terhadap kepuasan pembelian (studi pada konsumen handphone merek Nokia di Kelurahan Kepanjen Kidul Kota Blitar) / Yanik Megawati
771Pengaruh budaya organisasi dan pemberdayaan karyawan terhadap kepuasan kerja (studi pada karyawan UD. Phalosari Unggul Jaya Tembelang Jombang) / Rizal Bashroni
772Pengaruh perputaran aktiva, debt to equity ratio (DER) dan pertumbuhan penjualan pada perusahaan wholesale and retail yang listing di BEI tahun 2007-2009 / Yeny Krisnawati
773Pengaruh stres kerja terhadap komitmen organisasional melalui kepuasan kerja karyawan (Studi pada karyawan PT. PLN Persero distribusi Jawa Timur APJ Bojonegoro) / Prisca Nourmanovieta
774Pengaruh persepsi konsumen tentang iklan kartu As versi "Ga Punya Pulsa" pada media televisi terhadap kesadaran merek (Studi kasus pada mahasiswa manajemen 2011 Fakultas Ekonomi Universitas Negeri Malang) / Afrizal Candra Andreanto
775Faktor-faktor yang dipertimbangkan konsumen dalam membeli sepeda motor honda (Studi pada pengguna sepeda motor honda di kota Malang) / Clorida Oktarima
776Pengaruh citra produk terhadap proses keputusan konsumen dalam pembelian sepeda motor yamaha (Studi pada pelanggan Dealer UD. Surya Mas Motor Jombang) / Nindyo Kumoro
777Pengaruh kemampuan personal selling (Sales) terhadap keputusan pembelian dalam memilih rumah (Studi pada pembeli rumah yang dikembangkan oleh PT. Pancanaka Malang di Tirtasari Recidence Sukun) / Dadang Arfi Permana Putra
778Pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan hutang dan kebijakan diveden terhadap biaya keagenan (Studi pada Perusahaan Manufaktur yang listing di BEI tahun 2007-2009) / Sheila Dhany Putriyanti
779Analisa perbedaan komitmen organisasional pada tiap tahapan karir (studi kasus pada PT. PLN Persero APJ Malang) / Rahadhian Vindy W.
780Kinerja rumah sakit umum Surya Melati Kab. Kediri berdasarkan analisis balance scorecard / Inayatul Fitriya
781Analisis kesehatan keuangan pusat koprasi pegawai republik Indonesia kabupaten Nganjuk tahun 2006-2010 / Trias Anggi Bestari
782Pengaruh citra perusahan terhadap organizational citizenship behavior (OCB) melalui komitmen organisasional (Studi pada pegawai tetap PT.PLN (Persero) APJ Malang) / Puspita Widya Utami
783Pengaruh kualitas layanan pemeliharaan terhadapoyalitas pelanggan pada Ahass Karya Agung Motor Durenan, Trenggalek / Novi Dwi Wulandari
784Pengaruh persepsi kualitas dan loyalitas merek terhadap proses pengambilan keputusan pembelian Indomie (studi pada mahasiswa Jurusan Manajemen FE UM) / Eva Rahmawati Agustina
785Pengaruh kompensasi finansial dan kompensasi non finansial terhadap kepuasan kerja karyawan (studi pada karyawan PT. Kereta Api (Persero) Daop 8 Surabaya Stasiun Malang Bagian Teknisi) / Indra Ari Prasetya
786Analisis faktor-faktor penentu penggunaan jasa pengiriman Jalur Nugraha Ekakuris (JNE) (studi pada mahasiswa Universitas Negeri Malang Jurusan Manajemen angkatan 2013) / Adi Setiawan
787Pengaruh promosi onlie melalui twitter terhadap proses keputusan pembelian konsumen toko online Roadin Store (studi kasus pada followers twitter Roadin Store) / Ramya Daksa Mandhana
788Pngaruh reputasi underwriter, reputasi auditor, Return On Asset (ROA), dan financial leverage terhadap tingkat underpricing pada penawaran saham perdana (di Bursa Efek Indonesia periode tahun 2008-2010) / Faridatul Munawaroh
789Pengaruh kecerdasan emosional terhadap kinerja pegawai melalui stres kerja (studi pada pegawai Balitjestro Kota Batu, Jawa Timur) / Faisol Akbar
790Analisis pengaruh current ratio, DPR, ROE, dan financial leverage terhadap price earning ratio pada perusahaan [property dan real estate yang terdaftar di BEI tahun 2006-2010) / Moh. Tohari
791Pengaruh DER terhadap return saham melalui ROE, ROA, dan EVA pada perusahaan food and beverages yang listing di BEI periode 2009-2011 / Hesty Tri Budiharti
792Pengaruh kebijakan investasi terhadap nilai perusahaan yang dimediasi oleh kebijakan pendanaan dan kebijakn dividen (Studi pada perusahaan publik yang terdaftar di BEI tahun 2009) / Muhammad Iqbal Al Muchlisun
793Pengaruh kompensasi finansial langsung dan kompensasi finansial tidak langsung terhadap komitmen organisasi (studi pada karyawan PT Alfa Mandiri Jaya Surabaya) / Wahyu Widiyanti
794Tingkat Organizational Citizenship Behavior (OCB) karyawan dan kebijakan manajemen yang berkaitan dengan organizational citizenship behavior karyawan / Wahyu Hakam Ahsantino
795Pengaruh merk, harga, dan kualitas produk terhadap niat membeli keripik pedas Maicih (studi pada siswa kelas XII SMK Negeri 3 Kediri) / Affan Lancur Harli Prabowo
796Pengaruh return on assets (ROA) return on equity (ROE) terhadap return saham melalui trading vulume activity (TVA) pada perusahaan automotive and allied product yang listing di BEI periode 2008-2010 / Dewi Rifqiyati Sari
797Pengaruh gaya kepemimpinan terhadap kepuasan kerja karyawan (Studi pada karyawan hotel Pelangi Malang) / Hugik Yudo Kristantyo
798Analisis kinerja perusahaan dengan pendekatan balanced scoricard pada PT. PLN (Persero) area pelayanan dan jaringan Malang periode 2007-2010 / Fanny Restu Saputri
799Pengaruh komponen verbal dan visual dalam iklan sabun cuci Sunlight di televisi terhadap citra produk (studi kasus pada pengguna produk sabun cuci Sunglight di Desa Gempol Kecamatan Gempol Kabupaten Pasuruan) / Nurindah Devi Susanti
800Pelaksanaan public relations di Hotel Graha Cakra Malang / Farida Reviyanti
801Pengaruh keselamatan dan kesehatan kerja (K3) terhadap produktivitas kerja karyawan (Studi pada karyawan bagian pabrikasi PT. PG. Kebonagung, Malang) / Suherlis Setiowati
802Perbedaan kinerja keuangan (metode camels) dan return saham perbankan yang lsiting di BEI sebelum dan right issue (periode 2007-2009) / Yunita Dwi Pertiwi
803Pengaruh persepsi bauran promosi terhadap keputusan pembelian konsumen pada produk XL bebas (studi pengguna XL bebas di Kota Malang) / Royan Purwo Istanto
804Pengaruh stres kerja terhadap kinerja karyawan melalui komitmen organisasi pada PT. Bank Jatim Cabang Blitar / Eko Sugihartanto
805Analisis perbedaan economic value added (EVA) dan harga saham sebelum dan sesudah merger pada beberapa perusahaan yang terdaftar di Bursa Efek Jakarta / Ni Kadek Sri Ony Pariartini
806Studi deskriptif tentang kesehatan bank umum yang go public (listing di Bursa Efek Jakarta) tahun 2004-2005 (studi analisis dengan metode Camel) / Supriono
807Pengaruh kualitas layanan terhadap loyalitas melalui kepuasan pelanggan (studi pada nasabah tabungan Britama BRI Kantor Cabang Malang Martadinata) / Tatik Warniati
808Pengaruh iklan sabun Dove di televisi terhadap keputusan pembelian konsumen (studi kasus pada penduduk RW 06 di Kelurahan Kolpajung, Kecamatan Pamekasan, Kabupaten Pamekasan) / Rachmawati
809Faktor-faktor yang mempengaruhi keputusan pembelian konsumen dilihat dari dimensi bauran promosi (studi pada konsumen shampo Sunsilk di Kelurahan Mergosono Kecamatan Kedungkandang Kota Malang) / Kunthi Endah Pratiwi
810Faktor-faktor yang mempengaruhi return on equity pada Koperasi Simpan Pinjam Arta Unggas Makmur / Fiktoria Ningsih
811Pengaruh penempatan dan pelatihan terhadap kinerja karyawan non teknis (studi kasus di PT. Telkom Indonesia Witel Malang) / Faizatin Istiqomah
812Pengaruh Return On Equity (ROE) dan Debt To Equity Ratio (DER) terhadap initial return (studi pada perusahaan yang melakukan Initial Public Offering (IPO) di Bursa Efek Indonesia periode tahun 2011-2015 / Ernando Kurnia Putra
813Pengaruh manfaat citra merek terhadap intensi pembelian ponsel Nokia (studi kasus pada konsumen di Counter Oke Shop Malang Town Square) / Witamining Ayu Lelia Dewi
814Pengaruh faktor sosial, pribadi, dan psikologis terhadap keputusan pembelian smartphone Samsung (studi pada mahasiswa Program Studi S1 Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Muhammad Zainuddin
815Pengaruh current ratio dan debt to total asset ratio terhadap rentabilitas modal sendiri (ROE) melalui perputaran modal kerja pada koperasi serba usaha di Kota Malang tahun 2010 / Mutimah Faidah
816Pengaruh store atmosphere (suasana toko) terhadap keputusan pembelian konsumen (studi pada konsumen toko Stroberi Matos) / Bayu Prasetyo
817Pengaruh variabel fundamental terhadap harga saham industri food and beverages yang go public di Bursa Efek Jakarta (BEJ) / Yunita Dwi Anggraini Boru Simamora
818Pengaruh kualitas layanan terhadap loyalitas pelanggan pada pengunjung obyek wisata Eco Green Park Batu / Yoga Dwi Satria
819Pengaruh current ratio, return in asset, dan return on equity terhadap return saham pada perusahaan food and beverages yang listing di BEI periode 2010-2012 / Daniel Sakti Kusuma Wijaya
820Perbedaan actual return abnormal return, trading volume activity (TVA), dan security return variability (SRV) saham sebelum dan setelah merger tahun 2006 pada perusahaan yang listing di BEJ / R.A. Norromadani Yuniati
821Pengaruh budaya organisasi melalui kepuasan kerja dan komitmen organisasional terhadap kinerja tenaga penjualan pada PT. Telkom Kancatel Tulungagung / Dwi Rahmawati
822Pengaruh perceived service quality terhadap loyalitas melalui kepuasan pelanggan (studi pada konsumen rumah makan Kaliurang Malang) / Muhammad Romdhani
823Pengaruh pemberian kompensasi terhadap kinerja pegawai (studi pada pegawai PT. Bank Rakyat Indonesia (Persero) Tbk Cabang Cut Mutiah Jakarta) / Harry Mawardi
824Pengaruh karakteristik pekerjaan terhadap komitmen organisasi melalui kepuasan kerja (studi pada tenaga paramedis dan non paramedis Rumah Sakit Islam Lumajang) / Khurriyah Hidayati
825Analisis faktor atmosfer toko pada Ratu Swalayan Gajahmada Malang / Iin Rosalia Suwito
826Presepsi masarakat Desa Kendal Kabupaten Ngawi atas atribut produk sepeda motor merek yamaha dan pengaruhya terhadap minat membeli / Sumarwasenja
827Kesesuaian penerapan gaya kepemimpinan dalam upaya memperkuat karakteristik individu pegawai (studi pada bidang UMKM Dinas Koperasi, usaha mikro, kecil, dan menengah Kabupaten Tulungagung) / Toni Eko Prasetiyo
828Pengaruh bauran pemasaran jasa terhadap keputusan konsumen dalam memilih jasa penginapan (studi pada pengguna jasa hotel Puri Perdana Blitar) / Purwanditya Hendra Wahyudi
829Pengaruh faktor psikologis terhadap proses keputusan pembelian konsumen (studi pada konsumen perusahaan Dynamic Product Lawang) / Damai Setyawan
830Pengaruh faktor psikologis terhadap keputusan pembelian laptop Acer (studi pada mahasiswa Program Studi Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang) / Rendra Handoko
831Pengaruh hari perdagangan terhadap return, abnormal return dan risiko saham di Bursa Efek Jakarta / David Bahar Mahbubi
832Pengaruh kualitas jasa terhadap loyalitas pasien (studi pada PT Petro Graha Media Rumah Sakit Petrokimia Gresik) / Saktya Ernita Eka Octaviana
833Pengaruh kualitas layanan terhadap loyalitas konsumen (studi pada peserta didik di Lembaga Bimbingan Belajar Primagama Blitar) / Restu Panca Antarina Sugianto
834Analisis earning growth, price earning ratio, dan return on equity yang mempengaruhi dividend payout ratio pada perusahaan go public yang listing di BEI periode 2007-2009 / Ina Iramayana
835Pengaruh harga minyak dunia, nilai tukar rupiah dan tingkat suku bunga SBI terhadap Jakarta Islamic Index (JII) / Titik Indriasari
836Pengaruh atmosfir toko (Sture Atmosphere) terhadap pembelian ulang (Repeat purchase) (Studi pada konsumen Matahari Departement Store MATOS) / Agus Nuruz Zaman
837Pengaruh atribut produk terhadap loyalitas konsumen (studi pada konsumen "UD Mayang Jaya" di Muncar-Banyuwangi / Islamiyah
838Analisis perbedaan multiple intellegence karyawan kusuma agrowisata hotel Batu berdasarkan jenis kelamin sebagai dasar perumusan strategi pemindahan karyawan (Studi pada karyawan Kusuma Agrowisata Hotel batu) / Anita Fitriawati
839Pengaruh inflasi, tingkat suku bunga, dan kurs rupiah terhadap return saham perusahaan manufaktur di BEJ / Ika Kartika
840Pengaruh tayangan iklan televisi terhadap citra merek dan dampaknya kepada keputusan pembelian soft drink Fanta (studi kasus pada SMA Negeri 1 Talun Blitar) / Saiful Anwar
841Pengaruh atribut produk terhadap loyalitas konsumen (studi pada pelanggan kartu seluler prabayar IM3 di Kelurahan Sumbersari Kecamatan Lowokwaru-Kota Malang) / Dina Mufida
842Pengaruh aspek psikologis terhadap keputusan pembelian sepeda motor Honda Tiger (studi pada klub motor Neo Gat's Malang) / Machfud
843Analisis kelayakan investasi usaha budidaya lobster air tawar oleh Gentle Face Farm / Ferry Adiwiraga
844Pengaruh rasio lancar dan perputaran total aktiva terhadap harga saham melalui return on investment (ROI) pada perusahaan manufaktur 2005-2008 / Hikmah Punjung Widhasa
845Analisis strategi rekruitmen dan seleksi SDM berbasis kompetensi (studi kasus jabatan Account Officer pada PT BPR Mitra Catur Mandiri Pakis-Kab. Malang) / Yoseph Dimas Prayogo
846Pengaruh stock split terhadap abnormal return dan trading volume activity (studi pada perusahaan manufaktur yang listing di Bursa Efek Jakarta tahun 2003-2006) / Chandra Riana
847Pengaruh brand image produk layanan terhadap loyalitas konsumen PT. Pos Indonesia (Persero) Kantor Cabang Malang / Yohanes Tri Widada
848Pengaruh bauran pemasaran jasa terhadap keputusan konsumen dalam memilih perusahaan jasa pengiriman barang (studi kasus pada PT. TIKI Jalur Nugraha Ekakurir Pandaan, Kabupaten Pasuruan) / Ika Dhesi Kristanti
849Perbedaan harga saham, volume perdagangan saham dan bid-ask sebelum dan sesudah pengumuman dividen di Bursa Efek Jakarta tahun 2007 (studi kasus pada perusahaan keuangan yang listing di Bursa Efek Jakarta) / Sefti Herdianingsih
850Pengaruh perputaran piutang dan perputaran persediaan terhadap rentabilitas perusahaan farmasi yang listing di Bursa Efek Jakarta (BEJ) periode 2001-2006 / Aris Setiyadi
851Pengaruh Debt To Equity Ratio (DER) terhadap harga saham melalui Return On Equity (ROE) dan Earning Per Share (EPS) pada perusahaan property dan real estate yang listing di Bursa Efek Indonesia tahun 2012 / Mochamad Samsu Dhukha
852Pengaruh iklan televisi terhadap citra merek produk sepeda motor Honda Beat (studi pada mahasiswa Prodi S1 Manajemen angkatan 2014 Fakultas Ekonomi Universitas Negeri Malang / Pungky Wiranata
853Pengaruh retail mix (bauran eceran) terhadap keputusan pembelian di Toko Buku Diskon Toga Mas Malang / Perin Wulan Yuliyah
854Pengaruh current ratio dan working capital turnover terhadap return saham melalui Return On Equity (ROE) pada perusahaan LQ 45 yang listing di BEI periode Februari-Juli 2015 / Aisyah Issura
855Pengaruh return on equity (ROE) dan operating cash flow ratio (OCFR) terhadap return saham melalui earning per share (EPS) (studi pada perusahaan food and baverages tahun 2007-2010) / Muhammad Maisur Amin.
856Pengaruh iklan televisi terhadap keputusan pembelian sepeda motor yamaha (Studi khusus pada konsumen dealer Blimbing motor Malang) / Beny Alif Ayu Wijaya
857Pengaruh Current Ratio, Debt To Equity Ratio dan Working Capital Turnover terhadap Profit Margin (studi pada Koperasi Pegawai Republik Indonesia di Kabupaten Sidoarjo tahun 2012) / Achmad Zaki
858Pengaruh kualitas layanan yerhadap kepuasan Mahasiswa dalam mengikuti studi di Fakultas Ekonomi Universitas Negeri Malang / Hildan Fathoni
859Pengaruh lingkungan toko terhadap keputusan pembelian konsumen (Studi pada Hero Swalayan Sarinah Malang) / Heri Purwanto
860Perbedaan abnormal return saham sebelum dan sesudah peristiwa Right Issue (Studi pada Perusahaan yang Listing di BEJ Periode 2001-2006) / Maya R. Kusumaningtiyas
861Analisis kebangkrutan model Zavgren dan pengaruhnya terhadap risiko sistematis saham pada perusahaan basic industry and chemicals yang listing di BEI periode 2009 / Hesti Ardianti
862Pengaruh atribut produk terhadap keputusan pembelian deterjen (studi pada ibu rumah tangga di Kelurahan Satriyan Kecamatan Kanigoro Kabupaten Blitar) / oleh Dian Eka Prasastianta
863Pengaruh tingkat inflasi, tingkat suku bunga, dan jumlah uang beredar terhadap nilai tukar antara Indonesia dengan Jepang periode waktu 2006-2010 / Dedi Suselo
864Pengaruh EVA dan ROE terhadap nilai perusahaan melalui TVA pada perusahaan real estate and property yang listing di BEI tahun 2010 / Kartika Wulan Sari
865Pengaruh kinerja keuangan terhadap jumlah penyaluran pembiayaan BMT Sidogiri periode 2010 / Fatichatur Rachmaniyah
866Pengaruh total aset turnover, debt to asset ratio, dan working capital turnover rentabilitas ekonomi pada koperasi karyawan periode 2008-2010 di kota Malang / Gita Kinanti Rahmawati
867Analisis perbandingan efisiensi kinerja bank konvensional dan bank syariah dengan metode Data Envelopment Analysis (DEA) tahun 2012-2014 / Irmaniar Astuti Ansori
868Pengaruh kupon obligasi, dan Yield Obligasi terhadap harga obligasi pemerintah seri fixed rate (FR) periode 2005-2007 / Eirene Mardika Ekawati
869Pengaruh manajemen saluran distribusi terhadap loyalitas ritel PT. Lukindari Permata Malang (studi pada ritel ice cream Wall's wilayah Kota Malang) / Brahmantya Agusta
870Pengaruh store image (Citra Toko) terhadap keputusan pembelian (Studi pada konsumen apotek Kimia Farma 36 Malang) / M. Ismail Marzuqi
871Diversifikasi internasional: integrasi pasar modal Indonesia dengan pasar modal Asia Tenggara (ASEAN) / Hardianto Wibowo
872Pengaruh economic value added (EVA) dan arus kas operasi terhadap return saham pada perusahaan manufaktur yang listing di BEI pada tahun 2004-2007 / Sandy Setiawan
873Pengaruh lingkungan kerja fisik dan motivasi kerja terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan PT. Anugerah Abadi Cahaya Sejati Surabaya) / Riza Diansyah
874Pengaruh struktur kepemilikan saham terhadap biaya keagenan pada perusahaan manufaktur yang listing di bursa efek Jakarta / Tety Prestiani
875Pengaruh kualitas layanan terhadap loyalitas peserta didik (studi pada peserta didik kursus bahasa Inggris di LBPP LIA Malang) / Oky Adi Nugraha
876Pengaruh perubahan arus kas terhadap tingkat likuiditas dan rentabilitas pada perusahaan food and beverages yang listing di Bursa Efek Jakarta / Ananda Pratama Setyawan
877Pengaruh iklan media TV terhadap keputusan pembelian konsumen dalam membeli sepeda motor Yamaha Mio (studi pada komunitas Mio Fans Club Malang) / Lucky Septia Nurhadi
878Pengaruh kepemimpinan transformasional terhadap komitmen organisasional melalui kepuasan kerja (studi pada karyawan pabrik gula Djombang Baru) / Novita Layyina Wardah
879Perbedaan stress kerja dan kepuasan kerja antar karyawan laki-laki dan perempuan di PT. Bank Rakyat Indonesia (Persero), TBK.Kantor Cabang Martadinata Malang / Risky Aditya Firdaus
880Pengaruh Promosi dan persepsi harga terhadap citra merek (studi pada penonton Band Last Child) / Rully Prayogi
881Pengaruh diferensiasi produk terhadap loyalitas konsumen (studi pada pengguna produk obat batuk Komix di Desa Kaligambir Kecamatan Panggungrejo Kabupaten Blitar) / Dwi Wahyuni
882Studi evaluasi dan kelayakan investasi jasa konstruksi untuk pengembangan PT Nusa Indah Surya Teknik, Tegal Jawa Tengah / Dikrilia A. Rizki EA.
883Pengaruh EVA (Economic Value Added), MVA (Market Value Added) dan ROI (Return on Investment) terhadap harga saham pada perusahaan manufaktur yang listing di BEI periode 2005-2007 / Vina Afriana Fauzia
884Pengaruh kualitas layanan dan komunikasi terhadap kepuasan nasabah tahapan (studi pada pelanggan PT. Bank Central Asia, Tbk Cabang Dinoyo Malang) / Prisma Budiarto
885Pengaruh citra toko terhadap loyalitas konsumen hypermart, Malang Town Square / Senjaning Festiyanti
886Kualitas pelayanan prima (service excellence) dan pengaruhnya terhadap kepuasan konsumen (studi kasus pada konsumen distribution outlet realizm Jl. Wilis 25 Malang) / M. Fariduddin Amin
887Leasing dan Pengaruhnya Terhadap Return on Investmen (Studi pada Perusahaan Transportasi yang Terdaftar di Bursa Efek Jakarta Tahun 1998-2002) oleh Ni Wayan Sri Ambarawati
888Pengaruh faktor pribadi terhadap keputusan penggunaan layanan internet Telkom Speedy (studi pada peserta program Broadband Learning Center (BLC) di PT. Telkom Kandatel Tulungagung) / Elvanto Widya Santosa
889Pengaruh faktor psikologis terhadap proses pengambilan keputusan konsumen dalam melakukan pembelian sepeda motor Yamaha Mio (studi pada mahasiswa Fakultas Ekonomi Universita Negeri Malang) / Hafid Irmansyah
890Suksesi bisnis keluarga pada usaha penyalur baby sitter CV. Siti Ari / Rayie Tariaranie Wiraguna
891Pelaksanaan strategi diversifikasi konsentris pada PT. Pos Logistik Indonesia dan fungsi saluran distriobusi pada Pt. Pos Indonesia Cabang Kantor Pos Besar Surabaya / Anggraini Kumaladari
892Pengaruh capital expenditure, return on equity terhadap harga saham pada perusahaan batubara yang listing di Bursa Efek Indonesia periode 2008-2012 / Matius Harda Gumelar
893Pengaruh atmosfer toko terhadap pengambilan keputusan konsumen untuk berbelanja di Plaza Araya Malang / Yuki Patriasari
894Pengaruh ekuitas merek terhadap keputusan pembelian Indomie goreng (Studi pada mahasiswa reguler Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Rinta Niary
895Analisis faktor-faktor pembentuk citra merek Adidas (studi pada follower twitter @3foil_id_MLG komunitas pecinta produk Adidas di Malang Raya / Andy Taruna Putra
896Pengaruh brand equity terhadap proses pengambilan keputusan (Studi pada siswa kursus mengemudi "Natuna" Malang) / Andy Hakim Permadi
897Perbedaan return, abnormal return dan trading volume activity saham sebelum dan sesudah stock split pada perusahaan yang listing di BEI (Bursa Efek Indonesia) periode 2004-2007 / Dian Nurfebriani
898Pengaruh relationship marketing terhadap loyalitas nasabah tabungan BRI Simpedes (Studi pada nasabah BRI pengguna tabungan Simpedes di PT Bank Rakyat Indonesia (Persero) Tbk. cabang Malang Mardinata) / Yeni Adiningrum
899Analisis pengaruh suku bunga Bank Indonesia (BI rate) terhadap obligasi negara RI melalui trading volume (studi pada obligasi negara RI seri Fixed Rate (FR) yang listing di BEI periode 2009) / Suhartatik
900Pengaruh kualitas layanan terhadap kepuasan pelanggan pada Perusahaan Daerah Air Minum (PDAM) Kecamatan Trenggalek / Chandra Setyoningrum
901Pengaruh faktor sosial dan faktor psikologi terhadap proses keputusan pembelian laptop Toshiba (Studi pada mahasiswa penghuni kost di Kelurahan Subersari Kecamatan Lowokwaru Kota Malang) / Muh Zuhdi Kurniawan
902Pengaruh kualitas pelayanan terhadap loyalitas pelanggan pada Bravo Supermarket (studi pada pemegang member card Bravo di Bojonegoro) / Achmad Fauzi Juniar Primadana
903Pengaruh eksposur nilai tukar, inflasi, dan suku bunga terhadap profitabilitas (Studi kasus pada Perusahaan Perbankan yang terdaftar di Bursa Efek Indonesia) / Jose Dwijaksono
904Pengaruh budaya organisasi terhadap kinerja karyawan (Studi kasus di PT Telekomunikasi Indonesia Tbk Area Malang) / Deas Muhammad
905Pengaruh ekuitas merek (Brand Equity) terhadap keputusan pembelian konsumen pada pelembab olay (Study pada konsumen Swalayan Batu Gajah Mada Malang) / Agus Yulianto
906Pengaruh kepuasan kerja terhadap semangat kerja karyawan (Studi pada PT. Agar Sehat Makmur Lestari (ASML) Pasuruan) / Dini Hayyu Rahmawati
907Implementasi hasil pelatihan karyawan dengan metode on the job training untuk meningkatkan profesionalisme guide rafting (studi pada CV. Mata Air Sejahtera) / Muhammad Khairil Akbar
908Pengaruh kualitas layanan terhadap keputusan pembelian di rumah makan ayam bakar wong solo cabang Malang / Arisatul Silfiyah
909Pengaruh kompensasi finansial dan kompensasi non finansial terhadap kinerja melalui kepuasan kerja karyawan PT PLN (Persero) Distribusi Jawa Timur Area Malang / Pradhisa Adhisty
910Analisis pengaruh persepsi konsumen tentang experiental marketing terhadap customer loyalty smartphone Samsung (studi pada mahasiswa Prodi S1 Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2014) / Olsin anjani Asih
911Pengaruh persepsi brand image (citra merek) terhadap keterlibatan konsumen dalam proses keputusan pembelian tas merek Eiger (studi kasus pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Muh. Fakhrudin Alkhalwani
912Pengaruh Return On Equety (ROE) terhadap harga saham melalui Price Earing Ratio (PER) pada perusahaan ritel yang listing di BEI tahun 2012-2016 / Uswatun Hasanah
913Pengaruh atribut produk terhadap keputusan pembelian laptop Acer (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Sigit Saputro
914Pengaruh atribut produk terhadap proses pengambilan keputusan pembelian air minum dalam kemasan merek Cleo (studi pada mahasiswa strata satu Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2014) / Febby Candra Pratama
915Pengaruh kualitas pelayanan terhadap loyalitas pelkanggan melalui kepuasan pelanggan (studi pada Resto Sate Ayam Pak Siboen Kediri) / Indra Priyanto
916Pengaruh bauran promosi (Periklanan, penjualan personal, promosi penjualan, dan hubungan masyarakat) terhadap keputusan pembelian sepeda motor yamaha Nio melalui faktor psikologis (Motivasi, persepsi, dan sikap konsumen) (Studi mahasiswa Fakultas Ekonomi Universitas Neg
917Pengaruh atribut produk terhadap proses keputusan pembelian handphone Sony Ericsson (studi pada mahasiswa Jurusan Psikologi Fakultas Ilmu Pendidikan Universitas Negeri Malang) / Gatra Tri Bangga Yudha
918Faktor-faktor yang mempengaruhi kepuasan kerja perawat pada Rumah Sakit Islam Malang "Unisma" / Yuni Purwah Yuningsih
919Pengaruh budaya organisasi terhadap kinerja karyawan melalui kepuasan kerja (studi pada PT. Telekomunikasi Indonesia, Tbk. Witel Jatim Selatan, Cabang Malang) / Enik Endahwati
920Pengaruh budaya organisasi terhadap komitmen organisasi melalui kepuasan kerja pada karyawan PDAM Tirta Dharma Kota Malang / Halla Choirunnisa
921Pengaruh bauran promosi terhadap keputusan pembelian konsumen pada produk AHA (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Fandi Hidayat
922Implementasi model pembelajaran problem based learning untuk meningkatkan kemampuan pemecahan masalah dan kepercayaan diri siswa (studi pada siswa SMP Muhammadiyah 4 Malang kelas IX) / Jesy Diah Rokhmawati
923Peran pimpinan dan kepatuhan karyawan terhadap penerapan Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3) untuk mendukung tercapainya zero accident (studi pada Divisi Incinerator dan Divisi Laundry RSUD Dr. Soegiri Lamongan) / Mukhammad Mizan Zulmi)
924Pengaruh kurs rupiah, inflasi, dan suku bunga SBI terhadap indeks hrga saham LQ45 yang listing di BEI periode 2007-2009 / Jeva Ferial Sandi
925Pengaruh iklan televisi dan layanan purna jual terhadap keputusan konsumen dalam membeli motor Yamaha (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Hendra Karuniawan
926Pengaruh rasio leverage, rasio likuiditas, rasio profitabilitas dan retained earning terhadap devidend payout ratio pada perusahaan manufaktur yang listing di Bursa Efek Jakarta (BEJ) tahun 2003-2005 / Lilik Retnowati
927Pengaruh inflasi dan tingkat suku bunga Bank Indonesia terhadap harga obligasi syariah yang listing di BEI pada tahun 2008-2009 / Wenda Meles Tri Nilasari
928Pengaruh kompensasi finansial dan lingkungan kerja fisik terhadap kinerja karyawan (studi pada karyawan PT PLN Persero Malang) / Selvy Juniawati
929Pengaruh konflik peran dan ambiguitas peran terhadap kepuasan kerja dan komitmen organisasi melalui keletihan (burnout) pada tenaga perawat rumah sakit Lavalette Malang / Kurniawan Tri Cahyono
930Analisis buzz marketing pada wisata Kampung Coklat Desa Plosorejo Kecamatan Kademangan Kabupaten Blitar / Eliyana Hanit Robati
931Pengaruh iklim organisasi terhadap turnover intention melalui stres kerja dan kepuasan kerja (studi pada karyawan bagian produksi PT. Dadi Mulyo Sejati Ngawi) / Bobi Prasetyo Adi
932Pengaruh kinerja keuangan perbankan berdasarkan model Camels dan Eagles terhadap saham (studi kasus pada perusahaan perbankan yang listing di BEI periode 2007-2009) / Arif Yudhistira Raj Suweda
933Pengaruh bauran promosi terhadap proses keputusan pembelian telepon seluler nokia (Studi pada konsumen di fakultas ekonomi program studi S-1 manajemen angkatan tahun 2011) / Endarto Dedy Atmanu
934Penerapan analisa strategi pemasaran (Studi pada Perusahaan Shafira Cake & Bakery Malang) / Soffi Andri Ana
935Pengaruh manajemen mutu terhadap volume penjualan pada PT. Leo Food Industry Malang oleh Nanik Susilawati
936Analisis kebutuhan pelatihan untuk meningkatkan kompetensi karyawan di PDAM Kota Malang / Rahmansyah Dwi Tafenda
937Pengaruh Debt to Equity Ratio (DER) dan insider ownership terhadap nilai perusahaan melalui Dividend Payout Ratio (DPR) (studi pada perusahaan manufaktur yang listing di BEI periode tahun 2012-2014) / Risdiani Ekaning Handari
938Persepsi konsumen tentang bauran pemasaran dalam keputusan pembelian (studi pada pembeli rumah di Perumahan Demangan Regency Lamongan) / Yohana
939Sumber modal dan pengelolaan modal kerja pada pengrajin batik gedog di Desa Karang Kecamatan Semanding Kabupaten Tuban / Ela Dwi Mayaningtyas
940Pengaruh citra merek dan layana purna jual terhadap keputusan pembelian sepeda motor Honda (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Bima Sinatrya Putra
941Pengaruh faktor psikologis terhadap putusan penggunaan jasa modifikasi sepeda motor (studi pada konsumen bengkel Java Speed Malang) /Bill Edward B
942Pengaruh penempatan dan pelatihan terhadap kinerja karyawan PT. PLN (Persero) Distribusi Jawa Timur Area Malang / Aning Drastari
943Analisis kinerja keuangan pada unit simpan pinjam KPRI Dhaya Harta Jombang periode 2005-2011 / Rizky Fitrianto Abdillah
944Studi perbedaan tentang kinerja keuangan pada perusahaan manufaktur yang listing di BEI sebelum dan pada saat krisis global / Dendy Surya Permana
945Pengaruh faktor pribadi terhadap keputusan nasabah PT. Asuransi Raksa Pratikara dalam memilih perusahaan asuransi (studi pada kantor pemasaran PT. Asuransi Raksa Pratikara Malang) / Helmy Syarif Hendriyanto
946Pengaruh ROE dan DER terhadap nilai perusahaan melalui kebijakan deviden pada perusahaan otomotif dan komponen yang terdaftar di BEI tahun 2010-2014 / Siti Hajar Sasmita
947Analisis kesesuaian antara metode motivasi dengan motivasi kerja salesman Auto 2000 Probolinggo dengan menggunakan teori Herzberg / Ulfa Hidayati
948Pengaruh Bid-Ask spread dan trading volume activity terhadap abnormal return pada Bank Konvensional yang listing di BEI tahun 2009 / Sukma Waedhana Wahyuning Widi
949Pengaruh atribut produk pasta gigi Pepsodent terhadap keputusan pembelian konsumen (studi pada mahasiswa jurusan Manajemen Non Reguler Fakultas Ekonomi Universitas Negeri Malang angkatan tahun 2006) / Dian Puspita Sari
950Pengaruh bauran pemasaran terhadap proses keputusan pembelian konsumen pada distro Bandung Sport Blitar / Dian Firma Wijayanti
951Persepsi karyawan pada lingkungan kerja dan pengaruhnya terhadap kepuasan kerja karyawan (studi pada rumah sakit pelengkap Medical Center Jombang) / Neri Setyawan
952Analisis dimensi kualitas jasa pada PT. Bank Tabungan Negara (Persero) cabang Malang / Rahmad Sugianto
953Studi komparatif kinerja keuangan bank konvensional dan bank syariah yang listing di BEI tahun 2003-2006 / Moch. Wahyu Widodo
954Pengaruh komunikasi organisasi terhadap kepuasan kerja karyawan (studi pada karyawan Dinas Pendsapatan, Pengelolaan Keuangan dan Asset Kabupaten Malang) / Anisa Adiastuti
955Analisis efektifitas pelaksanaan Diklat Kepemimpinan Tingkat IV Pola Kemitraan Provinsi Jawa Timur di Badan Penelitian Pengembangan dan Diklat Kabupaten Pasuruan / Dewi Sriwahyuni
956Pengelolaan modal kerja pada pengrajin mebel di Desa Sukorejo Bojonegoro / Hesty Hertikawati
957Pengaruh struktur modal dan struktur kepemilikan terhadap nilai perusahaan melalui return on equity (studi pada perusahaan real estate & property yang listing di BEI periode 2013-2014) / Sri Rahayu
958Pengaruh Current Ratio (CR), Debt to Equity Ratio (DER) dan Working Capital Turnover (WCT) terhadap profitabilitas pada perusahaan sub sektor perkebunan yang terdaftar dio BEI tahun 2010-2014 / Retno Nur Iftita
959Pengaruh profitabilitas dan operating leverage terhadap nilai perusahaan melalui struktur modal pada perusahaan otomotif dan komponen yang listing di BEI periode 2012-2014 / Dipa Wahyu Ashar Pratama
960Pengaruh corporate social responsibility terhadap nilai perusahaan melalui profitabilitas pada perusahaan property dan real estate yang listing di BEI periode 2013-2014 / Aulia Alfia Rohma
961Pengaruh kecerdasan emosional terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan PT. Petrokimia Gresik) / Anisa Yunike Triananda
962Analisis bauran pemasaran dalam meningkatkan volume penjualan pada New York Bakery / Nabila Wahyu Kusuma
963Pengaruh atmosfer toko terhadap keputusan konsumen untuk membeli produk di For You All Distro Jalan Veteran 25 Malang / Reska Mega Sari
964Pengaruh kualitas pelayanan terhadap kepuasan konsumen (Studi pada rumah sakit ibu dan anak Puri Bunda Malang) / Shinta Dhestyana
965Pengaruh struktur modal terhadap return saham melalui earning per share (EPS) pada perusahaan LQ 45 periode 2007-2008 / Immanuel Setiawan Siregar
966Pengaruh Capital Adequacy Ratio (CAR), Loan to Deposit Ratio (LDR), dan Net Interst Margin (NIM) terhadap Return On Asset (ROA) pada Bank Umum Swasta Nasional yang listing di BEI tahun 2011-2014 / Maharani Galuh Pratiwi
967Pengaruh pengembangan karir dan motivasi kerja terhadap kinerja karyawan (studi pada PT. Bank Rakyat Indonesia, Tbk Cabang Martadinata Malang) / Susilowati
968Analisis tingkat kepatuhan personal dalam mendukung pencapaian zero accident pada kesehatan dan keselamatan kerja (K3) (Studi pada PT. Molindo Inti Gas, Malang) / Firda Rizki Amalia
969Pengaruh dimensi kualitas jasa terhadap keputusan konsumen dalam memilih travel (Studi pada Kirana Tour & Travel Malang) / Eko Zudhi Kurniawan
970Pengaruh atribut produk terhadap keputusan pembelian produk handphone Nokia (studi pada siswa pengguna handphone Nokia di SMAN 1 Grati Pasuruan) / Darma Harfiansyah
971Pengaruh atmosfer toko dan kualitas layanan terhadap loyalitas konsumen melalui kepuasan konsumen (studi pada J.CO Donuts and Coffe Malang) / Muhammad Fadil
972Pengaruh Debt to Equity Ratio (DER) dan Debt to Asset Ratio (DAR) terhadap ROE melalui transaksi anggota Koperasi Pegawai Republik Indonesia (KPRI) Kota Malang Tahun 2013-2014 / Shinda Andriyanti
973Pengaruh store atmosphere (suasana toko) terhadap minat beli Konsumen (studi pada pelanggan Kopi Racer Pasuruan) / Akhmad Erwinsyah
974Pengaruh iklan televisi terhadap Brand Image produk Top Coffee (Studi di Kecamatan Kedungwaru Kabupaten Tulungagung)
975Pengaruh marketing public relations terhadap minat pembelian sepeda motor merek Honda (studi pada PT. Mitra Pinasthika Mustika (MPM) Motor Malang) / Abdi Manaf Al Idrus
976Pengaruh periklanan sebagai bentuk komunikasi pemasaran terhadap perilaku konsumen dalam membeli mie sedaap (studi kasus pada masyarakat Kelurahan Bukir Kecamatan Gadingrejo Kota Pasuruan) / Mokhamad Maulidyin
977Pengaruh stres kerja terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan bagian marketing PT. Bank Rakyat Indonesia Kantor Cabang dan Kantor Cabang Pembantu Martadinata Malang) / Gusti Agung Widya Ksamawati
978Analisis kebijakan hutang, profitabilitas, dan pertumbuhan perusahaan terhadap kebijakan dividen pada perusahaan manufaktur yang listing di Bursa Efek Indonesia (BEI) tahun 2005-2008 / Ayu Yenia Sari
979Pengaruh kesesuaian penempatan karyawan terhadap prestasi kerja karyawan PT. Telkom Indonesia Witel Jatim Selatan (Malang) / Lailatul Badriyah
980Pengaruh disiplin kerja terhadap produktivitas kerja karyawan (studi pada CV Indonesia Jersey Malang) / Ferdianta Hendrawan
981Pengaruh program keselamatan dan kesehatan kerja (K3) terhadap produktivitas kerja (studi pada karyawan bagian produksi PT. Perkebunan Nusantara X (Persero) Pabrik Gula Gempolkerep Mojokerto) / Alifiyaumi
982Pengaruh kualitas produk terhadap kepuasan konsumen (Studi pada mahasiswa pengguna modem smrtfren Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2011/2012) / Bayu Jaya Puspita
983Pengaruh kesempatan investasi (IOS) terhadap kebijakaan dividen dan pendanaan perusahaan manufaktur yang listing di BEI periode 2007-2009 / Elfa Septi Hanani
984Pengaruh persepsi pelanggan tentang in-store promotion terhadap motivasi impulse buying (studi pada pelanggan Belga Mart Tulungagung / Muhammad Muis Khudori
985Pengaruh kepribadian terhadap motivasi kerja melalui komitmen karyawan bagian transportasi di PT. Kingstone Malang / Sulestiawan
986Pengaruh CAR (Capital Adequacy Ratio), NPL (Non (Performing Loan) dan GWM (Giro Wajib Minimum) terhadap profitabilitas bank umum konvensional yang listing di BEI tahun 2013-2014 / Yusrin Yutika
987Pengaruh motivasi kerja dan pelatihan kerja terhadap kinerja melalui kepuasan kerja karyawan (studi pada karyawan PT. BRI Tbk. Kantor Cabang Blitar) / Sri Wahyuni
988Persepsi nasabah tentang relationship marketing dan pengaruhnya terhadap lovalitas / Sulhida Silmi
989Pengaruh atribut produk dan iklan televisi terhadap keputusan konsumen dalam membeli sabun lux (Studi pada Mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Citra Niada Elisa
990Pengaruh faktor psikologis terhadap keterlibatan proses keputusan pembelian laptop merek Toshiba (Studi pada penggunan fasilitas Hostpot Cafe Tutu Demas Malang) / Dini Nur Zakiyah
991Pengaruh budaya organisasi terhadap komitmen organisasi (studi pada karyawan bagian HRD PT. Bakrie Pipe Industries Bekasi) / Dwinda Kartika Hertianti
992Pengaruh promosi online terhadap keputusan pembelian produk Strudle di Kota Malang (studi pada konsumen Malang Strudle Jl. Ardimulyo No. 14 Singosari Kab. Malang) / Richa Rodhiyah
993Pengaruh kualitas layanan terhadap loyalitas melalui kepuasan pelanggan Studi pada nasabah PT Pegadaian (Persero) Cabang Tlogomas Malang) / Pradipta Caesar Anoraga
994Pengaruh konflik peran terhadap niat untuk keluar melalui stres kerja (Studi pada PT. Sasa Inti Probolinggo) / Mochamad Rizal
995Perbedaan kinerja keuangan perbankan menggunakan metode Eagles antara bank swasta nasional dan bank pemerintah periode 2007-2009 / Dwi Erawati
996Pengaruh kualitas layanan terhadap kepuasan nasabah bank BRI Syarih Cabang Malang / Rizta Ferina Damasty
997Pengaruh Electronic Word of Mouth (e-WOM) dan harga terhadap minat beli produk pakaian pada Tokopedia (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Shinta Ayu Dewayanti
998Pengaruh motivasi kerja terhadap kinerja karyawan melalui kepuasan kerja (studi pada karyawan Pabrik Gula Kebon Agung Malang) / Imroatul Khamidah
999Pengaruh atribut produk dan persepsi harga terhadap keputusan pembelian (studi pada konsumen Ramayana Dept Store Malang) / Raihan Wishal Nafis
1000Pengaruh kualitas pelayanan dan kepercayaan terhadap loyalitas pelanggan (studi pada Cafe Bingsoo Malang) / Ela Nofika
1001Pengaruh kepuasan kerja dan keterlibatan kerja terhadap organizational citizenship behavior karyawan PT. Telekomunikasi Indonesia, Tbk. Witel Jatim Selatan Malang / Yollanda Swagaretha Kayonatan
1002Pengaruh karakteristik bank dan kondisi makroekonomi terhadap profitabilitas pada bank umum yang go public di Bursa Efek Indonesia 2005-2008 / Dian Riestiawati
1003Pengaruh resiko sistematis terhadap tingkat pengembalian saham dan kaitannya dengan analisis Capm pada dalam kondisi bullish dan bearish pada perusahaan LQ-45 (Periode 1 Jan-31 Des 2008) / Ade Fahlevy
1004Pengaruh citra merek terhadap proses keputusan pembelian melalui faktor psikologis konsumen (pengguna smartphone Samsung di PTN Kota Malang) / Joefri Mulyana
1005Analisis manajemen kas dan manajemen piutang pada Koperasi Wanita Karya Mandiri di Kabupaten Gresik periode tahun 2011-2013 / Dani Al Faruq
1006Pengaruh retail mix terhadap keputusan pembelian konsumen di planet biru Blitar / Ahmad Rijal Azza
1007Pengaruh pengalaman kerja dan hasil pelatihan terhadap kinerja karyawan Kanwiul Direktorat Jenderal Pajak Jatim III Kota Malang / Muhammad Taufiq Fajar
1008Pengaruh kemasan sikat gigi yang menggunakan tutup (helm) terhadap keputusan pembelian konsumen (studi pada anggota KSR PMI Universitas Negeri Malang) / oleh Dian Eka Prasastianta
1009Pengaruh on the job training dan off the job training terhadap peningkatan kinerja pegawai pada pemerintah Kota Blitar (studi pada Badan Kepegawaian Daerah Kota Blitar) / Ratih Rahayu
1010Pengaruh persepsi atmosfer toko terhadap kepuasan pelanggan (studi pada member card Matahari Cabang Malang Matos) / Ony Verdianto
1011Pengaruh ketidakpuasan terhadap perpindahan merek pada smartphone Blackberry (studi pada mahasiswa Jurusan Manajemen angkatan 2015 Fakultas Ekonomi Universitas Negeri Malang) / Mochtar Asyrofi
1012Pengaruh stres kerja terhadap kinerja melalui motivasi kerja (studi pada karyawan Pabrik Gula Pesantren Baru Kediri) / Andriansyah Tristia Adi Pradana
1013Pengaruh budaya organisasi dan motivasi terhadap kinerja karyawan melalui kepuasan kerja (Studi pada karyawan non-medik Rumah Sakit Islam Unisma Malang) / Yani Adi Handaya
1014Pengaruh current ratio, total assets turnover, total debt to equity ratio dan debt to assets ratio terhadap rentabilitas koperasi karyawan di Kota Kediri tahun 2008-2011 / Reni
1015Pengaruh perputaran kas, perputaran piutang, dan perputaran persediaan terhadap rentabilitas ekonomi koperasi (studi pada KPRI Kota Malang periode 2009-2010) / Caesarian Dwi Rahardian
1016Ketaatan dan komitmen sumber daya manusia sekolah terhadap penerapan sistem manajemen mutu ISO 9001:2008 di SMA Negeri 1 Malang / Aditya Ramadhaniar
1017Pengaruh stres kerja terhadap turnover intention karyawan melalui kepuasan kerja (studi pada AJB Bumiputera Malang) / Ach. Faris As Syauqi
1018Peran Serikat Pekerja dalam membangun hubungan industrial (Studi kasus pada Serikat Pkerja Seluruh Indonesia (SPSI) unit kerja PT. Ekamas Fortuna Malang) / Hendrik Eko Aprilianto
1019Pengaruh sore atmosphere terhadap interest buying konsumsi pada Cafe Cheesebury Kopitiam Malang / Sony Dhiyo Mochammad Nur Affin
1020Pengaruh kualitas produk dan media iklan televisi terhadap keputusan membeli (Studi pada pengguna dan pemilik sepeda motor Honda di Desa Rejoso, Kec. Binangun Kab. Blitar) / Diana Nofitasari
1021Pengaruh tayangan iklan Aqua di televisi terhadap citra merek (Studi pada mahasiswa kelas penjualan Fakultas Ekonomi Universitas Negeri Malang) / Robbah Fatawi
1022Leader-member exchange sebagai moderator pengaruh beban kerja dan konflik peran terhadap stres kerja (studi kasus pada karyawan AJB Bumiputera Kantor Cabang Malang) / Lerenop Sulaksono
1023Pengaruh pelatihan terhadap peningkatan kinerja karyawan (studi pada karyawan Hotel Klub Bunga Butik Resort Batu) / Yonathan Candra Wirana
1024Pengaruh budaya organisasi terhadap kinerja karyawan melalui kepuasan kerja (studi pada PT Taspen Persero Kantor Cabang Mataram) / Riza Nur Imam Febrianto
1025Pengaruh kepribadian, kualitas kehidupan kerja, dan komitmen organisasi terhadap Organizational Citizenship Behavior (OCB) (studi pada perawat Rumah Sakit Islam Gondanglegi) / Lita Nursanti
1026Pengaruh kualitas layanan terhadap loyalitas melalui kepuasan pelanggan pada Richdjoe Barbershop Malang / Yongky Edo Saputra
1027Pengaruh relationship marketing terhadap loyalitas pelanggan (studi pada pengguna media iklan stasiun penyiaran RRI Kota Malang) / Mohammad Haris Udin
1028Pengaruh kualitas layanan terhadap kepuasan konsumen pada PT. Prima Dollar Lestari Jember / Verda Novriyan Aldi
1029Rekasi Kinerja Saham PT. Indosat Terhadap Penjualan Aset Pemerintah Pada Pihak Asing (Even Study atas Divestasi Saham PT. Indosat, Tbk.) Oleh Adam Romadhon
1030Analisis proses rekrutmen dan seleksi karyawan Agent Call Centre di PT. Infomedia Solusi Humanika (ISH) Cabang Malang / Ozy Adham Syah
1031Pengaruh Return On Asset (ROA), Return On Equity (ROE), dn Equity to Asset Rati (EAR) terhadap return saham pada perusahaan LQ45 periode 2006-2009 / Mokh. Fariz Nasrullah
1032Pengaruh promotion mix tehadap keputusan pembelian konsumen dalam berbelanja di ramyana departemen store dan supermaket malang oleh Endang Setyo Rini
1033Pengaruh kepemilikan institusional, kepemilikan manajerial dan ukuran perusahaan terhadap profitabilitas pada perusahaan manufaktur yang listing di BEI periode 2011-2015 / Anggita Riyani Putri
1034Pengaruh lingkungan toko terhadap keputusan pembelian konsumen (studi pada pembeli fashion di Bandung Sport Jl. M.T. Haryono 98 Malang) / Indah Dwi Wahyuni
1035Pengaruh tata ruang dan lingkungan kerja terhadap semangat kerja pegawai Kantor Dinas Pendapatan Daerah Kabupaten Banyuwangi / Rizki Astriani
1036Analisis kepuasan nasabah terhadap kualitas pelayanan PT. (persero) asuransi jiwasraya Malang oleh Burham Achmadi
1037Peranan kebijakantarifdalam usaha meningkatkan tingkat hunian kamar hotel pada hotel pelangi Malang oleh Dino Fajar Firdi
1038Analisis SWOT sebagai dasar perumusan strategi pemasaran (studi pada temporary boradband and digital sales Grapari Telkomsel Malang) / Fiska Mamona
1039Pengaruh tingkat suku bungan SBI, durasi, konveksitas, dan peringkat obligasi terhadap persentase perubahan hara obligasi perusahaan yang listing di Bursa Efek Indonesia periode 2010-2011 / Retno Oktafiani
1040Pengaruh kualitas layanan terhadap loyalitas pelanggan (studi pada pasien yang melakukan rawat inap di RSIA Aminah Kota Blitar) / Rizka Naini
1041Pelaksaaan service recovery (Pemuliahan Jasa) untuk meningkatkan kepuasan pelanggan speedy PT. Telkom Malang / Harum Sari Rachma Wati
1042Analisis dimensi kualitas layanan (studi pada konsumen AHASS UD.Sutomo Tulungagung / Widyartha Teja Sukmana
1043Penggunaan metode balanced scorecard untuk mengukur kinerja perusahaan: studi kasus pada PT. Co-cola amatil Indonesia Surabaya periode 2001-2003 oleh Dhamayanti Liger
1044Manajemen portofolio reksadana syariah di pasar modal Indonesa oleh Fitria Setyaningsih
1045Analisis faktor-faktor yang mempengaruhi pengambilan keputusan nasabah bermitra dengan Bank Syariah (Studi pada nasabah Bank Syariah di Malang) / Zainul Abidin
1046Pengaruh budaya organisasi terhadap kinerja karyawan (studi pada PT. Anindo Bertahannuts Perkasa Malang) / Nurul Inayah
1047Pengaruh brand image terhadap keputusan pembelian sepatu Converse (studi pada mahasiswa Jurusan Manajemen Universitas Negeri Malang) / Hendraris Abri Prasetyo
1048Pengaruh persepsi atribut produk terhadap keputusan pembelian rokok merek Gudang Garam Surya Profesional Mild (studi pada mahasiswa Jurusan Manajemen angkatan 2011/2012 Fakultas Ekonomi Universitas Negeri Malang) / Mochammad Ikhwanuddin
1049Pengaruh roa dan epsterhadap harga saham perdana dan initial return pada perusahaan non-keuangan yanp IPO periode 2007-2009 / Senja Andika Sari
1050Pengaruh financial leverage dan likuiditas terhadap dividend payout ratio melalui profitabilitas pada perusahaan non jasa keuangan yang listing di BEJ tahun 2005 / Andry Putera Ginting
1051Pengaruh citra merek terhadap kepercayaan (studi pada konsumen lembaga bimbingan belajar Primagama cabang Tulungagung) / Nadia Kusuma Wardhana
1052Pengaruh komunikasi organisasi terhadap kepuasan kerja (studi pada karyawan Jawa Pos Radar Malang) / Tomy Riyanto
1053Pengaruh keadilan distributif dan keadilan prosedural terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan bagian ekspedisi PT. Pos Indonesia (Persero) Malang) / Surya Naharman
1054Pengaruh customer delight terhadap active dan passive loyalty (studi kasus pada konsumen EF English First Malang) / Adityo Gunawan
1055Pengaruh nilai tukar rupaih terhadap return saham perusahaan semen yang go public di Bursa Efek Jakarta/ Anis Ikmahani
1056Faktor-faktor yang dipertimbangkan muzakki dalam menyalurkan zakat melalui Yayasan Amal Sosial Ash Shohwah Malang / Windi Wiradani
1057Pengaruh persepsi konsumen tentang produk dan motivasi konsumen terhadap keinginan membeli ulang Handphone Blackberry / Khrisna Satriadaya
1058Pengaruh debt to equity ratio (DER) dan return on equity (ROE) terhadap harga saham melalui earning per share (EPS) pada perusahaan LQ 45 yang listing di BEi tahun 2009 / Moh. Faried Muis
1059Pengaruh persepsi kesadaran merek, asosiasi merek, kesan kualitas terhadap loyalitas merek pengguna handphone Blackberry (studi pada mahasiswa Fakultas Ekonomi Jurusan Manajemen Universitas Negeri Malang) / Hyang Widhi Wisnu Wardhana
1060Pengaruh atribut produk terhadap keputusan pembelian kaos Arema E-Poel pada Aremania Korwil Koclok Ilakes di Betek, Kota Malang / Wahyu Adi Nugroho
1061Analisis reaksi pengumuman dividen terhadap harga saham, abnormal return, trading volume activity, cummulative abnormal return, dan security return variability (studi pada perusahaan yang listing di Bursa Efek Jakarta tahun 2005) / Ririh Mundisari
1062Pengaruh relationship marketing terhadap citra perusahaan (studi kasus pada PT Telkom Kantor Daerah Telekomunikasi Malang) / Sri Muria Diatri
1063Penambahan methyl tertiary buthyl ether (MTBE) sebagai octane booster untuk menurunkan emisi gas karbon monoksida / Yohanes Anggoro Hadi Sampurno
1064Pengaruh dividend payout, leverage, earning variability dan accounting beta terhadap risiko sistematis (β) saham-saham perusahaan yang tergabung dalam LQ-45 (periode 2004-2006) / Tria Astiana
1065Kinerja efisiensi bank syariah sebelum dan sesudah krisis global dengan pendekatan data envelopment analysis (Dea) /Iis Sugianto
1066Pengaruh kepemilikan manajerial, kepemilikan institusional, kebijakan dividen, ukuran perusahaan, struktur aktiva, dan profitabilitas terhadap kebijakan hutang perusahaan (studi pada perusahaan manufaktur yang listing di Bursa Efek Jakarta pada tahun 2004
1067Pengaruh media periklanan terhadap proses keputusan konsumen (mahasiswa) kuliah di Wearness Education Centre Malang / Dewi Rengganis
1068Pengaruh leader-member exchange dan keadilan distributif terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan giling PT. Cakra Guna Cipta Malang) / Dwi Maullidiyawati
1069Pengaruh motivational factors terhadap kepuasan kerja karyawan (studi pada karyawan PT. Pos Indonesia (Persero) Malang) / Enggal Putranto Wibowo
1070Penerapan manajemen karir dalam rangka peningkatan komitmen karir karyawan PT. PLN (Persero) Tbk. Distribusi Jawa Timur APP Malang / Mei Dewi Yuliyana
1071Pengaruh DCMR, ICMR, acquring cost, overhead cost, dan NPF terhadap pendapatan margin murabahah pada Bank Syariah di Indonesia tahun 2012 / Akhmad Faris Jazuli
1072Perbandingan kinerja portofolio saham-saham dengan metode Sharpe, Treynor dan Jensen pada perusahaan LQ-45 tahun 2009-2011 / Hanif Satya Wicaksono
1073Pengaruh motivasi dan kepuasan kerja terhadap kinerja guru sekolah dasar negeri Kecamatan Kalipare Kabupaten Malang / Titik Mujiwardani
1074Pengaruh pertumbuhan penjualan, struktur aktiva, stabilitas earning, dan profitabilitas terhadap Earning Per Share (EPS) perusahaan food and beverage yang listing di BEI tahun 2008-2011 / Widyawati Chandra Dewi
1075Pengaruruh cash ratio, total assets turnover, working capital turnover dan net profit margin terhadap perolehan Sisa Hasil Usaha (SHU) pada Koperasi Serba Usaha (KSU) di Kotaq Malang tahun 2009-2011 / Dwi Au Rhonita Ningrum
1076Faktor-faktor yang mempengaruhi EVA (Economic Value Added) sebagai alat ukur kinerja keuangan pada perusahaan farmasi yang go publik di BEJ / Tutin Nafitri
1077Pengaruh total asset turnover dan debt to equity ratio terhadap nilai perusahaan tobin's Q melalui rentabilitas ekonomi pada perusahaan pertambangan yang listing di BEI periode 2008-2011 / Irma Yulianti Ningsih
1078Pengaruh atribut produk terhadap keputusan pembelian produk Shampoo Sunsilk (Studi pada Mahasiswa Strata-I Jurusan Psikolagi angkatan 2007-2010 Universitas Negeri Malang) / Eva Kristya Anggraeni
1079Analisis kinerja keuangan pada Koperasi Unit Desa (KUD) Karangploso periode 2006-2011 / Laily Mahfudhoh Fitria
1080Pengaruh kompetensi terhadap komitmen organisasi melalui kepuasan kerja karyawan (Studi pada Hotel Pelangi Malang) / Puja Putra Trilaksana
1081Pengaruh faktor psikologi dan faktor sosial terhadap keputusan pembelian komputer di lingkungan mahasiswa (studi kasus pada mahasiswa Fakultas Ekonomi Universitas Brawijaya Malang) / Devi Wahyuddin Syaf
1082Pengaruh gaya kepemimpinan transformasional terhadap stres kerja melalui pemberdayaan karyawan (studi pada karyawan Jawa Timur Park Batu) / Rahma Dani Andri Astutik
1083Pengaruh faktor fundamental perusahaan terhadap return dan risiko sistematis pada perusahaan properti dan real estate yang listing di bursa efek Jakarta tahun 2002-2005 / Angih Sinyal Putrasiwi
1084Pengaruh kualitas pelayanan terhadap kepuasan nasabah gadai KCA (Kredit Cepat Aman) pada PT. Pegadaian (Persero) Cabang Tlogomas Malang / Ardhian Adhie Widodo
1085Analisis pengaruh harga dan pendapatan terhadap permintaan telor ayam di Kabupaten Blitar tahun 2007-2011 / Sopyan Ranu Wijaya
1086Pelaksanaan indeks kepuasan masyarakat pada Perusahaan Daerah Air Minum Kota Malang / Ari Indra Rahmawati
1087Pengaruh working capital turnover, current ratio dan debt ratio terhadap return on investment pada perusahaan food and beverage yang listing di BEI 2008-2011 / Ainul Masruroh
1088Analisa SWOT dalam penentuan strategi pemasaran (studi kasus pada minuman sari apel Esemka di SMKN 2 Batu) / Reza Susanto
1089Pengaruh Kinerja Keuangan Terhadap Harga Saham: Studi pada Perusahaan LQ 45 di Bursa Efek Jakarta Tahun 2000-2002 oleh Fefi Purbahayu
1090Pengaruh struktur aktiva, financial laverage dan struktur modal terhadap provitabilitas pada perusahaan otomotiv yang go public di bursa efek indonesia (periode pengamatan tahun 2006-2008) Aditya Hermawan
1091Pengaruh roa dan roe terhadap return saham pada perusahaan besar dan kecil di perusahaan manufaktur yang listing di BEI pada tahun 2009 / Gunawan Prasetio Adi
1092Pengaruh perilaku kerja inovatif terhadap kinerja karyawan: kontrol atasan sebagai moderator (studi pada AJB Bumiputera 1912 Area Kepanjen Malang / Imron Aris Arfan
1093Perbedaan trading volume activity dan bid-ask spread sebelum dan sesudah stock split pada perusahaan yang listing di BEI (periode stock split 2006-2009) / Dina Marisandi
1094Pengaruh kualitas jasa terhadap loyalitas pelanggan kartu pasca bayar Flexi (studi pada pengguna kartu pasca bayar Flexi di PT. Telkom Kancatel Blitar) / Ida Afianti
1095Pengaruh budaya organisasi terhadap kinerja karyawan melalui komitmen organisasi (studi pada PT. Fast Food Indonesia Tbk. (KFC) Cabang Kawi Malang) / Suparmi
1096Pengaruh konflik peran terhadap turnover intention melalui stres kerja pada karyawan PT. Adira Quantum Multifinance Malang / M. Solikin
1097Pengaruh kualitas layanan terhadap keputusan konsumen (studi pada pasien di Rumah Sakit Ibu dan Anak HST Trenggalek) / Maysa Dianika
1098Pengaruh brand image terhadap minat beli motor scuter matic Honda Vario 125 (FI) (studi kasus pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang Jurusan Manajemen angkatan 2014) / Septian Rochmatulloh
1099Kebijakan rekrutmen, seleksi, dan penempatan account officer (studi pada Bank Rakyat Indonesia Kantor Wilayah Martadinata Malang) / Dwi Agung Suwasono
1100Pengaruh konflik peran dan stres kerja terhadap kinerja karyawan (studi pada karyawan PT. Terafulk Mergantara Design Surabaya) / Danang Yohanda
1101Pengaruh in-store promotion terhadap impulse buying (studi pada Matahari Department Store Cabang Malang Town Square) / Rezadio Hardika
1102Pengaruh lingkungan toko terhadap kepuasan konsumen dalam berbelanja di Giant Supermarket, Madiun / Riski Agung Anggara
1103Analisis perbedaan return, abnormal return, trading volume activity dan security return variability sebelum dan sesudah berlakunya Permen ESDM No. 7 Tahun 2012 pada saham pertambangan / Dwi Analistono
1104Analisis bentuk komunikasi antara atasan dan bawahan dalam rangka mewujudkan efektivitas tujuan perusahaan (studi pada UD. Semangat Pasuruan) / Aegnes Dica Priscilia
1105Pengaruh profitabilitas terhadap nilai perusahaan yang dimoderasi oleh kepemilikan manajerial dan proporsi dewan komisaris independen (studi pada perusahaan sektor barang konsumsi yang listing di BEI tahun 2012-2014) / Pramesti Herwindarti
1106Pengaruh Current Ratio (CR), Debt To Equity Ratio (DER), Working Capital Turnover (WCTO), dan Inventory Turnover (ITO) terhadap Return On Investment (ROI) pada UKM sentra industri keramik Dinoyo Malang periode 2011-2013 / Nur Indah Sari
1107Pengaruh tingkat inflasi, suku bunga dan kurs rupiah terhadap return saham perusahaan food and beverages yang listing di BEI periode 2004-2006 / Ika Vera Susanti
1108Pengaruh faktor psikologis terhadap keputusan konsumen dalam membeli produk rokok Dji Sam Soe (studi pada karyawan Tata Usaha Universitas Negeri Malang) / Cucuk Dian Afianto
1109Pengaruh kualitas layanan terhadap loyalitas pelanggan dalam pembayaran rekening listrik dengan sistem on line (studi kasus pada konsumen yang melakukan pembayaran rekening listrik di CV Bima Putra) / Erawati Setya Wijaya
1110Pengaruh lingkungan kerja terhadap motivasi kerja pegawai pada PT. Taspen (Persero) Cabang Malang / Moch. Yusuf Prasetyo
1111Pengaruh kualitas pelayanan pramuwisata terhadap loyalitas wisatawan pasca berkunjung di Kusuma Agrowisata Batu / Retno Wisudawati
1112Analisis rasio keuangan perusahaan sebelum dan sesudah krisis moneter (studi kasus pada PT. Indofood Sukses Makmur Tbk) / Nurma Widarti
1113Pengaruh risiko sistematis terhadap tingkat keuntungan saham (pengujian dan penggunaan CAPM untuk berinvestasi sahan secara efisien di Bursa Efek Jakarta) / Indri Lestari Rahayuningtyas
1114Pengaruh EPS (Earning Per Share), PER (Price Earning Ratio), BV (Book Value Per Share), PBV (Price To Book Value) terhadap harga saham pada Perusahaan Perbankan yang listing di Bursa Efek Indonesia periode 2005-2007 / Ratna Anggita
1115Pengaruh budaya organisasi terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan PT. Wowin Purnomo Trenggalek) / Lutfi Rahmawati
1116Pengaruh current Ratio, total asset turnover dan debt to asset ratio terhadap rentabilitas ekonomi koperasi wanita di Kota Malang tahun 2010 / Ratna Dwi Imawati
1117Pengaruh budaya organisasi terhadap kinerja karyawan melalui komitmen organisasi pada PT Asuransi Ekspor Indonesia (Persero) Kantor Cabang Malang / Hokibuanmaltar Pardamaian
1118Pengaruh arus kas operasi dan arus kas pendanaan terhadap return saham melalui profitabilitas: Pada Perusahaan Manufaktur yang listing di BEI periode 2006-2009 / Rizzul Ngishmawati
1119Pengaruh kualitas produk terhadap proses pengambilan keputusan pembelian rokok Gudang Garam Internasional merah (studi kasus pada konsumen rokok Gudang Garam Internasional merah di Desa Cendono Kecamatan Kandat Kabupaten Kediri) / Ahmad Farid Rosyadi
1120Analisis perbedaan persepsi konsumen tentang kualitas produk sepeda motor Honda, Yamaha, Suzuki (studi pada pemilik sepeda motor Honda, Yamaha, Suzuki) di Desa Pronojiwo, Kecamatan Pronojiwo, Kabupaten Lumajang) / Bagoes Arie Wibowo
1121Pengaruh lokasi toko, tata letak toko dan atmosfer toko terhadap kepuasan konsumen dalam berbelanja di toko buku diskon toga mas Malang oleh Yusi Ernawati
1122Pengaruh faktor internal terhadap keputusan pembelian air minum kemasan galon merek Aqua pada konsumen di wilayah Terusan Cikampek Kelurahan Penaggungan Kota Malang / Dian Aprilia Insani
1123Analisis perbedaan abnormal return, trading volume activity (TVA) dan security return variability (SRV) saham sebelum dan sesudah right issue pada perusahaan food and beverage yang listing di Bursa Efek Jakarta (periode pengamatan tahun 2000 sampai 2005)/Umdatul Khoiriy
1124Pengaruh maturitas obligasi dan kupon obligasi terhadap harga obligasi pada Perusahaan Finance yang listing di Bursa Efek Indonesia (BEI) / Citra Okky Perdanawati
1125Analisis faktor brand equity produk samartphone Samsung (studi padsa mahasiswa Prodi S1 Manajemen Universitas Negeri Malang angkatan 2012) / Ahmad Hamdun
1126Analisis perbedaan rasio profitabilitas dan Market Value Added (MVA) sebelum dan sesudah akuisisi pada perusahaan manufaktur yang listing di BEI / Silvy Novita
1127Analisis Camels untuk mengukur kinerja keuangan 2 tahun pertama dan 2 tahun kedua setelah merger pada PT Bank CIMB Niaga Tbk periode 2009-2012 / Agung Yuli Saputro
1128Pengaruh faktor psikologis terhadap keputusan pembelian (Studi pada Konsumen Rokok Gudang Garam Internasional di Kota Malang) / Achmad Rochim
1129Perbedaan kinerja keuangan dan harga saham sebelum dan sesudah akuisisi perusahaan non jasa keuangan yang listing di BEJ / Eka Ario Yudha
1130Pengaruh asset growth, proporsi dewan komisaris independen, debt to equity ratio, dan return on asset terhadap dividend payout ratio pada perusahaan property & real estate yang listing di BEI periode 2012-2014 / Eka Rizki Wulandari Putri
1131Implmentasi pemberian motivasi kerja karyawan pada perusahaan batik tulis "fiesta" Pamekasan Madura oleh Siti Hazizah
1132Pengaruh current ratio (CR) dan debt to equity ratio (DER) terhadap return saham melalui return on equity (ROE) pada perusahaan food and beverages yang listing di Bursa Efek Indonesia tahun 2007-2009 / Rio Romadona
1133Pengaruh motivasi dan kepuasan kerja terhadap produktivitas kerja karyawan (Studi pada karyawan bagian produksi PT. Crestec Indonesia Rembang Pasuruan) / Yusya' Wirawan
1134Pengaruh kecerdasan emosional pemimpin terhadap kinerja karyawan (studi pada perusahaan jasa kuliner Racel Tea yang dipimpin manager laki-laki dan Racel Risol yang dipimpin manager perempuan) / Risang Candrasa Rahino Suwignyo
1135Pengaruh iklan televisi terhadap keputusan pembelian (studi pada pemilik sepeda motor Yamaha di Blitar) / Ummu Chairu Wardani
1136Penggunakan analisis teknikal dalam pengambilan keputusan investasi pada empat saham teraktif di bursa efek Indonesia / Fitro Juniawan
1137Pengaruh tayangan iklan Yamaha Mio di televisi terhadap keputusan pembelian (studi pada dealer Yamaha Unggul Motor Malang) / Bagus Fajar Hartanto
1138Pengaruh brand image terhadap keputusan pembelian kartu seluler im3 (Studi pada mahasiswa jurusan manajemen fakultas ekonomi Universitas Negeri Malang) / Hetty Nilawati
1139Pengaruh pengungkapan wajib dan asimetri informasi terhadap biaya modal ekuitas (Studi pada Perusahaan Makanan dan Minuman yang listing di BEI Periode 2005-2007) / Nila Rusmaliana
1140Implementasi bauran pemerasan jasa (studi pada Yusro Hotel Restaurant & onvention Jombang) / Dessy Arinanda
1141Pengaruh gaya kepemimpinan dan budaya organisasi terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan PT PLN Persero Area Malang) / Annaafi Dwi Delia
1142Pengaruh struktur modal dan ukuran perusahaan terhadap kinerja keuangan (studi pada usaha kecil menengah sektor bordir "Aspendir" di Kota Bangil periode 2013-2015) / Abdillah Majdi
1143Pengaruh iklan IM3 terhadap keputusan konsumen dalam menggunakan kartu telepon seluler IM3 (survey pengguna IM3 Kota Malang) / Sofia Yulian Rakhmawati
1144Pengaruh ekuitas merek terhadap loyalitas konsumen (studi pada ibu rumah tangga pengguna pasta gigi Pepsodent di Kelurahan Bendogerit, Kecamatan Sananwetan, Kota Blitar) / Gita Raditya Meitaria
1145Pengaruh kualutas produk terhadap proses pengambilan keputusan pembelian ponsel Nokia (studi kasus pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Nicko Bagus Setiawan
1146Implementasi bauran promosi pada CV. Raj Organik Malang / Amar Torikun Iksan
1147Pengaruh kepuasan kerja terhadap komitmen organisasi (studi pada karyawan Asuransi Jiwa Bumiputera 1912 Cabang Trenggalek) / Selfiana Fauzi
1148Pengaruh bauran pemasaran terhadap keputusan pembelian (studi pada konsumen Hot Cui Mie di Malang Town Square) / Erlin Rakhmawati
1149Pengaruh capacity, capital dan collateral terhadap jangka waktu pengembalian pinjaman debitur perseorangan dan UMKM (studi kasus BRI Unit Pakisaji Cabang Malang Martadinata) / Fatimatuz Zuhriyah
1150Pengaruh motivasi kerja terhadap kinerja karyawan (studi pada pabrik rokok Tiga Bola Malang) / Yayan Pernama Putra
1151Pengaruh semangat kerja dan disiplin kerja terhadap kinerja karyawan (studi pada karyawan Hotel Bromo View Probolinggo) / Fajar Yuri Suprayugi
1152Pengaruh kualitas layanan terhadap loyalitas melalui switching cost (studi pada nasabah Bank Syariah Mandiri KCP Nganjuk) / As'ad Syamsul Arifin
1153Pengaruh similar name terhadap keputusan konsumen dalam membeli air mineral merek Aqua versus Aquase (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Rifki Afandi
1154Pengaruh kepuasan gaji dan budaya organisasi terhadap kinerja karyawan melalui komitmen afektif (studi karyawan pemasaran perusahaan rokok PT. Gandum, Malang) / Bayu Setiawan
1155Pengaruh struktur aktiva, financial laverage dan struktur modal terhadap profitabilitas pada perusahaan mining (pertambangan) yang go public di Bursa Efek Jakarta (periode pengamatan tahun 2004-2005) / Santi Septi Pratiwi
1156Pengaruh kualitas layanan terhadap keputusan konsumen dalam membeli mobil (studi kasus pada konsumen Kartika Sari Motor Authorized TOYOTA Dealer Malang) / Arina Uli Carolina G.
1157Pengaruh inflasi suku bunga SBI maturity dan konveksitas terhadap yield obligasi perbankan periode 2007-2009 / Donna Satria Yonantha
1158Pengaruh budaya organisasi terhadap komitmen organisasional melalui kepuasan kerja (studi pada karyawan PT PLN Persero APJ Malang) / Alfian Taufiqurachman
1159Pengaruh pengetahuan konsumen terhadap keputusan pembelian laptop acer (Studi pada pengguna laptop acer di area hotspot Fakultas Perikanan dan Ilmu Kelautan Universitas Brawijaya) / Lina Budiarti
1160Pengaruh debt to equity ratio (DER) dan time interest earned ratio (TIER) terhadap earning per share (EPS) melalui return on equity (ROE) pada perusahaan food and beverages yang listing di BEI periode 2006-2009 / Mafikasari
1161Pengaruh keterlibatan kerja terhadap niatan untuk keluar kerja melalui kepuasan kerja dan komitmen organisasi (studi PT. Tunas Jaya Raya Abadi Nganjuk) / Johan Irwansyah
1162Study komparatif peranan serikat pekerja dalam memperjuangkan hak-hak pekerja " Studi kasus di Bank BRI cabang Martadinata kota Malang dan PT.Sampoerna Tbk cabang Malang " / Hidayatullah Cahyadi Fahmi
1163Pengaruh strategi pemasaran word of mouth terhadap proses keputusan pembelian konsumen (Studi pada pembeli CV Jaya Mandiri Interior JL. Peltu Sujono Malang) / Lutfi Hermansyah
1164Analisis perbedaan return, abnormal return, cummulative abnormal return (CAB), cummulative average abnormal return (CAAR), dan security return variability (SRV) sahan sebelum dan setelah pengumuman laporan keuangan tahun 2006 (studi pada perusahaan manufa
1165Faktor-faktor yang dipertimbangkan konsumen dalam penggunaan jasa cuci motor (studi pada konsumen pengguna jasa cuci motor Berto Motor Malang) / Mochammad Subakti Yusuf
1166Pengaruh lingkungan kerja dan karakteristik individu terhadap kinerja karyawan (studi pada karyawan Bagian Pabrikasi PG Kebon Agung Malang) / Riza Bustomi
1167Pengaruh online promotion terhadap proses keputusan pembelian produk fashion (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2014) / Eva Anggun Sadzillah
1168Analisis manajemen piutang pada Koperasi Pume Kecamatan Kejayan Kabupaten Pasuruan tahun 2008-2012 / Megasari Restuning Gusti
1169Pengaruh pelayanan prima (service excellence) terhadap loyalitas nasabah (syudi pada nasabah Bank Jatim Cabang Batu) / Ariska Adi Tiara
1170Pengaruh Total Asset Turn Over (TATO), Debt to Equity Ratio (DER) terhadap return saham melalui Return On Equity (ROE) pada perusahaan real estate and property yang listing di BEI periode 2013-2014 / Eka Meida Rachmawati
1171Faktor-faktor yang menentukan keputusan wisatawan berkunjung ke objek Wisata Bahari Lamongan (WBL) Kabupaten Lamongan / Lydia Wahyu Surya Prayogi
1172Pengaruh aspek psikologis konsumen terhadap loyalitas konsumen harian pagi Jawa Pos (studi pada pelanggan harian pagi Jawa Pos di Kecamatan Sanan Wetan , Kota Blitar ) / Catur Khrisna Atmaja
1173Penerapan analisis SWOT sebagai salah satu cara dalam menentukan strategi pemasaran (studi kasus pada PR. Dua Dewi Besuki - Tulungagung) / Ibnu Wafa
1174Pengaruh kompensasi dan komunikasi internal terhadap semangat kerja pegawai (studi pada KPSP Setia Kawan Nongkojajar) / Yuni Widiyanti B.
1175Pengaruh inflasi, suku bunga dan kurs rupiah terhadap harga saham pada perusahaan makanan dan minuman yang go publik di Bursa Efek Jakarta / Widya Pratista Wardhani
1176Analisis faktor-faktor yang mempengaruhi keputusan pembelian mobil Toyota Avanza di dealer Auto2000 Probolinggo / Okta Retno Mardhilla Pramesthi
1177Pengaruh kualitas layanandan citra toko terhadap loyalitas pelanggan (studi pada pelanggan Takashimura Departemens Store Krian Sidoarjo) / Ocky Dwi Pratiwi
1178Pengaruh current ratio, debt to equity ratio, return on equity, total asset turnover, dan net profit margin terhadap harga dan volume perdagangan saham PT Eratex Djaja TBK - Probolinggo tahun 1999-2007 / Irma Fitri Nur'aini
1179Pengaruh kepemimpinan transformasional terhadap kinerja melalui motivasi kerja (studi pada karyawan PT. PLN (Persero) Distribusi JAwa Timur APJ Malang) / Irma Setiawati
1180Pengaruh diferensiasi produk terhadap keputusan pembelian produk Sariayu Martha Tilaar (Studi kasus pada Mahasiswa Universitas Negeri Malang di Kelurahan Gadingkasri Kecamatan Lowokwaru Kota Malang) / Jahizatus Sa'adah
1181Pengaruh rasio keuangan dalam model Zmijewski (X-score), dan Zavgren (Logit) terhadap harga saham (Studi paqda apparel and textile products yang listing di BEI periode 2006-2008) / Ratih Hapsari Wahyu Widarti
1182Pengaruh budaya organisasi terhadap komitmen organisasi melalui kepuasan kerja (Studi pada karyawan terminal BBM Malang) / Hendita Gaustamam
1183Pengaruh penayangan iklan di televisi terhadap pembentukan citra produk (studi kasus pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Aditha Dwi Putriyanti
1184Analisa pergerakan valas dengan metode technical analysis dalam menentukan keputusan investasi di Bursa Berjangka Jakarta (BBJ) periode Januari 2010-April 2011 / Abdul Kholiq Afandi
1185Pengaruh kualitas layanan terhadap loyalitas pelanggan (Studi pada pelanggan warung panggang ayam "Rasa Khas" Bangi Kediri / Siska Dian Novita
1186Pengaruh rasio camel terhadap return saham perbankan yang listing di BEI tahun 2008-2010 / Vira Zakhiya
1187Pengaruh budaya organisasi terhadap komitmen organisasi melalui kepuasan kerja (Studi pada karyawan Lotus Garden Hotel & Restaurant Kediri) / Ekanis Anggarini
1188Pengaruh baruan pemasaran terhadap keputusan pembelian (studi pada konsumen Sentra Keramik Dinoyo Malang) / Ridho Satya Harpawan
1189Pengaruh perubahan return on assets, perubahan debt to equity ratio, dan perubahan cash ratio terhadap perubahan dividend payout ratio pada perusahaan makanan dan minuman yang go public di BEJ / Trisna Yusitawati
1190Pengaruh jaminan keselamatan dan kesehatan kerja terhadap produktivitas kerja karyawan (studi pada karyawan PB. PAKU BUMI Sukolilo, Jabung-Malang) / Rafly Firdaus
1191Pengaruh gaya kepimpinan orientasi tugas dan orientasi hubungan terhadap kinerja karyawan dengan mediasi motivasi berprestasi (Studi pada karyawan bagian produksi PT. Kemas Super Indonesia, Singosari, Malang) / Ridwan Fajar
1192Pengaruh perputaran modal kerja (Perputaran kas, perputaran piutang, dan perputaran persediaan) terhadap profitabilitas (Studi pada Perusahaan Manufatur yang listing di BEI periode 2005-2007) / Achmad Ishak Setyawan
1193Pengaruh penayangan iklan sepeda motor Honda Vario melalui media televisi terhadap citra produk (studi kasus pada anggota klub motor Vario Owner Community Malang) / Rizky Bagus Prakoso
1194Analisis kebijakan rekrutmen, seleksi dan penempatan karyawan Frontliner dalam rangka mendapatkan karyawan yang berkompeten (Studi pada Bank Rakyat Indonesia Kantor Wilayah Malang) / Siti Umairoh
1195Pengaruh iklan televisi terhadap keputusan konsumen dalam membeli produk pencuci piring Sunlight (studi pada ibu rumah tangga di Dusun Sawentar Desa Sawentar Kecamatan Kanigoro Kabupaten Blitar) / Raras Wangi Susanti
1196Pengaruh kualitas pelayanan terhadap loyalitas siswa di lembaga bimbingan belajar Sony Sugeme College (SSC) Malang / Dice Noviana
1197Pengaruh perputaran modal kerja dan current ratio terhadap Return On Wquity (ROE) melalui Net Profit Margin pada KPRI di Kota Malang tahun 2013-2014 / Listya Fransiska Dewi
1198Pengaruh kualitas pelayanan pembayaran rekening listrik secara konvensional terhadap kepuasan pelanggan (studi pada pelanggan golongan tarif bisnis PT PLN Persero Distribusi Jawa Timur area pelayanan dan jaringan Gresik) / Fitria Ariani
1199Pengaruh faktor psikologis terhadap keputusan pembelian pakaian pada konsumen Matahari Departmen Store Malang Town Square (MATOS) / Vina Anggun Sari
1200Pengaruh bauran promosi terhadap keputusan pembelian konsumen dalam membeli produk shampoo mek Sunsilk (studi pada pengguna shampoo Sunsilk di Kota Jombang) / Agus Riadi Syaifuddin
1201Pengaruh faktor internal terhadap keputusan konsumen dalam membeli sepeda motor Honda Supra (studi pada konsumen sepeda motor Honda Supra di wilayah Kelurahan Petamanan Kecamatan Bugul Kidul Pasuruan) / Isaac Muhammad
1202Pengaruh iklan televisi sepeda motor Yamaha Vega R terhadap citra produk (studi kasus pada pengguna sepeda motor Yamaha Vega R di Desa Pagedangan Kecamatan Turen Kabupaten Malang) / Muslih Raharja
1203Pengaruh kualitas layanan terhadap kepuasan pelanggan hotel Palem Garden Tulungagung / Yusdiana Fatmawati Fitroh
1204Analisis efisiensi penggunaan modal kerja pada swalayan Koperasi Agro Niaga (KAN) Jabung Pakis tahun 2008-2012 / Laila Rachmawati
1205Pengaruh persepsi konsumen tentang bauran pemasaran terhadap proses keputusan pembelian sepeda motor Yamaha (studi pada konsumen sepeda motor Yamaha di Desa Lumbungsari Kecamatan Bululawang, Kabupaten Malang) / Alfian As'ad Putra
1206Pengaruh pemberdayaan karyawan terhadap kualitas pelayanan melalui keletihan (Burnout) (Studi pada perawat Rumah Sakit Ngudi Waluyo Wlingi-Blitar) / Destiana Nila Praharani
1207Pengaruh faktor-faktor fundamental terhadap abnormal return saham sebelum dan sesudah stock split pada perusahaan manufaktur yang listing di BEI / Ananji Wiyastomo
1208Pengaruh relationship marketing terhadap loyalitas nasabah (studi pada nasabah tabungan Britama PT. Bank Rakyat Indonesia Tbk. Cabang Malang Martadinata) / Irul Kurniawan
1209Pengaruh variabel-variabel tingkat kebangkrutan model Altman Z-Score terhadap harga saham pada perusahaan property and real estate yang listing di BEI pada tahun 2011-2012 / Ihmawatus Syafila
1210Pengaruh pemberian kompensasi finansial dan kompensasi non finansial terhadap persepsi kinerja karyawan (studi pada PT. Sung Sun Satria Bagian Produksi Wonosari-Mojokerto) / Adek Dedi Rohmansyah
1211Analisis perbedaan harga saham dan volume penjualan saham sebelum dan sesudah BEJ dan BES Merger (Study kasus pada Perusahaan LQ 45 periode Agustus 2007-Januari 2008) / Indah Yuliany
1212Pengaruh kualitas menu dan lokasi terhadap keputusan pembelian (studi pada Warung Bebek Sinjay Karangploso Malang) / Yan Agung Pamungkas
1213Pelaksanaan Keselamatan dan Kesehatan Kerja (K3) di SPBE PT. Bintang Cipta Persada Trenggalek / Woro Okta Tricahyo
1214Kepuasan sebagai mediasi pengaruh brand image dan Customer Relationship Management (CRM) terhadap loyalitas nasabah (studi kasus pada nasanah Bank X Cabang Malang) / Yusva Ferdiawan
1215Pengaruh kualitas layanan terhadap minat beli ulang (studi pada pengguna jasa Azka Buana Harta (ABH) Travel Malang) / Nurjanah
1216Pengaruh current ratio, debt to equity ratio, dan account receivable turnover terhadap rentabilitas KPRI di Kabupaten Jombang tahun 2007-2011 / Deis Soraya Anja Andika
1217Pelaksanaan dimensi kualitas layanan di Coffee Story Malang / Ismail Riadi
1218Implementasi strategi saluran distribusi "Packing Plant dan Gudang Penyangga" pada PT. Semen Indonesia (Persero) Tbk / Mochammad Musa Akbar
1219Perbedaan abnormal return dan trading volume activity sebelum dan sesudah publikasi corporate governance perception index 2001-2005 / Aries Fauziah Rahmania
1220Pengaruh penciptaan produk dan penganekaragaman produk terhadap pilihan keputusan pembelian produk mode pada toko Bandung Sport Blitar / Rian Susilo
1221Pengaruh kinerja keuangan perusahaan terhadap return saham pada perusahaan food and beverages di BEJ periode 2004-2006 / Nurul Fajriyah
1222Pengaruh strategi saluran distribusi terhadap keputusan pembelian (studi pada relasi penerbit Gema Insani Press Perwakilan Malang-Jawa Timur) / Nina Ainur Fitri
1223Faktor-faktor yang mempengaruhi keputusan mahasiswa kuliah pada program non reguler fakultas ekonomi Universitas Negeri Malang oleh Endang Setyo Rini
1224Pengaruh kebangkrutan model Altman terhadap return saham pada perusahaan plactic and glass product yang listing di BEI tahun 2006-2008 / Aris Nafianto
1225Pengaruh kualitas produk terhadap loyalitas pelanggan (Studi pada pelanggan koran Jawa Pos di wilayah Kecamatan Lowokwaru Kota Malang) / Kartikasari
1226Pengaruh atribut produk terhadap keputusan konsumen dalam membeli produk pons's facial foam (Studi pada mahasiswa Fakultas Sastra Program Studi Pendidikan Seni Tari Universitas Negeri Malang) / Heri Murtioso
1227Pengaruh struktur modal terhadap earning per share pada perusahaan manufaktur yang listing di Bursa Efek Indonesia periode 2004-2006 / Elmi Arista Yusty
1228Pengaruh kualitas layanan terhadap loyaliats pelanggan (Studi pada member the coffee bean & tea leaf Tunjungan Plaza Surabaya) / Agung Budi Prasetyo
1229Pengaruh budaya organisasi terhadap kepuasan kerja (studi pada karyawan bagian tanaman PG. Kebon Agung, Malang) / Fajar Bayu Ardiansyah.
1230Pengaruh diversifikasi produk terhadap keputusan pembelian (studi pada pembeli sepeda motor matic (otomatis) Yamaha di Desa Pajaran, Kecamatan Poncokusumo, Kabupaten Malang) / Rudi Nur Kholis
1231Penerapan model pembelajaran role playing untuk meningkatkan motivasi dan hasil belajar siswa pada standar kompetensi melaksanakan pelayanan prima di kelas X Pemasaran SMK Islam Batu / Fajriah Nur Karim
1232Pengaruh persepsi atribut produk terhadap keputusan pembelian simpati (Studi pada konsumen simpati di citra seluler, Malang) / Fery Moniagara
1233Analisis faktor-faktor keputusan pembelian handphone Nokia (studi pada pengguna handphone Nokia di Malang Plaza Handphone Center) / Herris Firmansyah
1234Pengaruh kualitas produk terhadap proses keputusan pembelian konsumen dalam membeli produk minyak goreng kemasan filma (studi pada ibu rumah tangga warga Perum Griya Asri, Kelurahan Pandan Wangi, Kecamatan Blimbing, Kota Malang) / Fonni Adrianti
1235Penerapan service excellence pada nasabah Bank Jatim Cabang Pasuruan / Ovi Ratnawati
1236Analisis perbedaan tingkat efisiensi kinerja Bank BUMN dan BUSN yang terdaftar di BEi tahun 2007-2009 berdsarkan metode DEA / Kartika Dwi Ariyani
1237Pengaruh atribut produk terhadap keputusan pembelian telepon selular Nokia (Studi pada siswa MAN 1 Bungah Gresik yang menggunakan telepon selular Nokia) / Syaifudin Yuchal
1238Analisis hasil pelatihan karyawan menggunakan model PJT (On The Job Training) di Matahari Departement Sore (MATOS) Malang / Akbar Oktobriandi
1239Pengaruh lingkungan dan aspek psikologis terhadap keputusan pembelian (studi pada Senkuko Kartika Candra Pandaan) / Ana Farida
1240Pengaruh Return On Asset dan Debt To Equity Ratio terhadap harga saham melalui Dividend Payout Ratio pada sektor industri manufaktur periode 2009-2011 / Octa Tri Wahyuni
1241Penilaian kinerja portofolio dengan strategi aktif dan pasif pada indeks sri-kehati periode mei-juli 2011 / Prita Pradaning Sandya
1242Pengaruh persepsi manfaat dan persepsi kemudahan terhadap sikap penggunaan layanan internet banking (studi pada komunitas virtual E-Banking BCA) / Usfatul Ika Agustina
1243Pengaruh kepemilikan manajerial dan kepemilikan institusional terhadap nilai perusahaan melalui kebijakan dividen pada perusahaan manufaktur yang terdaftar di BEI tahun 2007-2009 / Zuliya Rohma
1244Penagruh pengelolaan arsip, lingkungan kerja, dan karakteristik individu terhadap efisiensi kerja pegawai: studi pada Badan Arsip Propinsi Jawa Timur oleh Nifa Nafiani
1245Pengaruh kupon, maturitas, yield, dan default risk terhadap harga obligasi perusahaan finance yang listing di BEI periode 2007-2009 / Asri Widarti
1246Pengaruh struktur modal dan struktur kepemilikan terhadap nilai perusahaan (Studi pada perusahaan manufaktur yang listing di Bursa Efek Indoneia periode 2006-2008) / Tri Agustin Wulandari
1247Pengaruh keadilan distributif dan keadilan kepuasan kerja (Studi pada karyawan pabrikasi PG Krebet Baru Malang) / Tegar Rizkika Afthartu
1248Pengaruh kepuasan kerja dan motivasi karyawan terhadap kinerja karyawan (studi kasus pada karyawan Bagian Produksi PR. Djagung Padi) / Ratih Febrianti
1249Pengaruh iklan televisi terhadap ekuitas merek body spray Axe Dark Temptation (studi kasus pada mahasiswa Universita Negeri Malang) / Nur Fahriza Wahyu Priambodo
1250Analisis faktor-faktor yang menentukan preferensi belanja online oleh konsumen pada produk fashion (studi pada mahasiswa Fakultas Ekonomi, Universitas Negeri Malang) / Aprian Ramadhani
1251Pengaruh atribut produk terhadap keputusan pembelian konsumen dalam menggunakan kartu seluler Simpati (studi pada mahasiswa Universitas Negeri Malang Kampus III Blitar) / Eny Mulyono
1252Pengaruh biaya periklanan dan biaya promosi penjualan terhadap omzet penjualan pada PT. Warna Utama Tulung Agung / Tito Herminto
1253Analisis pengaruh economic value added (EVA), residual income, earning per share dan arus kas operasi terhadap harga saham perusahaan manufaktur yang listing di BEI periode 2007-2009 / Risang Arisandi Rahmawan
1254Pengaruh Return On Equity (ROE), Earning Per Share (EPS), Gross Profit Margin, dan Net Profit Margin (NPM) terhadap harga saham perusahaan real estate and property yang listing di Bursa Efek Indonesia (BEI) periode 2011-2012 / Debby Eka Fransiska
1255Peran kepemimpinan dalam mengembangkan budaya kerja pada Departemen Kredit PT. Bank Papua Cabang Surabaya / Alifia Pandu Pratiwi
1256Pengaruh green marketing terhadap minat pembelian ulang nasi organik (studi pada pelanggan HFC Probolinggo) / Danti Kurniastuti
1257Pengaruh debt to equity ratio, debt to total asset ratio, long term debt to equity ratio dan current asset ratio terhadap return on equity (studi pada KPRI Kota Malang periode 2011-2012) / Vera Himatul Ngazizah
1258Pengaruh Loan to Assets Ratio (LAR), Capital Adequacy Ratio (CAR), dan Non Performing Financing (NPF) terhadap penyaluran pembiayaan murabahah pada bank umum syariah (tahun 2009-2012) / Melinda Nur Ardiani
1259Pengaruh kualitas pelayanan terhadap nilai yang dirasakan pasien (studi pada Rumah Sakit Khusus Bedah Hasta Husada Kepanjen) / Ruli Edi Santoso
1260Pengaruh rasio profitabilitas terhadap harga saham melalui price earning ratio pada perusahaan sektor pertanian yang listing di Bursa Efek Indonesia periode 2010-2012 / Khalimatus Sodiyah
1261Pengaruh brand image terhadap proses keputusan konsumen dalam membeli motor honda (Studi pada mahasiswa jurusan manajemen fakultas ekonomi Universitas Negeri Malang) / Muhammad Andan Permadi
1262Pengaruh current ratio, account receivable turnover, asset turnover terhadap rentabilitas koperasi pegawai Republik Indonesia (KPRI) di kota Malang tahun 2010 / Putri Oktavia
1263Pengaruh motivasi kerja terhadap prestasi kerja karyawan bagian juru utama pada PT. Kertas Leces (Persero) Probolinggo / Chandra Refianto
1264Pengaruh karakteristik pekerjaan terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan bank BRI Cabang Kota Blitar) / Dian Rosita Dewi
1265Pengaruh diferensiasi pelayanan terhadap kepuasan konsumen dalam membeli sepeda motor Yamaha (studi pada konsumen dealer Unggul Motor Malang) / Brahma Wahyu Kurniawan
1266Penggunaan analisis rasio keuangan dan economic value added (EVA) untuk menilai kinerja keuangan pada PT. British American Tobbaco Tbk oleh Febiola Niken Purbosari
1267Pengaruh pelatihan terhadap kinerja karyawan di Pondok Jatim Park Kota Batu / Lucinda N.M.
1268Pengaruh financial distress dan ukuran perusahaan terhadap return saham pada perusahaan sektor pertambangan yang terdaftar di BEI tahun 2014 / Lailatul Jannah
1269Pengaruh kompensasi finansial dan kompensasi non finansial terhadap kinerja karyawan (studi pada karyawan golongan I dan II Pabrik Gula Tjoekir Jombang) / Irwan Mashuda
1270Pengaruh kepercayaan merek terhadap loyalitas (studi pada pengguna pasta gigi Pepsodent di Perumahan Canggu Permai Kabupaten Mojokerto) / Agung Rudianto
1271Pengaruh pendidikan dan pelatihan kerja terhadap kinerja pada karyawan wisata pantai Bentar Kabupaten Probolinggo / Dedy Wahyu Tri Harwindo
1272Pengaruh rasio arus kas operasi dan return on asset terhadap dividend payout ratio (studi pada perusahaan manufaktur yang listing di BEI periode 2012-2013) / Ratna Ayu Kusumaningtyas
1273Analisis faktor yang menentukan kepuasan mahasiswa terhadap pelayanan yang diberikan oleh Fakultas Ekonomi Universitas Negeri Malang / Devi Wulan Febriarto
1274Pengaruh kompensasi finansial dan non finansial terhadap produktivitas kerja karyawan (studi pada karyawan P.R. Bayi Kembar Malang) / Ellisca Ayu Desy M.
1275Pengaruh return on equity (ROE), price earning ratio (PER), dan price to book value (PBV) terhadap return saham sebelum dan sesudah stock split pada perusahaan yang listing di BEI pada tahun 2004 / Fatna Kanzun Istaoroda
1276Pengaruh relationship marketing terhadap loyalitas konsumen melalui kepuasan konsumen (studi pada PT. Citra Van Titipan Kilat (TIKI) Agen Utama Kota Malang) / Achmad Rizal Nur Faizin
1277Penerapan bauran pemasaran pada CV. Rizki Jaya Sentosa Malang / Rizki Kurniawan
1278Pengaruh gaya kepemimpinan terhadap kepuasan kerja karyawan (studi pada karyawan bagian verpak PT. Bokormas Cabang Blitar) / Frishca Santika Megawati
1279Pengaruh citra toko terhadap loyalitas konsumen pada oke shop cabang Batu / Oby Treeska Maulana
1280Pengaruh media advertising, brand image dan customer reference terhadap keputusan pembelian motor (Studi pada Dealer Suzuki Indomadiun Kota madiun) / Miftah Ali Nurdiyani
1281Pengaruh bauran pemasaran jasa terhadap proses keputusan konsumen dalam memilih jasa penginapan (studi pada hotel Montana I Malang) / Ria Yudyanti Wina Dellya
1282Pengaruh current ratio, total debt to total asset ratio, debt to equity ratio, return on asset ratio, dan return on equity ratio terhadap return saham perusahaan manufaktur sektor basic industry and chemicals / Saifudin Zuhri
1283Pengaruh budaya organisasi terhadap kinerja melalui komitmen organisasi pada PT. Bank Jatim Cabang Blitar / Bismar Ari Andi
1284Faktor-faktor yang membentuk kualitas layanan di RSUD dr. Soedomo Trenggalek / Intan Dwi Lestari
1285Pengaruh citra merek dan faktor psikologis terhadap keputusan konsumen dalam membeli sepeda motor Suzuki (studi pada masyarakat Kecamatan Kalipare, Kabupaten Malang) / Miko Adit Andrean
1286Pengaruh Capital Adequacy Ratio (CAR), Loan To Deposit Ratio (LDR), dan Net Interest Margin (NIM) terhadap Return On Equity (ROE) pada bank umum milik negara yang listingdi BEI tahun 2009-2013 / Moh. Saifudin Muhtar
1287Pengaruh Debt To Equity Ratio terhadap harga saham melalui Return On Equity dan Price Earning Ratio (pada perusahaan real estate dan property yang listing di Bursa Efek Indonesia tahun 2012) / Diana Trisnawati
1288Pengaruh profitabilitas dan leverage terhadap return saham melalui kebijakan dividen pada perusahaan manufaktur yang listing di BEI tahun 2002 / Alvy Isnaini
1289Pengaruh suasana toko terhadap pembelian impulsif (studi pada pelanggan Giant Hupermarket Gajayana Malang) / Galih Dwi Septio Ady
1290Analisis proses pengambilan keputusan dengan pembobotan multi kriteria dalam memilih penyedia barang (Studi pada Bagian Umum Sekretariat Daerah Kota Batu dengan metode analytic hierarchy process) /Welly Chandra Kusuma
1291Analisis teknikal dalam penentuan keputusan investasi pada saham teraktif di Bursa Efek Indonesia (studi kasus pada saham banking yang tercatat di Bursa Efek Indonesia bulan Januari 2008-April 2010) / Ahmad Mahyudin Subechi
1292Pengaruh atmosfer toko dan harga terhadap keputusan pembelian (Studi pada konsumen Giant Hypermarket Gajayana Malang) / Rachmawati Budi Lestari
1293Pengaruh rasio arus kas operasi terhadap nilai perusahaan melalui profitabilitas (studi pada perusahaan property dan real estate yang listing di BEI periode 2012-2014) / Stefanus Dwi Wardoyo
1294Pengaruh atribut produk handphone Nokia terhadap kepuasan pelanggan (Studi pada mahasiswa S1 Manajeman Fakultas Ekonomi Universitas Negeri Malang angkatan 2010 / Rita Natanael
1295Persepsi tentang komitmen organisasional pada beberapa level manajerial (studi pada karyawan PDAM Kota Malang) / Uluf Nurul Kifayati
1296Pengaruh perputaran modal kerja terhadap profitabilitas melalui cash ratio, quick ratio dan current ratio (studi pada perusahaan otomotif dan komponen yang listing di BEI periode 2011-2013) / Daisy Fandira Prastiwi
1297Pengaruh struktur aktiva dan profitabilitas terhadap struktur modal pada koperasi simpan pinjam Kota Malang tahun 2010-2012 / Y.R. Novita Salsabella
1298Pengaruh ekuitas merek terhadap keputusan pembelian (studi pada konsumen pengguna sepeda motor merek Yamaha di wilayah Kelurahan Sumbersari Kecamatan Lowokwaru Kota Malang) / Sri Raehan
1299Pengaruh leverage keuangan dan rasio aktivitas terhadap profitabilitas pada perusahaan manufaktur dengan menggunakan variabel control LQ 45 dan non LQ 45 yang listing di BEI periode 2007-2009 / Deby Eriesa Retnaningrum.
1300Analisis faktor-faktor yang mempengaruhi keputusan pembelian produk kecantikan Wardah (studi pada konsumen Counter Wardah Matahari Department Store Malang Town Square) / Zahrotul Fairus
1301Pengaruh daya tarik iklan televisi dan citra merek terhadap kualitas keputusan konsumen dalam membeli Pond's White Beauty Lightening Facial Foam (Studi pada siswa SMK PGRI 2 Malang kelas X) / Widhi Puspo Hardianto
1302Pengaruh rasio arus kas kegiatan operasi dan return on asset terhadap dividend payout ratio (studi pada perusahaan sektor property dan real estate yang listing di BEI periode 2012-2014) / Eka Wahyu Apriliani
1303Pengaruh budaya organisasi dan pemberdayaan karyawan terhadap komitmen organisasi melalui kepuasan kerja (studi pada karyawan PT. Lestari Agro Kencana Tulungagung) Nia Nurmala Tamba
1304Pengaruh financial levereage. likuiditas dan profitabilitas terhadap return saham pada perusahaan manufaktur yang listing di BEI periode 2008-2010 / Syofyan Syawaludin
1305Pengaruh gaya kepemimpinan terhadap kepuasan kerja karyawan (studi pada karyawan hotel Mutiara Malang) / Anugrah Januar Pranata
1306Pengaruh kualitas layanan terhadap loyalitas pelanggan (studi pada travel Aloha Trenggalek) / Galang Sayful Islam
1307Pengaruh atribut produk terhadap kepuasan pelanggan (studi pada siswa SMAN 1 Srengat Blitar pengguna kartu seluler prabayar IM3) / Wahyuningdyah Budi Safitri
1308Faktor-faktor yang menentukan pembelian produk online fashion shopping (studi pada mahasiswa Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2012) / Firman Abdul Wafi
1309Pengaruh Return On Equity (ROE), Economic Value Added (EVA) dan Earning Per Share (EPS) terhadap return saham pada perusahaan perbankan yang listed di BEI periode 2008-2009 / Dwi Marta Siswa
1310Penerapan portofolio model pasar indek tunggal untuk menentukan portofolio optimal pada perusahaan makanan dan minuman di BEJ Januari 2005 sampai Desember 2006 / Nicha Kumalasary
1311Prosedur penerapan anggaran basis nol sebagai alat bantu perencanaan dan pengendalian di Rumah Sakit Umum Unit Swadana Daerah Gambiran Kota Kediri oleh Lukluil Maknun
1312Pengaruh komunikasi organisasi terhadap kepuasan kerja (studi pada karyawan Hotel Santika Malang) / Elya Agustina
1313Pengaruh kualitas layanan terhadap kepuasan nasabah di PT. Bank Negara Indonesia (Persero) Tbk. Kantor Cabang Madiun oleh Erwin Nasution
1314Pengaruh penempatan kerja terhadap kepuasan kerja karyawan: studi kasus pada PT. Telekomunikasi Indonesia, Tbk. Kantor Cabang Kediri oleh Islafiyatul Asna
1315Pengaruh strategi bauran pemasaran terhadap perilaku konsumen dalam membeli shampo sachet pada mahasiswa fakultas ekonomi Universitas Negeri Malang oleh Agung Yulianto
1316Pengaruh dimensi kualitas jasa terhadap pola perilaku konsumen pesaca pembelian pda Biro Perjalanan Umum MT tours and travel Madiun oleh Taufan Kurnia Budhi
1317Pengaruh layanan purna jual terhadap citra produk: studi kasus pada pengguna produk mobill merk KIA Visto di Kota Malang oleh Eva Yuliana Sethiono
1318Pengaruh likuiditas terhadap kebijakan dividen (studi pada perusahaan manufaktur tahap growth dan tahap mature yang listing di BEI periode 2012-2013) / Rossa Pravitasari Prayitno
1319Pengaruh kualitas jasa terhadap kepuasan mahasiswa: studi pada Fakultas Ekonomi Universitas Negeri Malang oleh Wanto Herdianto
1320Pengaruh pengembangan karir terhadap kepuasan kerja karyawan (studi pada karyawan Hotel Griyadi Montana Malang dan Hotel Asida Batu) / Dendy Elok Saputra
1321Pengaruh pengembangan karir terhadap kinerja karyawan melalui kepuasan kerja (Studi pada karyawan PT. Taspen cabang Malang) / Intan Kumala Dewi
1322Pengaruh persepsi kualitas produk terhadap keputusan pembelian konsumen (Studi pada pengguna sepeda motor Yamaha di Kelurahan Bandarhalim, Kecamatan Badegan, Kabupaten Ponorogo) / Lusiana Dwi Priyastiwi
1323Pengaruh citra merek (brand image) terhadap loyalitas pelanggan (studi pada konsumen PT. Tiara Megah Indah Jaya - Honda Malang) / Robi Ulan Desi
1324Implementasi strategi komunikasi pemasaran terpadu pada outlet virtual Merch Malang / Audila Anki Sadewanta
1325Pengaruh faktor sosial dan pribadi terhadap kepuasan pembelian sepatu tiruan (studi pada pelajar SMA di Kabupaten Tulungagung) / Andika Harya Dwi Nalanda
1326Pengaruh debt to equity ratio (DER) dan time interest earned ratio (TIER) terhadap earning per share (EPS) melalui return on equity (ROE) pada perusahaan tekstil dn garmen yang listing di BEI periode 2007-2009 / Erlina Anggraeni
1327Pengaruh personal selling, advertising dan public relation terhadap minat pembelian sepeda motor Yamaha (studi pada dealer Yamaha Indo Perkasa Jombang) / Rony Eka Febriawan
1328Pengaruh manajemen laba dan profitabilitas terhadap return saham pada perusahaan makanan dan minuman yang listing di BEI periode 2006-2008 / Betty Fajarini
1329Pengaruh motivasi kebutuhan berprestasi, motivasi kebutuhan afiliasi dan motivasi kebutuhan kekuasaan terhadap kepuasan kerja (studi pada karyawan tetap bagian Tanaman PT PG Krebet Baru) / Devi Sofiana Yulianti
1330Pengaruh resiko sistematis, economic value added, dan profitabilitas terhadap return saham pada perusahaan manufaktur yang listing di BEI periode 2008-2009 / Andris Dinar Wijaya
1331Pengaruh lingkungan kerja terhadap motivasi kerja melalui stres kerja karyawan di Delta Super Store Kraksaan / Asih Judatus Shidqiyah
1332Pengaruh dimensi kualitas pelayanan terhadap loyalitas nasabah Bank Rakyat Indonesia di Nganjuk / Hanandhito Panji Prabowo
1333Pengaruh perubahan current ratio (CR), perubahan debt to equity (DER) dan perubahan working capital to total assets (WCTA) terhadap perubahan laba masa depan pada perusahaan otomotif yang listing di BEI tahun 2006-2009 / Rani Asiyah Rochmania
1334Pengaruh good corporate governance terhadap nilai perusahaan melalui return on equity dan return on asset pada [erusahaan manufaktur yang lsiting di BEI tahun 2013-2014 / Dewi Kumalasari
1335Pengaruh Customer Relationship Management (CRM) dan Switching Barrier terhadap customer loyality (studi pada pelanggan BIG TV Madiun) / Wildan Ridholloh
1336Pengaruh strategi diferensiasi (produk, pelayanan, personil, dan citra) terhadap keputusan pembelian (studi pada pelanggan Legend Coffee Malang) / Fichi Arenda
1337Pengaruh citra merek dan kualitas produk terhadap keputusan pembelian (studi pada pelanggan Distro Inspired Kota Malang) / Yosua Soedibyo
1338Analisis faktor-faktor pembentuk citra Java Dancer Coffee / Arif Fajrianto
1339Tingkat kesehatan koperasi simpan pinjam dan faktor yang mempengaruhinya (studi kasus pada Koperasi Simpan Pinjam Kota Malang periode 2013-2014) / Nurita Indriawati
1340Pengaruh atribut kartu seluler Telkomsel terhadap proses keputusan pembelian (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang) / Muhammad Nabiel Abraham
1341Pengaruh Sales Growth (SG) dan Return On Asset (ROA) terhadap Debt to Equity Ratio (DER) dimoderasi oleh firm size (pada perusahaan sektor pertanian yang listing di BEI periode 2011-2014) / Yohana Sulistyorini
1342Pengaruh persepsi konsumen tentang bauran promosi terhadap keputusan pembelian (studi pada konsumen Matahari Department Store Cabang Malang Town Square) / Sarah Ainun Dewi Mashita
1343Pengaruh motif, lokasi dan kualitas layanan terhadap keputusan pemilihan fitness center (studi pada member Fitness Center Best Gym Malang) / Dian Yuli Prasetiyo
1344Pengaruh bauran eceran (retail mix) terhadap citra toko (studi pada konsumen Carrefour Market Malang) / Yohanes Setiawan
1345Analisis kualitas layanan di Puskesmas Karangan Kabupaten Trenggalek / Onny Shindra Swari
1346Pengaruh pemberian insentif terhadap semangat kerja karyawan pabrik gula Pesantren Baru Kediri / Titis Riyandani
1347Pengaruh economic value added (EVA), return on asset (ROA) dan return on equity (ROE) terhadap return saham (Studi pada perusahaan yang tergabung dalam 50 biggest market capitalization tahun 2009) / Aris Yuliono
1348Analisis perbedaan tingkat kesehatan bank sebelum dan sesudah merger dengan metode Camel / Niken Wulandari
1349Pengaruh Capital Adequacy Ratio, Loan To Deposit Ratio, dan Return On Aset terhadap harga saham (pada perbankan yang listing di BEI periode 2011-2012) / Nova Isnaini Rizqiah
1350Pengaruh total assets turnover dan debt to equity ratio terhadap harga saham melalui return on equity (studi pada perusahaan property dan real estate yang listing di BEI periode 2012) / Santi Andreani
1351Pengaruh semangat dan disiplin kerja terhadap produktivitas karyawan pada hotel Sahid Montana Malang / Jurist Risaldi Desmanair Bolang
1352Pengaruh bauran pemasaran terhadap keputusan konsumen dalam membeli ponsel merk nokia : studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang / oleh Bambang Wijonarko
1353Pengaruh Keselamatan dan Kesehatan Kerja (K3) dan pemberian tunjangan terhadap kinerja karyawan (pada karyawan bagian produksi di PT Barokah Mitra Karya Unggul Kota Pasuruan) / Altela Afrilianingrum
1354Pengaruh faktor psikologis dan faktor sosial terhadap keputusan konsumen dalam menggunakan jasa Kereta Api Sancaka Pagi / Wardya Syahida
1355Analisis faktor-faktor yang menentukan pembelian t-shirt musik metal secara online di Kota Batu / Ardi Army Wiratama
1356Analisis sistem kompensasi finansial karyawan produksi di PT. Audi Jaya Bio Walet Malang / Firdayasa Bella Pertiwi
1357Analisis metode penilaian kinerja dan kebijakan kompensasi pada PT Pos Indonesia (Persero) Malang / Fitri Nur Kholila
1358Pengaruh struktur aktiva, financial leverage dan struktur modal terhadap Return On Equity (ROE) pada perusahaan real estate & property yang listing di BEI tahun 2006-2009 / Puji Endah Purnamasari
1359Pengaruh desain, lingkungan sosial dan ambien terhadap minat pembelian ulang (studi pada konsumen Smesco Mart Al-Hikam) / M Zaenal Abidin
1360Penerapan bentuk layanan pada Lembaga Keuangan Mikro Wajak Artha Mulya Kecamatan Wajak Kabupaten Malang / Mohammad Sandy Aripiyanto
1361Pengaruh Debt to Asset Ratio (DAR) dan Debt to Equity Ratio (DER) terhadap Return On Asset (ROA) dan Return On Equity (ROE) pada KPRI Kota Malang periode 2012-2013 / Yohana Yosta Permatasari
1362Pengaruh working capitak turnover, current ratio, dan debt to equity ratio terhadap return on asset perusahaan otomotif dan komponen yang terdaftar di Bursa Efek Indonesia tahun 2010-2012 / Halfin Drat Ainul
1363Pengaruh arus kas operasi dan economic value added terhadap nilai perusahaan (studi pada perusahaan property & real estate yang listing di BEI periode 2011-2013) / Arila Cholilah
1364Pengaruh atribut produk dan kelas sosial terhadap keputusan pembelian kartu prabayar Telkomsel jenis Simpati (studi pada mahasiswa di Kelurahan Sumbersari Lowokwaru Malang) / Mutho Vivin Dwi Amalia
1365Personal selling dalam meningkatkan kinerja sales force (studi pada PT. Alamanda Delta Surya Sidoarjo) / Darik Oktinawati
1366Pengaruh kulaitas pelayanan terhadap kepuasan tamu pada hotel Lotus Garden Kediri oleh Ana Rahmawati
1367Pengaruh debt to equity ratio, debt to assets ratio, total assets turnover, working capital turnover dan equity multiplier terhadap return on equity pada Koperasi Pegawai Republik Indonesia di Kota Malang tahun 2010 / Vita Sari Kusuma Wardani
1368Pengaruh arus kas operasi, investasi, dan pendanaan terhadap likuiditas dan rentabilitas pada KPRI Kota Malang / Agustin Rahayu
1369Analisis penerapan strategi promosi (promotion mix) produk tabungan (studi pada Bank Muamalat Cabang Malang) / Andhika Widhi Prasetya
1370Pengaruh bauran pemasaran terhadap keputusan pembelian konsumen (studi pada CV Cahaya Mustika Malang) / Khofiful Mutaqin
1371Pengaruh pertumbuhan penjualan dan perputaran model kerja terhadap profitabilitas yang dimoderasi oleh ukuran perusahaan pada perusahaan makanan dan minuman yang listing di BEI tahun 2012-2014 / Manda Ayu Farhana
1372Pengaruh analisis pekerjaan (job analysis) terhadap rekruitmen pegawai pada PT. PLN (Persero) distribusi Jawa Timur area pelayanan dan jaringan (APJ) Malang / Evita Al Quria
1373Pengaruh kualitas jasa terhadap loyalitas pelanggan (Studi pada pelanggan jasa cuci kendaraan bermotor di UD. Mitra Olie Kabupaten Blitar) / Budi Prasetyanto
1374Prediksi kebangkrutan unit bisnis dengan model Altman (studi pada kopma UM dan kopma "PB" UIN Maliki Malang tahun 2006-2010) / Galuh Purnama Sari
1375Pengaruh kualitas layanan terhadap loyalitas pelanggan melalui kepuasan (studi pada siswa Lembaga Pendidikan Bahasa Asing English First Malang) / Risky Alvionita
1376Pengaruh kesadaran merek, persepsi kualitas dan asosiasi merek terhadap loyalitas konsumsi pada produk motor Honda Vario di dealer Honda UD. Sido Makmur Wlingi / Kukuh Santoso
1377Pengaruh kecocokan audiens dan kecocokan atribut dalam even sponsorship Honda development basketball league terhadap citra merek Honda (Studi kasus pada siswa kelas XII SMA Katolik Kolese Santo Yusup Malang) / Dhiya'u shidiqy
1378Pengaruh kepuasan kerja karyawan terhadap intensi turnover melalui komitmen organisasi karyawan (Studi pada karyawan PT. Hero Sakti Motor Gemilang Malang) / Andri Kurniawan
1379Pengaruh bauran produk terhadap keputusan konsumen dalam membeli produk minuman The Coca-Cola Company pada siswa SMUN I Garum Kabupaten Blitar / Septiana Widyastuti
1380Pengaruh kualitas produk dan harga terhadap keputusan konsumen dalam membeli laptop Thosiba (Studi pada mahasiswa fakultas Ekonomi angkatan tahun 2010 dan 2011 Universitas Negeri Malang) / Fania Rossilawati
1381Pengaruh rasio solvabilitas dan aktivitas terhadap rentabilitas ekonomi pada koperasi karyawan di kota Malang / Irawati Naibaho
1382Pengaruh brand trust terhadap proses keputusan pembelian smartphone merek Sony Xperia (studi pada mahasiswa Prodi S1 Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2013-2014) / Evalia Primastuti
1383Pengaruh kompensasi finansial dan motivasi kerja terhadap niat untuk keluar (studi pada karyawan Bagian Pengolahan dan Pengeringan Tembakau Koperasi Kareb Bojonegoro) / Totok Hariyanto
1384Pengaruh lingkungan toko (store environment) terhadap perilaku konsumen dalam melakukan pembelian (studi pada konsumen Alfamart Suropati Batu) / Norma Dyah Asmarani
1385Analisa rasio keuangan untuk mengukur kinerja keuangan pada KPRI "Patria Utama Karya" Kota Blitar / Edi Utami
1386Pengaruh kualitas pelayanan terhadap pengambilan keputusan kredit sepeda motor / Anwar Bagus Sampurno
1387Pengaruh kualitas produk dan harga terhadap keputusan pembelian kerajinan batik tulis Tuban (studi kasus pad Galery Batik Tulis Emmy Tuban) / Siti Muthoharoh
1388Pengaruh penerapan jaminan sosial kesehatan terhadap kinerja karyawan (studi pada karyawan bagian produksi pabrik gula Kebon Agung, Malang) / Eni Jaya Kuswanti
1389Pengaruh return on equity dan debt to equity ratio terhadap kebijakan dividen yang dimoderasi oleh umur perusahaan (studi pada perusahaan manufaktur yang terdaftar di BEI tahun 2014) / Rahmawati Dwika Pratiwi
1390Analisis perbedaan kinerja efisiensi perbankan Syariah dan perbakan konvensional dengan pendekatan Data Envelopment Analysis (DEA) (studi pada 10 perusahaan perbankan di Indonesia 2011-2013) / Fani Adi Cahyono
1391Pengaruh persepsi atribut produk laptop Toshiba terhadap proses keputusan pembelian konsumen (studi kasus pada mahasiswa Jurusan Administrasi Niaga Politeknik Negeri Malang) / Rina Nugraheny
1392Pengaruh iklan televisi sepeda motor Yamaha Mio terhadap citra produk (studi kasus pada pengguna sepeda motor Yamaha Mio anggota club "Miomate" Balikpapan) / Ainul Yaqin
1393Faktor-faktor yang menjadi pertimbangan wisatawan domestik berkunjung di objek wisata Cangar Batu / Fanggi Ananta Tirtana
1394Pengaruh faktor psikologis terhadap keputusan konsumen dalam membeli Mie Sedaap (Studi pada mahasiswa reguler jurusan matematika angkatan 2011 FMIPA Universitas Negeri Malang) / Dwi Pramodya Ningsih
1395Motif, persepsi, pembelajaran dan sikap konsumen dalam transaksi online di forum jual beli situs / Rukhi Efendi
1396Pengaruh keselamatan dan kesehatan kerja terhadap kinerja karyawan bagian produksi PT. Bentoel Malang / Dita Perpitasari
1397Penerapan bauran pemasaran pada PT. Asuransi Jiwasraya Malang / Vydha Lolita Devy
1398Analisis faktor-faktor atribut produk yang dipertimbangkan konsumen dalam menggunakan handphone blackberry (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Indra Kurniawan
1399Pengaruh faktor fundamental dan teknikal ekonomi terhadap harga saham property dan real estate yang listing di BEI / Didit Prasongko
1400Pengaruh similar name packaging terhadap keputusan konsumen dalam membeli produk oreo dan rodeo (studi terhadap perilaku konsumen di Indomaret Jl. Raya Singosari No. 1 Malang) / Murtinah
1401Pengaruh kualitas layanan terhadap loyalitas pelnggan melalui kepuasan emosional pembeli (Studi pada toko buku dan alat tulis Restu Cabang Lodoyo Kabupaten Blitar) / Setyawan Agus Nugroho
1402Pengaruh desain kemasan (packaging) tek kotak jasmine tea Ultrajaya 300 ml terhadap keputusan pembelian konsumen (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Sandradevi Crisdiana Sahatta
1403Pengaruh bauran pemasaran terhadap kepuasan konsumen (studi pada konsumen Dundee Fried Chicken (DFC) I Kota Malang) / Fitri Intan Sari
1404Pengaruh arus kas operasi, modal kerja bersih, dan laba per lembar saham terhadap abnormal return saham pada perusahaan LQ 45 tahun 2009 / Wisnu Wijaya
1405Analisis kinerja keuangan koperasi simpan pinjam "Bahagia" Kota Kediri oleh Dian Dwi Hapsari
1406Pengaruh pendapatan asli daerah dan dana alokasi umum (DAU) terhadap tingkat kemandirian keuangan daerah dan tax effort (studi pada pemerintahan kabupaten/kota di Provinsi Jawa Timur) / Adi Firmansyah)
1407Perngaruh motivasi dan disiplin kerja terhadap kinerja pegawai Dinas Pendapatan Pengelolaan Keuangan dan Asset Kabup[aten Malang / Rita Ika Budiana
1408Analisis strategi perusahaan dan peran pimpinan dalam mempertahankan budaya organisasi pada karyawan perusahaan Asuransi Jiwa Bumi Putera 1912 Tulungagung / Lusy Mutiara Sawitri
1409Pengaruh currert ratio, equity multiplier, dan total asset ternover terhadap profitabiltas KPRI Kota Malang tahun 20111 / Dewi Nurmalasari
1410Pengaruh media iklan televisi terhadap minat beli melalui citra merek produk kosmetik merek Wardah (studi kasus pada mahasiswi S1 Manajemen angkatan 2015 Fakultas Ekonomi Universitas Negeri Malang) / Dwihan Septiawan
1411Pengaruh iklan televisi Mie Sedaap "versi Ayam Turbo" terhadap citra merek (studi pada mahasiswa Fakultas Ekonomi Prodi S1 Manajemen 2013 Universitas Negeri Malang / Naranobel Putra Bijaksana
1412Analisis faktor brand equity (studi pada konsumen Lwegee Chocolate Malang) / Eka Febri Anita
1413Pengaruh bauran promosi terhadap keputusan konsumen dalam membeli produk Blackberry (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Ika Noviriani
1414Pengaruh pengembangan karir terhadap motivasi kerja karyawan pada Toko Buku Gramedia Basuki Rachmat Malang / Rifky Rifanda Sakti
1415Pengaruh kualitas jasa terhadap minat peserta didik menggunakan jasa lembaga bimbingan belajar Primagama Malang / Nur Avifah
1416Pengaruh penempatan (positioning) terhadap citra produk : studi pada pengguna kartu hand phone mentari di Fakultas Ekonomi Universitas Negeri Malang Malang / oleh Edi Setiawan
1417Pengaruh pertumbuhan arus kas operasi dan earning per share terhadap return saham (studi pada perusahaan property dan real estate yang listing di BEI periode 2009-2013) / Devi Oktafiana Chori
1418Analisis SWOT sebagai dasar penentuan strategi pemasaran (Studi pada Hotel Mutiara Malang) / Elita Betvania
1419Analisis efisiensi kinerja pada Bank Umum di Indonesia dengan metode Data Envelopment Analysis (DEA) (studi pada perusahaan yang listing di Bursa Efek Indonesia periode 2010-2013) / Emha Andieka Hidayatulloh
1420Peranan analisis cost, volume dan profit sebagai dasar perencanaan laba pada PT. Serbaguna Prima Pare / Vina Andriana
1421Pengaruh ekuitas merek terhadap keputusan pembelian konsumen (studi pada konsumen oli sintetik sepeda motor merek Top 1 di Kota Malang) / Akhmad Rizza Mustaqiem
1422Analisis kerja keuangan pada Koperasi Pegawai Republik Indonesia (KPRI) basis Kantor Kementerian Agama Kota Malang / Alifia Putri Perdani
1423Pengaruh informasi prospektus terhadap initial return (studi pada perusahaan yang melakukan initial public offering (IPO) di Bursa Efek Indonesia periode 2011-2013) / Elmi Rosalia Fathony
1424Pengaruh free cash flow terhadap nilai perusahaan melalui keputusan pendanaan dan kebijakan dividen pada perusahaan manufaktur yang listing di BEI tahun 2012 / Reni Rosalina
1425Analisis faktor-faktor yang mempengaruhi motivasi kerja pegawai fungsional umum kantor Balai Pengkajian Teknologi Pertanian (BPTP) Karangploso-Malang-Jawa Timur / Enggar Dwi Wahyuni
1426Pengaruh kualitas pelayanan terhadap kepuasan konsumen dalam menggunakan jasa transportasi: studi kasus pada PT. Bouroq Indonesia Airlines oleh Ria Wahyu Purwanti
1427Pengaruh personal selling dan kualitas layanan terhadap keputusan konsumen membeli kaset DVD (studi pada Flamboyan DVD 16th Mall Olympic Garden, Malang) / Efka Avilis Asnan
1428Pengaruh kepuasan pelanggan terhadap loyalitas pelanggan Hotel Sri Lestari (Tugu) Blitar / Ferri Bagus Setiawan
1429Analisis komparatif rasio kebangkrutan altman antara bank konvensional dan bank syariah di Indonesia tahun 2011 / Rizka Yunita
1430Pengaruh kualitas produk terhadap kepuasan konsumen notebook Toshiba (studi pada mahasiswa Jurusan Manajemen Universitas Negeri Malang) / Gahana Pracimayasa Budaya
1431Pengaruh pengalaman kerja dan pelatihan karyawan terhadap kinerja (studi pada karyawan PT PLN Persero Malang) / Irfan Priandana
1432Analisis SWOT sebagai dasar perumusan strategi pemasaran online produk fashion pada Suka-suka Shop Malang / Amelindha Vania
1433Pengaruh kualitas pelayanan jasa terhadap loyalitas nasabah Bank BNI 46 Malang (studi pada nasabah BNI 46 Malang Kantor Cabang Pembantu Universitas Negeri Malang) / Mohammad Iman Fahrian
1434Pengaruh cash ratio, dan debt equity ratio terhadap harga saham (studi kasus pada perusahaan farmasi yang listing di Bursa Efek Indonesia periode 2009-2013 / Yoga Aditya Pratama
1435Pengaruh budaya organisasi, kepuasan kerja karyawan terhadap kinerja perusahaan (studi pada Bank Mandiri KCP Malang Sawojajar) / M. Kharisudin Dwi A.P.
1436Pengaruh atribut produk terhadap keputusan pembelian laptop Asus (syudi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Univesitas Negeri Malang angkatan 2012) / M. Rifanudin H. Candra
1437Pengaruh kecerdasan emosional terhadap kinerja karyawan melalui motivasi kerja (studi pada karyawan perusahaan daerah Jasa Yasa Kabupaten Malang) / Ficky Adi Purwoko
1438Pengaruh citra merek terhadap keputusan pembelian kartu seluler Simpati (studi pada siswa kelas XI SMA Negeri 1 Lumajang) / Pradipta Fitri Apriyanto
1439Pengaruh ukuran perusahaan, profitabilitas, dan harga saham terhadap praktik perataan laba pada perusahaan manufaktur asing di Indonesia yang listing di bursa efek Indonesia tahun 2004-2006 / Rachma Aulia
1440Pengaruh Earning Per Share (EPS), Debt To Equity Ratio (DER), return On Investment (ROI), return On Equity (ROE), dan Divident Payout Ratio (DPR) terhadap harga saham industri farmasi yang listing di bursa efek Indonesia / Yossi Oktavia
1441Pengaruh tayangan iklan televisi dan citra merek terhadap keputusan konsumen dalam membeli kartu seluler IM3 (studi pada mahasiswa Fakultas Ekonomi Universitas Negeri Malang) / Stevanus Surya Murti
1442Pengaruh kualitas pelayanan terhadap loyalitas nasabah produk tabungan (studi pada nasabah BTN Malang) / Fivi Handayani
1443Pengaruh bauran pemasaran terhadap loyalitas konsumen menonton film di bioskop Matos 21 Malang / Damayanti Wismaningtyas
1444Pengaruh atmosfer toko dan promosi penjualan terhadap perilaku pembelian spontan (studi pada swalayan Golden Tulungagung) / Indah Linawati Octavia
1445Analisis Pengaruh Stock Split Terhadap Trading Volume Activity Saham (Studi Kasus Pada Perusahaan Go Public Yang Listing Di BEJ Perid 1 Januari 2001 - 31 Desember 2003) oleh Yiyin Ayatin
1446Pengaruh citra merek dan harga terhadap kepuasan konsumen (studi kasus pada konsumen motor matic Yamaha Mio J CW di Dealer Motor Yamaha YES Mojokerto / Firman Ghani Wicaksono
1447Pengaruh perubahan Current Ratio, perubahan Deb to Equity Ratio dan perubahan Net Profit Margin terhadap perubahan sisa hasil usaha pada koperasi karyawan di Mojokerto tahun 2006-2010 / Ferry Diansyah
1448Pengaruh leader member exchange terhadap komitmen organisasi melalui kepuasan kerja (studi kasus pada karyawan PT. Miswak Utama Bangil Pasuruan) / Venny Andriasari
1449Pengaruh harga dan kualitas produk terhadap keputusan pembelian Oppo Smartphone (studi pada mahasiswa pengguna Oppo Smartphone Prodi S1 Manajemen angkatan 2015 di Fakultas Ekonomi Universitas Negeri Malang / iyanti Adlina
1450Pengaruh likuiditas terhadap profitabilitas melalui size perusahaan pada erusahaan makanan minuman yang listing di Bursa Efek Indonesia (BEI) periode 2010-2014 / Allan Denyzhar
1451Analisis faktor keputusan pembelian tiket secara online (e-ticketing) (studi pada penumpang PT. Kereta Api Indonesia (Persero) Stasiun Malang) / Suwarno
1452Pengaruh kompensasi dan motivasi terhadap kinerja karyawan Bagian Operasional Malang Town Square / Irviandi Rahmadani
1453Pengaruh kompensasi dan keterlibatan kerja pada kinerja karyawanBagian Operasional Malang Town Square / Fandi Achmad Riza
1454Pengaruh suku bunga SBI, nilai tukar rupiah, ukuran perusahaan dan Debt to Equity Ratio (DER) terhadap yield obligasi korporasi periode 2014-2015 / Nurul Azizah
1455Pengaruh Cash Position (CP), Return On Equity (ROE) dan Debt to Equity Ratio (DER) terhadap Dividend Payout Ratio (DPR) melalui Earning Per Share (EPS) pada perusahaan manufaktur yang listing di BEI tahun 2015 / Tedy Tri Wicaksono
1456Pengaruh CAR (Capital Adequacy Ratio), FDR (Financing to Deposit Ratio) dan BOPO (Beban Operasional Pendapatan Operasional) terhadap perubahan laba bank syariah yang listing di BEI periode 2013-2014 / Faradhila Maharani
1457Pengaruh periklanan dan citra merek terhadap keputusan pembelian kartu seluler IM3 (studi pada siswa kelas X SMA Negeri 2 Nganjuk) / Gilang Wahyu Wieddagdo
1458Analisis komparatif tingkat kesehatan bank dengan pendekatan Risk-Based Bank Rating (RBBR) antara bank konvensional dan bank syariah tahun 2014-2015 / Marinta Nurryayanti
1459Penerapan public relation melalui program wisata pos (studi pada PT. Pos Indonesia Kantor Pos Lumajang) / Diaz Prawidya Mukti
1460Pengaruh intellectual capital terhadap nilai perusahaan dengan Return On Asset (ROA) sebagai variabel intervening pada perusahaan real estate and property yang terdaftar di Bursa Efek Indonesia tahun 2014-2015 / Regina Setyaningsih
1461Analisis tingkat kesehatan koperasi simpan pinjam Kota Malang pada tahun 2013-2015 / Miftahul Sari
1462Pengaruh kepercayaan dan kepuasan terhadap loyalitas pelanggan (studi pada pelanggan bengkel Yoyota Kartika sari Malang) / Gaby Anggaeno Leonanda
1463Pengaruh struktur modal terhadap profitabilitas Koperasi Pegawai Republik Indonesia (KPRI) Kota Malang tahun 2013-2015 / Nissya Endah Ismawati
1464Perbandingan tingkat kesehatan pada BPR konvensional dan syariah di Jawa Timur periode 2015-2016 (penerapan metode Altman Bankruptcy Formula dan RGEC) / Arista Dian Permana
1465Pengaruh relationship marketing terhadap kepuasan pelanggan berdasarkan persepsi pelanggan (studi pada bengkel AHASS 8111 Kembang Jawa Motor Trenggalek) / Rahma Dwi Trissahidah
1466Pengaruh gaya kepemimpinan transformasional dan lingkungan kerja terhadap kepuasan kerja karyawan PT Bank Rakyat Indo-nesia (Persero) Tbk Kantor Cabang Blitar / Dian Nur Hayati
1467Pengaruh consumer ethnocentrism dan brand image terhadap niat pembelian produk kosmetik Wardah (studi pada mahasiswa Jurusan Manajemen angkatan 2014/2015 Universitas Negeri Malang) / Rina Karina
1468Pengaruh intellectual capital dan kepemilikan manajerial terhadap nilai perusahaan yang dimoderasi oleh CSR pada perusahaan property dan real estate yang terdaftar di BEI tahun 2012-2015 / Vivi Septiviana
1469Pengaruh citra merek, kualitas produk, harga, dan promosi terhadap keputusan pembe;lian lispstik Oriflame (studi pada mahasiswa Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2014-2015) / Putri Nur Mayasari
1470Pengaruh promosi online dengan instagram terhadap keputusan pembelian produk fashion melalui citra merk / Cian Shafarahil
1471Pengaruh kepercayaan terhadap kepuasan pelanggan: moderasi customer experience pada Malaka Tour Organizer / Kristin Kusuma Wardani
1472Pengaruh persepsi bauran promosi terhadap kepuasan pelanggan pada Julian Potts Soekarno-Hatta Malang / Lia Tri Ningtyas
1473Pengaruh Return On Asset (ROA) dan Debt to Equity Ratio (DER) terhadap initial return (studi pada perusahaan yang melakukan Initial Public Offering (IPO) di Bursa Efek Indonesia periode 2009-2015) / Dea Fika Siswahyu
1474Pengaruh struktur modal dan ukuran perusahaan terhadap nilai perusahaan pada perusahaan property and real estate yang listing di BEI periode 2014-2015 / Sri Ani
1475Pengaruh penggunaan celebrity endorser Raisa terhadap proses keputusan pembelian produk Sunsilk (studi eksperimen pada mahasiswa Manajemen Fakultas Ekonomi UM tahun 2015-2016) / Rachma Sri Agustin
1476Pengaruh kepercayaan dan kualitas informasi terhadap kepuasan konsumen dalam bertransaksi secara online pada konsumen kategori fashion wanita dan fashion pria / Novi Yupitasari
1477Pengaruh profitabilitas terhadap kebijakan dividen melalui struktur modal (studi pada perusahaan manufaktur yang terdaftar di BEI ahun 2015) / Jujuk Noviana
1478Pengaruh iklan TV dan promosi penjualan terhadap keputusan pembelian provider kartu seluler Simpati (studi pada mahasiswa Jurusan Manajemen Fakultas Ekonomi Universitas Negeri Malang angkatan 2014) / Sandy Geptarana
1479Profil praktik MSDM pada industri opak gambir Sekar Mawar Blitar / Yana Anggraini
1480Pengaruh stres kerja terhadap turnover intention pekerja melalui kepuasan kerja di UMKM pengplahan tahu (Tahu RT, Industri Tahu RDS dan Tahu Duta) di Malang / Aditya Baskoro
1481Pengaruh kualitas layanan terhadap loyalitas pelanggan (studi pada pelanggan Champion Futsal De Rumah Malang) / Ahmad Taufan Anugrah
1482Pengaruh green marketing terhadap keputusan pembelian mobil low cost green car Daihatsu Ayla (studi pada konsumen Daihatsu Jolo Abadi Malang) / Amireza Ardiansyah
1483Pengaruh komunikasi internal dan disiplin kerja terhadap kinerja karyawan (studi pada karyawan non medis rumah sakit Wava Husada Kepanjen) / Ethika Maria Krissanti
1484Pengaruh free cash flow terhadap return saham melalui dividend policy (studi pada perusahaan yang listing di BEI tahun 2013-2015 / Lisa Rahayu Ningsih
1485Kebijakan pendanaan pada Garbage Clinical Insurance dalam merawat sustainabilitas bisnis / Chintya Maharani Putri
1486Pengaruh bauran pemasaran terhadap keputusan pembelian pada Distro Three Second (studi pada mahasiswa Universitas Negeri Malang Fakultas Ekonomi P:rodi S1 Manajemen angkatan 2013) / Ryan Aditya Christy
1487Pengaruh kualitas produk dan harga terhadap keputrusan pembelian produk sepatu Sneakers Converse All Star (studi kasus pada mahasiswa Universitas Negeri Malang Fakultas Ekonomi Prosi S1 Manajemen angkatan 2014/2015 / Jelinda Dimarsyah
1488Pengaruh penilaian kinerja terhadap kinerja karyawan melalui kepuasan kerja karyawan Perusahaan Daerah Air Minum (PDAM) Kota Malang /Siti Zahrotul Jannah
1489Pengaruh atribut produk terhadap keputusan pembelian produk sepatu converse ( studi pada mahasiswa Fakultas Ekonomi Prodi S1 Manajemen angkatan 2013-2014 Universitas Negeri Malang / Fanni Yola Ernanda
1490Pembekalan jiwa kewirausahaan untuk komunitas punk dan black metal di Tulungagung / Bekti Arsal Karsih
1491Pengelolaan anggaran pada Malang Town Square (Kasus penyelenggaraan event promosi periode tahun 2015) / Rizka Novelia Permata Citra
1492Pengaruh efikasi diri (self effecation) dan pendidikan kewirausahaan terhadap minat berwirausaha (Studi pada siswa kelas X di SMK Muhammadiyah 5 Kepanjen) / Retno Puji Rahayu
1493Analisis pelaksanaan Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3) pada pengawai outsourcing bagian penyambungan daya baru PT. PLN (Persero) Distribusi Jawa Timur Area Malang Rayon Blimbing / Sinta Dwi Rahayu
1494Pengaruh green marketing terhadap minat pembelian ulang produk tupperware (Studi pada konsumen member tapperware Blitar) / Sri Kuntari
1495Pengaruh pelatihan dan lingkungan kerja non fisik terhadap kinerja karyawan (studi pada karyawan all Center PT. Infomedia. Malang) / Rani Pangesti
1496Pengaruh kualitas jasa dan harga terhadap kepuasan pelanggan (Studi pada pelanggan AL-Shahba Umroh & Haji Plus Cab Malang) / Iin Wahyuni Aprilia
1497Pengaruh atribut produk terhadap keputusan pembelian air minum kemasan merek Hexahaq (studi pada pelanggan air minum kemasan Hexahaq di Trenggalek, Jawa Timur) / Galif Ausrilia Reka Bahari
1498Pengaruh brand trust terhadap proses keputusan pembelian pengguna smarthphone merek Iphone (studi pada mahasiswa prodi S1 Manajemen Fakultas Ekonomi Universitas Negeri Malang Angkatan 2013 / Wahyu Dian Ningrum
1499Pengaruh harga dan atmosfer toko terhadap kepuasan konsumen (studi pada Urban Pop Cafe Sawojajar Malang) / Adhitya Mahatva Yodha
1500Pengaruh debt financing dan equity financing terhadap return on assets Bank Umum Syariah tahun 2013-2015 / Katrin Yuliani
1501Pengaruh job involvement dan kompensasi terhadap kepuasan kerja karyawan Taman Indie Resto Malang / Dwi Robby Ilham
1502Penggunaan metode Pearls untuk menilai tingkat kesehatan koperasi simpan pinjam Kabupaten Malang tahun 2013-2015 / Audia Rahmawati
1503Pengaruh perputaran modal kerja terhadap profitabilitas melalui efisiensi pengendalian biaya pada Koperasi Karyawan Kabupaten Malang tahun 2013-2015 / Dewi Puspitaningrum
1504Pengaruh perputaran modal kerja terhadap leverage melalui Return On Asset (ROA) (studi pada perusahaan manufaktur food and beverage yang listing di BEI periode tahun 2012-2015) / Izazi Zata Adzhani
1505Pengaruh informasi non keuangan terhadap initial return pada perusahaan yang melakukan Initial Public Offering (IPO) periode tahun 2009-2015 / Ardhis Ayu Pratiwi
1506Pengaruh manajemen laba terhadap return saham di sekitar IPO perusahaan yang terdaftar di BEI periode 2009-2015 / Fitria Rizki Febrianti
1507Manajemen pengelolaan modal kerja (studi pada CV Kajeye Food) / Cuculiya Duwi Ayu Raraswati
1508Analisis tingkat financial distress pada perusahaan pertambangan batu bara yang lsiting di BEI dengan menggunakan modal ohlson (O-Score) periode 2011-2013 / Harni Windan Sari
1509Pengaruh reward terhadap turnover intention dengan komitmen organisasional sebagai variabel intervening (studi pada karyawan golongan I dan II Pabrik Gula Djatiroto) / Andi Arianto
1510Analisis Initial Public Offering (IPO) pada hot (cold) market di Busa Efek Indonesia periode 2001 - 2016 / Oktalia Devi Suwandi
1511Pengaruh motivasi dan komitmen organisasi terhadap kinerja karyawan call center 147 bagian complain PT. Infomedia Telkom Blimbing Malang / Annisa Marchelina Budianti
1512Pengaruh brand image terhadap minat beli Piaggio Vespa Matic Primavera I-Get / Rakha Rizal Amin
1513Pengaruh kualitas produk terhadap kepuasan konsumen Asus Smartphone (studi pada mahasiswa pengguna Asus Smartphone Prodi S1 Manajemen angkatan 2014/2015 dan 2015/2016 FE UM) / Bella Stia Mahardhika
1514Pengaruh atribut produk terhadap kepuasan berdasarkan persepsi pelanggan (studi pada klub mobil Honda Jazz "JFC" Jass Fit Club di Malang) / Arif Adi Kusuma
1515Pengaruh job involvement dan dukungan organisasi terhadap komitmen organisasional karyawan PG Redjosarie Kab. Magetan / Ratna Dewi Dyah Rikmaratri
1516Pengaruh kebijakan dividen terhadap leverage yang dimoderasi oleh variabel firm size pada perusahaan manufaktur yang listing di Bursa Efek Indonesia tahun 2013-2015 / Fitri Rahayuningsih