Penelitian Tindakan Kelas :: UPT Perpustakaan UM

JudulPenerapan model discovery untuk meningkatkan pembelajaran IPA pada siswa kelas III SDN Bokor Kecamatan Tumpang, Kabupaten Malang oleh Irmawiherlina
Pembimbing1. Sri Estu Winahyu; 2. Heru Agus Triwidjaja
Penerbitan2016, S1 Program Studi Pendidikan Guru Sekolah Dasar.
LabelRs 372.357044 IRM p


Irmawiherlina.2016. Penerapan Model DiscoveryUntukMeningkatkanPembelajaran IPA PadaSiswaKelas III SDN BokorKecamatanTumpang, Kabupaten Malang.Skripsi. Program Studi S1 Pendidikan Guru SekolahDasar. JurusanKependidikanDasardanPrasekolah.FakultasIlmuPendidikan. UniversitasNegeri Malang.Pembimbing (I) Dra. Sri EstuWinahyu, M.Pd, (II) Drs. HeruAgusTriwidjaja, M.Pd.

Kata Kunci:IlmuPengetahuanAlam, Pembelajaran, Model Discovery

Dari hasilobservasidengan guru kelas III, diperolehtemuanpembelajaran yang dilakukanoleh guru yaitudalamPembelajaran IPA guru sudahberusahauntukmengaktifkansiswadengancaramemberipertanyaan-pertanyaankepadasiswanamunsiswabelummerespondenganbaikdanaktivitassiswarendahterlihatdarisebagiansiswaterlihatpasif. Hal iniberdampakpadahasilbelajarmatapelajaran IPA rendahyaitu67.15, tidakmencapai KKM yang ditentukansekolahyaitu 70.

Penelitianinibertujuanuntukmendeskripsikanpenerapan model Discoverydalampembelajaran IPA kelas III SDN,aktivitasbelajarsiswasaatpenerapan model Discoverydalampembelajaran IPA Kelas III, hasilbelajarsiswasetelahpenerapan model Discoverydalampembelajaran IPA kelas III materienergigerak di kelas III.

PenelitianinimenggunakanmetodePenelitianTindakanKelas yang dilakukandalamduasiklus.Dalamsetiapsiklusada 2x pertemuandantiappertemuanterdiridari 4 tahapyaituperencanaan, tindakan, observasidanrefleksidenganpendekatankualitatif. Subjekpenelitianadalahsiswa yang berjumlah 37 siswayang terdiridari 15 siswalaki-lakidan 22 siswaperempuan.Teknikpengumpulan data adalahobservasi, tesdandokumentasi.

Hasilpenelitianmenunjukkanbahwapenerapan model Discovery di kelas III dapatdilaksanakansesuaidenganperencanaan. Terbuktidarikesesuaianlangkah-langkahpembelajaranguru denganRencanaPelaksanaanPembelajaran model Discoverypadasiklus I memperolehskor 80, tampakmengalamipeningkatanpadasiklus II denganskor 87 demikian pula denganaktivitasdanhasilbelajarsiswa yang telahmeningkatsetelahmenggunakan model Discovery. Denganskor rata-rata keberhasilanaktivitassiswapadasiklus 1 memperolehskor 59 padasiklus II memperolehskor 68 Untukhasilbelajarsiswapadasiklus 1 mendapatskor rata-rata 67.15, sedangkanpadasiklus II meningkatmenjadi 87.81

BerdasarkanhasilpenelitiandapatdisimpulkanbahwapenerapanDiscoverydapatmeningkatkanpembelajarandenganditandaimeningkatnyaaktivitasdanhasilbelajarsiswa.PadapenerapanDiscoverymelibatkanaktivitassiswasecarapenuh, sehinggamemerlukanpengelolaankelas yang terencana, untukituapabila guru maumenerapkan model Discoverydisarankansebelummelaksanakanpembelajarandengan model Discovery, sebaiknyadilakukanperencanaan yang matangterlebihdahuluuntukmenghindarikekacauandalamkelas.

P.T.K yang memiliki kemiripan dengan diatas

1Penerapan model belajar investigasi kelompok (group investigation) untuk meningkatkan pembelajaran IPA pada siswa kelas V SDN Soso 03 Kecamatan Gandusari Kabupaten Blitar / Nining Ramadani Apriliana
2Penerapan model Student Teams Achievement Division (STAD) untuk meningkatkan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Purworejo 03 Kabupaten Madiun / Fakhriyatu Zahro
3Pemberdayaan lembar kerja siswa untuk meningkatkan aktivitas belajar siswa pada pembelajaran IPA kelas IV SDN Popoh 3 Kecamatan Selopuro Kabupaten Blitar / Irfa Nurohmah
4Penerapan metode eksperimen untuk meningkatkan kemampuan sains permulaan pada anak didik kelompok A TK Negeri Pembina Kota Blitar / Anis Masriyah
5Penerapan guided discovery learning dalam pembelajaran IPA untuk meningkatkan penguasaan konsep bagian-bagian tumbuhan pada siswa kelas II SDN Pringo kecamatan Bululawang kabupaten Malang / Yulis Purwati
6Penerapan metode inkuiri untuk meningkatkan penguasaan konsep energi gerak pada mata pelajaran IPA kelas III SDN Pakisaji 02 / Sutirah
7Penerapan strategi bertanya dengan media gambar untuk meningkatkan pemahaman tentang pengaruh lingkungan fisik terhadap daratan pada siswa kelas IVB SDN Kandangan III/621 Surabaya / Ahmad Murdi
8Penggunaan media benda konkrit untuk meningkatkan pembelajaran siswa kelas IV tentang gaya di SDN Rampal Celaket 2 Malang / Erna Juwariyah
9Pemanfaat media tiruan kerangka untuk meningkatkan pembelajaran IPA di kelas IV SDN Ketawanggede 1 Kecamatan Lowokwaru Kota malang / Supriyatin
10Pemanfaatan media alam sekitar untuk meningkatkan hasil belajar siswa dalam pembelajaran tematik tema lingkungan di kelas II C SDN Percobaan 2 Malang / Toni Tulus Santoso
11Penggunaan media konkrit untuk meningkatkan konsepsi siswa kelas IV tentang gaya di SDN Tamanayu 03 / Fitri Yuliani
12Pemanfaatan media kartu gambar untuk meningkatkan aktivitas dan hasil belajar siswa kelas V tentang persebaran flora dan fauna wilayah Indonesia di SDN Kandung, Kecamatan Winongan, Kabupaten Pasuruan / Agus Budiono
13Implementasi media pembelajaran CD interaktif untuk meningkatkan pembelajaran IPA siswa kelas V SDN BI Tlogowaru Kota Malang / Wahyu Aditia Ghafur P.
14Penerapan model pembelajaran kontekstual berbantuan media VCD untuk meningkatkan pelajaran IPA lingkungan fisik terhadap daratan siswa kelas IV SDN Lakarsantri III/474 Surabaya / Nunuk Nularsih
15Pemanfaatan media audio visual untuk meningkatkan pembelajaran IPA pada siswa kelas V SDN Kemiriswu 2 Pasuruan / Junaedi Nugroho
16Penggunaan peralatan seqip untuk meningkatkan pembelajaran sains siswa kelas V SDN Tidu I Kecamatan Pohjentrek Kabupaten Pasuruan / Romlah
17Penggunaan media macromedia flash professional 8 untuk meningkatkan pembelajaran IPA siswa kelas VI SDN Tunjungsekar 1 Malang / Wildan Akhsana
18Penggunaan media film dan video interaktif untuk meningkatkan kualitas pembelajaran metamorfosis hewan di kelas IV SDN Sumbermanjingkulon 05 Kecamatan Pagak Kabupaten Malang / Dina Rosikkawati
19Penerapan model pembelajaran sains teknologi masyarakat untuk meningkatkan pembelajaran IPA siswa kelas V di SDN Bumiayu 3 Kecamatan Kedungkandang kota Malang / Eva Chandra Qodarsih
20Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar IPA siswa kelas V SDN Pandanwangi 2 Kecamatan Blimbing Kota Malang / Ribut Widianti
21Penerapan metode inkuiri dipadu dengan reciprocal teaching pada mata pelajaran sains untuk meningkatkan kemampuan berpikir dan aktivitas siswa kelas V Madrasah Ibtidaiyah Wahid Hasyim III Malang / Devi Taulina Wati
22Penerapan model learning cycle pada pembelajaran IPA untuk meningkatkan pemahaman konsep siswa tentang gaya magnet di kelas V SDN Kendalpayak / Ayu Kusuma Murti
23Penggunaan model Snowball Throwing untuk meningkatkan pembelajaran IPA kelas V SDNU Bangil / Achmad Zahron
24Penerapan model learning cycle untuk meningkatkan pembelajaran IPA siswa kelas IV SDIT Wildan Mukholladun Kecamatan Nglegok Kabupaten Blitar / Khusnul Khotimah
25Penerapan model problem based learning untuk meningkatkan keaktifan dan hasil belajar IPA siswa kelas V SDN Karangmenggah Wonorejo Pasuruan / Alfitriatun Nurun Alfiah
26Penerapan model pembelajaran kooperatif tipe word square pada mata pelajaran ilmu pengetahuan alam (IPA) pokok bahasan energi dan penggunaan untuk meningkatkan hasil belajar siswa kelas IV di SDN Srimulyo 05 Kecamatan Dampit / Sellvia Kusuma Wardani
27Penerapan model pembelajaran ABC (Anticipation, Building Knowledge and Consolidation) pada materi jarak, waktu dan kecepatan untuk meningkatkan kemampuan berpikir kritis (siswa kelas V SD Negeri Kapota Yudha Makassar) / Asmain
28Penerapan model talking stick untuk meningkatkan pembelajaran IPA siswa kelas 3A SDN Sumberkradenan Kecamatan Pakis / Ribka E. Talomanafe
29Penerapan model kooperatif tipe think pair share berbantuan media gambar untuk meningkatkan motivasi dan hasil belajar IPA siswa kelas IV SD Inpres Mangga Dua Kabupaten Merauke / Yonarlianto Tembang
30Penerapan model peta konsep untuk meningkatkan kualitas pembelajaran IPA di kelas IV SDN Kandung Winongtan Kabupaten Pasuruan / Nailil Afifah
31Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Karangbesuki 1 Kecamatan Sukun Kota Malang / Arniati
32Penerapan model two stay two stray untuk meningkatkan kemampuan bertanya dan menjawab pada siswa kelas V SDN 2 Curahsuri Kabupaten Situbondo / Agung Widyatama
33Penerapan model inkuiri terbimbing untuk meningkatkan aktivitas dan hasil belajar siswa kelas III pada materi gerak benda di SDN Sidokepung I Sidoarjo / Heni Nurul Hidayah
34Penerapan model pembelajaran index card match untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas VI di SDN Kedungsalam 5 / Ratih Purnama Dewi
35Penerapan strategi pembelajaran inkuiri untuk meningkatkan aktivitas dan hasil belajar IPA pada siswa kelas III SDN Sudimoro 02 Kecamatan Bululawang Kabupaten Malang / Sukartono
36Penerapan metode inkuiri dengan bantuan media audio-visual dalam meningkatkan keaktifan dan prestasi belajar IPA / Harmilawati
37Penerapan model complete setence berbasis gambar untuk meningkatkan kemampuan mendeskripsikan benda siswa kelas II SDN Karang Besuki 01 kota Malang / Yuliawati Ma'sum
38Penerapan model pembelajaran think pair share untuk meningkatkan hasil belajar IPA siswa kelas V SDN Bendo 2 Kecamatan Kepanjenkidul Kota Blitar / Albina Djondjonler
39Penerapan model Sains Teknologi Masyarakat (STM) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Sendang I Kecamatan Senori Kabupaten Tuban / Diah Novitasari Jauhari
40Penerapan model deep learning untuk meningkatkan hasil pembelajaran IPS siswa kelas III SDN Lesanpuro 3 Kecamatan Kedungkandang Kota Malang / Lodia Wayerjuari
41Penerapan model mind mapping untuk meningkatkan pembelajaran IPA pada kelas V SDN Pandesari 05 Kabupaten Malang / Sucy Aprillia Wahyuningtyas
42Penggunaan model kontekstual untuk meningkatkan pembelajaran IPA siswa kelas IV di SDN Jatisari IV Kecamatan Purwodadi Kabupaten Pasuruan / Firda Firdaus Arianto Putri
43Penerapan model group investigation untuk meningkatkan aktivitas dan hasil belajar siswa pada pembelajaran IPA di kelas V SDN Mabung 2 Kabupaten Nganjuk / Wachiddaning Tiara Supardi
44Penerapan model inkuiri untuk meningkatkan pembelajaran IPA di kelas V pada materi magnet SDN Bandungrejosari 1 Kota Malang / Ruli Diyan Aprianoto
45Pembelajaran kooperatif tipe Student Teams Achievement Divisions (STAD) berbantuan media powerpoint untuk meningkatkan motivasi dan hasil belajar IPA siswa kelas V SDN Negeri 18 Parepare / Sultan
46Penerapan model pembelajaran inkuiri terbimbing berbantuan mind map untuk meningkatkan motivasi dan hasil belajar IPA siswa kelas V SDN 2 Lamokato Kabupaten Kolaka / Sovya Nur Kartika
47Penerapan model SAVI untuk meningkatkan pembelajaran IPA kelas IV di SDN Wates 6 Mojokerto / Dewi Oktaviana
48Penerapan bermain sains sederhana benda terapung, tenggelam, dan melayang untuk meningkatkan kemampuan kognitif anak kelompok B2 di TK Katolik Sang Timur Malang / Ekaristiana Sihombing
49Meningkatkan kemampuan penalaran siswa dengan model problem based learning pada pelajaran IPA di kelas IV SDN 1 Serut Kabupaten Tulungagung / Kurnia Dwi Puspita
50Penerapan model pembelajaran kooperatif tipe Student Teams Achiement Divisions (STAD) dalam meningkatkan keaktifan dan hasil belajar IPA pada siswa kelas V semester 2 SDN Jenggolo 2 Kepanjen / Dwi Nurma Yunita
51Penerapan model siklus belajar untuk meningkatkan pembelajaran IPS kelas IV MI As-Sholihin Rebalas Grati Pasuruan / Misbahul Munir
52Penerapan model pembelajaran two stay two stray untuk meningkatkan pembelajaran IPA siswa kelas V SDN Tanjungrejo 2 Malang / Ning Wijaya
53Penerapan model assure untuk meningkatkan pembelajaran IPA kelas V SDN Madyopuro 4 Kota Malang / Maria Singerin
54Meningkatkan pembelajaran IPA menggunakan pendekatan contextual teaching and learning siswa kelas VB SDN Madyapuro 4 Kecamatan Kedungkandang kota Malang / Paulina Karam
55Penerapan model contextual teaching and learning (CTL) untuk meningkatkan pembelajaran IPS siswa kelas III E MIN Malang I / Mutik Atul Khoiriyah
56Upaya meningkatkan pembelajaran IPA melalui model somatic auditory visualization intellectualy pada siswa kelas V SDN Sumberagung I Kecamatan Plosoklaten / Amalia Rohmatu Mafida
57Penerapan model inkuiri untuk meningkatkan pemahaman konsep pengaruh perubahan lingkungan fisik terhadap daratan pada siswa kelas IV SDN Bumiayu 3 Malang / Indah Siatin
58Penerapan model pembelajaran Sains Teknologi Masyarakat (STM) untuk meningkatkan pembelajaran IPA siswa kelas 4 SDN Bandulan 4 Kota Malang / Lutfia Nur Azizah
59Penerapan model problem solving untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas IV SDN Kedungkandang 2 Kota Malang pada pembelajaran IPA / Imroatul Latifah
60Penerapan model Problem Based Learning (PBL) untuk meningkatkan pembelajaran IPA siswa kelas V-C di SDN Model Kota Malang / Novita Wulandari
61Penerapan model inkuiri untuk meningkatkan pembelajaran IPA materi daur air kelas V SDN Bandungrejosari 1 Malang / Siska Prabhandhari
62Penerapan model jigsaw dalam meningkatkan pembelajaran IPA kelas IV SDN Citrodiwangsan 01 Lumajang / Vivi Arum Lestari
63Penerapan model pembelajaran Predict, Observe, and Explain (POE) untuk meningkatkan kualitas pembelajaran IPA kelas V SDN Pisangcandi 4 Malang / Winda Ayu Ningtyas
64Penerapan model pembelajaran Two Stay Two Stray (TSTS) untuk meningkatkan kualitas pembelajaran IPA kelas VA SDN Pakunden 2 Kota Blitar / Arifendi Ahwanto
65Penerapan model Learning Cycle (LC) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN 2 Bloro Kecamatan Besuki Kabupaten Situbondo / Fitriana Dwi Kartika
66Penerapan model Learning Cycle (LC) 5 fase untuk meningkatkan pembelajaran IPA siswa kelas IV B SDN Penanggungan Kota Malang / Choirul Anam
67Implementasi model learning cycle untuk meningkatkan pembelajaran IPA pada materi pesawat sederhana di kelas V SDN Sawojajar 2 Malang / Bunga Lena Mayangsari
68Penerapan model interaktif untuk meningkatkan pembelajaran IPA siswa kelas V SDN Kalisongo 3 Kecamatan Dau Kabupaten Malang / Afifah Surohmah
69Penerapan model investaigasi kelompok untuk meningkatkan pembelajaran IPA kelas V SDN Suwayuwo I Kecamatan Sukorejo Kabupaten Pasuruan / Ninik Fatmawati
70Penerapan strategi contextual teaching and learning (CTL) untuk meningkatkan pembelajaran IPA kelas IV SDN Kesatrian 2 Malang/ Nurul Puadiyah
71Penerapan model learning cycle untuk meningkatkan aktivitas dan hasil belajar IPA materi sumber daya alam kelas IV SDN Gaprang 03 Kabupaten Blitar / Muhamad Rizqi Mubarok
72Penerapan model learning cycle untuk meningkatkan pembelajaran IPA kelas V di SDN Mergosono 5 Kota Malang / Fenny Setiowati
73Penerapan model pembelajaran Two Stay Two Stray (TSTS) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Negmbul 03 Kabupaten Blitar / Siti Maskiatun Nikmah
74Penerapan model Explicit Instuction untuk meningkatkan kualitasa pembelajaran IPA siswa kelas IV A Sdn Lesanpuro 3 Kota Malang / Ayuk Susilaning Stiyas
75Penerapan model learning tournament untuk meningkatkan kualitas pembelajaran IPA siswa kelas IV SDN Binangun 2 Blitar / Nayla Nurul Husna
76Meningkatkan kemampuan siswa menjelaskan dalam pembelajaran IPA kelas V melalui model siklus belajar 5E di SDN Karangtengah 3 Kota Blitar / Windra Jemi Rokhmad
77Penerapan model Contetextual Teaching and Learning (CTL) untuk meningkatkan pembelajaran IPA kelas IV SDN Sambigede 01 Sumberpucung-Malang / Yayuk Yuliawati
78Penerapan model quantum teaching untuk meningkatkan pembelajaran IPA kelas V SDN 4 Besuki Kabupaten Trenggalek / Eka Putri Lestari
79Penerapan model eksperimen untuk meningkatkan pembelajaran IPA kelas IVB di SDN Sawojajar 1 Kota Malang / Lulu Andriyani
80Penggunaan pendekatan contekstual teaching and learning (CTL) dengan teknik inkuiri dalam meningkatkan motivasi siswa pada pembelajaran IPA kelas V MI Hidayatul Mubtadi'in Kabupaten Pasuruan / Iin Indrawati
81Penerapan media belajar multi dimensi untuk meningkatkan aktivitas dan pemahaman konsep pada pelajaran IPA kelas III di SDN Lakarsantri III - 474 Surabaya / Wahyu Supriyati
82Pemanfaatan lingkungan sekitar untuk meningkatkan pemahaman konsep IPA di kelas V SDN Dayu 2 Kecamatan Nglegok Kabupaten Blitar / Hendra Retno Setiawan
83Meningkatkan pemahaman konsep perubahan benda melalui metode discovery pada siswa kelas V SDN Tundosoro Kabupaten Pasuruan / Sri Astutik
84Penerapan pendekatan keterampilan proses untuk meningkatkan pemahaman konsep IPA siswa kelas V SDN Kertosari I Kabupaten Pasuruan / Badrus Shochich M.
85Penerapan model pembeljaran concept attainment untuk meningkatkan pemahaman siswa tentang globalisasi di kelas IV SDN Rembang Kecamatan Rembang Kabupaten Pasuruan / Esterlina Watratan
86Meningkatkan pembelajaran IPA siswa kelas IV SDN Sawojajar 5 melalui pembelajaran kooperatif model two stay two stray / Sulikin Agus Purwanto
87Penerapan mind mapping berbasis eksperimen untuk meningkatkan pembelajaran IPA siswa kelas IV di SDN Sombron Kabupaten Nganjuk / Gagik Adi Wibowo
88Penerapan model discovery untuk meningkatkan pembelajaran IPA di kelas IV MI Bahrul Ulum Kecamatan Pandaan / Li'ana
89Penerapan research training model untuk meningkatkan pembelajaran IPA siswa kelas VA SDN Ketawanggede Kota Malang / Indah Kusuma Budiarti
90Pemanfaatan lingkungan alam sekitar untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Gadang 1 Kecamatan Sukun Kota Malang / Ely Kristiyana Cahyaningtrang
91Penerapan siklus belajar 5E untuk meningkatkan keterampilan menjelaskan konsep dalam pembelajaran IPA siswa kelas IV SDN I Buntaran Kecamatan Rejotangan Kabupaten Tulungagung / Lini Anggraeni Rahayu
92Penerapan pembelajaran berbasis masalah untuk meningkatkan kemampuan berpikir siswa kelas III SD Laboratorium Universitas Negeri Malang / oleh Dian Siskarini
93Penerapan model pembelajaran discovery untuk meningkatkan pembelajaran IPA siswa kelas V di MI Miftahul Ulum Kejapanan / Ismaul Chusnah
94Meningkatkan pembelajaran IPA melalui pendekatan CTL pada siswa kelas V SDN Panggungrejo kota Pasuruan / Panji Kusumah
95Penerapan model pembelajaran contextual teaching and learning untuk meningkatkan pembelajaran IPA kelas III SDN Punten I kota Batu / Arline Oktavia Jaya Sari
96Penerapan pendekatan kontekstual untuk meningkatkan pembelajaran IPA siswa kelas V SDN Curahdukuh II / Supardi
97Penerapan pendekatan CTL untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Wonorejo I kecamatan Lumbang / Nur Aisah
98Penerapan pembelajaran kontekstual dengan metode inkuiri dalam upaya meningkatkan motivasi, aktivitas, dan hasil belajar sains pada siswa kelas V Madrasah Ibtidaiyah Wahid Hasyim III Malang / Dyah Pramesthi Isyana Ardyati
99Penerapan model pembalajaran kooperatif jigsaw untuk meningkatkan aktivitas dan kerjasama siswa pada mata pelajaran IPA kelas V di SDN Bareng 3 Malang / Eka Dian Wulandari
100Upaya meningkatkan pembelajaran IPA siswa kelas IV MI Darul Ulum Gondangwetan dengan pendekatan kooperatif model STAD / Hidayati
101Penerapan model children learning in science (CLIS) untuk meningkatkan kualitas pembelajaran IPA siswa kelas V SDN BAndulan 4 Kota Malang / Ettik Irawati
102Penerapan pendekatan quantum learning untuk meningkatkan pembelajaran IPA siswa kelas IV A SDN Bareng 01 kota Malang / Dwi Ana Lestari
103Penerapan model quantum learning untuk meningkatkan pembelajaran IPA siswa kelas V SDN Turus Kecamatan Gampengrejo Kabupaten Kediri / Hanik Aida
104Upaya meningkatkan pembelajaran IPA siswa kelas IV SDN Bandungrejosari I Kota Malang melalui model Attention Relevance Confidance Satisfaction (ARCS) / Riyani
105Upaya meningkatkan pembelajaran IPA melalui model pembelajaran ARCS (Attention, Relevance, Confidence, Satisfaction) pada siswa kelas IV SDN Jatimuluo 1 Kecamatan Kauman Kabupaten Tulungagung / Widha Bhinartika
106Penggunaan model clis untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Karangbesuki 4 kota malang / Femmy Ludrian Afrinda
107Implementasi model CLIS (Children Learning in Science) untuk meningkatkan pembelajaran IPA siswa kelas V SDN dukuh II Kecamatan Ngadiluwih Kabupaten Kediri / Mifta A. Yunita E.A.
108Penerapan model course review horay (CRH) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Merjosari 1 Malang / Lika Pratiwi
109Penerapan model pembelajaran course review horay untuk meningkatkan pembelajaran IPA siswa kelas VC SDN Bandungrejosari 1 Kota Malang / Davis Dwi Cahyo Nugroho
110Penerapan pendekatan discovery untuk meningkatkan pembelajaran IPA di kelas IV SDN Pandanwangi 04 Kecamatan Blimbing kota Malang / Friska Ayu Nurawati
111Penggunan model discovery untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Menyarik Winongan Pasuruan / Zainul Arifin
112Penggunaan model pembelajaran eksperimen untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Klinter Kecamatan Kejayan Kabupaten Pasuruan / Realita Mitayani
113Penerapan model eksperimen untuk meningkatkan pembelajaran IPA siswa kelas V SDN Randuagung 02 / Sarini
114Penerapan model eksperimen untuk meningkatkan pembelajaran IPA pada siswa kelas V di SDN Kotalama 2 Malang / Sofya Aries
115Penerapan model index card match untuk meningkatkan IPA pada siswa kelas IV SDN Tulusrejo 2 kota Malang / Alfan Yuniawan
116Penerapan model group investigation untuk meningkatkan pemebelajaran IPA siswa kelas V SDN Kidul Dalem 2 Malang / Dedik Setiyo Winoto
117Penerapan model learning cycle (LC) 5 face untuk meningkatkan pembelajaran IPA siswa kelas V-B SDN Bareng 01 Kecamatan Klojen kota Malang / Setiyani Eka Ningsih
118Penerapan model pembelajaran make a match untuk meningkatkan pembelajaran IPA siswa kelas V SDN Oro-oro Dowo Malang / Hanik Masruroh
119Penerapan model paikem untuk meningkatkan pembelajaran IPA siswa kelas V SDN Sokosari 02 Tuban / Widya Wahyuni
120Penerapan model problem based learning (PBL) untuk meningkatkan pembelajaran IPA siswa kelas V SDN Pringapus 2 kecamatan Dongko Kabupaten Trenggalek / Linda Rachmawati
121Penerapan model peta konsep untuk meningkatkan pembelajaran IPA kelas IV SDN Mojosari Kabupaten Malang / Dimas Kusuma Dyan Pamungkas
122Penerapan model peta konsep untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Pandanwangi 04 Kecamatan Blimbing kota Malang / Dhian Dwi Nur Wenda
123Penerapan model POE (Predict. Observe, explain) untuk meningkatkan pembelajaran IPA siswa kelas III SDN Karangbesuki 4 Malang / Setyaningtyas Wahyu Nugraheni
124Penerapan model picture and picture untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Gampingan 01 Pagak / Dewi Diansari
125Penerapan model reciprocal teaching untuk meningkatkan pembelajaran IPA siswa kelas V SDN Pisang Candi 2 Kota Malang / Ericha Ayu EW.
126Penerapan model savi untuk meningkatkan pembelajaran IPA siswa kelas IVA SDN Madyopuro 1 Kecamatan Kedungkandang kota Malang / Theresia Natasian
127Penerapan pendekatan science environment technology society (SETS) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Selorejo Tulungagung / Ika Diana Tristanti
128Penerapan model siklus belajar (learning cycle) untuk meningkatkan pembelajaran IPS siswa kelas V SDN Jimbaran I Puspo Kabupaten Pasuruan / Elok Dwi Isty Qomah
129Penerapan snowball throwing untuk meningkatkan pembelajaran IPA kelas IV SDNU Kecamatan Bangil Kabupaten Pasuruan / Nafisah
130Penerapan model student team achievement division (STAD) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Jimbaran III Kecamatan Puspo Kabupaten Pasuruan / Dedy Dwi Wahyudi
131Penerapan model sains teknologi masyarakat (STM) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Tanjungrejo 2 Malang / Dita Ayu Putri Permatasari
132Penerapan model pembelajaran team assisted individualization (TAI) untuk meningkatkan pembelajaran IPA materi sifat-sifat cahaya siswa kelas V SDN Purworejo 1 Tulungagung / Yunia Mikawati
133Penerapan model think pair share untuk meningkatkan pembelajaran IPA siswa kelas V SN Lesanpuro I Kecamatan Kedungkandang Kota Malang / Nur Ulfa
134Penerapan model think pair share (TPS) untuk meningkatkan pembelajaran IPA kelas V SDN Sedayu 03 Kecamatan Turen Kabupaten Malang / Ana Najmatul La'ali,
135Penerapan model pembelajaran talking stick untuk meningkatkan pembelajaran IPA kelas IV SDN 2 Pringapus Kecamatan Dongko Kabupaten Trenggalek / Winda Sustyanita Mutarto
136Penerapan model TSTS untuk meningkatkan pembelajaran IPA siswa kelas V SDN Bandungrejosari 1 Kota Malang / Zulfa Nur Urida
137Penerapan model two stay two stray (TSTS) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Tulusrejo 2 Malang / Nety Agustin Walantika
138Penerapan pendekatan pakem untuk meningkatkan hasil belajar IPA kelas VI SDN Watukosek Gempol Pasuruan / Danang Fatkhur Rohman
139Penerapan peta konsep untuk meningkatkan hasil belajar IPA siswa kelas V-A SDN Tanjungrejo 2 Kota Malang / Siti Ana Misula
140Penerapan pembelajaran tematik dengan tema lingkungan untuk meningkatkan hasil belajar siswa kelas III di SDN Purwantoro 7 Kecamatan Blimbing Kota Malang / Rasmi Patty
141Penerapan pembelajaran tematik untuk meningkatkan aktivitas dan hasil belajar siswa kelas II tema lingkungan SDN Pandanwangi 04 Kecamatan Blimbing kota Malang / Rohmatul Maulidiah
142Penerapan strategi pembelajaran peningkatan kemampuan berpikir (SPPKB) untuk meningkatkan kualitas pembelajaran IPA kelas III di SDN Ketawanggede 2 Malang / Ira Indrianika
143Upaya meningkatkan kualitas pembelajaran IPA melalui model discovery siswa kelas IV SDN Lesanpuro 3 Kota Malang / Oktovina Desnam
144Penerapan cooperative learning tipe team game tournament untuk meningkatkan kualitas pembelajaran IPA di SDN Pecalukan V Kecamatan Prigen Kabupaten Pasuruan / Muh. Al Murtadho
145Penerapan model inkuiri terbimbing untuk meningkatkan kualitas pembelajaran IPA siswa kelas IV MI Miftahul Ulum Banjarkejen Pandaan / Moh. Fauzi
146Penerapan pendekatan keterampilan proses untuk meningkatkan pembelajaran IPA di kelas V SDN Madyopuro 3 Kota Malang / Syamsia Siwa Siwan
147Implementasi model cooperative integrated reading and composition (CIRC) untuk meningkatkan pembalajaran IPA siswa kelas V SDN Bareng 5 Malang / Luthfi Muthmainah
148Penerapan model group investigation untuk meningkatkan pembelajaran IPA kelas IV SDN Blayu 01 Kecamatan Wajak Kabupaten Malang / Citra Rusanti
149Penggunaan pendekatan lingkungan alam untuk meningkatkan penguasaan konsep sifat-sifat benda pada siswa kelas IV SDN. Urek-urek 02 kecamatan Gondanglegi kabupaten Malang / Eri Yuniati
150Penerapan metode eksperimen untuk meningkatkan hasil dan aktivitas belajar IPA siswa kelas VI SDN Sidorejo 02 Kecamatan Jabung Kabupaten Malang / Rendi Agus Triono
151Penerapan model pembelajaran clis untuk meningkatkan kualitas pembelajaran dan hasil belajar IPA siswa kelas III SDN Pisangcandi II malang / Akbar Tanjung M. D. A.
152Pemanfaatan kebun sekolah untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Karangrejo 02 / Dyah Ayu Pertiwi
153Penerapan model pembelajaran learning cycle untuk meningkatkan aktivitas da hasil belajar siswa kelas V SDN Karangbesuki 4 Malang materi pokok sifat-sifat cahaya / Erni Pujayanti
154Penggunaan metode eksperimen untuk meningkatkan hasil belajar siswa pada pembelajaran IPA pokok bahasan sifat-sifat cahaya kela V SDN Tekung 02 Lumajang / Dhia Suprianti
155Penerapan model discovery untuk meningkatkan hasil belajar siswa kelas IV SDN Minggir dalam mengidentifikasi daur hidup hewan / Ahmad Sufiyan
156Penerapan model pembelajaran quantum learning untuk meningkatkan hasil belajar IPA di kelas IV SDN Pandean I Kecamatan Gondang Kabupaten Nganjuk / Sumiatin
157Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar IPA siswa kelas V di MI Mifthaul Huda Pohjentrek Pasuruan / Nur Yulianti
158Meningkatkan hasil belajar dengan menggunakan asesmen portofolio pada pembelajaran IPA siswa kelas III SDN Glagahsari III Sukorejo Pasuruan / Ina Purwati
159Penerapan model pembelajaran Group Investigation (GI) untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Kasin Malang / Fitria Nurmala Dewi
160Penerapan pendekatan sains teknologi masyarakat untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Kebonsari 4 Kota Malang / Windra Septi Mulyanti
161Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Selotambak Kraton Pasuruan / Khoirun Nisak
162Pemanfaatan media alam sekitar untuk meningkatkan prestasi belajar IPA siswa kelas 4 SD / Arief Destyan Faisal M.
163Penerapan media diorama untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Klangrong I / Samsul Arifin
164Penggunaan media solar sistem dan CD interaktif untuk meningkatkan hasil belajar mengidentifikasi sistem tata surya siswa kelas VI SDN Sumberoto 05 Kecamatan Donomulyo Kabupaten Malang / Felina Devi Cacilia
165Penerapan media asli untuk meningkatkan aktivitas dan hasil belajar siswa kelas III SDN Gading Kasri pada pelajaran IPA materi penggolongan tumbuhan / Siti Nurhidayati
166Penggunaan media benda asli untuk meningkatkan hasil belajar bagian-bagian tumbuhan di kelas IV SD Negeri Selokgondang 02 Kecamatan Sukodono Kabupaten Lumajang / Idha Dwi Agustin
167"Pemanfaatan pendekatan lingkungan alam sekitar untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Kebonagung 02" / Ester Dwi Rahayu
168Penggunaan media specimen untuk meningkatkan hasil belajar IPA kelas III di SDN Randuati Kecamatan Nguling Kabupaten Pasuruan / Sofi Eko Cahyono
169Penerapan media tiga dimensi KIT untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN PAsinan II Kecamatan Lekok / Supaedah
170Penggunaan media asli untuk meningkatkan hasil belajar IPA (Perubahan Lingkungan Fisik) Di kelas IV SDN pekoren III kecamatan rembang Kabupaten pasuruan / Supangat
171Penggunaan media benda asli dan model untuk meningkatkan hasil belajar IPA siswa kelas II SDN I Gandusari kecamatan Gandusari Kabupaten Trenggalek / Hendratna Setiawan
172Pemanfaatan media tiruan (boneka) dalam meningkatkan prestasi belajar mata pelajaran IPA pokok bahasan mengidentifikasi fungsi organ pernafasan manusia kelas V SDN Kudu II Kecamatan Kertosono Kabupaten Nganjuk / Denny Setya Budi
173Pemanfaatan media pembelajaran benda kongkrit untuk meningkatkan hasil belajar IPA tentang pesawat sederhana di kelas V SDN Benerwojo Kecamatan Kejayan Kabupaten Pasuruan / Susmiati
174Penerapan pembelajaran IPA dengan media gambar untuk meningkatkan prestasi siswa kelas II SDN Gunungsari kecamatan Tajinan kabupaten Malang / Luluk Miftakhul Ulumiyah
175Meningkatkan hasil belajar siswa melalui media specimen pada mata pelajaran IPA kelas III MI Zainiyah Tempel Kecamatan Gempol Kabupaten Pasuruan / Erik Silamsari
176Penggunaan media kongkrit dan gambar untuk meningkatkan hasil belajar IPA siswa kelas I SDNU Bangil / Saidah Misdiana
177Pemanfaatan media gambar untuk meningkatkan hasil belajar IPA kelas I SDN Sidogiri I Kecamatan Kraton Kabupaten Pasuruan / Nur Anita
178Penggunaan media ritatoon untuk meningkatkan hasil belajar IPA materi cara hewan menyusaikan diri dengan lingkungan kelas V SDN Tambak Kalisogo I Sidoarjo / Arofatul Azizah
179Penerapan collaborative learning melalui permainan mencari gambar untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Cepokomulyo 2 Kepanjen / Rahmawati
180Pemanfaatan media VCD untuk meningkatkan aktivitas dan hasil belajar IPA pada siswa kelas V SDN Madyopuro 6 Kec. Kedungkandang Kota Malang / Indah Rohmawati
181Penggunaan media konkrit untuk meningkatkan hasil belajar IPA siswa kelas III SDN Sidodadi II Lawang / Revi Lujeng Rahayu
182Pemanfaatan cd interaktif untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Kebonagung II Malang / Didin khoirun Nikmah
183Meningkatkan prestasi belajar IPA melalui pendekatan keterampilan observasi media benda konkrit pada siswa kelas II SDN Taman Harjo III kec.Singosari kab.Malang / Nurjannah
184Penerapan pakem dengan metode diskusi presentasi menggunakan media kartu kerja (work card) pada pembelajaran IPA untuk meningkatkan motivasi dan hasil belajar siswa kelas VI B di SD Negeri Banjararum 1 Singosari / Maya Wardah Maulana
185Penggunaan media pembelajaran interaktif berbasis CD untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Nongkojajar I Pasuruan / Siti Fatimah
186Penerapan peta konsep untuk meningkatkan prestasi belajar IPA pada pokok bahasan benda dan sifatnya siswa kelas IV di SDN Maguan 1 Kecamatan Ngajum Kabupaten Malang / Fakih Dian Tri Kuncahyo
187Penggunaan lingkungan sekitar sebagai media pembelajaran untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Rejosari 1 Kecamatan Bantur Jabupaten Malang / Endri Kurniadi
188Penggunaan media SEQIP siklus air untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kedungsalam II Kecamatan Donomulyo Kabupaten Malang / Agisty Nirmalasari Rosyidah
189Penggunaan media terrarium untuk meningkatkan hasil belajar IPA siswa kelas II SDN Nguling 02 Kecamatan Nguling Kabupaten Pasuruan / Khodiatus Suaibah
190Penggunaan media gambar untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SD Inpres Watujara tahun pelajaran 2013/2014 / Adi Neneng Abdullah
191Pemanfaatan media pembelajaran benda konkrit untuk meningkatkan hasil belajar IPA kelas III SD Negeri Ketangirejo I Kecamatan Kejayan Kabupaten Pasuruan / Endang Sri Ratnawati
192Penggunaan media benda asli dan manipulatif untuk meningkatkan hasil belajar IPA konsep organ tubuh manusia dan hewan di kelas V SDN Karangasem 2 Kecamatan Lumbang Kabupaten Pasuruan / Muhamad Munir
193Penggunaan media peta untuk meningkatkan hasil belajar sumber daya alam dan kegiatan ekonomi siswa kelas IV SDN Kandung Winongan Pasuruan / Ninik Purwantini
194Pemanfaatan media torso untuk meningkatkan aktivitas siswa dan hasil belajar di kelas 4 SDN Lesanpuro 1 Kota Malang / Wulan Nuzulul Isnaini
195Penerapan metode eksperimen unyuk meningkatkan hasil belajar siswa tentang perpindahan energi panas pada bidang studi sains kelas IV SDN Klenang Lor I Kecamatan Banyuanyar Kabupaten Probolinggo / Liling Nuryefi Rinjantina
196Penggunaan pemodelan untuk meningkatkan hasil belajar IPA pada kelas V SDN Wonokoyo 2 Malang / Saiful
197Penerapan model siklus belajar (Learning Cycle) dengan metode eksperimen pada pokok bahasan benda dan sifatnya untuk meningkatkan kerja ilmiah dan hasil belajar kognitif siswa kelas IV-B semester I SDN Bareng I Kota Malang / Suci Wijayanti
198Penerapan pendekatan sains teknologi masyarakat (STM) dalam meningkatkan hasil belajar siswa mata pelajaran IPA kompetensi dasar proses daur air dan kegiatan yang mempengaruhinya di kelas V SDN Gadang I Kota Malang / Septiana Dyah Winanty
199Penerapan pakem untuk meningkatkan prestasi belajar IPA pada siswa kelas IV di SDN Tlogowaru 2 / Suci Fitriana
200Keefektifan penggunaan metode diskusi dalam meningkatkan prestasi belajar sains di kelas IV SDN Kotalama 2 Kota Malang / Upit Witasari
201Penerapan metode eksperimen untuk meningkatkan hasil dan aktivitas belajar IPA siswa kelas III SDN Bakalan II Kec. Purwosari Kabupaten Pasuruan / Wido Sumarno
202Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar IPA siswa kelas VI SDN Tampung II Kecamatan Lekok Kabupaten Pasuruan / Katiyo
203Penerapan model discovery untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Kiduldalem I Kecamatan Bangil Kabupaten Psuruan / Endang Melati
204Meningkatkan prestasi belajar IPA siswa kelas V SDN Karanganyar I Kecamatan Kraton Kabupaten Pasuruan dengan menggunakan metode pembelajaran injuiri / Nurgia Kilwouw
205Penggunaan model pembelajaran kooperatif tipe STAD untuk meningkatkan hasil belajar IPS siswa kelas IV semester ganjil TA 2011/2012 MI Miftahul Hidayah Gogourung Kademangan Blitar / Hilyatul Mahsun Rahmawati
206Penerapan model Student Team Achievement Division (STAD) untuk meningkatkan pembelajaran subtema perubahan energi di kelas III SDN Bunulrejo 1 Malang / Tuti Arbatia
207Penerapan model mind map (peta pikiran) untuk meningkatkan motivasi dan hasil belajar IPA siswa kelas III SDN Karangbesuki 02 Malang / Hafit Arifiandi
208Penerapan pembelajaran tematik berbantuan peta pikiran untuk meningkatkan aktivitas dan hasil belajar siswa kelas IVC SDN Dinoyo 2 Malang / Indrawati
209Penerapan model guided inquiry melalui practice rehearsal pairs untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SDN 1 Baturetno Kabupaten Wonogiri / Purwadi
210Penerapan model pembelajaran kooperatif tipe two stay two stray menggunakan metode problem solving untuk meningkatkan motivasi dan hasil belajar IPA siswa kelas V di SD-SMP Negeri Satu Atap 3 Dongko / Fakih Dian Tri Kuncahyo
211Penerapan metode inkuiri terstruktur dengan media permainan puzzle untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IVB SDN Bakalan Krajan I Kota Malang tahun ajaran 2013/2014 Eni Arifatun Ni'mah
212Penerapan metode inkuiri untuk meningkatkan hasil belajar pada pembelajaran IPA siswa kelas IV SDN Klojen Kidul Kota Malang semester II tahun ajaran 2011/2012 / Lailatul Badriyah
213Penerapan model problem based learning untuk meningkatkan keterampilan berpikir kritis dan hasil belajar IPA siswa kelas IV SDN Pagelaran 02 Kab. Malang / S. Evita Kumalasari
214Penerapan metode demonstrasi menggunakan kartu bilangan bulat untuk meningkatkan hasil belajar matematika dalam menyelesaikan penjumlahan bilangan bulat pada siswa kelas IV SDN Kebotohan Pasuruan / Ruri Ayu Widowati
215Penggunaan peta konsep untuk meningkatkan proses dan hasil belajar IPS pada siswa kelas IV SD Inpres Otombamba Kabupaten Ende / Josef Kusi
216Penerapan model Problem Based Learning (PBL) untuk meningkatkan pembelajaran IPA kelas V SDN Pojok 1 Kecamatan Campurdarat Kabupaten Tulungagung / Neti Novitasari
217Penerapan pendekatan keterampilan proses untuk meningkatkan pembelajaran IPA siswa kelas V SDN Sumurgung II Tuban / Nafiatus Syafa'ati
218Penerapan model learning cycle untuk meningkatkan hasil belajar IPA materi pokok posisi bulan bagi siswa kelas IV SDN Pisang Candi 2 Malang / Dian Risa Pratiwi
219Penerapan model problem based learning (PBL) untuk meningkatkan pembelajaran IPA siswa kelas V SDN Plintahan II Kecamatan Pandaan Kabupaten Pasuruan / Pipit Mau Ria
220Penerapan model make A match untuk meningkatkan pembelajaran IPA kelas V SDN Pandanwangi 04 Malang / Dwi Retnowati
221Penerapan model learning cycle untuk meningkatkan pembelajaran IPA kelas IV SDN Jatimulyo 01 Malang / Hariza
222Upaya meningkatkan pembelajaran IPA menggunakan model problem based instruction (PBI) siswa kelas IV SDN Madyopuro V Kecamatan Kedungkandang kota Malang / Lisa Sedubun
223Penerapan model dicovery untuk meningkatkan pemahaman konsep IPA dan aktivitas siswa kelas V SDN Oro-oro Dowo Kota Malang / Reni Anasari
224Penerapan model Group Investigation untuk meningkatkan aktivitas dan hasil belajar IPA pada materi sifat-sifat cahaya di kelas V SDN Gadingkulon 01 Malang / Achmad Rifai
225Penerapan model sets untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Bandungrejosari 2 Malang / Hermin Suswati
226Penerapan model pembelajaran practice rehearsal pairs untuk meningkatkan aktivitas dan hasil belajar IPA kelas V SDN Kebonduren 02 Ponggok Kabupaten Blitar / Ade Satrio Nugroho
227Penggunaan pendekatan humanistik model Mangunwijaya untuk meningkatkan aktivitas dan hasil belajar sains pada siswa kelas V SDN Bandungrejosari I kecamatan Sukun kota Malang / Wahyu Firmansyah
228Penerapan model pembelajaran jigsaw untuk meningkatkan aktivitas dan hasil belajar IPA materi struktur tumbuhan pada siswa kelas IV di SD Islam Nurul Izzah Kota Malang / Heri Hermanto
229Penerapan model TAI (Team Assisted Individualization) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV B SDN Candirenggo 04 Singosari Kabupaten Malang / Lailatul Nikmah
230Penerapan model pembelajaran salingtemas untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Karangbesuki 4 Malang / Devi Pratiwi
231Penerapan model problem based learning (PBL) untuk meningkatkan pembelajaran IPA pada siswa kelas V SDN Madyopuro 3 Kecamatan Kedungkandang kota Malang / Ebti Lusiana Dumgair
232Penerapan model kooperatif TSTS untuk meningkatkan hasil belajar siswa pada materi mengidentifikasi organ sistem pernafasan manusia dan hewan kelas V semester genap SDN Gaprang 03 Kabupaten Blitar / Mokhamad Imron Rosyadi
233Penerapan model pembelajaran peta konsep untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas Vd SDN Madyopuro 1 Kota Malang / Diana Resikahil
234Penerapan model Problem Based Learning (PBL) untuk meningkatkan kemampuan sains sederhana pada kelompok B3 di TA Ar-Ridlo Malang / Najiatin
235Penerapan model pembelajaran rotating trio exchange untuk meningkatkan pembelajaran IPA kelas 4 SDN Kidul Dalem 2 Kota Malang / Tito Santana Eriza
236Penerapan model pembelajaran short card untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pembelajaran IPA materi gaya di SDN Oro-oro Pule / Dody Hariyanto
237Penerapan pakem melalui pencari pasangan untuk meningkatkan motivasi dan hasil balajar IPA pada siswa kelas III SDN Pengetahuan I Kota Pasuruan / Iskandar
238Penerapan model sains teknologi masyarakat untuk meningkatkan aktivitas, motivasi dan prestasi belajar IPA siswa kelas VI B SD Negeri Cijoho Kec. Kuningan Kab. Kuningan tahun ajaran 2013/2014 / Rohadi
239Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Sumbersari I Kecamatan Beji Kabupaten Pasuruan / Yuli Panca Intarti
240Penerapan pakem untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Plinggisan Kecamatan Kraton Kabupaten Pasuruan / Iskandar
241Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar IPA siswa kelas V SDN Brambang Kecamatan Gondangwetan Kabupaten Pasuruan / Khuriyatul Aisyiyah
242Penerapan pendektan pakem dalam pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas V SDN Ngiliran Magetan / Dhora Tri Agustina
243Penerapan pembelajaran berdasarkan masalah (PBM) deangan strategi kooperatif teknik stad (Student Teams Achievement Divisions) pada mata pelajaran sains untuk meningkatkan aktivitas dan hasil belajar siswa kelas V Madrasah Ibtidaiyah Jenderal Sudirman malang tahun ajara
244Penggunaan pembelajaran bermain jawaban untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kesatrian 02 Malang / Kamaluddin
245Pemanfaatan multimedia melalui model pembelajaran CLIS untuk meningkatkan hasil belajar sains pada siswa kelas V SDN Pakisaji 02 Malang / Novi Rusma Noverta Gandhi
246Meningkatkan hasil belajar IPA melalui pembelajaran berbantuan media internet pada siswa kelas VI SDN Mergosono 3 Kota Malang / Sigit Gunawan
247Penerapan pendekatan discovery untuk meningkatkan aktivitas dan hasil belajar IPA konsep kenampakan bulan siswa kelas IV SDN Sukoharjo II Kota Malang / Mashuri Warat
248Penerapan pendekatan discovery untuk meningkatkan hasil belajar IPA materi benda dan sifatnya pada siswa kelas V MI. Miftahul Huda Pohjentrek Pasuruan / Nurhidayati
249Penerapan pendekatan discovery dalam pembelajaran untuk meningkatkan hasil belajar IPA di kelas V SDN Banjarsari Kecamatan Pandaan Kabupaten Pasuruan / Sutomo
250Penerapan pendekatan pembelajaran inkuiri untuk meningkatkan prestasi belajar siswa kelas IV Mata pelajaran IPA SDN Cangkringmalang III Kecamatan Beji Kabupaten Pasuruan / Dalila Keliobas
251Meningkatkan hasil belajar IPA pada pembelajaran pesawat sederhana dengan metode inkuiri di kelas V SDN Wonosunyo II Kecamatan Gempol Kabupaten Pasuruan / Bahrul Ulum
252Penerapan model inkuiri untuk meningkatkan hasil belajar IPA pada siswa kelas IV SDN Pogar III Bangil semester II / Suhariyati
253Penerapan metode inkuiri untuk meningkatkan hasil belajar IPA materi kerangka manusia pada siswa kelas IV SDN Pagentan II Singosari Kabupaten Malang / Abdul Rochim
254Penerapan model pembelajaran inkuiri untuk meningkatkan prestasi belajar siswa kelas IV mata pelajaran IPA di MI Senden tahun ajaran 2007/2008 / Naning Dwi Cahyarini
255Upaya meningkatkan hasil belajar IPA melalui model inkuiri di kelas IV SDN Puspo IV Kabupaten Pasuruan / Dewi Pintoko Arida
256Penggunaan pendekatan pembelajaran inkuiri untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kauman 2 Kecamatan Klojen kota Malang / Pius Tokndekut
257Penerapan model inquiry untuk meningkatkan hasil belajar IPA pada pembelajaran gaya di kelas IV SDN Pejangkungan I Kecamatan Rembang / Rusman
258Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA pada siswa kelas IV SDN Sundil Kecamatan Praya Kabupaten Lombok Tengah / Muh. Syukri Ghazali
259Penggunaan pendekatan inkuiri untuk meningkatkan keaktifan dan hasil belajar IPA pada siswa kelas V SDN Sumbersari II Kabupaten Pasuruan / Arina Indriani
260Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA siswa kelas V di SDN Buring Kecamatan Kedungkandang Kota Malang / Eko setia Budi
261Penerapan model pembelajaran ctl dengan metode inquiri dalam meningkatkan hasil belajar IPA siswa kelas IV SDN Ngrejo 01 Kec. Bakung Kab. Blitar tahun pelajaran 2009/2010 / Mariyatim
262Upaya meningkatkan prestasi belajar IPA kelas V melalui strategi pembelajaran inquiri (SPI) di MI Roudlotul Hikmah II Sumurlecen Kedawang - Nguling - Pasuruan / Sri Wahyuni Hidayati
263Penerapan metodr inquiri untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPA pada siswa kelas III SDN ngawonggo 01 Kecamatan tajinan kabupaten malang tahun pelajaran 2009/2010 / Sugeng Mulyanto
264Penerapan pendekatan inquiri dalam meningkatkan hasil prestasi belajar pada mata pelajaran sains siswa kelas IV SDN Gogodeso 01 Kecamatan Kanigoro Kabupaten Blitar / Retno Dwi Budi Cahyanti
265Penerapan pembelajaran inquiry untuk meningkatkan hasil belajar IPA siswa kelas V SDN Tutur 1 Pasuruan / Ponidi
266Penerapan model pembelajaran investivigasi kelompok untuk meningkatkan hasil belajar siswa mata pelajaran sains kelas IV semester ganjil di SDN Kaliboto tahun ajaran 2008/2009 / Dwi Indra Purnamawati
267Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar mata pelajaran IPA pada siswa kelas V SDN Ngenep 1 Karangploso Kab. Malang / Mashudah
268Penerapan model pembelajaran kolaboratif untuk meningkatkan kualitas hasil belajar IPA siswa kelas V SD Ma'arif Jogosari Pandaan PAsuruan / Diana Johartono
269Penerapan pendekatan konstruktivitas model siklus belajar untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Mlideg Bojonegoro / Tya Wulan Sari
270Penerapan CTL (Contextual Teaching and Learning) untuk meningkatkan aktivitas dan hasil belajar siswa kelas V pada pembelajaran sains "Sifat-sifat cahaya" di SDN Pohsangit ngisor Kabupaten Probolinggo / Rilvan Uzwardani
271Penerapan pendekatan kontekstual dalam meningkatkan motivasi belajar dan hasil belajar sains siswa kelas IV semester VII tahun ajaran 2006/2007 SDN Sumber Sekar II Dau Malang / Lisdiana
272Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar IPA siswa kelas IV Madrasah Intidaiyah Darul Ulum Candiwates kecamatan Prigen Kabupaten Pasuruan / Was'ayah
273Penerapan pendekatan CTL untuk meningkatkan hasil belajar IPS siswa kelas III SDN Umbulan Kecamatan Winongan Kabupaten Pasuruan / Karisma Lestari
274Penerapan pendekatan kontekstual untuk meningkatkan hasil belajar IPA siswa kelas 2 SDN Pandanwangi 1 Kota Malang / Dian Rahmani
275Penerapan pendekatan kontekstual pada pembelajaran IPA untuk meningkatkan aktifitas dan hasil belajar siswa kelas IV SDN Ardimulyo 03 Singosari Malang / Eva Agustine Yusnita Sari
276Penerapan model pembelajaran CTL untuk meningkatkan hasil belajar IPA di kelas IV SDN Kandung Pasuruan / Arif Wicaksono
277Meningkatkan hasil belajar IPA siswa melalui pendekatan kontekstual di kelas IV SDN Karang Besuki I Kecamatan Sukun Kota Malang tahun ajaran 2008/2009 / Dita Purwoadi Susanto
278Pembelajaran kontekstual untuk meningkatkan hasil belajar IPS siswa kelas II-B SDN Mergosono I Kota Malang / Suhartini
279Penerapan pendekatan CTL untuk meningkatkan hasil belajar IPA siswa kelas III SDN Kandung Kecamatan Winongan Kabupaten Pasuruan / Nur Faizah
280Penerapan pembelajaran kontekstual untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV semester II SDN Merjosari 1 Malang / Eka Setiawati
281Penerapan pendekatan contextual teaching and learning (CTL) untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Plandirejo 02 Kecamatan Bakung Kabupaten Blitar / Yeni Pusnawati
282Pembalajaran kontekstual dengan model InQuiry untuk meningkatkan hasil dan aktivitas belajar ipa pada siswa kelas V SD negeri karangtengah 2 kota blitar / ganis sri rejeki
283Penerapan model pembelajaran kontekstual dengan metode inkuiri untuk meningkatkan hasil belajar IPA siswa kelas III SDN kalipang 01 kecamatan sutojayan kabupaten Blitar / Suhariningsih Eko
284Penerapan model pembelajaran group investigation untuk meningkatkan hasil belajar IPA tentang tumbuhan hijau kelas V SDN Temenggungan 02 kecamatan Udanawu kabupaten Blitar / Iswandi
285Penerapan pendekatan kooperatif model investigasi kelompok untuk meningkatkan hasil belajar IPA di SDN Plintahan I Pandaan Pasuruan / Tsalis Fatmawati
286Penerapan model pembelajaran kooperatif jigsaw II untuk meningkatkan aktivitas dan hasil belajar IPA di kelas IV SDN Purwoasri 01 Kabupaten Malang / Faridha Susanti
287Penerapan pendekatan kooperatif problem posing untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V Sdit Insan Permata Malang / Diana Fitriani
288Penggunaan pembelajaran kooperatif model STAD untuk meningkatkan hasil belajar IPA siswa kelas V SDN Podokoyo II Kecamatan Tosari Kabupaten Pasuruan / Yuni Kristanti
289Meningkatkan hasil belajar IPA dengan menggunakan pendekatan cooperative learning tipe STAD di kelas V SDN Pasrepan I Kecamatan Pasrepan Kabupaten Pasuruan / Shinta Diah Damayanti
290Penerapan pembelajaran kooperatif model STAD untuk meningkatkan aktifitas dan hasil belajar materi listrik siswa kelas VI / Sunoto
291Penerapan pembelajaran kooperatif model student teams echivement division (STAD) untuk meningkatkan hasil belajar ilmu penetahuan alam ( IPA ) siswa 2 SDN Sentul 1 Blitar / Ermi Farida
292Penerapan pembelajaran kooperatif model Student Teams Achievement Division (STAD) untuk meningkatkan aktivitas dan prestasi belajar IPA siswa kelas IV di SDN I Widoro Kec. Gandusari Kab. Trenggalek / Devi Indriati
293Pendekatan kooperatif model TGT untuk meningkatkan hasil belajar IPA siswa kelas V MI Nurul Ulum Sebalong Nguling Pasuruan / Siti Fahroh
294Pembelajaran cooperative learning tipe team game tournament untuk meningkatkan prestasi belajar IPA di SDN Nglegok 02 Kabupaten Blitar / Mardiana Dwi Lulitasari
295Penerapan model quantum learning untuk meningkatkan hasil belajar pada mata pelajaran IPA di kelas V SDN Tulusrejo 02 Malang / Maya Puspita Indah Sari
296Penelitian tindakan kelas penerapan metode demontrasi dalan ilmu pengetahuan alam tentang sifat-sifat cahaya dapat meningkatkan prestasi belajar pada siswa kelas V SDN Kolomayan 02 kecamatan Wonodadi kabupaten Blitar / Komsatun
297Upaya meningkatkan hasil belajar IPA melalui metode eksperimen tentang cara tumbuhan membuat makan kelas V SD Sambisirah II-Wonorejo-Pasuruan / Sugiyanto
298Penerapan metode eksperimen untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPA pokok bahasan penyesuaian diri makhluk hidup pada siswa kelas V SDN Pagentan 05 Kec. Singosari Kab. Malang tahun pelajaran 2009/2010 / Jaenab
299Penerapan metode eksperimen untuk meningkatkan prestasi belajar IPA pada siswa kelas V SDN Pagentan V Kecamatan Singosari Kabupaten Malang tahun pelajaran 2009/2010 / Wiwik Sumiyati
300Penerapan metode eksperimen dengan memanfaatkan barang bekas pada pembelajaran IPA untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Karang Pakis II Kabuh Jombang / Neni Widaryanti
301Penerapan metode eksperimen untuk meningkatkan prestasi belajar IPA pada siswa kelas V SDN Bareng 4 Kecamatan Klojen Kota Malang tahun pelajaran 2009/2010 / Rahayu Hendaruti
302Penerapan metode eksperimen untuk meningkatkan prestasi belajar IPA tentag cahaya merambat lurus pada siswa kelas V di SDN Baturetno IV Kecamatan Singosari Kabupaten Malang / Sunarto
303Penerapan metode eksperimen untuk meningkatkan hasil belajar IPA konsep benda dan sifatnya siswa kelas IV SDN Plososari III Kecamatan Grati Kabupaten Pasuruan / Nurul Ulum
304Penerapan metode eksperimen untuk meningkatkan hasil belajar IPA pokok bahasan tumbuhan hijau siswa kelas V SDN Dandanggendis Kecamatan Nguling Kabupaten Pasuruan / Samsul Arif
305Penggunaan metode inkuiri untuk meningkatkan prestasi belajar kompetensi dasar mendeskripsikan sifat-sifat cahaya pada mata pelajaran IPA siswa kelas V SDN Temayang Kecamatan Kerek Tuban / Melinda Olifia Sahara
306Penggunaan metode inkuiri untuk meningkatkan prestasi belajar IPA siswa kelas V semester II pada pokok bahasan magnet SDN Clumprit I Kecamatan Pagelaran Kabupaten Malang / Yustika Dwi Ismawati
307Upaya meningkatkan prestasi belajar IPA dengan metode "penemuan terbimbing" pada siswa kelas VI SDN Ardimulyo I Kecamatan Singosari Kabupaten Malang / Sugiarti
308Penerapan model pembelajaran terpadu tipe connected untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Martopuro II / Maria Theresia Kilmas
309Penerapan cognitive style mapping (CSM) untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Prodo Wonongan Pasuruan / Indri Susanti
310Penerapan pembelajaran CTL untuk meningkatkan hasil belajar IPA materi bagian-bagian utama tumbuhan bagi siswa kelas II MI Miftahul Ulum 2 Nguling Kec. Nguling Kab. Pasuruan / Susriati
311Penerapan metode discovery dalam pembelajaran sains untuk meningkatkan hasil belajar dan keterampilan kooperatif siswa kelas II SDN Karanganyar Pasuruan / Siti Chotijah
312Penerapan model discovery nelalui metode eksperimen dalam pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas IV SD Negeri Bareng 5 Kecamatan Klojen Kota Malang / Samsudin Rumateor
313Penerapan model pembelajaran eksperimen untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kandung Pasuruan / Lukman Hakim
314Penerapan metode eksperimen dalam pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas III-B SDN Pagentan 02 Singosari - Malang / Witayah
315Penerapan model group investigation untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Jabung 1 Kab. Malang / Dwi Setyo Muji Lestari
316Penerapan model pembelajaran index card match untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Begendeng 3 Kabupaten Nganjuk / Gatut Saputro
317Upaya meningkatkan aktivitas dan hasil belajar IPA melalui model jigsaw pada siswa kelas V SD Negeri Latek Bangil tahun pelajaran 2010/2011 / Silfia Safriani
318Penerapan pendekatan kooperatif model jigsaw untuk meningkatkan hasil belajar IPA siswa kelas V di SDN Pakisaji 02 Kabupaten Malang / Zainal Abdi
319Penerapan model kreatif produktif untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Plosoharjo II Kecamatan Pace Kabupaten Nganjuk / Andra Dewi Lestari
320Penerapan pendekatan daur belajar )Learning cycle) untuk meningkatkan hasil belajar IPA kelas III di SDN Suberjo Kulon II Ngunut Tulungagung / Nina Sayyidah
321Penerapan model learning cycle untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas VI di SD Islam Nurul Izzah Malang / Etik Wunarwulan
322Penerapan model pembelajaran modification of resiprocal teaching untuk meningkatkan hasil belajar IPA siswa kelas III SDN Tawangargo 02 Kecamatan Karangploso Kabupaten Malang / Ike Maulida Andini
323Penerapan pembelajaran kooperatif model numbered heads together untuk meningkatkan motivasi dan hasil belajar siswa pada mata pelajaran IPA materi sumber daya alam kelas III di SDN Kemulan 02 Turen / Mochamad Eko Budi Prastyo
324Penerapan model pembelajaran problem based introduction (PBI) untuk meningkatkan hasil belajar IPA siswa kelas IV di SDN Purwantoro 2 Kota Malang / Nora Muliyandari
325Penerapan model project-based learning untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Ketawanggede 2 Malang / Dewi Nofita Sari
326Penerapan problem based learning (PBL) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Kebonagung 2 Kabupaten Malang / Bambang Setyadi
327Aplikasi model mind mapping berbasis eksperimen untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV-B di SDN Klojen Kota Malang / Mohamad Fadli Fauzi Renyaan
328Penerapan pendekatan keterampilan proses (PKP) untuk meningkatkan hasil belajar IPA konsep sifat benda cair, padat dan gas siswa kelas IV SDN Bareng V Kecamatan Klojen Kota Malang tahun pelajaran 2009-2010 / Jefri Rumodar
329Penerapan model pembelajaran problem solving untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Tempuran 1 Ngawi / Pratika Tungga Dewi
330Penerapan model problem solving untuk meningkatkan hasil belajar IPA kelas V SDN Tulusrejo 02 Malang / Gita Septyanna Wulandari
331Penerapan model QWH-Chart untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Merjosari I Malang / Feni Handayani
332Penerapan model siklus belajar peta pikiran untuk meningkatkan aktivitas dan hasil belajar siswa kelas VI SDN Lidah Kulon V/468 Surabaya pada mata pelajaran IPA / Sri Yanti
333Penerapan model pembelajaran student teams-achievement divisions (STAD) untuk meningkatkan hasil belajar IPA siswa kelas IV MI Darul Ulum Rembang Kabupaten Pasuruan / Siti Kholilatul Jannah
334Penerapan pendekatan sains teknologi masyarakat (STM) untuk meningkatkan motivasi, aktivitas, dan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Petung I Kecamatan Pasrepan Kabupaten Pasuruan / Syamsul Arif
335Meningkatkan hasil belajar siswa dalam pelajaran IPA kelas V SDN Bandulan I dengan pendekatan STM / Bambang Tri Kuntoyo
336Penerapan pendekatan sains teknologi masyarakat (STM) untuk meningkatkan hasil belajar IPA kelas IV di SDN Parasrejo II Pohjentrek Pasuruan / Dwi Andriani Diah Ayu Permatasari
337Penerapan pendekatan STM untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kedungringin II Kecamatan Beji Kabupaten Pasuruan / Siti Riyadah
338Penerapan pendekatan sains-teknologi-masyarakat untuk meningkatkan hasil belajar ilmu pengetahuan alam tentang hubungan kegiatan manusia dan ekosistem pada siswa kelas VI di SDN Ciptomulyo 2 / Sri Budyo Cahyono
339Pendekatan sains teknologi masyarakat (STM) untuk meningkatkan hasil belajar sains siswa kelas III SDN Sukorejo Kecamatan Pohjentrek Kabupaten Pasuruan / Setyowati
340Penerapan model pembelajaran team game tournament untuk meningkatkan aktivitas dan hasil belajar IPA di SDN Tegalweru Malang / Nurul Khoiriyah
341Penggunaan model TGT (teams Games Tournament) untuk meningkatkan hasil belajar dan aktivitas siswa kelas V dalam pembelajaran IPA di SDN Sukoharjo I Kecamatan Klojen Kota Malang / Stevianus Laiyan
342Penerapan pakem untuk meningkatkan prestasi belajar IPA siswa kelas IV SDN Sungikulon Kecamatan Pohjentrek Kabupaten Pasuruan / Indah Widyastuti
343Penerapan pembelajaran penemuan terbimbing untuk meningkatkan hasil belajar IPA siswa kelas V SDN Ngawongso 01 Kecamatan Tajinan Kabupaten Malang tahun pelajaran 2009/2010 / Chotidjah Hidayati
344Penerapan contextual teaching and learning untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SN Baujeng II Kecamatan Beji Kabupaten Pasuruan / Susanto
345Penerapan pendekatan sains teknologi masyarakat untuk meningkatkan hasil belajar IPA siswa kelas III SDN Gondangwetan II Kabupaten Pasuruan / Risna Wirawan
346Penerapan model quantum teaching untuk meningkatkan hasil belajar siswa kelas V tentang gaya gesek di SDN Parangargo 1 Kecamatan Wagir Kabupaten Malang / Selvy Krisnasari
347Penerapan model quantum teaching untuk meningkatkan hasil belajar IPA siswa kelas V SDN Parangargo 1 Kecamatan Wagir Kabupaten Malang / Selvy Krisnasari
348Meningkatkan aktivitas dan hasil belajar IPA dengan menggunakan pendekatan kontekstual pada siswa kelas V di SDN Bungur II Kecamatan Sukomoro Kabupaten Nganjuk / Yoessena
349Penerapan model pembelajaran paikem untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPA MI Darul Ulum Rembang Kabupaten Pasuruan / K. Istiqomah
350Penerapan pendekatan konstruktivisme dengan model pembelajaran peta konsep untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Bantur 06 Kec. Bantur Kab. Malang / Ika Faridaningrum
351Pemanfaatan media tiruan kebun binatang pada pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas IV MI Ma'arif Legok-Gempol / Achmad Bustanul Arifin
352Penggunaan metode eksperimen berbasis verifikasi untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPA konsep gaya SDN Gejugjati I Kecamatan lekok Kabupaten pasuruan / Saiful Rumain
353Penggunaan media LKS word square untuk meningkatkan aktivitas dan hasil belajar peserta didik kelas IV materi sumber energi alternatif dan penggunaannya di SDN Rebalas III Grati-Pasuruan / Hanifatul Khusnaini
354Penerapan teknik CASA (Cards and Ask Student to Ask) untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa pada pembelajaran IPA kelas IV di sekolah dasar / Yantaufik
355Penerapan model pembelajaran STAD untuk meningkatkan aktivitas dan hasil belajar IPA pada siswa kelas V SDN Pagak 04 Kabupaten Malang / Rizky Ulla Eka Destiana
356Penerapan model pembelajaran Problem Based Learning (PBL) untuk meningkatkan aktifitas dan hasil belajar siswa dalam mata pelajaran IPA kelas IV di SDN Wlingi 03 Kabupaten Blitar / Akbar Resi Wiyatma
357Penggunaan media ritatoon untuk meningkatkan hasil belajar daur hidup serangga di kelas IV SDN Patuguran 1 Kabupaten Pasuruan / Aini Zukhria
358Penerapan model pembelajaran siklus belajar dalam upaya meningkatkan prestasi belajar siswa tentang SDA pada siswa kelas V SDN Plosoharjo I Nganjuk / Puji Rahayu
359Upaya meningkatkan prestasi belajar IPA pokok bahasan bunga dan fungsinya pada siswa kelas IV dengan pendekatan exploratory-discovery di SDN Tamanharjo 02 Singosari Malang / Erlina Suhardiningsih
360Penerapan model pembeljaran pakem untuk meningkatkan hasil belajar IPA pokok bahasan penyesuaian diri mahluk hidup dengan lingkungannyan pada siswa kelas V SDN Sumberboto 03 kec. Wonotirto kab. Blitar tahun pelajaran 2009/2010 / Teguh Widodo
361Penggunaan media benda asli untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Tawangrejo 02 Kecamatan Pandaan Kabupaten Pasuruan / Ika Sukma Prihatiningrum
362Penerapan pendekatan inkuiri untuk meningkatkan hasil belajar IPA siswa kelas V SDN 1 Badegan Kabupaten Ponorogo / Wahyuningsih
363Penerapan pembelajaran problem solving untuk meningkatkan hasil belajar IPA "Perlunya Penghematan Air" pada siswa kelas V SDN Ngetos II Nganjuk / Rudiyanto
364Penerapan pengelolaan kelas model meja kelompok formasi corak tim untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Arjosari 1 Kabupaten Pasuruan / Septi Anjarsari Rakhman
365Upaya meningkatkan aktifitas dan prestasi belajar IPA dengan pendekatan pembelajaran discovery pada siswa kelas VI SDN Gunungrejo 1 Singosari Malang / Gatot sukotjo
366Penerapan metode discovery untuk meningkatkan hasil belajar IPA Siswa kelas V SDN Oro-Oro Ombo kulon I Kecamatan Rembang Kabupaten Pasuruan / Maftuhadi
367Penggunaan media specimen pada pembelajaran ilmu pengetahuan alam untuk meningkatkan hasil belajar siswa kelas IV SDN Kebonagung 06 Malang / Dyah Purwahyuni
368Penerapan strategy based student request dalam meningkatkan hasil belajar IPA siswa kelas IV SDN Rowogempol III Lekok-Pasuruan / Kasiyati
369Penerapan model pembelajaran learning cycle untuk meningkatkan aktivitas dan hasil belajar IPA kelas V di SDN Kasin Malang / Unsa Amiroh
370Penerapan model pembelajaran STAD untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SDN Wirogunan Kota Pasuruan / Icca Nurika Lalita
371Penggunaan modul pembelajaran untuk meningkatkan prestasi hasil belajar dalam pelajaraan IPA siswa kelas IV di SD Negeri Purwantoro XIV kecamatan Blimbing Kota Malang / oleh Muslikhatin
372Penerapan teknik talking stick untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IA SDIT Nuurul Fikri Trenggalek
373Penerapan pakem dengan metode eksperimen untuk meningkatkan hasil belajar IPA materi benda dan sifatnya di kelas V SDN Kebonsari 4 Kota Malang / Martini Dwi Purnama
374Penggunaan model pembelajaran learning cycle dan peta konsep untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SDN Oro-oro Pule Kecamatan Kejayan Kabupaten Pasuruan / Ika Puji Lestari
375Penerapan pembelajaran tematik tema kesehatan untuk meningkatkan hasil belajar siswa kelas III SDN Rebalas III Kecamatan Grati Kabupaten Pasuruan / Fatkhur Rozi
376Cooperative learning model stad untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Pulowetan 2 Kecamatan Jatikalen Kabupaten Nganjuk / Novie amurwani
377Penerapan pembelajaran kontekstual dengan metode inkuiri untuk meningkatkan aktivitas dan hasil belajar sains siswa kelas V Madrasah Ibtidaiyah Darussalam Malang / Septavia Dewi Savitri
378Penerapan model direct instruction (DI) untuk meningkatkan hasil belajar dan keaktifan siswa dalam pembelajaran IPA kelas V SDN Sukoharjo 1 Kota Malang / Ris Talaohu
379Penerapan model pembelajaran generatif untuk meningkatkan hasil belajar IPA siswa kelas V SDN Oro-Oro Dowo Malang / Elminawati Sutomo
380Penggunaan model picture and picture untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Gadingkulon 03 Dau Malang / Erva Wulandari
381Penerapan pendekatan esperiental learning untuk meningkatkan hasil belajar sifat cahaya di kelas V SDN Plososari III Pasuruan / Dwi Purwanto
382Penerapan model belajar inkuiri untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Alastlogo III Kecamatan Lekok Kabupaten Pasuruan / Ifa Murtiningsih
383Penerapan model two stay two stray untuk meningkatkan hasil pembelajaran IPA siswa kelas IV SDN Plinggisan I Kecamatan Kraton Kab. Pasuruan / Rabia Bugis
384Penerapan metode eksperimen untuk meningkatkan hasil belajar siswa kelas IV pada materi fungsi panca indera manusia di SDN Sukoharjo I Malang / Eko Dwi Cahyono
385Penerapan metode eksperimen untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPA dan siswa kelas V SDN Wonorejo IV kecamatan Singosari kabupaten Malang tahun pelajaran 2009/2010 / Umi Wahyuni
386Penerapan pakem untuk meningkatkan hasil belajar IPA siswa kelas 5B materi cahaya di SDN Bareng I Kota Malang / Sunarmi
387Penerapan model kooperatif tipe Think Pair Share untuk meningkatkan kemampuan siswa mengembangkan sikap ilmiahnya dalam pembelajaran IPA kelas IV MI Al-Muslihuun 01 Tlogo / Nur Fatwa Khoirun Hanim
388Penerapan model pembelajaran guided discovery inquiry untuk meningkatkan kemampuan mengkonstruksi konsep IPA pada siswa kelas IV SDN Ngaglik II / Reti Febriana
389Penggunaan mind map (peta pikiran) untuk meningkatkan pembelajaran IPA kelas V SDN Bareng 5 Malang / Oktoyuana Hardian Perwitasari
390Upaya meningkatkan pembelajaran IPA melalui penerapan model pembelajaran Savi (Somatis Auditori Visual Intelektual) pada siswa kelas III SDN Pesanggrahan 02 kota Batu / Evi Aulia Rizka
391Penerapan pembelajaran problem based learning melalui pendekatan CTL untuk meningkatkan aktivitas dan hasil belajar IPA (studi pada siswa kelas V SDN Pengembangan 6 Banjarmasin) / Dede Dewantara
392Meningkatkan hasil belajar IPA dengan pendekatan CTL pada kelas IV SDN Bajang I Kecamatan Ngluyu Kabupaten Nganjuk / Mustakim

P.T.K yang memiliki keterhubungan dengan diatas

1Peningkatan hasil belajar PKn materi Kebebasan Berorganisasi melalui model student teams achievement division di kelas V SDN I Suwaluh Kabupaten Tulungagung / Wisdana Imanu Bakhtiar
2Penggunaan media benda asli untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Tawangrejo 02 Kecamatan Pandaan Kabupaten Pasuruan / Ika Sukma Prihatiningrum
3Penerapan model pembelajaran kooperatif group resume untuk meningkatkan aktivitas dan hasil belajar IPS kelas V di SDN Sitirejo 02 Wagir Kabupaten Malang / Yunitaria Jayanti
4Meningkatkan hasil belajar dan motivasi belajar IPS melalui pembelajaran kooperatif model investigasi kelompok di kelas V SDN Ngembul 03 Kecamatan Binangun Kabupaten Blitar / Ivo Damayanti Yusseno
5Implementasi pendidikan karakter pada kegiatan ekstrakurikuler Pramuka di SDN Maqdyopuro IV Kecamatan Kedungkandang Kota Malang / Ahmad Fauzi Rizal
6Analisis kesesuaian pelaksanaan materi ajar buku siswa kelas 3 SD dengan Tema 6 Indahnya Persahabatan di SDN Perrcobaan 02 Kota Malang / Elkana Agnes Yuvikasari
7Pengembangan modul pembelajaran IPS tentang konsep globalisasi kelas VI semester 2 berbasis problem solving / Rizky Vina Agustin
8Meningkatkan hasil belajar IPS melalui media televisi dan cd pembelajaran pada siswa kelas IV SDN Mungkung II Kecamatan Rejoso Kabupaten Nganjuk / Amelia Indiyah Susanti
9Peningkatan kemampuan motorik halus anak kelompok A melalui kegiatan melipat kertas di TK Bahrul Ulum Sanankerto / Dewi Ulya
10Penerapan model pembelajaran Think Pair Share untuk meningkatkan aktivitas dan hasil belajar siswa mata pelajaran IPS kelas V SDN Kalen Kabupaten Lamongan / Syahrul Adhi Sugiarto
11Pendekatan konstruktivisme meningkatkan pemahaman siswa tentang penyebab gerak benda pada pembelajaran IPA di kelas I SDN Kotalama I kota Malang / Welasasih
12Penerapan metode field trip untuk meningkatkan kemampuan menulis deskripsi pada siswa kelas VB SDN Tanjungrejo 5 Kota Malang / Bahrul Ulum
13Persepsi guru terhadap implementasi pendekatan pembelajaran saintifik pada kurikulum 2013 di SDN Gugus 5 dan 6 Kecamatan Lowokwaru Kota Malang / Fany Lusita Sari
14Peningkatan kemampuan membaca permulaan melalui media puzzle alphabet di TK B Muslimat 18 Banjarejo Pakis Malang / Ferda Ferik Putri Anindika
15Penerapan pendidikan matematika realistik guna meningkatkan prestasi belajar penjumlahan bilangan cacah bagi siswa kelas II SDN Senggreng 05 Kecamatan Sumberpucung Kabupaten Malang / Nofita Putranti Kristiyaningsih
16Penggunaan metode simulasi untuk meningkatkan hasil belajar siswa kelas V SDN Sidorejo 02 Pagelaran-Malang pada mata pelajaran PKn / Lailatul Fajriah
17Pemanfaatan media pembelajaran sederhana model bangun datar dalam upaya meningkatkan pemahaman konsep bangun datar siswa kelas III MI Almaarif 09 Randuagung singosari malang / Rima Yunita
18Peningkatan pemahaman peninggalan sejarah praislam melalui model discovery learning pada siswa kelas IV SDN Dayu 01 Kabupaten Blitar / Laila Maharani
19Penerapan model pembelajaran kooperatif tipe numbered heads together untuk meningkatkan motivasi dan hasil belajar IPS materi koperasi siswa kelas IV SDN Kebonagung II Malang / Desi Ratna Sulistyowati
20Peningkatan hasil belajar tema Indahnya Negeriku melalui model kooperatof tipe Numbered Heads Together (NHT) di kelas IV SDN Ariyojening 01 Kabupaten Tulungagung / Alfira Maylana
21Penerapan permainan tebak misteri untuk meningkatkan keterampilan menulis deskripsi mata pelajaran bahasa Indonesia peserta didik kelas III SDN Pandanwangi 5 Kota Malang / Fitri Wulandari
22Pemanfaatan media lingkungan sekitar sekolah untuk meningkatkan kemampuan menulis karangan deskripsi kelas IV SDN Resapombo 03 Kecamatan Doko Kabupaten Blitar / Siti Umayanah
23Pemanfaatan media puzzle untuk meningkatkan kemampuan menulis deskripsi siswa kelas V SDN Clumprit 03 Kecamatan Pagelaran Kabupaten Malang / Sri Wahyuningsih
24Meningkatkan kemampuan menulis cerita pengalaman dengan memanfaatkan media lingkungan alam di kelas V SDN Kinandang Kecamatan Bendo Kabupaten Magetan / Ninik Styaningrum
25Penerapan pendekatan inkuiri untuk meningkatkan hasil belajar IPA siswa kelas V SDN 1 Badegan Kabupaten Ponorogo / Wahyuningsih
26"Pemanfaatan pendekatan lingkungan alam sekitar untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Kebonagung 02" / Ester Dwi Rahayu
27Meningkatkan prestasi belajar IPS kelas III melalui model inkuiri di SDN 2 Sumberingin Kidul kecamatan Ngunut Kabupaten Tulungagung / Saiful Amri
28Meningkatkan kemampuan menemukan kalimat utama melalui model pembelajaran stad (Student Team Achievement Devision) di kelas IV SDN Cangkringmalang III Kabupaten Pasuruan / Imroatin Masruroh
29Analisis implementasi kurikulum 2013 pada kelas III b SDN Sawojajar 5 Kecamatan Kedungkandang Kota Malang / Nani Indrawati
30Penerapan metode bermain peran untuk meningkatkan kognitif siswa kelas I pada pembelajaran IPS di SDN Gedog 2 Blitar / Mar Atus Sholikhah
31Penerapan model Sains Teknologi Masyarakat (STM) untuk meningkatkan pembelajaran IPA kelas V di SDN Saptorenggo III Kec. Pakis Kab. Malang / Irmawati
32Penerapan model siklus belajar peta pikiran untuk meningkatkan aktivitas dan hasil belajar siswa kelas VI SDN Lidah Kulon V/468 Surabaya pada mata pelajaran IPA / Sri Yanti
33Peningkatan keterampilan menulis karangan deskripsi melalui model picture and picture pada siswa kelas III SDN Purwodadi 4 Malang / Nilamsari Nurcahyani
34Pemanfaatan membaca terstruktur di perpustakaan untuk meningkatkan kemampuan menceritakan kembali isi bacaan bagi siswa kelas IV SDN Tempuran I / Pinanti
35Penggunaan permainan beauty balls untuk meningkatkan kemampuan sosial emosional pada anak kelompok B2 di TK Kartika IV-I Malang / Minniswatil Lathifah
36Pemanfaatan media diorama area kehidupan ayam untuk meningkatkan kemampuan membaca kelompok B2 di TK Assalam Tlogomas Malang / Anis Septiana R.
37Peningkatan kecerdasan kinestetik anak melalui permainan tradisional boi-boian pada kelompok B di Children Centre Brawijaya Smart School Malang / Merry Ayu Wijayanti
38Problematika pelaksanaan penilaian autentik kelas II berdasarkan kurikulum 2013 di SDN Kota Malang / Qurrotu Aini
39Pengembangan pemahaman konsep penjumlahan dan pengurangan melalui kegiatan bercerita dengan gambar wayang kelompok B TK Dharma Wanita 03 Sonosari Malang (penelitian tindakan kelas) / Dina Maretta Amelia
40Pengaruh pemanfaatan media audio visual terhadap kemampuan menyimak siswa kelas III SDN Bunulrejo I Kecxamatan Blimbing Kota Malang / Wahyuni Eka Priono
41Peningkatan kemampuan bahasa anak kelompok A melalui strategi pembelajaran BCM (bermain, Cerita, Menyanyi) di TK Kartika IX-41 Malang / Natalia Defi Renata
42Kesulitan guru dalam menerapkan penilaian autentik pada kurikulum 2013 di SDN se-Kecamatan Sukun Kota Malang / Ida Ayuwulan Sari
43Penerapan model Cooperative Integrated Reading and Composition (CIRC) untuk meningkatkan kemampuan menulis karangan persuasi siswa kelas IV SDN Cemorokandang 1 Kota Malang / Meitina Asih Indriani
44Penggunaan buku cerita untuk meningkatkan kemampuan membaca siswa kelas III SDN Oro-oro Dowo Kota Malang / Arie Rizka Setyawan
45Meningkatkan aktivitas dan hasil belajar siswa melalui penerapan model Controversial Issues (CI) pada pembelajaran PKn di Kelas IV SDN Argosari 02 Lumajang / Nafidatul Ummah
46Peningkatan hasil belajar IPS melalui media diorama lipat pada siswa kelas III SDN Ngunut 07Kabupaten Tulungagung / Riris Rahayu
47Penggunaan media specimen untuk meningkatkan hasil belajar IPA kelas III di SDN Randuati Kecamatan Nguling Kabupaten Pasuruan / Sofi Eko Cahyono
48Penerapan model Problem Based Learning (PBL) untuk meningkatkan pembelajaran IPA Siswa kelas III SD Mutiara Harapan / Fanny Vidhayanti Nasution
49Upaya meningkatkan pemahaman konsep volume kubus dan balok melalui penggunaan kubus satuan di kelas V SDN Sedaeng II Kecamatan Tosari Kabupaten Pasuruan / Akhmad Shodikin
50Penerapan model word square untuk meningkatkan aktivitas dan hasil belajar IPS kelas III MI Sunniyah Kisik Kalirejo Kabupaten Pasuruan / Dia Kurnia Lestari
51Penerapan pendekatan konstruktivisme untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pembelajaran IPS SDN Jambearjo 2 Kecamatan Tajinan Kabupaten Malang / Kresnanda Dwi Puspita Ayu Megawati
52Penerapan strategi Direct Writing Activity (DWA) untuk meningkatkan kemampuan menulis karangan siswa kelas V SDN Bareng 2 Kecamatan Klojen Malang / Dian Nirwana
53Pemanfaatan lingkungan sebagai sumber belajar un tuk meningkatkan aktivitas dan hasil belajar mata pelajaran SBK siswa kelas III SDN Oro-oro Dowo Kota Malang / Santi Herrini
54Penggunaan media peta untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Cemorokandang 01 Malang / Dwi Alfiah
55Meningkatkan kemampuan penalaran siswa dengan model problem based learning pada pelajaran IPA di kelas IV SDN 1 Serut Kabupaten Tulungagung / Kurnia Dwi Puspita
56Penerapan metode eksperimen untuk meningkatkan pemahaman
konsep IPA pada pokok bahasan air Siswa Kelas IV SDN Kauman
I Kota Malang / oleh Djarno Teguh Prasetyo
57Upaya orang tua dalam meningkatkan prestasi belajar siswa
kelas VI di Sekolah Dasar Negeri Sumbersari III Kota Malang / Hangersi Widoretno
58Penggunaan pembelajaran kooperatif model STAD untuk meningkatkan hasil belajar IPA siswa kelas V SDN Podokoyo II Kecamatan Tosari Kabupaten Pasuruan / Yuni Kristanti
59Pengembangan media pembelajaran CD interaktif pada subtema Keanegaragaman Hewan dan Tumbuhan siswa kelas IV semester Ii di sekolah dasar / Novia
60Penggunaan media VCD untuk meningkatkan pemahaman konsep musyawarah dalam pembelajaran PKn siswa kelas V SDN Pancur 2 Kecamatan Lumbang Kabupaten Pasuruan / Hadi Wijoyo
61Penggunaan model problem based learning (PBL) untuk meningkatkan hasil belajar siswa dalam memecahkan soal-soal cerita pada mata pelajaran matematika kelas I SDN Nguling 01 Kecamatan Nguling Kabupaten Pasuruan / Laila Triwahyuningsih
62Problematika guru kelas III dalam mengimplementasikan scientific approach pada kurikulum 2013 di SDN Gugus IV Kecamatan Kedungkandang Kota Malang / Amalia Choirun Nisa
63Penerapan pakem untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Plinggisan Kecamatan Kraton Kabupaten Pasuruan / Iskandar
64Peningkatan hasil pembelajaran muatan IPA materi Hubungan Sumber Daya Alam dengan Lingkungan Teknologi dan Masyarakat mnelalui model Problem Based Learning (PBL) kelas IV SDN Karangtengah 1 Kota Blitar / Masitoh Alfitati Ilma
65Penerapan model pembelajaran make a match untuk meningkatkan pembelajaran IPA siswa kelas V SDN Oro-oro Dowo Malang / Hanik Masruroh
66Upaya meningkatkan keterampilan menulis deskripsi dengan menggunakan media gambar seri pada siswa kelas III SDN Penataran 01 Kabupaten Blitar / Ahmad Nur Ludfianto
67Penerapan model pembelajaran group investigation untuk meningkatkan hasil belajar siswa pada bidang studi IPS kelas 5 SDN Patianrowo 1 Kecamatan Patianrowo Kabupaten Nganjuk / Mochamad Yanuar Arif Wijaya
68Pengembangan buku bacaan sesuai karakteristik anak TK Kelompok A di TK Negeri Pembina 2 Malang / Sariati
69Penerapan metode tanya jawab (question answer) untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn kelas V SDN Bareng 5 Malang / Nany Puspita Sari
70Penerapan model pembelajaran bermain peran untuk meningkatkan hasil belajar PKn pokok bahasan sistem pemerintahan provinsi siswa kelas IV SDN Pandean II Pasuruan / Sobirin
71Meningkatkan hasil belajar tentang perkembangan teknologi produksi, komunikasi dan transportasi melalui model pembelajaran kooperatif jigsaw pada mata pelajaran IPS kelas IV SD Tulungrejo 03 Kecamatan Gandusari / Wila Binti Masruroh
72Penggunaan media gambar dalam pembelajaran PPKn pokok bahasan "keyakinan" untuk meningkatkan aktivitas siswa kelas III SD Negeri Sumbersari I Kota Malang / oleh Artiningsih
73Penerapan model Talking Stick untuk meningkatkan aktivitas dan hasil belajar siswa kelas IVA pada mata pelajaran IPS di SDN Sekarpuro Kecamatan Pakius Kabupaten Malang / Tri Muryani
74Upaya meningkatkan hasil belajar siswa pada bidang studi PKn dengan menggunakan model pembelajaran jigsaw materi keputusan bersama di kelas V ADN Bareng 5 / Basri Rumadaul
75Penggunaan motif batik Ponorogo untuk meningkatkan hasil belajar menggambar dekoratif pada siswa kelas V SDN Sempu Ponorogo / Bayu Triwicaksono
76Pemanfaatan media keping berwarna untuk meningkatkan hasil belajar siswa tentang operasi hitung bilangan bulat kelas IV SDN Petung II Kecamatan Pasrepan Kabupaten Pasuruan / Muhammad Mukhdor
77Penerapan pembelajaran Realistic Mathematics Education (RME) untuk meningkatkan penguasaan konsep operasi perkalian pada siswa kelas IV SDN KARANG DUREN 03 PAKISAJI KABUPATEN MALANG./Tutik Khoidaroh
78Meningkatkan kemampuan operasi hitung campuran melalui pembelajaran pemecahan masalah matematika kelas III SDN Kebonagung Pasuruan / Puji Mulyati
79Penerapan model CTL dalam meningkatkan kemampuan membuat kalimat siswa kelas III SDN Wonoayu Wajak Malang / Dyan Faridha
80Peningkatan hasil belajar PKn melalui model kooperatif sckrip pada siswa kelas SDN Turi 2 Kota Blitar / Marice Gainau
81Penerapan model peta konsep untuk meningkatkan pembelajaran IPA di kelas IV SDN Madyopuro 6 Kedungkandang-Malang / Ani Ginting Lestari
82Implementasi keterampilan guru dalam mengelola kelas pada pembelajaran IPS kelas III SDN Bendogerit 02 Kota Blitar / Nurma Rofita
83Penerapan teknik perkalian nafir untuk meningkatkan hasil belajar matematika tentang pekalian dalam pembelajaran looperatif model Stad pada siswa kelas IV SDN Kaweron 02 Kabupaten / Anita Zunarni
84Pengembangan kurikulum Sekolah Alam Madrasah Ibtidaiyah Bilingual Al-Ikhlas Desa Sengguruh Kecamatan Kepanjen Kabupaten Malang / Ayu Romadani
85Penggunaan media dekak-dekak untuk meningkatkan hasil belajar konsep penjumlahan bilangan cacah di kelas II SDN Minggir Winongan Pasuruan / Siti Aminah
86Penerapan model pembelajaran Student Team Achievemen Division (STAD) untuk meningkatkan hasil belajar tema indahnya kebersamaan di kelas 4 SDN Kotalama 6 Malang / Erlina Betty Permaisari
87Penerapan model discovery pada mata pelajaran IPS untuk meningkatkan motivasi, aktivitas dan hasil belajar siswa kelas IV SDN Oro-Oro Dowo Kecamatan Klojen kota Malang / Retno Dwi Astuti
88Pembalajaran kontekstual dengan model InQuiry untuk meningkatkan hasil dan aktivitas belajar ipa pada siswa kelas V SD negeri karangtengah 2 kota blitar / ganis sri rejeki
89Peningkatan kemampuan mengenal lambang bilangan 1-10 melalui permainan pot angka pada anak kelompok A di TK PKK Bandulan Kota Malang / Desy Dwi Kurniawati
90Penerapan pakem melalui pencari pasangan untuk meningkatkan motivasi dan hasil balajar IPA pada siswa kelas III SDN Pengetahuan I Kota Pasuruan / Iskandar
91Penggunaan kartu perkalian untuk meningkatkan hasil belajar matematika siswa kelas III SDN Kebonagung 05 kecamatan Pakisaji Kabupaten Malang / Prasdian Yudha Bhakti
92Penggunaan media peta untuk meningkatkan hasil belajar IPS Siswa kelas IV SD Negeri 1 Besuki Munjungan Trenggalek / Puji Lestari
93Implementasi media pembelajaran CD interaktif untuk meningkatkan pembelajaran IPA siswa kelas V SDN BI Tlogowaru Kota Malang / Wahyu Aditia Ghafur P.
94Peningkatan hasil belajar IPS melalui model everyone is a teacher here di kelas IV SDN Karangrejo 03 Garum Blitar / Lulut Virma Tullah
95Pengembangan buku panduan eksperimen dalam pembelajaran kognitif untuk guru TK di Kecamatan Garum Kabupaten Blitar / Eva Nur Aisah
96Penerapan model two stay two stray untuk meningkatkan hasil belajar siswa kelas IV pada mata pelajaran PKn di SDN Martopuro II Kecamatan Purwosari Kabupaten Pasuruan / Margaretha Ohoiwutun
97Penerapan media tiga dimensi KIT untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN PAsinan II Kecamatan Lekok / Supaedah
98Penerapan model pembelajaran course review horay untuk meningkatkan aktivitas dan hasil belajar IPS soswa kelas IV SDN Pisangcandi 4 Kota Malang / Putri Ariesta Anggraeni
99Penggunaan boneka tongkat untuk meningkatkan kemampuan menyimak dongeng kelas II SDN Dawung 2 Kediri / Yunia Bintarti
100Penerapan media lembar balik untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV SDN Lowokwaru 5 Kota Malang / Selviana Dea Panary
101Peningkatan kemandirian anak melalui pendekatan scientific di Kelompok A TK-SD Satu Atap SDN Mojolangu 5 Malang / Fitriah Puspita Ningtyas
102Peningkatan kemampuan motorik halus melalui kegiatan Meronce Berpola pada anak Kelompok B TK PGRI 2 Poncokusumo Kabupaten Malang / Erni Rizky Lilasari
103Pengembangan permainan lingkaran warna dalam pembelajaran kecerdasan visual-spasial pada anak kelompok usia 3-4 tahun PAUD Pitaloka Bangil Pasuruan / Gita Ayu Immamah
104Penggunaan media two counter coin untuk meningkatkan kemampuan operasi hitung bilnagan bulat pada siswa kelas IV / Khoirina Nur Hikmah
105Penerapan metode mendongeng untuk meningkatkan proses dan hasil belajar PKN materi pokok hidup gotong royong siswa kelas II SDN Karangbesuki 1 Malang / Alfi Lailatin
106Pendekatan discovery untuk meningkatkan kemampuan menemukan rumus luas bangun datar segiempat siswa kelas V SDN Jenggolo 02 Kepanjen Kabupaten Malang / Pipit Kesuma Sugiarti
107Penggunaan media standar lembr blik untuk meningkatkan proses dan hasil belajar PKn pada konsep musyawarah siswa kelas V SDN Susukanrejo Pohjentrek Pasuruan / Febe Retno Hendriarti
108Upaya pembentukan karakter siswa melalui kegiatan ekstrakurikuler Pramuka di SDN Rejoyoso 04 Kecamatan Bantur kabupaten Malang / Nurin Puspa Kinasih
109Peningkatan kemampuan sosial emosional melalui permainan bangkiak berpasangan anak Kelompok B TK Kartika IV-79 Malang / Widiya Susanti
110Penanganan lambat wicara pada anak autis di TKLB River Kids Kota Malang / Diana Nasution
111Penerapan model pembelajaran jigsaw untuk meningkatkan hasil belajar PKn bagi siswa kelas IV di SDN Pisang III Kabupaten Nganjuk / Setya Dwi Rahayu
112Implementasi model pembelajaran jigsaw untuk meningkatkan prestasi belajar IPS materi peninggalan sejarah Indonesia pada siswa kelas IV SDN Waung I Nganjuk / Mujiati
113Upaya meningkatkan hasil belajar matematika siswa kelas V SDN Tangkilsari 1 Kecamatan Tajinan melkalui model group investigation / Aslu Wahidah
114Penerapan metode diskusi untuk meningkatkan prestasi belajar siswa kelas V pada pembelajaran PPKn di SDN Tulusrejo 4 Malang / Suprijanto
115Penerapan metode diskusi untuk meningkatkan hasil belajar mata pelajaran IPS pada siswa kelas IV SDN Kersikan Kecamatan Gondangwetan Kabupaten Pasuruan / Siti Saleha Rumfot
116Pemanfaatan barang bekas sebagai media pembelajaran untuk meningkatkan pemahaman sifat-sifat bangun ruang dalam pembelajaran matematika siswa kelas V SDN Bocek 02 Kecamatan Karangploso Kabupaten Malang / Yayuk Wahyuni
117Penerapan media crossword puzzle untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV di SDN Sawojajar 6 Kecamatan Kedung Kandang Kota Malang / Ika Yuni Purwanti
118Penerapan model Polya untuk meningkatkan kemampuan memecahkan masalah matematika siswa kelas 4 SDN Kesongo II Kabupaten Bojonegoro / Setiya Ninggiarti
119Meningkatkan hasil belajar PKn siswa kelas IV SDN gunungsari Kecamatan Tajinan melalui pendekatan kontekstual / Ponco Setyono
120Penerapan model pembelajaran investigasi kelompok untuk meningkatkan aktifitas dan hasil belajar IPS siswa kelas IV SDN Rejosalam 2 Kecamatan Pasrepan Kabupaten Pasuruan / Ridwan Kamarmir
121Problematika guru kelas III dalam implementasi pembelajaran tematik terpadu berdasarkan kurikulum 2013 di SD Gugus 7 Kecamatan Klojen Kota Malang / Agustini Lestari
122Peningkatan motorik halus melalui kegiatan menggambar teknik batik sederhana pada anak usia 5-6 tahun di TK Dharma Wanita 01 Senggreng / Yossie Setyo Wardhani
123Meningkatkan hasil belajar siswa dengan menggunakan pendekatan kooperatif learning model STAD mata pelajaran IPS kelas VA SDN Mergosono I Kota Malang / M. Habiburrohman
124Penerapan mind mapping untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SDN Lowokwaru 5 Kota Malang / Laili Lutfi Arini
125Penerapan model STAD (Student Team Achievement Divisions) untuk meningkatkan pembelajaran IPA kelas 4 SDN Sawojajar 4 Kedungkandang Malang / Ade Yama Wahyu Nur Prasetya
126Penerapan media belajar multi dimensi untuk meningkatkan aktivitas dan pemahaman konsep pada pelajaran IPA kelas III di SDN Lakarsantri III - 474 Surabaya / Wahyu Supriyati
127Peningkatan hasil belajar siswa materi bilangan bulat melalui model Teams Games Tournament (TGT) di kelas IV SDN 1 Gilang Kabupaten Tulungagung / Dian Retno Anggraini
128Pengembangan rencana pelaksanaan pembelajaran dan buku siswa dengan pendekatan kontekstual pada tema ekosistem untuk siswa kelas X SDN Madyopuro 3 Kota Malang / Cinderima Karina
129Penerapan model quantum writing untuk meningkatkan keterampilan menulis narasi pada siswa kelas IV A SDN Bareng I Malang / Heny Retnowati
130Upaya meningkatkan kualitas pembelajaran IPA melalui model discovery siswa kelas IV SDN Lesanpuro 3 Kota Malang / Oktovina Desnam
131Penerapan model course review horay (CRH) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Merjosari 1 Malang / Lika Pratiwi
132Permainan ular tangga pada pembelajaran tematik untuk meningkatkan keterampilan interaksi sosial dan hasil belajar siswa kelas II-A di SD Negeri Gununggangsir I Kecamatan Beji Kabupaten Pasuruan / Suhermin
133Penerapan pembelajaran problem solving untuk meningkatkan hasil belajar IPA "Perlunya Penghematan Air" pada siswa kelas V SDN Ngetos II Nganjuk / Rudiyanto
134Peningkatan Kemampuan membaca anak usia 5-6 tahun melalui media buku flanel di TK Satu Atap Ciptomulyo 2 Malang / Yolanda Elisa Christanti
135Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPS sumber daya alam di SDN Pekoren I Rembang Pasuruan / Dian Lailatus Syarifah
136Peningkatan hasil belajar bangun datar melalui model Numbered Heads Together (NHT) di kelas II SDN Karangtengah 4 Kota Blitar / Andik Roni Cahyono
137Penerapan model Whole Brain Teaching untuk meningkatkan pembelajaran IPA siswa kelas V di SDI Plus Al-Azhar Kota Malang / Indah Rifayanti
138Penerapan model pembelajaran problem based learning (PBL) untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS kelas VI SDN Janjangwulung II Kecamatan Puspo Kabupaten Pasuruan / Maria Safitri
139Penerapan metode guided note taking untuk meningkatkan proses dan hasil belajar PKn pokok bahasan peraturan pusat dan peraturan daerah siswa kelas V SDN Mulyoagung 04 / Iva Yulia Wahyuning Tyas
140Penerapan metode eksperimen unyuk meningkatkan hasil belajar siswa tentang perpindahan energi panas pada bidang studi sains kelas IV SDN Klenang Lor I Kecamatan Banyuanyar Kabupaten Probolinggo / Liling Nuryefi Rinjantina
141Pemanfaatan lingkungan sekitar untuk meningkatkan aktivitas dan hasil belajar IPS kelas III SDN I Sanggrahan Kabupaten Tulungagung / Bagus Cahya Mahardika
142Penerapan model discovery untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Blimbing 4 Kota Malang / Cahya Riudlatul Lailiyah
143Meningkatkan kemampuan menulis cerita dengan latihan mengembangkan ide dalam gambar seri di kelas IV SDN Bangelan 03 Kabupaten Malang / Ma'ruf Eko Susanto
144Peningkatan hasil belajar IPS dengan materi jenis pekerjaan melalui media snakes and ladders di kelas III SDN Candirejo 04 Kabupaten Blitar / Septi Annur Zumrotul Sholichah
145Penggunaan media asli untuk meningkatkan hasil belajar IPA (Perubahan Lingkungan Fisik) Di kelas IV SDN pekoren III kecamatan rembang Kabupaten pasuruan / Supangat
146Penggunaan media gambar untuk meningkatkan aktivitas dan hasil belajar PKn materi cinta tanah air pada siswa kelas III SDN Pagar II Bangil Pasuruan / Wari Hermiati
147Penerapan model pembelajaran cooperative integrated reading and composition (CIRC) untuk meningkatkan kemampuan menemukan kalimat utama pada siswa kelas IV SDN Karang besuki IV kota MAlang / Nurul Khoiriyah
148Penggunaan media benda asli dan model untuk meningkatkan hasil belajar IPA siswa kelas II SDN I Gandusari kecamatan Gandusari Kabupaten Trenggalek / Hendratna Setiawan
149Penerapan metode sosiodrama untuk meningkatkan keterampilan berbicara dalam pembelajaran bahasa Indonesia siswa kelas V SDN Macanbang Tulungagung / Restu Dewi Susilowati
150Pengembangan media CD pembelajaran untuk kelas IV subtema lingkungan tempat tinggalku di SDN Pandanwangi 4 Malang / Octorio Putra Tristari
151Penerapan pendekatan pemecahan masalah untuk meningkatkan kemampuan siswa kelas IV dalam menyelesaikan soal cerita di SDN Bareng 01 Klojen kota Malang / Mike Irawati
152Penerapan model Student Team Achievement Division (STAD) untuk meningkatkan pembelajaran subtema perubahan energi di kelas III SDN Bunulrejo 1 Malang / Tuti Arbatia
153Meningkatkan pembelajaran IPA melalui pendekatan CTL pada siswa kelas V SDN Panggungrejo kota Pasuruan / Panji Kusumah
154Penerapan model inductive thinking untuk meningkatkan keterampilan menulis deskripsi siswa kelas IV SDN Ketawanggede 2 Malang / Risma Lusi Santi
155Penggunaan movie media untuk meningkatkan kemampuan memerankan tokoh drama siswa kelas 5 SDN Genukwatu II Kecamatan Ngoro Kabupaten Jombang / Kiki Ratnaning Arimbi
156Penerapan permainan scrabble untuk meningkatkan penguasaan kosakata bahasa Indonesia siswa kelas IV SDN Sukolilo no. 250 Kecamatan Bulak Surabaya / Nur Hijratul Laili
157Meningkatkan kemampuan operasi hitung satuan waktu melalui model think pair share dengan bermain kartu bilangan pada siswa kelas V SDN Galih II / Linawati
158Penerapan pengelolaan kelas model meja kelompok formasi corak tim untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Arjosari 1 Kabupaten Pasuruan / Septi Anjarsari Rakhman
159Penggunaan model bangun datar untuk meningkatkan hasil belajar matematika pokok bahasan bangun datar siswa kelas II SDN Purwantoro 2 Malang / Devita Elviana
160Peningkatan hasil belajar IPS tentang aktivitas ekonomi penduduk melalui metode inkuiri pada siswa kelas IV SDN Karangrejo 04 Kabupaten Blitar / Achmad Ryan Fauzi
161Pengembangan rencana pelaksanaan pembelajaran (RPP) kelas I tema lingkungan bersih, sehat, dan asri dengan pendekatan saintifik di SDN Purwantoro 3 Kecamatan Blimbing Kota Malang / Dwi Aprilia Mustikawati
162Hubungan Tingkat Pendidikan Guru Dengan Prestasi Belajar Siswa Mata Pelajaran PPKn Di SDN Sukun VI Kecamatan Sukun Malang Oleh Herlina Yusminingsih
163Penerapan model two stay two stray (TSTS) untuk meningkatkan aktivitas pembelajaran dan pemahaman cerita anak pada siswa kelas V SDN Ngijo 01 Karangploso Malang / Miftachul Ulum
164Penerapan model pembelajaran problem based introduction (PBI) untuk meningkatkan hasil belajar IPA siswa kelas IV di SDN Purwantoro 2 Kota Malang / Nora Muliyandari
165Pembelajaran IPS melalui metode role playing untuk meningkatkan aktivitas dan prestasi belajar siswa kelas IV MI Sirojul Huda Rejoso pasuruan / Siti Farihah
166Penerapan metode bermain seed music untuk meningkatkan kemampuan kognitif anak Kelompok A di TK Dharma Wanita 02 Jatilengger Kecamatan Ponggok Kabupaten Blitar / Elly Puspitasari
167Penerapan model pembalajaran tematik tema lingkungan untuk meningkatkan hasil belajar siswa kelas I di SDN Puger Kulon 01 Kecamatan Puger, Kabupaten Jember / Florentina Mandasari Putri
168Pembelajaran cooperative learning tipe team game tournament untuk meningkatkan prestasi belajar IPA di SDN Nglegok 02 Kabupaten Blitar / Mardiana Dwi Lulitasari
169Penerapan metode discovery terbimbing untuk meningkatkan pemahaman konsep luas daerah segitiga dan jajargenjang siswa kelas IV SDN Brangkal I Kecamatan Kepohbaru Kabupaten Bojonegoro / Dwi Esti Mitasari
170Penggunaan media pembelajaran "Pohon Perkalian" dengan teknik permainan untuk meningkatkan penguasaan konsep perkalian siswa kelas III SDN Pandanwangi 2 Malang / Eny Sutarti
171Penerapan pembelajaran kooperatif model STAD untuk meningkatkan aktifitas dan hasil belajar materi listrik siswa kelas VI / Sunoto
172Penerapan model children learning in science (CLIS) untuk meningkatkan kualitas pembelajaran IPA siswa kelas V SDN BAndulan 4 Kota Malang / Ettik Irawati
173Upaya meningkatkan kemampuan berbicara siswa kelas III dengan metode masyarakat belajar di SDN Sumbersari 03 Kecamatan Nglegok Kabupaten Blitar / Ericca Retna Kusumawati
174Pelaksanaan pembelajaran pada sekolah penyelenggaran pendidikan inklusi di SDN Junrejo 01 Kota Batu / Mirna Ari Wijayanti
175Penggunaan metode SQ3R untuk meningkatkan kemampuan memahami isi bacaan pada siswa kelas IV SDN Kauman bangil / Apriviati Purwaningrum
176Penerapan model directive learning untuk meningkatkan kreatifitas dan hasil belajar PKn siswa kelas V SDN Kedungkandang 1 Kota Malang / Sri Andayani
177Penerapan metode reflektif untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Madyopuro 3 Kecamatan Kedungkandang Kota Malang / Angrita Winda Septory
178Penggunaan permainan komunikasi untuk meningkatkan keterampilan menyampaikan pesan pendek bagi siswa kelas II SDN Gununggangsir III Pasuruan / Ana Anita Silitubun
179Penerapan model pembelajaran Team Accelerated Instruction (TAI) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas II MI Hidayatul Mubtadiin Kota Malang / Miftahul Jannah
180Penerapan model pembelajaran kooperatif tipe jigsaw untuk meningkatkan hasil belajar PKn materi pengaruh globalisasi pada siswa kelas IV SDN Andonosari I Tutur Pasuruan / Kateni Winata
181Penerapan model kooperatif tipe TGT untuk meningkatkan partisipasi siswa dalam kerja kelompok kelas IVB SDN Dampit 02 Kabupaten Malang / Sarah Nurhabibah
182Penerapan pendekatan pemecahan masalah heuristik 1 untuk meningkatkan hasil belajar pengurangan bilangan bulat kelas IV SD / Ririn Tri Setyaningtyas Anggraini
183Penerapan pendekatan pembelajaran inkuiri untuk meningkatkan prestasi belajar siswa kelas IV Mata pelajaran IPA SDN Cangkringmalang III Kecamatan Beji Kabupaten Pasuruan / Dalila Keliobas
184Peningkatan keterampilan mengidentifikasi unsur-unsur cerita melalui media audio visual pada siswa kelas V SDN 2 Wonoanti Kabupaten Trenggalek / Ayu Oktafia Prihanani
185Pemanfaatan media dua dimensi untuk meningkatkan hasil belajar PKn siswa kelas V SDN Randuagung 04 Kecamatan Tajinan Kabupaten Malang / V. Tutik Purwati
186Penggunaan model pembelajaran eksperimen untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Klinter Kecamatan Kejayan Kabupaten Pasuruan / Realita Mitayani
187Penggunaan strategi the power of two untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Madyopuro V Kecamatan Kedungkandang Kota Malang / Amelda Asri Maigoda
188Penggunaan media gambar seri untuk meningkatkan kemampuan bercerita pada mata pelajaran bahasa Indonesia siswa kelas III SDN Palangsari II, Kecamatan Puspo, Kabupaten Pasuruan / Alfiah
189Penerapan pembelajaran kooperatif model STAD (Student Team Achievement Division) untuk meningkatkan hasil belajar siswa pada mata diklat kewirausahaan (studi pada siswa kelas 1 APK SMK Ardjuna 1 Malang) / Jovita Vicka Bayuwardhani
190Penerapan model pembelajaran jigsaw untuk meningkatkan hasil belajar siswa pada bidang studi PPKn kelas 5A SDN Sukoarjo I / Tri Astatik
191Pemanfaatan media visual interaktif untuk meningkatkan hasil belajar pecahan siswa kelas V SDN Gedangan 03 Kabupaten Malang / Frandhica Wahyu Ardhianto
192Penerapan model pembelajaran mind mapping untuk meningkatkan aktivitas belajar dan penguasaan siswa terhadap materi IPS kelas V MI Miftahul Astar Bedug Kabupaten Kediri / Jihan Filisyamala
193Pemanfaatan media komik dalam pembelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas VB SDN Kedungkandang 2 Kecamatan Kedungkandang Kota Malang / Rurin Hidayatuts Tsalits
194Penerapan model cooperative integrated reading and composition (CIRC) untuk meningkatkan keterampilan siswa dalam memahami isi wacana bahasa Indonesia kelas V SDN Kiduldalem I Kota Malang / Brampi Djukut
195Penerapan permainan kartu bilangan untuk meningkatkan hasil belajar perkalian kelas III SDN Candirenggo V Kecamatan Singosari Kabupaten Malang / Suparjimah Adriana
196Penerapan model inkuiri terbimbing untuk meningkatkan aktivitas dan hasil belajar siswa kelas III pada materi gerak benda di SDN Sidokepung I Sidoarjo / Heni Nurul Hidayah
197Peningkatan pemahaman aktivitas ekonomi melalui penerapan metode diskusi pada siswa kelas IV SDN Sentul 2 Kota Blitar / Gayuh Gigih Laksono
198Penerapan model Roating Trio Exchange untuk meningkatkan aktivitas dan hasil belajar IPS peserta didik kelas VI SDN Purwantoro 6 Malang / Cahyaning Rahmi Sudibyo
199Penerapan pendekatan keterampilan proses untuk meningkatkan pemahaman konsep IPA siswa kelas V SDN Kertosari I Kabupaten Pasuruan / Badrus Shochich M.
200Pemanfaatan media gambar tokoh pahlawan untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas 5B SDN Lowokwaru 4 Kota Malang / Sri Astutik
201Penerapan model Survey, Question, Read, Recite, Review (SQ3R) untuk meningkatkan kemampuan membaca pemahaman siswa kelas V SDN Sumbersuko 01 Kecamatan Wagir Kabupaten Malang / Sri Mujiati
202Penerapan media permainan kartu arisan untuk meningkatkan hasil belajar PKn siswa kelas IV SDN Sukoharjo 1 Kota Malang / Suparti
203Penerapan Problem Based Learning (PBL) untuk meningkatkan aktivitas dan hasil belajar IPS kelas VI SDN Pusungmalang Puspo Pasuruan / Eka Yessie Lovita M.S.
204Penerapan model pembelajaran Cooperative Integrated Reading and Composition (CIRC) untuk meningkatkan kemampuan menulis karangan deskripsi di kelas IV SDN Madyopuro 2 Malang / Maya Matruty
205Pemanfaatan lingkungan sekolah sebagai sumber belajar IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas III SDN Gadang 1 Kecamatan Sukun Kota Malang / Santi Widiastuti
206Peningkatan kemampuan memahami isi dongeng melalui model pembelajaran SQ3R (Survey, Question, Read, Recite, Review) pada siswa kelas III SDN Purwodadi 2 Kecamatan Blimbing, Kota Malang / Ahmad Hanif Zainuruddin
207Peningkatan keterampilan berbahasa lisan melalui media gambar seri pada siswa kelas III SDN Senggreng 05 Kecamatan Sumberpucung Kabupaten Malang / Imro'atul Chusnia Afifah
208Peningkatan keterampilan menulis narasi dengan melengkapi cerita di kelas V SDN Kauman 01 Kota Blitar / Salma Kwadarkwasir
209Penerapan model pembelajaran broken shapes untuk meningkatkan aktivitas dan hasil belajar siswa kelas V pada mata pelajaran IPS SDN Sumbersari 2 Malang / Endah Nurhayati
210Peningkatan kemampuan motorik halus melalui teknik mozaik pada anak kelompok A TK Al Hikmah 2 Kecamatan Kanogoro Kabupaten Blitar / Sinta Rizky Alviasari
211Penerapan model pembelajaran langsung (direct instruction) untuk meningkatkan pembelajaran matematika di kelas II B SDN Blimbing I Kota Malang / Lydia Dewi Mahendra
212Penggunaan alat permainan kartu kata bergambar untuk meningkatkan keterampilan membaca dan menulis siswa kelas I SDN Ternyang 02 Kecamatan Sumberpucung Kabupaten Malang / Yuyun Setyaningsih
213Penerapan pendekatan konstruktivisme untuk meningkatkan hasil belajar siswa dalam pembelajaran matematika tentang luas bangun datar di kelas IV SDN Kalirejo V / Rizki Candra Septanto
214Pemanfaatan media pembelajaran koin bilangan bulat untuk meningkatkan hasil belajar matematika siswa kelas IV SDN Percobaan 1 kota Malang / Novi Qurratu A'yunin
215Peningkatan kemampuan kognitif anak mengidentifikasi bentuk geometri melalui kegiatan meronce pada kelompok A2 TK negeri Pembina Kepanjenkidul Kota Blitar / Desy Sukma Nindiasari
216Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar IPA siswa kelas V SDN Pandanwangi 2 Kecamatan Blimbing Kota Malang / Ribut Widianti
217Penggunaan media perspektif 3 dimensi untuk meningkatkan hasil belajar konsep bangun ruang siswa kelas VI SDN Podokoyo I, Pasuruan / I Made Kerta Ardana
218Penerapan pendidikan karakter di SDN Percobaan 2 Malang / Lenita Puspitasari
219Penerapan pembelajaran kooperatif tipe stad untuk meningkatkan penguasaankonsep penjumlahan tiga bilangan kelas III SD Negeri Kalipare III Kab. Malang tahun ajaran 2008/2009 / Aan Eko Cahyo Yunianto
220Penggunaan media tape recorder untuk meningkatkan keterampilan berbicara dalam bercerita siswa kelas V SDN Srandil Kec. Jambon Kab. Ponorogo / Fetina Diana Putri
221Penerapan model siklus belajar untuk meningkatkan pembelajaran IPS kelas IV MI As-Sholihin Rebalas Grati Pasuruan / Misbahul Munir
222Penerapan pendekatan whole language dengan fokus pembelajaran shared reading untuk meningkatkan keterampilan membaca permulaan siswa kelas 1 MI. Ma'arif Nogosari Pandaan / Yamyunah
223Implementasi teknik membaca skimming sebagai upaya meningkatkan hasil belajar mata pelajaran bahasa Indonesia siswa kelas IV SDN Sidoharjo VI Kecamatan Tanjunganom Kabupaten Nganjuk / Retno Dwi Wuryanti
224Penerapan model pembelajaran paikem untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPA MI Darul Ulum Rembang Kabupaten Pasuruan / K. Istiqomah
225Penerapan permainan bingo mini untuk meningkatkan kemampuan kognitif anak kelompok B TK PKK Setya Putra Malang / Faridlotul Laily
226Upaya meningkatkan aktifitas dan prestasi belajar IPA dengan pendekatan pembelajaran discovery pada siswa kelas VI SDN Gunungrejo 1 Singosari Malang / Gatot sukotjo
227Pembelajaran matematika lealistik berbasis discovery untuk meningkatkan hasil belajar matematika pokok bahasan luas bangun datar siswa kelas III SDN Kalisat I Kecamatan Rembang Kabupaten Pasuruan tahun pelajaran 2007/2008 / Diyana Fitriyah
228Pengembangan modul pembelajaran IPA materi panca indra manusia untuk kelas IV SDN Genukwatu I Kabupaten Jombang / Khristika Ayu Suryani
229Permainan ular tangga sebagai media untuk meningkatkan aktivitas dan hasil belajar IPS kelas v di SDN Sawojajar 1 Kota Malang / Saela Fauza
230Penerapan cooperative integrated reading and composition untuk meningkatkan kemampuan mengidentifikasi paragraf siswa kelas IV SDN Bakung 01 Kabupaten Blitar / Zuliana
231Pemahaman konsep IPA pokok bahasan listrik melalui media
seqib pada siswa kelas VI SD di Kecamatan Sukun Kota Malang / oleh Triana Kamiasih
232Peningkatan kemampuan mengenal huruf melalui media kartu nama di Kelompok Beramain Anak Saleh Malang / Lina Vidianti
233Penerapan model pembelajaran numbered head together untuk meningkatkan hasil belajar mata pelajaran IPS siswa kelas III SDN Kasembon 03 Kab. Malang / Dewi Septi Maria Pohashi
234Penerapan model pembelajaran group investigation untuk meningkatkan hasil belajar IPA tentang tumbuhan hijau kelas V SDN Temenggungan 02 kecamatan Udanawu kabupaten Blitar / Iswandi
235Penerapan metode role-playing untuk meningkatkan pemahaman kedisiplinan tema kehidupan sehari-hari kelas 2 SDN Purwantoro 8 Kecamatan Blimbing Kota Malang / Fardhika Saraswati Metrikarini
236Meningkatkan hasil belajar PKn dengan strategi TTW (Think - Talk - Write) siswa kelas III SDN Gampeng II / Dianika Ratnasari
237Penerapan pembelajaran kooperatif model TGT untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn kelas IV SDN Ngrami I Kecamatan Sukomoro Kabupaten Nganjuk / Malisa Dewi Mayasari
238Pemanfaatan industri rumah tangga sebagai sumber belajar siswa kelas V dengan pokok bahasan perekonomian untuk meningkatkan prestasi belajar IPS di SDN Widang III Tuban / Camelia Said
239Meningkatkan kemampuan menbaca melalui pembelajaran membaca melalui pembelajaran membaca cepat di kelas IV SDN Betet II Kec. Ngronggot Kab. Nganjuk / Aan Afidana Setyawan
240Penerapan metode numbered head together untuk meningkatkan hasil belajar siswa kelas V pada mata pelajaran PKn di SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan / Ida Ohoiwutun
241Penggunaan model pembelajaran kooperatif tipe STAD pada mata pelajaran PKn topik sistem pemerintahan desa dan kecamatan untuk meningkatkan hasil belajar siswa kelas IV SDN Arjosari I Kecamatan Rejoso Kabupaten Pasuruan / Antonius Rahadat
242Penggunaan metode inkuiri untuk meningkatkan prestasi belajar kompetensi dasar mendeskripsikan sifat-sifat cahaya pada mata pelajaran IPA siswa kelas V SDN Temayang Kecamatan Kerek Tuban / Melinda Olifia Sahara
243Aplikasi metode penemuan terbimbing untuk meningkatkan hasil belajar matematika siswa kelas IV SDN Kauman 2 kota Malang / Inna Megawati Suprapto
244Strategi guru dalam menangani anak usia 4-5 tahun yang mengalami temper tantrum di TK Pembina 5 Kedung Kandang Kota Malang / Dian Ramadhani Yahya
245Penerapan model pembelajaran index card match untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas VI di SDN Kedungsalam 5 / Ratih Purnama Dewi
246Penerapan model pembelajaran Snowball Throwing untuk meningkatkan aktivitas dan hasil belajar tematik siswa kelas VA di SDN Penanggubngan Kecamatan Klojen Kota Malang / Maidina
247Mengintegrasikan pendidikan seni budaya dan keterampilan dengan pelajaran lain pada pembelajaran tematik dalam meningkatkan minat dan keaktifan belajar siswa kelas II Sekolah Dasar Negeri Gadang 2 Kecamatan Sukun Kota Malang / Lucia Tjahja Darmawati
248Penggunaan multimedia interaktif untuk meningkatkan hasil belajar siswa pada pembelajaran IPA kelas IV SDN Sentul 02 Kota Blitar / Moh. Adibul Akrom
249Pengembangan media rotabus untuk perkembangan berbicara anak usia 4-5 tahun di Taman Kanak-kanak Kota Malang / Riska Amelia Permatasari
250Pemanfaatan media gambar ilustrasi sebagai alat peraga untuk meningkatkan hasil belajar PKn siswa kelas I SDN Pisangcandi I Kota Malang / Rita Yulaika
251Penerapan model pembelajaran role playing untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Sukun 01 Kota Malang / Irawati Rahayu
252Penerapan media gambar seri untuk meningkatkan keterampilan bercerita pada siswa kelas III SDI Klojen Kidul Kecamatan Klojen Kota Malang / Purnawan Dian Prasetya
253Penerapan pendekatan keterampilan proses (PKP) untuk meningkatkan hasil belajar IPA konsep sifat benda cair, padat dan gas siswa kelas IV SDN Bareng V Kecamatan Klojen Kota Malang tahun pelajaran 2009-2010 / Jefri Rumodar
254Penerapan pembelajaran matematika yang berorientasi pada teori belajar Bruner untuk meningkatkan pemahaman konsep pecahan senilai siswa kelas IV SDN Jatimulyo 3 Malang / Indah Yulaikah
255Peningkatan prestasi belajar siswa melalui model Nimbered Head Together (NHT) pada pembelajaran matematika di kelas III SDN Purworejo 03 Kabupaten Blitar / Afta Rahmat Zayn
256Peningkatan hasil belajar IPS melalui metode pembelajaran index card match pada siswa kelas III SDN Kedungwilut Kabupaten Tulungagung / Agustin Limita Ariany
257Penerapan model permainan simulasi untuk meningkatkan keaktifan dan hasil belajar PKn pokok bahasan tolong menolong siswa kelas II Sekolah Dasar Ampelgading 01 Kecamatan Selorejo Kabupaten Blitar tahun ajaran 2008-2009 / Desfita Agustina
258Efektifitas penerapan metode contextual teaching and learning (CTL) dalam meningkatkan motivasi belajar pendidikan kewarganegaraan materi norma siswa kelas III SDN Jatiguwi V Sumberpucung Malang tahun 2008 / Marsiti
259Upaya meningkatkan motivasi dan hasil belajar siswa melalui model siklus belajar dalam pembelajaran IPS kelas IV SDN gempol Kecamatan Rejoso Kabupaten Nganjuk / Afif Kurniawan
260Penerapan teori belajar Jerome Bruner untuk meningkatkan penguasaan konsep perkalian siswa kelas II SDN Blimbing 4 Kecamatan Blimbing Kota Malang / Indah Sukowati
261Peningkatan hasil belajar IPS melalui model kooperatif tipe Think Pair Share (TPS) pada kelas V SDN 1 Karanganom Kabupaten Tulungagung / Fitria Maria Ulfa
262Upaya meningkatkan hasil belajar IPS siswa kelas III di SDN Sidodadi 02 Lawang melalui penerapan model kooperatif jenis numbered heads together (NHT) / Luhana Dia Pertiwi
263Meningkatkan keterampilan berbahasa Indonesia melalui pemanfaatan perpustakaan sekolah siswa kelas IV SDN Klurahan III Kecamatan Ngronggot Kabupaten Nganjuk / Siti Umi Nurul Hidayah
264Penerapan model pembelajaran berbasis deep dialogue untuk meningkatkan prestasi belajar PKn bagi siswa klas V SDN Gebangkerep I Kecamatan Baron Kabupaten Nganjuk / Agus Dwi Putranto
265Penggunaan blok dienes untuk meningkatkan penguasaan konsep penjumlahan dan pengurangan pada siswa kelas II SDN Watuwungkuk Probolinggo / Desi Arie Kurniawati
266Penerapan pemecahan masalah dengan menggunakan teori polya untuk meningkatkan emampuan memecahkan masalah matematika siswa kelas IV SDN Asmorobangun 2 Kabupaten Kediri / Hardini Novia Widoti
267Penerapan model contextual teaching and learning untuk meningkatkan prestasi belajar dan kedisiplinan siswa bidang studi PKn pokok bahasan NKRI siswa kelas V SDN Drenges 04 Kecamatan Kertosono Kabupaten Nganjuk / Slamet Wahyudhi
268Pemanfaatan media tiruan (boneka) dalam meningkatkan prestasi belajar mata pelajaran IPA pokok bahasan mengidentifikasi fungsi organ pernafasan manusia kelas V SDN Kudu II Kecamatan Kertosono Kabupaten Nganjuk / Denny Setya Budi
269Pemanfaatan kebun sekolah untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Karangrejo 02 / Dyah Ayu Pertiwi
270Penggunaan strategi survey, question, read, record, recite, dan review(SQ4R) untuk meningkatkan kemampuan membaca pemahaman siswa kelas V SD Al-Irsyad Kota Batu / Moh. Faishal
271Meningkatkan kemampuan menulis dan mengekspresikan puisi dengan pembelajaran terpadu model terhubung (connected) pada pembelajaran bahasa Indonesia kelas V SDN talok 03 Turen Malang / Ise Dwi Erliningsih
272Penggunaan media gambar ilustrasi untuk meningkatkan kemampuan menyimpulkan isi teks bacaan dalam pembelajaran bahasa Indonesia siswa kelas IIA SDN Maron Wetan I Probolinggo / Wulan Kusuma Anggeraeni
273Pemanfaatan media gambar untuk meningkatkan hasil belajar IPS materi tokoh pejuang proklamasi kemerdekaan siswa kelas V SDN Curah Dukuh II Kecamatan Kraton Kabupaten Pasuruan / Luluk Winarti
274Penggunaan media konkrit untuk meningkatkan konsepsi siswa kelas IV tentang gaya di SDN Tamanayu 03 / Fitri Yuliani
275Penerapan metode inkuiri untuk meningkatkan penguasaan konsep energi gerak pada mata pelajaran IPA kelas III SDN Pakisaji 02 / Sutirah
276Penerapan model pembelajaran inkuiri jurisprudensial untuk meningkatkan keaktifan dan hasil belajar siswa pada mata pelajaran PKn kelas IV SDN Kasreman Kecamatan KAndangan Kabupaten Kediri / Shinta Paramita Priananda
277Pembelajaran matematika berbasis inkuiri untuk meningkatkan kemampuan menemukan volume limas di kelas VI SDN Pakisaji 2 / Dian Wirastutik
278Peningkatan kemampuan mengenal konsep bilangan 1-10 melalui permainan misteri dadu pada anak kelompok A di TK Angkasa 07 Pringgodani Singosari / Wening Kridhaning Arum
279Peningkatan hasil belajar PKn melalui model pembelajaran bermain peran pokok bahasan sistem pemerintahan pusat siswa kelas IV SDN Pukul Kecamatan Kraton Kabupaten Pasuruan / Anggarini Prihatiningsih
280Penggunaan metode diskusi untuk meningkatkan prestasi belajar IPS siswa lkelas IV SDN Ranuklindungan I kecamatan Grati kabupaten Pasuruan / Widat Maulukhi
281Penerapan metode discovery untuk meningkatkan hasil belajar IPA Siswa kelas V SDN Oro-Oro Ombo kulon I Kecamatan Rembang Kabupaten Pasuruan / Maftuhadi
282Penerapan model permainan berbasis teori dienes untuk meningkatkan pemahaman konsep perkalian siswa kelas II B SDN Dadaprejo 01 Batu / Usnindra Utami
283Penerapan strategi language experience approach (LEA) untuk meningkatkan kemampuan menulis karangan sederhana di kelas III SDN Tanjungrejo 2 Kota Malang / Aulia Rohmawati
284Tingkat kompetensi guru dalam pengembangan media pembelajaran di SDN se-kecamatan Mojowarno Kabupaten Jombang / Ananda Bagus Prakoso
285Penerapan metode simulasi untuk meningkatkan hasil belajar IPS siswa kelas III SDN Ngadiwono II Kecamatan Tosari Kabupaten Pasuruan / Reni Rusmiati
286Pelaksanaan program pelajaran kerajinan tangan dan kesenian
kurikulum SD 1994 di SD Negeri Sekepengawasan Sukun 05
Kecamatan Sukun Kodya Malang / oleh Eny Wahyuningsih
287Meningkatkan hasil belajar IPA pada pembelajaran pesawat sederhana dengan metode inkuiri di kelas V SDN Wonosunyo II Kecamatan Gempol Kabupaten Pasuruan / Bahrul Ulum
288Meningkatkan kemampuan menulis puisi dengan metode pebdeskripsian dalam tema air, bumi dan matahari pada kelas IIB SDN Ngabar Jetis Mojokerto / Moch. Choirul Hidayat
289Peningkatan hasil belajar tentang kegiatan jual beli melaui metode role playing pada siswa kelas III SDN 01 Semanding Kabupaten Tulungagung / Bayu Segoro
290Penerapan pendekatan sains teknologi masyarakat (STM) untuk meningkatkan motivasi, aktivitas, dan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Petung I Kecamatan Pasrepan Kabupaten Pasuruan / Syamsul Arif
291Penerapan metode inkuiri untuk meningkatkan kemmpuan mendeskripsikan benda di sekitar pada mata pelajaran Bahasa Indonesia siswa kelas II SDN Gondanglegi Wetan 02 Kabupaten Malang / Iskandar Dzulkarnain
292Penggunaan teknik batang napier untuk meningkatkan prestasi belajar pada operasi perkalian bilangan cacah siswa kelas IV SDN Watestani 04 Kecamatan Nguling Kabupaten Pasuruan / Epuk Suswati Rahayu
293Meningkatkan hasil belajar IPA dengan menggunakan pendekatan cooperative learning tipe STAD di kelas V SDN Pasrepan I Kecamatan Pasrepan Kabupaten Pasuruan / Shinta Diah Damayanti
294Penerapan pembelajaran kontekstual (contextual teaching and learning) untuk meningkatkan penguasaan konsep pembagian siswa kelas II SDN Puspo V Kabupaten Pasuruan / Lina Hidayatul Ilmiyah
295Hubungan kemampuan literasi dengan hasil belajar siswqa kelas V di SDN Bunulrejo 3 Kota Malang / Esthi Prasetyaning Puspitasari
296Penerapan model Polya untuk meningkatkan kemampuan siswa dalam menyelesaikan soal pemecahan masalah matematika di kelas II SDN Tunggul Wulung I Pandaan Pasuruan / Ike Indah Kurniawati
297Pemanfaatan media mock-up timbangan bilangan untuk meningkatkan hasil belajar operasi hitung pembagian pada siswa kelas II SD Negeri Cobanjoyo I Kecamatan Kejayan Kabupaten Pasuruan / Usep Dwi Andrianto
298Meningkatkan pemahaman konsep nilai tempat suatu bilangan dengan menggunakan media abacus biji kelas IV di SDN Tundosoro Kabupaten Pasuruan / Elis Ratna Dewi
299Penerapan model pembelajaran jigsaw untuk meningkatkan hasil belajar siswa dalam pembelajaran IPS kelas III B SDN Karangsari 3 Kota Blitar / Lutfi Rahmawati
300Penggunaan pendekatan paikem pada pembelajaran PKn dapat meningkatkan hasil belajar siswa kelas IV di SDN Tlumpu kota Blitar / Reni Uba Permatasari
301Penerapan model peta konsep untuk meningkatkan hasil belajar pendidikan kewarganegaraan siswa kelas IV SDN Dermo I Bangil - Pasuruan / Djaelani
302Analisis kemampuan siswa kelas V dalam menemukan pesan moral yang termuat pada cerita rakyat di SDN Kotaanyar 1 Kabupaten Probolinggo / Maulidatul Jannah
303Penerapan model quantum teaching untuk meningkatkan motivasi, keaktifan, dan hasil belajar IPA siswa kelas III MI Negeri Beji Pasuruan / Labibah Maftuhah
304Penerapan metode inquiry untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS di kelas IV SDN Tunggulwulung I Kec. Pandaan Kab. Pasuruan / Moh. Samsul Arifin
305Meningkatkan prestasi belajar perkalian melalui pendekatan PMRI siswa kelas II SDN Martopuro 1 kecamatan Purwosari kabupaten Pasuruaan / Endah Puspandari
306Upaya meningkatkan keterampilan berbahasa jaea kromo inggil dengan model picture and picture pada siswa kelas IV SDN Lesanpuro 3 kecamatan Kedungkandang kota Malang / M.M. Sri waluyowati
307Upaya meningkatkan prestasi belajar IPA kelas V melalui strategi pembelajaran inquiri (SPI) di MI Roudlotul Hikmah II Sumurlecen Kedawang - Nguling - Pasuruan / Sri Wahyuni Hidayati
308Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar IPA siswa kelas IV Madrasah Intidaiyah Darul Ulum Candiwates kecamatan Prigen Kabupaten Pasuruan / Was'ayah
309Penerapan model bermain dalam upaya meningkatkan prestasi belajar perkalian pada siswa kelas dua SDN Pucangsari 2 Kecamatan Purwosari / Akhmad Khusaini
310Penerapan media pembelajaran ritatoon untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPS di MI Darul Ulum Rowogempol Kecamatan Lekok / Lima Melati
311Meningkatkan kemampuan memahami isi bacaan dengan teknik jigsaw pada siswa kelas II di Sekolah Dasar Negeri Kotalama I Kota Malang / Pandu Bayu Cita
312Penerapan pembelajaran kontekstual untuk meningkatkan prestasi belajar matematika konsep penjumlahan bilangan bulat pada siswa kelas IV SDN Karangrejo 01 kec. Garum Kab. Blitar / Siti Mahmudah
313Penerapan pendekatan problem solving untuk meningkatkan penguasaan konsep pengukuran waktu pada siswa kelas III B di SDN Landungsari 01 Malang / Harwiyati Utami
314Upaya meningkatkan hasil belajar IPA melalui metode eksperimen tentang cara tumbuhan membuat makan kelas V SD Sambisirah II-Wonorejo-Pasuruan / Sugiyanto
315Penerapan model bermain peran untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn di kelas V SDK Wignya Mandala Kecamatan Tumpang Kabupaten Malang / Dessi Dianti
316Penerapan model pembelajaran bermain peran untuk meningkatkan hasil belajar IPS pada siswa kelas III SDN Kedawung 02 Kabupaten Blitar / Kenes Wantiana
317Penggunaan benda asli dan multimedia untuk meningkatkan penguasaan konsep pecahan di kelas III SDN Kebonagung 06 Malang / Rafiud Nur Annisa
318Meningkatkan kemampuan menulis melalui media audio visual pada siswa kelas V SDN Sutojayan 01 kecamatan Sutojayan kabupaten Blitar / Ika Bekti Tina Lestari
319Penerapan pendekatan cooperative learning tipe student teams achievement division untuk meningkatkan hasil belajar IPS siswa kelas V SDN Mulyoagung 04 / Khoirun Nisa'
320Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar mata pelajaran IPA pada siswa kelas V SDN Ngenep 1 Karangploso Kab. Malang / Mashudah
321Meningkatkan kemampuan menemukan kalimat utama dengan model pembelajaran kooperatif tipe STAD di kelas IV SDN Candibinangun IV Kecamatan Sukorejo Kabupaten Pasuruan / M. Yasin
322Meningkatkan hasil belajar melalui metode mind mapping pada pembelajaran IPS siswa kelas IV di SDN Bendo 02 Kota Blitar / Yanti Adriana Pohwainyaan
323Penerapan metode discovery dalam pembelajaran sains untuk meningkatkan hasil belajar dan keterampilan kooperatif siswa kelas II SDN Karanganyar Pasuruan / Siti Chotijah
324Penerapan pembelajaran kooperatif model student teams echivement division (STAD) untuk meningkatkan hasil belajar ilmu penetahuan alam ( IPA ) siswa 2 SDN Sentul 1 Blitar / Ermi Farida
325Penerapan pembelajaran jigsaw untuk meningkatkan hasil belajar PKn siswa kelas IV SDN Karangrejo 05 kec. Garum kab. Blitar / Idha Yusani
326Penggunaan model pembelajaran guided note taking untuk meningkatkan proses dan hasil belajar IPS siswa kelas VC SDN Bareng 3 Kota Malang / Ardan Herenana
327Penggunaan pemodelan untuk meningkatkan hasil belajar IPA pada kelas V SDN Wonokoyo 2 Malang / Saiful
328Penarapan metode bermain peran meningkatkan proses dan hasil belajar PKn materi pokok pelaksanaan pemilu dan pilkada pada siswa kelas VI SDN Sedarum I Kecamatan Nguling Kabupaten Pasuruan / Ika Nur Noviyanti
329Upaya meningkatkan hasil belajar melalui metode diskusi dalam pembelajaran IPS bagai siswa kelas V SDN Kedungdowo I Kabupaten Nganjuk / Dany Murjianto
330Meningkatkan hasil belajar IPA melalui pembelajaran berbantuan media internet pada siswa kelas VI SDN Mergosono 3 Kota Malang / Sigit Gunawan
331Meningkatkan kemampuan memecahkan masalah pengukuran luas bangun datar melalui penerapan pohon matematika di kelas V SDN Sebandung II Pasuruan / Era Penida
332Penerapan model stad untuk meningkatkan keterampilan membaca pada siswa kelas 4 SDN Kebonagung 6 Pakisaji Malang / Citra Anugrah Hendra
333Pemanfaatan media pembelajaran kartun dalam meningkatkan kemampuan membaca nyaring siswa kelas II Sekolah Dasar Negeri Sumberejo Kecamatan Winongan Kabupaten Pasuruan / Fatkah
334Peningkatan hasil belajar IPS menggunakan media lingkungan sekitar sekolah di kelas IV SDN Suru 01 Kabupaten Blitar / Dana Wahyu Saputra
335Meningkatkan pembelajaran membaca menulis permulaan dengan model kartu huruf di kelas I SDN Kemiri Kecamatan Puspo Kabupaten Pasuruan / Erlinawati
336Pengembangan media pembelajaran berbasis multimedia dengan menggunakan swishmax 4 untuk kelas V materi tema 5 subtema 3 di SDN Purwantoro 8 Kota Malang / Anjar Surya Kusuma
337Meningkatkan kemampuan menyelesaikan operasi hitung bilangan bulat melalui pembelajaran TPS dengan menggunakan media benda konkret / Siti Juhariyah
338Penerapan model kooperatif tipe group investigation untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang Kota Malang / Dorkas H. Gardjalay
339Penerapan pembelajaran model mind mapping untuk meningkatkan aktivitas dan hasil belajar IPS kelas V SDN Sumberjo 3 Kecamatan Wonosalam Kabupaten Jombang / Desi Ratna Triwulan Sari
340Penggunaan media key word card untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas I SDN Gongseng I Megaluh Jombang / Yuniar Ayu Widhayati
341Penggunaan media fraction circles untuk meningkatkan kualitas pembelajaran konsep pecahan di kelas III SDN Mulyorejo 3 Malang / Riska Wahyu Hidayati
342Peningkatan keterampilan menulis karangan narasi melalu model Think Talk Write (TTW) pada pembelajaran di kelas V SDN Diwek 1 Jombang / Asri Dwi Pratiwi
343Peningkatan pemahaman keindahan alam negeriku melalui model problem based learning kelas IV SDN Bendo 1 Kepanjenkidul Kota Blitar / Sartika Purnama Sari
344Penerapan model Example Non Example untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn di kelas IV SDN Jetis 1 Pace Nganjuk / Farida Nur Rahmawati
345Peningkatan keterampilan menulis puisi melalui media lingkungan pada siswa kelas III SDN Sawojajar 2 Malang / Qonia Chusna Yunindha
346Problematika implementasi pendekatan saintifik dan pendekatan tematik integratif di SDN Sumbersari 1 Kota Malang / Bagus Cahyanto
347Upaya guru dalam memotivasi belajar matematika siswa kelas V Sekolah Dasar se-Kepenilikan Kecamatan Klojen Kota Malang oleh Rusiati
348Peningkatan kreativitas melalui permainan Sandiwara Boneka pada anak Kelompok B di TK Siwi Pertiwi Malang / Dian Eva Christianingrum
349Pengembangan media Cd interaktif tema Merawat Hewan dan Tumbuhan sub tema Hewan si Sekitarku kelas II semester 2 Sekolah Dasar / Citra Dwi Mawar Sari
350Korelasi antara perkembangan motorik halus dengan kemampuan menulis awal anak usia dini di TK Al Muhajirin Kota Malang / Dwi Indrawati
351Persepsi guru terhadap pembelajaran berdasarkan kurikulum 2013 di SDN se-Kecamatan Lengkong Kabupaten Nganjuk / Dessy Malinda Fidianti
352Pengembangan media pembelajaran CD interaktif mata pelajaran IPS materi pekerjaan untuk siswa kelas III SDN Kayukebek 1 Kecamatan Tutur Kabupaten Pasuruan / Teguh Wahyu Kurniawan
353Analisis kemampuan siswa kelas V dalam menemukan pesan moral yang termuat pada mass media di SDN Bumiayu 3 Kota Malang / Ghalih Eka Kusumaaji
354Penggunaan media audio visual untuk meningkatkan keterampilan menulis puisi siswa kelas V SDN Lamongrejo 4 Kabupaten Lamongan / Verda Noela Hardini
355Penerapan metode pembelajaran co-op co-op untuk meningkatkan kemampuan membaca cerita siswa kelas V SDN Masangan Kecamatan Bangil Kabupaten Pasuruan / Christina Laelaem
356Penggunaan strategi think talk write (TTW) untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS di SDN Manaruwi II Kecamatan Bangil Kabupaten Pasuruan / Annastasia Rettob
357Peran kepala sekolah dalam implementasi kurikulum 2013 di SDN Lowokwaru 2 Kecamatan Lowokwaru Kota Malang / Dilon Yordania
358Pengembangan pola bermain sirkuit Kawan Ceria untuk aspek sosial emosional anak Kelompok B TK Kartika IX-41 Malang / Rista Widyawati
359Pengembangan media gambar animasi manual dalam pembelajaran bahasa padsa anak Kelompok B di KC/TK An-Nur Sawojajar Malang / Nuri Yuniar Wahyu Putri Abadi
360Pengembangan media Prisma Putar untuk mengembangkan kemampuan kognitif anak Kelompok B Taman Kanak-Kanak / Suprapti
361Penerapan metode karya wisata untuk meningkatkan kemampuan menulis puisi siswa kelas V SDN Pendem 02 Kecamatan Junrejo kota Batu / Didit Yulian Kasdriyanto
362Peningkatan hasil belajar subtema Indonesiaku bangsa yang jaya melalui media scrapbook pada siswa kelas VC SDN Sananwetan 2 Kota Blitar / Lina Mustika Hidayaty
363Penggunaan media maket untuk meningkatkan keterampilan berbicara dalam pembelajaran bahasa Indonesia siswa kelas IV SDN Kauman 2 Kecamatan Ngoro Kabupaten Jombang / Mar'atus Sholihah
364Penerapan model pembelajaran make a match untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Bandungrejosari III Malang / Ria Erlinda
365Penerapan cooperative learning tipe team game tournament untuk meningkatkan kualitas pembelajaran IPA di SDN Pecalukan V Kecamatan Prigen Kabupaten Pasuruan / Muh. Al Murtadho
366Peneraoan pembelajaran pakem dalam meningkatkan hasil belajar IPS siswa kelas IV SDN Tanjungrejo 2 Kecamatan Sukun Kota Malang / Zainul Adha
367Aplikasi model mind mapping berbasis eksperimen untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV-B di SDN Klojen Kota Malang / Mohamad Fadli Fauzi Renyaan
368Penerapan model TGT untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS kelas V SDN Banjarejo 02 Kecamatan Pakis / Nanik Purwa Ningtiyas
369Penggunaan media boneka tangan untuk meningkatkan kemampuan menyimak cerita pada siswa kelas I SDN Madyopuro 03 Kota Malang / Ultria Mulyasari
370Penerapan model inkuiri untuk meningkatkan hasil belajar IPA pada siswa kelas IV SDN Pogar III Bangil semester II / Suhariyati
371Penggunaan media papan Flanel untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IV SDN Mergosono 5 Malang / Ernawati
372Penggunaan media specimen pada pembelajaran ilmu pengetahuan alam untuk meningkatkan hasil belajar siswa kelas IV SDN Kebonagung 06 Malang / Dyah Purwahyuni
373Penerapan peta konsep untuk meningkatkan hasil belajar IPA pokok bahasan perkembangan makhluk hidup kelas VI SDN Balearjosari 1 Kota Malang / Vita Romala Inspiranti
374Penerapan metode pembelajaran PQ4R (preview, question, readm reflect, recite, review) untuk meningkatkan hasil belajar IPS siswa kelas VI SDN Klampis Ngasem IV/560 Surabaya pada pokok bahasan benua / Leny Oktriana
375Penerapan pendekatan komunikatif untuk meningkatkan keterampilan berbicara pada siswa kelas VI SDN Dayurejo IV Kecamatan Prigen Kabupaten Pasuruan / Suligi
376Penggunaan media 10 jari tangan untuk meningkatkan pemahaman konsep penjumlahan dan pengurangan bilangan dua angka pada siswa kelas 1 SDN Sukoharjo 1 Kota Malang / Henny Kusmiati
377Penerapan model problem based learning untuk meningkatkan pembelajaran IPS siswa kelas IV SDN Bunulrejo 2 Kecamatan Blimbing Kota Malang / Ika Rusaria
378Peningkatan kemampuan bercerita anak usia 5-6 tahun melalui pemanfaatan media playdough bagi anak kelompok B TK Sta. Elisabeth Lewokung Kabupaten Flores Timur / Letitsia Aprilini Katarina Lewar
379Penerapan pendekatan kontekstual untuk meningkatkan hasil belajar matematika siswa kelas III SD Pandanmulyo 01 Kecamatan Tajinan Kabupaten Malang / Misdi
380Penerapan metode eksperimen untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPA pokok bahasan penyesuaian diri makhluk hidup pada siswa kelas V SDN Pagentan 05 Kec. Singosari Kab. Malang tahun pelajaran 2009/2010 / Jaenab
381Pengembangan media CD interaktif pada pembelajaran kelas IV semester genap subtema "Giat Berusaha Meraih Cita-cita" di sekolah dasar / Jonson
382Meningkatkan kemampuan menghitung luas permukaan kubus dan balok melalui pembelajaran discovery / Habib
383Meningkatkan hasil belajar IPA dengan pendekatan CTL pada kelas IV SDN Bajang I Kecamatan Ngluyu Kabupaten Nganjuk / Mustakim
384Penerapan model pembelajaran synectics dipadukan teknik mind map untuk meningkatkan hasil belajar IPS dan kemampuan berpikir kreatif siswa kelas IV SDN Jono II Bojonegoro / Ratna Widya Wijayanti
385Penggunaan model pembelajaran kontekstual untuk meningkatkan kemampuan menyelesaikan soal cerita pecahan matematika pada siswa kelas V SDN Sambikerep II/480 Surabaya / Akhmad Fasih
386Penerapan model STAD untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN bandulan 3 Kota Malang pada tema 8 subtema 2 / Ririn Widyaningsih
387Penerapan metode pembelajaran bermain peran untuk meningkatkan aktivitas belajar dan hasil belajar PKn pada siswa kelas V SDN Gandul I Madiun / Suti
388Penerapan model pembelajaran Van Hiele untuk meningkatkan kemampuan menentukan sifat-sifat bangun ruang di kelas V / Dwinoto
389Meningkatkan pemahaman konsep nilai tempat di kelas I dengan menggunakan teori belajar Dienes / Leliya Widiana Sucipto
390Penerapan model polya untuk meningkatkan kemampuan pemecahan masalah matemtika siswa kelas IV SDN Rejosari Kraton Pasuruan / Sri Umiyati
391Penerapan metode inkuiri untuk meningkatkan hasil belajar IPA materi kerangka manusia pada siswa kelas IV SDN Pagentan II Singosari Kabupaten Malang / Abdul Rochim
392Peningkatan keterampilan berbicara siswa kelas IIIB melalui bermain telepon di SDN Kademangan 5 Kecamatan Kademangan Kabupaten Blitar / Rosalia Kartikawati
393Penerapan model pembelajaran siklus belajar dalam upaya meningkatkan prestasi belajar siswa tentang SDA pada siswa kelas V SDN Plosoharjo I Nganjuk / Puji Rahayu
394Penerapan model pembelajaran jigsaw untuk meningkatkan hasil belajar PKn materi globalisasi pada siswa kelas IV SDN Pungging tutur Pasuruan / Abdul Azis
395Penggunaan teknik Euclides untuk meningkatkan hasil belajar faktor persekutuan terbesar (FPB) dan kelipatan persekutuan terkecil (KPK) pada siswa kelas IV SDN Kedungpengaron II Kecamatan Kejayan Kabupaten Pasuruan / Hari Purwanto
396Penerapan pembelajaran model think-pair-share untuk meningkatkan kemampuan pemecahan masalah pada matematika di kelas IV MI Ma'arif Kraton Pasuruan / Ririn Wulandari
397Penerapan model think pair share untuk meningkatkan hasil belajar pendidikan kewarganegaraan pada siswa kelas II SDN Lawang 06 Kecamatan Lawang Kabupaten Malang / Ary Nur Alni
398Penerapan model pembelajaran deep dialogue untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang kota Malang / Siti Kunut Goulap
399Penerapan model pembelajaran literasi untuk meningkatkan kemampuan menulis karangan siswa di kelas V SDN Pakisaji 02 / Siti Nur Aisyah
400Penerapan metode diskusi untuk meningkatkan pemahaman konsep matematika pecahan dalam pemecahan masalah pada siswa kelas V SDN menanggal 601 Surabaya / Umi Sumijati
401Penggunaan media gambar struktur organisasi untuk meningkatkan hasil belajar PKn materi kerja sama pada siswa kelas V di SDN Banjararum 02 Singosari / Elly Tjaturini
402Penerapan pendekatan discovery untuk meningkatkan hasil belajar IPA materi benda dan sifatnya pada siswa kelas V MI. Miftahul Huda Pohjentrek Pasuruan / Nurhidayati
403Meningkatkan hasil belajar siswa dalam pelajaran IPA kelas V SDN Bandulan I dengan pendekatan STM / Bambang Tri Kuntoyo
404Penerapan model pembelajaran demokratis berperspektif gender untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn di kelas V SDN Beji IV Pasuruan / Geralds Ronald Kolely
405Perbedaan hasil belajar berbahasa menggunakan metode bercerita dengan metode pemberian tugas anak kelompok B di TKM Al-Khoiriyah Segaran Pakisaji Kabupaten Malang / Ula Nur Hayatiningsih
406Pelaksanaan pembelajaran inklusi di SDN Arjosari 3 Kota Malang / Rendra Handy Abdillah
407Penggunaan media puzzle untuk meningkatkan kemampuan membaca peta buta Indonesia pada mata pelajaran IPS siswa kelas V SDN Sambikerep III Surabaya / Arif Setiawan
408Penerapan metode eksperimen untuk meningkatkan prestasi belajar IPA pada siswa kelas V SDN Pagentan V Kecamatan Singosari Kabupaten Malang tahun pelajaran 2009/2010 / Wiwik Sumiyati
409Penerapan model pembelajaran kontekstual berbantuan media VCD untuk meningkatkan pelajaran IPA lingkungan fisik terhadap daratan siswa kelas IV SDN Lakarsantri III/474 Surabaya / Nunuk Nularsih
410Penerapan pembelajaran model mind mapping untuk meningkatkan hasil belajar membaca pemahaman siswa kelas IV SDN Kotalama V Malang / Ida Hamzah
411Penerapan pembelajaran kooperatif model teams games tournaments (TGT) untuk meningkatkan hasil belajar IPS siswa kelas III SDN Gambiran I Kec. Prigen Kab. Pasuruan / Lilik Yuliati
412Penerapan media permainan TTS (teka-teki silang) untuk meningkatkan pemahaman konsep materi IPS di kelas V SDN Penanggungan Malang / Yati Karyati
413Penggunaan media foto untuk meningkatkan kemampuan menulis karangan narasi siswa kelas V SDN Mulyoagung 03 Kecamatan Dau Kabupaten Malang / Fiddina Fauzia
414Pengembangan media papan flanel untuk pembelajaran penjumlahan dan pengurangan bilangan pada siswa kelas I sekolah dasar / Ika Elita Nur Azizah
415Meningkatkan keterampilan menulis berita melalui menyimak rekaman berita radio di kelas V SDN Kamulan 02 Kabupaten Blitar / Novialita Angga Wiratama
416Pengembangan media Ritatoon my body is mine sebagai upaya preventif sexsual abuse anak taman kanak-kanak di TK Theobroma I Sepawon / Elthia Ulfa Marenda Adzani Wulan Suci
417Pengembangan modul pembelajaran subtema bermain di lingkungan rumah kelas II SDN Bandungrejosari 3 Malang tahun pelajaran 2014/2015 / Pratiwi Eka Rachmawati
418Analisis kesesuaian buku siswa kelas V dengan karakteristik pembelajaran tematik dan pendekatan saintifik / Nilamsari Dama Yanti Fajrin
419Penerapan pembelajaran paikem untuk meningkatkan kreativitas siswa kelas IV MI Darul Ulum Rembang Kec. Rembang Kab. Pasuruan / Silahi
420Upaya meningkatkan pembelajaran IPA siswa kelas IV MI Darul Ulum Gondangwetan dengan pendekatan kooperatif model STAD / Hidayati
421Penerapan strategi pembelajaran inkuiri untuk meningkatkan aktivitas dan hasil belajar IPA pada siswa kelas III SDN Sudimoro 02 Kecamatan Bululawang Kabupaten Malang / Sukartono
422Penerapan model pembelajaran think pair share untuk meningkatkan aktivitas dan hasil belajar siswa tema 2 kelas IVA SDN Kebonsari 2 Kecamatan Sukun Kota Malang tahun 2014-2015 / Tri Ardianto
423Penerapan metodr inquiri untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPA pada siswa kelas III SDN ngawonggo 01 Kecamatan tajinan kabupaten malang tahun pelajaran 2009/2010 / Sugeng Mulyanto
424Meningkatkan kemampuan membacakan dongeng kelas 2 melalui pendekatan komunikatif di MI Roudlotul Hikmah Kecamatan Nguling Kabupaten Pasuruan / Unaizah
425Upaya meningkatkan keterampilan pembelajaran perkalian melalui penggunaan jari-jari tangan pada siswa kelas IV SDN Pukul Kabupaten Pasuruan / Mukhdori
426Penerapan problem based learning untuk meningkatkan motivasi dan hasil belajar dalam pembelajaran bahasa Indonesia siswa kelas V SDN Tegalweru Kecamatan Dau Kabupaten Malang / Yulfika Yasmin
427Penerapan metode role playing pada mata pelajaran IPS untuk meningkatkan motivasi, aktivitas dan hasil belajar siswa kelas IV SDN Kotaanyar 1 Kecamatan Kotaanyar Kabupaten Probolinggo / Nurma Indah Pangesti
428Penerapan pendekatan CTL untuk meningkatkan hasil belajar IPS siswa kelas III SDN Umbulan Kecamatan Winongan Kabupaten Pasuruan / Karisma Lestari
429Penerapan pakem untuk meningkatkan aktivitas dan hasil belajar matematika siswa kelas III SDN Sindurejo 01 Kabupaten Malang / Anggun Eko Ferianto
430Penerapan pembelajaran CTL untuk meningkatkan hasil belajar IPA materi bagian-bagian utama tumbuhan bagi siswa kelas II MI Miftahul Ulum 2 Nguling Kec. Nguling Kab. Pasuruan / Susriati
431Penerapan pembelajaran kooperatif model jigsaw untuk meningkatkan hasil belajar siswa kelas VI tentang proses pemilu mata pelajaran pendidikan kewarganegaraan di SDN Kebon Waris Kecamatan Pandaan Kabupaten Pasuruan / Sukri
432Penggunaan buku kontak halus sebagai suplemen untuk meningkatkan kemampuan menulis permulaan pada pembelajaran bahasa Indonesia kelas II SDN Gadingkulon 03 Dau Malang / Riza Tri Astutik
433Implementasi model peta konsep untuk meningkatkan pembelajaran IPA siswa kelas IV mata pelajaran IPA di SDN Kandung Winongan Pasuruan / Novi Ariyanti
434Penerapan pembelajaran kooperatif tipe STAD untuk meningkatkan hasil belajar IPS siswa kelas V MI Al Hikmah Beji Pasuruan / Nanik Badriyah
435Pemanfaatan APS untuk meningkatkan aktivitas belajar siswa dan pemahaman konsep nilai tempat pada penjumlahan bersusun kelas II MI Miftahul Huda I Kenep Beji Pasuruan / Nursaidah
436Penerapan pendekatan contextual teaching and learning (CTL) untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Plandirejo 02 Kecamatan Bakung Kabupaten Blitar / Yeni Pusnawati
437Penerapan permainan kartu angka untuk meningkatkan keaktifan, rasa senang dan hasil belajar perkalian siswa kels IV SDN Kebonagung 05 / Ila Hidayati
438Penerapan model Student Teams Achievement Division (STAD) untuk meningkatkan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Purworejo 03 Kabupaten Madiun / Fakhriyatu Zahro
439Hubungan motivasi belajar dan perhatian orang tua dengan hasil belajar matematika siswa kelas III SD Negeri Kedungbanteng 3 Kabupaten Blitar / Supriadi
440Pembelajaran menurut standar National Council of Teachers of Mathematics (NCTM) yang dapat meningkatkan pemahaman siswa pada materi luas daerah persegi panjang kelas 3 SDN Dinoyo 1 Malang / Ika Ratih Sulistiani
441Penggunaan metode inkuiri untuk meningkatkan prestasi belajar IPA siswa kelas V semester II pada pokok bahasan magnet SDN Clumprit I Kecamatan Pagelaran Kabupaten Malang / Yustika Dwi Ismawati
442Pelaksanaan evaluasi model Tyler untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pada mata pelajaran IPS di SDN Mergosono 5 Kota Malang / Finti Agustina
443Penerapan pembelajaran kooperatif model STAD untuk meningkatkan hasil belajar IPS siswa kelas V MI Miftahul Huda IV Tanggul Kecamatan Beji kabupaten Pasuruan / Umi Sholicha
444Penerapan pendektan pakem dalam pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas V SDN Ngiliran Magetan / Dhora Tri Agustina
445Penerapan pembelajaran kooperatif untuk meningkatkan aktivitas siswa dan pengusahaan materi mata pelajaran IPS kelas III SDN Kotalama I Malang / Ardhiyah Dwi Kurnia
446Penerapan pendapatan pembelajaran kooperatif model jigsaw untuk meningkatkan prestasi belajar IPS pada siswa kelas VI SDN sukorame 02 kecamatan binangun kabupaten Blitar Tahun pelajaran 2009/2010 / Rohmatul Dwi Asiyah
447Meningkatkan kemampuan menemukan ide pokok paragraf melalui cooperative learning tipe stad siswa kelas V SDN Bangilan Pasuruan / Sulistyowati
448Penerapan metode eksperimen untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPA dan siswa kelas V SDN Wonorejo IV kecamatan Singosari kabupaten Malang tahun pelajaran 2009/2010 / Umi Wahyuni
449Menggunakan medi jari tangan untuk meningkatkan kemapuan perkalian bilangan mata pelajaan matematika siswa kelas III di SDN Sawojajar 3 Malang / Sugeng. A
450Penggunaan pendekatan lingkungan alam untuk meningkatkan penguasaan konsep sifat-sifat benda pada siswa kelas IV SDN. Urek-urek 02 kecamatan Gondanglegi kabupaten Malang / Eri Yuniati
451Penerapan model contextual teaching and learning untuk meningkatkan hasil belajar dan kedisiplinan siswa pembelajaran PKn di kelas IV Sekolah Dasar Negeri Turi I Kecamatanm Sukorejo Kota Blitar / Surati
452Meningkatkan hasil belajar PKn melalui model pembelajaran talking stick di kelas V SDN Dawuhan I Kecamatan Jatikalen Kabupaten Nganjuk / Arina Tri Mariyanti
453Meningkatkan kreativitas menulis cerita dengan bantuan media gambar pada siswa kelas V Sekolah Dasar Negeri Karangtengah I / Bakti Nugraharini
454Model pembelajaran jigsaw untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V di SDI Al-Yasini Ngabar Kraton Pasuruan / Saidah
455Penerapan model learning cycle (LC) 5 face untuk meningkatkan pembelajaran IPA siswa kelas V-B SDN Bareng 01 Kecamatan Klojen kota Malang / Setiyani Eka Ningsih
456Pendidikan matematika realistik Indonesia untuk meningkatkan kemampuan menghitung luas bangun datar di kelas III SDN Pakukerto 1 / Sutiyani
457Penerapan model pembelajaran non direktif untuk meningkatkan hasil belajar PKn kelas III MI Yaspuri Kecamatan Lowokwaru Kota Malang / Samsul Anam
458Penerapan model quantum teaching untuk meningkatkan aktivitas dan hasil belajar IPS pada siswa kelas IV SDN Ketawanggede I Kota Malang / Murti Yuni Wulandari
459Penerapan model paikem untuk meningkatkan pembelajaran IPA siswa kelas V SDN Sokosari 02 Tuban / Widya Wahyuni
460Penerapan metode inkuiri dalam pembelajaran IPS untuk meningkatkan hasil belajar siswa kels V SDN Pecalukan 1 Kecamatan Prigen Kabupaten Pasuruan / Nur Ainiyah
461Meningkatkan hasil belajar konsep perkalian melalui penerapan pendekatan discovery terbimbing di kelas II SDN Bendosewu 01 Blitar / Titim Prihana Rahayu
462Penerapan pendekatan sains teknologi masyarakat (STM) untuk meningkatkan hasil belajar IPA kelas IV di SDN Parasrejo II Pohjentrek Pasuruan / Dwi Andriani Diah Ayu Permatasari
463Penerapan model pembeljaran advance organizer untuk meningkatkan hasil belajar siswa kelas IV pada mata pelajaran IPS di SDN Karangbesuki 01 Kecamatan sukun kota Malang / Novalina Eka Hapsari
464Meningkatkan keterampilan menulis narasi non fiksi melalui model pembelajaran quantum learning siswa kelas IV SDN Sukorejo 3 kota Blitar / Ihda Hasniah Yulisa
465Penerapan metode kooperatif model team games tournament (TGT) sebagai alternatif meningkatkan prestasi belajar ilmu pengetahuan sosial pada siswa kelas I semester I SDN Bunulrejo I Kec.Blimbing kota Malang tahun pelajaran 2009-2010 / Yuliati
466Penerapan model peta konsep untuk meningkatkan pembelajaran IPA kelas IV SDN Mojosari Kabupaten Malang / Dimas Kusuma Dyan Pamungkas
467Penerapan model group investigation untuk meningkatkan pemebelajaran IPA siswa kelas V SDN Kidul Dalem 2 Malang / Dedik Setiyo Winoto
468Penerapan pendekatan science environment technology society (SETS) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Selorejo Tulungagung / Ika Diana Tristanti
469Penerapan model pembelajaran student facilitator and explaining (SFAE) untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Merjosari 1 Malang pada mata pelajaran pendidikan kewarganegaraan / Putri Mahanani
470Penerapan model guided note taking untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IVB SDN Tanjungrejo 5 Malang / Lita Kristiani
471Penerapan pendekatan kooperatif model investigasi kelompok untuk meningkatkan hasil belajar IPA di SDN Plintahan I Pandaan Pasuruan / Tsalis Fatmawati
472Peningkatan kemampuan membaca permulaan melalui pemanfaatan media "alphabet pillow" pada kelompok B TK Al-Hidayah 01 Tawangrejo Kabupaten Blitar / Erlina Novitasari
473Pemanfaatan lingkungan sebagai sumber belajar untuk meningkatkan hasil belajar PHn siswa kelas IV SDN. Klampisrejo Kecamatan Kraton - Pasuruan tentang globalisasi / Supaidah
474Penerapan model talking stick untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn kelas V SDN Tanjungrejo 2 Malang / Dwi Enggar Septiyani
475Penerapan model pembelajaran deep dialog untuk meningkatkan hasil belajar PKn siswa kelas V SDN Plinggisan I Kraton Pasuruan / Arafa Kelibay
476Penerapan model pembelajaran guided note taking pada mata pelajaran IPS untuk meningkatkan kualitas proses dan hasil belajar siswa kelas IV SDN Randuagung 01 Kecamatan Singosari Kabupaten Malang / Windarti
477Peningkatan kemampuan mengenal bilangan 1-10 dengan menggunakan media sudut kupu-kupu pada anak kelompok A di TK Muslimat NU 34 Malang / Muvida Noor Mutmainah
478Penggunaan permainan tradisional pasaran untuk meningkatkan penguasaan konsep jual beli siswa kelas III SDN Bareng 1 Malang / Dwi Handayani
479Penerapan model pembelajaran demokratis berperspektif gender untuk meningkatkan hasil belajar PKn pada siswa kelas IV SDN Kesamben 06 Blitar / Dandik Dwi Yulistyawan
480Penerapan pembelajaran kooperatif tipe group investigation untuk meningkatkan hasil belajar IPS di SDN Pagentan 01 Kecamatan Singosari Kabupaten Malang / Dwi Cahyo Rini
481Penerapan model pembelajaran two stay two stray untuk meningkatkan pembelajaran IPA siswa kelas V SDN Tanjungrejo 2 Malang / Ning Wijaya
482Penerapan metode eksperimen dengan memanfaatkan barang bekas pada pembelajaran IPA untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Karang Pakis II Kabuh Jombang / Neni Widaryanti
483Meningkatkan hasil belajar melalui metode problem solving dalam pembelajaran IPS di kelas IV SDN Kotes 01 Kecamatan Gandusari Kabupaten Blitar / Erwin Putera Permana
484Pengembangan media kubus huruf pada pembelajaran bahasa Indonesia aspek membaca permulaan untuk siswa kelas 1 SDN I Jingglong Ponorogo / Agnes Metyaventin
485Peningkatan hasil belajar IPS mengenal jenis-jenis pekerjaan melalui model pembelajaran Team Games Tournament (TGT) pada siswa kelas III di SDN Bendo 2 Kota Blitar / Lutvy Indri Setyoningrum
486Analisis kesesuaian buku guru kelas III semester 2 ditinjau dari standar isi kurikulum 2013 / Eka Nurviana Fatmawati
487Implementasi model pembelajaran direct instruction (DI) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Lesanpuro III Kecamatan Kedungkandang Kota Malang / Sofiana Leisubun
488Analisis kesesuiaian buku guru dengan buku siswa kelas VI SD tema Menuju Masyarakat Sehat kurikulum 2013 / Khusnul Khotimah
489Penerapan model Read, Encode, Annotate, Ponder (REAP) untuk meningkatkan keterampilan membaca kritis siswa kelas VI SDN Gamping 01 Kabupaten Tulungagung / Weny Ika Fitriastuti
490Pemanfaatan buku cerita bergambar untuk meningkatkan minat dan kemampuan membaca permulaan siswa kelas 1 sekolah dasar / Mayske Rinny Liando
491Pengembangan bahan pembelajaran PPT interaktif subtema Komponen Ekosistem untuk kelas V SD / Mega Setya Permatasari
492Pengaruh model CIRC terhadap hasil belajar siswa kelas IV pada kegiatan membaca intensif di SDN Nglegok 2 Kabupaten Blitar / Astri Muasisul Khoiroh
493Penerapan strategy based student request dalam meningkatkan hasil belajar IPA siswa kelas IV SDN Rowogempol III Lekok-Pasuruan / Kasiyati
494Pembelajaran dengan open ended untuk meningkatkan pemahaman keliling dan luas persegi panjang pada siswa kelas III SDN 1 Bukit Tunggal Kota Palangka Raya / Halimah Jumiati
495Penerapan model pembelajaran SAVI untuk meningkatkan kemampuan berbicara pada siswa kelas VB SDN Lesanpuro 3 Kedungkandang Malang / Mistin
496Peningkatan motorik halus dengan teknik kolase kertas pada anak kelompok A di TK Al-Hidayah Kaweron 02 Kabupaten Blitar / Dyah Arma Wilujeng
497Penerapan metode karya wisata untuk meningkatkan kemampuan menggambar bebas dalam pengembangan seni anak kelompok B TK Negeri Pembina Bumiaji kota Batu / Yusanti Puji Setyo Ayuningtyas
498Hubungan antara tingkat pendidikan orang tua dengan hasil belajar peserta didik sekolah dasar di Kabupaten Probolinggo / Dedis Imaniar Kusumaningrum
499Peningkatan kemampuan motorik halus melalui permainan Percik warna pada Kelompok B di Tk Al Hidayah Wonorejo 01 Kabupaten Blitar / Happy Eka Fajriyah
500Peningkatan kemampuan kognitif anak kelompok B melalui cubes game di TK Al-Hidayah 1 Kerjen Kabupaten Blitar / Dwi Atikha Widyanti
501Penerapan model pembelajaran kooperatif tipe TAI (Time Assisted Individualization) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas III A SDN Tamanharjo 01 Singosari Malang / Wahyuningtiyas Triadi Pamungkas
502Pengembangan metode membaca untuk anak Kelompok A di TK Kemala Bhayangkari 44 Kota Blitar / Yudatul Ismawati
503Penerapan model pembelajaran inkuiri untuk meningkatkan prestasi belajar siswa kelas IV mata pelajaran IPA di MI Senden tahun ajaran 2007/2008 / Naning Dwi Cahyarini
504Analisis komponen-komponen dalam karangan narasi siswa kelas IV SDN Ciptomulyo 3 Kec. Sukun Kota Malang / Savira Nurimansari
505Penerapan pembelajaran membaca cepat melalui metode SQ3R untuk meningkatkan prestasi belajar siswa dalam bidang studi bahasa Indonesia di kelas IV SDN Jatitengah 02 Kecamatan Selopuro Kabupaten Blita / Burhannudin Aulia Prista
506Penerapan pembelajaran kooperatif model "Numbered Head Together" untuk meningkatkan hasil belajar IPS pada tema pengalaman siswa kelas 1 semester 1 SDN percobaan 1 Malang tahun ajaran 2008/2009 / Dewi Urifah
507Keterlaksanaan scientific approach pada KTSP dalam pembelajaran kelas IV SDN Gelam II Kecamatan Candi Kabupaten Sidoarjo / Sofiatuz Zuhro
508Pengembangan bahan pembelajaran subtema Keuniukan daerah Tempat Tinggalku melalui media CD interaktif untuk kelas IV di SDN Pandanwangi 4 / Kiki Novitasari
509Penerapan model pembelajaran rotating trio exchange (RTE) untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V-A SDN Tanjungrejo 2 Malang / Reni Ika Puspita Sari
510Meningkatkan hasil belajar IPS melalui pembelajaran kooperatif model TGT di kelas V SDN Gununggangsir III Kecamatan Beji Kabupaten Pasuruan / Pikson Lesnussa
511Penerapan model pembelajaran pakem dalam meningkatkan hasil belajar IPS siswa kelas IV SDN Tembalang Kecamatan Wlingi Kabupaten Blitar / Rifka Zuyun Umadah
512Penerapan model siklus belajar (Learning Cycle) dengan metode eksperimen pada pokok bahasan benda dan sifatnya untuk meningkatkan kerja ilmiah dan hasil belajar kognitif siswa kelas IV-B semester I SDN Bareng I Kota Malang / Suci Wijayanti
513Profil penerapan pendidikan karakter berdasarkan kurikulum 2013 di SDN Purwodadi 1 Kecamatan Blimbing Kota Malang / Luwis Maulina
514Pelaksanaan pembelajaran kurikulum 2013 oleh guru kelas IV sekolah dasar inklusi gugus 04 Kecamatan Lowokwaru Kota Malang / Happy Omega Nanda
515Pemanfaatan media timeline video pembelajaran untuk meningkatkan proses dan hasil belajar IPS siswa kelas IV SDN Gunung Jati 01 Kec. Jabung Kab. Malang / Angga Silvani
516Penerapan model Dick and Carey untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS di kelas V SDN Masangan Kecamatan Bangil Kabupaten Pasuruan / Sapira Gurgurem
517Penerapan model pembelajaran addie untuk meningkatkan hasil belajar IPS siswa kelas IV di SDN Madyopuro 3 Kota Malang / Edita Laian
518Persepsi guru kelas IV terhadap pembelajaran tematik kurikulum 2013 di SDN se-Kecamatan Sukun Kota Malang / Nadia Rofika
519Penerapan model pembelajaran debat untuk meningkatkan aktivitas dan hasil belajar siswa pada matapelajaran PKn siswa kelas V SDN Lesanpuro 1 Kedungkandang Kota Malang / Nurhayati Rumakey
520Penerapan model assure untuk meningkatkan pembelajaran IPA kelas V SDN Madyopuro 4 Kota Malang / Maria Singerin
521Pengembangan media boneka wayang dalam pembelajaran bahasa pada anak kelompok B di Taman Kanak-Kanak / Yuli Rahayu Indriani
522Peningkatan kemampuan berbahasa anak melalui media kartu gambar dan kata pada kelompok B TK Dharma Wanita Bendo 02 Kecamatan Ponggok Kabupaten Blitar / Galih Indahwulandari
523Penerapan model think talk write IPS untuk meningkatkan hasil belajar siswa kelas IV SDN Madyopuro 2 Kecamatan Kedungkandang Kota Malang / Siti Kumala Sari Djilfufin
524Penerapan cognitive style mapping untuk meningkatkan aktivitas dan hasil belajar IPS kelas V SDN Purwodadi 1 Malang / Silfi Mauluti Aski
525Penerapan model group investigation untuk meningkatkan hasil belajar siswa kelas III pada mata pelajaran IPS SDN Lesanpuro 3 Kecamatan Kedungkandang Kota Malang / Juliana Fasse
526Penggunaan media gambar dan kartu kata untuk meningkatkan kemampuan menulis kalimat pada siswa kelas 1 SDN Pagentan 01 Singosari Kabupaten Malang / Eka Agustina
527Pengembangan pemahaman konsep bilangan melalui permainan pemasangan kartu angka dan kartu gambar pada kelompok B di TK Satu Atap Rampal Celaket 02 Malang / Intando Reasy Supriyani
528Penerapan pakem untuk meningkatkan aktivitas dan hasil belajar pengubinan kelas V SDN Bedalisodo 04 Wagir Malang / Evi Trissyawati
529Penerapan model interaktif untuk meningkatkan pembelajaran IPA pada siswa kelas IV SDN Madyopuro 4 kota Malang / Yusmiati Maigoda
530Penerapan problem solving model polya untuk meningkatkan kemampuan memecahkan masalah matematika tentang pecahan siswa kelas IV SDN Jugo 05 Kabupaten Blitar / Amalya Intan Pusfica Dewi
531Upaya meningkatkan hasil belajar IPA melalui model inkuiri di kelas IV SDN Puspo IV Kabupaten Pasuruan / Dewi Pintoko Arida
532Penerapan model think talk write (TTW) untuk meningkatkan ketrampilan menulis pengumuman pada siswa kelas IV SDN Madyopuro 4 di Malang / Oktovina Pupupin
533Penerapan pendekatan discovery dalam pembelajaran untuk meningkatkan hasil belajar IPA di kelas V SDN Banjarsari Kecamatan Pandaan Kabupaten Pasuruan / Sutomo
534Penggunaan media flip chart untuk meningkatkan kemampuan membaca anak kelompok B TK Kartika IX-41A Malang / Renitaningtyas Marisa Kurniasari
535Penerapan strategi direct reading thinking activities untuk meningkatkan aktivitas dan hasil belajar PKn bagi siswa kelas III SDN Sumbersari II Malang / Nimas Embun Pratiwi
536Penerapan permainan kartu domino pecahan untuk meningkatkan aktivitas dan hasil belajar perkalian pecahan siswa kelas V SDN Oro-Oro Dowo Malang / Herlina Niraningtiyas
537Pemanfaat media tiruan kerangka untuk meningkatkan pembelajaran IPA di kelas IV SDN Ketawanggede 1 Kecamatan Lowokwaru Kota malang / Supriyatin
538Penerapan pembelajaran kooperatif model stad dengan teknik perkalian nappier untuk meningkatkan hasil belajar matematika tentang perkalian pada siswa kelas II SDN Kebonsari 4 kota Malang / Luluk Anida
539Upaya guru dalam memotivasi belajar matematika siswa kelas V Sekolah Dasar Se-Kepenilikan Kecamatan Klojen Kota Malang / oleh Rusiati
540Penerapan model STAD untuk meningkatkan kerjasama dan hasil belajar pecahan pada siswa kelas V SDN Sumberagung I Ngantang - Malang / Dyah Rahayu Wismaningtyas
541Pemanfaatan media wayang kartun binatang untuk meningkatkan kemampuan menyimak siswa memahami isi dongeng pada siswa kelas 2 di SDN Grobogan 02 Kabupaten Jombang / Iin Zahrotu Zuhro
542Penggunaan metode mind mapping dalam meningkatkan kemampuan menulis puisi siswa kelas V SDN Tumpang 2 Kabupaten Blitar / Diavia Bristyn
543Penerapan teknik skimming scanning untuk meningkatkan pembelajaran membaca pemahaman siswa kelas V SD Negeri Salero 1 Ternate / Samsu Somadayo
544Peningkatan pemahaman aktivitas ekonomi melalui model make a match di kelas IV semester 2 SDN Selopuro 04 Kabupaten Blitar / Marya Anggrasari
545Penerapan teknik pembelajaran icebreaker untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V-A SDN Kedungkandang 2 Kota Malang / Nurun Okvinandari
546Penggunaan media lingkaran pecahan untuk meningkatkan pemahaman dan aplikasi materi perbandingan pecahan siswa kelas III di SDN Loceret 1 Kabupaten Nganjuk / Yuwana Dhian Marta
547Pengembangan media powerpoint interaktif tema Ekosistem kelas 5 SDI Baitul Makmur Kelurahan Sawojajar kecamatan Kedungkandang Kota Malang / Yulias Fitri Nur Rachmana
548Penggunaan media batang pecahan untuk meningkatkan hasil belajar matematika kelas IV di SDN Kidul Dalem 2 Kota Malang / Wheny Churnia Ningsih A.
549Pengembangan gerak dan lagu untuk pembelajaran bahasa anak kelompok B di TK Satu Atap SDN Tanjungrejo 5 Malang / Diana Rachmawati
550Upaya guru untuk memicu inisiatif bertanya melalui media tebak tirai ajaib pada anak kelompok B Di RA Muslimat NU 24 Malang / Norma Gupita
551Peningkatan keterampilan menjelaskan gambar sederhana melalui model pembelajaran picture and picture pada siswa kelas I SDN 2 Pelem Kabupaten Tulungagung / Rizky Hesti Fahriany
552Meningkatkan keterampilan menulis karangan narasi melalui model Think Talk Write (TTW) pada siswa kelas IV di SDN Gurah 1 Kabupaten Kediri / Fina Aulia Untsa Mufida
553Penerapan model pembelajaran Teams Games Tournaments untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Suwaru Kabupaten Malang / Mega Lovrina
554Penerapan model pembelajaran Problem Based Introduction (PBI) untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Bareng 3 Kota Malang / Ferid Aquarista
555Penggunaan media manik-manik untuk meningkatkan hasil belajar operasi penjumlahan bilangan bulat pada siswa kelas IV SDN Sidorahayu 04 Wagir Malang / Suryanto
556Penggunaan media pembelajaran CD interaktif untuk meningkatkan kemampuan kognitif anak kelompok B TK Taman Indria I Kota Malang / Monika Fenny Meylinda
557Penerapan model numbered heads together (NHT) untuk meningkatkan keterampilan menulis deskripsi siswa kelas IIA SDN Kasin Malang / Ika Wahyu Septiana
558Peningkatan hasil belajar soal cerita matematika melalui model conceptual understanding procedures di kelas V SDN Karangtengah 4 Kota Blitar / Ahkimatu Agin Dabri
559Implementasi pembelajaran modeling untuk mengurangi aktivitas bullying di kelas IV SDN Tangkilsari 01 Kecamatan Tajinan Kabupaten Malang / Indirga Arrum Puspita Sari
560Penerapan model snowball throwing untuk meningkatkan hasil belajar PKn siswa kelas IVB SDN Tlogomas 02 Kecamatan Lowokwaru Kota Malang / Wahyu Sri Indarti
561Pengembangan media circleboard dalam pembelajaran kognitif anak kelompok B di Malang / Vicky Alvionica
562Penerapan pembelajaran model guided writing proces untuk meningkatkan keterampilan menulis karangan narasi siswa kelas III di SDN Tulusrejo 2 Malang / Rozsaniar Prasti Eny
563Upaya meningkatkan keterampilan berbicara melalui kegiatan bercerita pada siswa kelas V SDN Sibon II Kecamatan Pasrepan Kabupaten Pasuruan / Mujindra Novi Pratiwi
564Penerapan model inquiry untuk meningkatkan hasil belajar IPS di kelas IV SDN Lecari Kecamatan Sukorejo Kabupaten Pasuruan / Maksum Soleh
565Penerapan pembelajaran kooperatif tipe think pair share (TPS) untuk meningkatkan hasil belajar IPS kelas V di SDN Turi 01 kota Blitar / Kusrini Hidayah
566Penggunaan media flash card untuk memfasilitasi anak mengenal konsep dan lambang bilangan di TK Permata Bunda Malang / Mia Alfiana Prahartini
567Pemanfaatan media audio visual untuk meningkatkan pembelajaran IPA pada siswa kelas V SDN Kemiriswu 2 Pasuruan / Junaedi Nugroho
568Penerapan model Quantum Teaching untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas II SDN Purwodadi 2 Kota Malang / Irma Candra Kasih
569Penerapan teknik dictogloss dalam meningkatkan menyimak pada siswa kelas V SDN Blabak 1 Kota Kediri / Andi Rubiyantoro
570Penerapan model siklus belajar (Learning Cycle) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN sawojajar 4 Malang / Eries Norma Yusmita
571Pemanfaatan media gambar ilustrasi untuk meningkatkan kemampuan menulis puisi pada siswa kelas III MI. Miftahul Huda 1 Manaruwi Kecamatan Bangil Kabupaten Pasuruan / Siti Fauziatul Mufidah
572Penerapan pembelajaran kooperatif model Student Teams Achievement Division (STAD) untuk meningkatkan aktivitas dan prestasi belajar IPA siswa kelas IV di SDN I Widoro Kec. Gandusari Kab. Trenggalek / Devi Indriati
573Pemanfaatan media alami untuk meningkatkan hasil belajar IPS kelas IV SDN Kebonagung 02 Kabupaten Malang / Ika Yulinar Sugihardini
574Meningkatkan hasil belajar operasi hitung campuran melalui metode pemecahan masalah Polya pada siswa kelas III MIN Bulusari Gempol Pasuruan / Muhammad Nabil
575Penerapan model student team achievement division (STAD) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Jimbaran III Kecamatan Puspo Kabupaten Pasuruan / Dedy Dwi Wahyudi
576Penggunaan media dekak-dekak untuk meningkatkan hasil belajar penjumlahan dan pengurangan bilangan tiga angka siswa kelas III SDN Sumberbening 01 Trenggalek / Jiwa Ihsanty
577Analisis kesalahan berbahasa Indonesia dalam tataran sintaksis pada karangan eksposisi siswa kelas V-B SDN Gondang 1 Kecamatan Gondang Kabupaten Tulungagung / Arthaningtyas Tri Wilujeng
578Penerapan "media komik" untuk meningkatkan pemahaman konsep keliling dan luas persegi panjang pada siswa kelas III SDN Girimoyo 03 Karangploso Kabupaten Malang / Suci Amalia
579Penggunaan media pembelajaran peta timbul untuk meningkatkan hasil belajar IPA pokok bahasan perubahan kenampakan bumi siswa kelas IV SDN Pandanwangi 5 Malang / Dwi Vindianasari
580Peningkatan keterampilan motorik halus melalui kegiatan menganyam kertas pada anak kelompok A1 di TK Negeri Pembina Kota Blitar / Avi Primawati
581Penerapan permainan teka-teki angka untuk meningkatkan prestasi belajar matematika operasi pembagian bilangan cacah siswa kelas III SDN Kedawang I Kecamatan Nguling Kabupaten Pasuruan / Eny Mujayanah
582Analisis kemampuan siswa kelas V dalam memahami pesan moral pada cerpen di SDN Undaan 01 Kecamatan Turen Kabupaten Malang / Rosida Dwi Wulandari
583Penerapan pembelajaran model problem based instruction (PBI) untuk meningkatkan proses dan hasil belajar IPS siswa kelas IV SDN Madyopuro 5 Kecamatan Kedungkandang Kota Malang / Fedelfina Djabumir
584Peningkatan kemampuan menulis deskripsi melalui metode karyawisata pada siswa kelas IV SDN 5 Kalibatur Kabupaten Tulungagung / Ratna Fitri Wulandari
585Penerapan pendekatan konstruktivisme dengan model pembelajaran peta konsep untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Bantur 06 Kec. Bantur Kab. Malang / Ika Faridaningrum
586Penerapan strategi pembelajaran index card match untuk meningkatkan aktivitas dan hasil belajar IPS pada siswa kelas V SDN Pesanggrahan 02 kota Batu / Ervan Yopi Putranto
587Penerapan model QWH-Chart untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Merjosari I Malang / Feni Handayani
588Penerapan model pembelajaran arias untuk meningkatkan aktivitas dan hasil belajar IPS siswa IIIA SDN Purwantoro 2 kota Malang / Rifqi Dian Agustin
589Penerapan pendekatan kooperatif problem posing untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V Sdit Insan Permata Malang / Diana Fitriani
590Penerapan model pembelajaran contextual teaching and learning untuk meningkatkan pembelajaran IPA kelas III SDN Punten I kota Batu / Arline Oktavia Jaya Sari
591Penerapan metode pembelajaran kooperatif untuk meningkatkan kemampuan kognitif anak melalui permainan menyusun huruf dan angka di TK Tunas Mulia malang / Yolarisa Ratriawan
592Penerapan model pembelajaran inkuiri terbimbing untuk meningkatkan keterampilan proses sains dan hasil belajar siswa kelas XI IPA SMA Laboratorium UM Malang / Sahla Rahma Annisa Agrisa
593Pemanfaatan kubus satuan untuk meningkatkan hasil belajar pengukuran volume balok siswa kelas V SDN Kedawung Wetan IV Kecamatan Grati Kabupaten Pasuruan / Dwi Sri Astutik
594Penerapan model pembelajaran make a match untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Kromengan 02 Kabupaten Malang / Noviana Maulidina
595Pemanfaatan media neraca bilangan untuk meningkatkan hasil belajar operasi perkalian bilangan siswa kelas II SD Negeri Tundosoro Kecamatan Kejayan Kabupaten Pasuruan / Andika Martaning
596Penerapan pembelajaran tematik tema lingkungan untuk meningkatkan hasil belajar pada siswa kelas II di SDN TLOGOWARU 2 kota Malang / Anis Iffah rosyita
597Penerapan teori bruner untuk meningkatkan hasil belajar keliling bangun datar pada siswa kelas III SDN Kauman 3 Malang / Cholilatuz Zahroh
598Penerapan model pembelajaran giving question and getting answer untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV SDN Kidul Dalem 2 Kecamatan Klojen kota Malang / Rizki Yusuf Hidayat
599Meningkatkan hasil belajar matematika materi luas bangun daftar melalui model pembelajaran think pair share pada siswa kelas III SDN Senden II Kabupaten Kediri / Titis Andestya Furinda
600Penerapan pembelajaran kooperatif tipe STAD untuk meningkatkan penguasaan konsep sifat-sifat bangun ruang siswa kelas V SDN Patuguran I Kecamatan Rejoso Pasuruan / Sustiyah
601Problematika minat baca siswa kelas V di Perpustakaan Sekolah Dasar se-Kecamatan Durenan Kabupaten Trenggalek / Faizul Ismiyah
602Penerapan model pembelajaran inkuiri untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn kelas V MI. Roudlotul Falah Rembang Pasuruan / Siti Khasbiah
603Pemanfaatan media pembelajaran benda kongkrit untuk meningkatkan hasil belajar IPA tentang pesawat sederhana di kelas V SDN Benerwojo Kecamatan Kejayan Kabupaten Pasuruan / Susmiati
604Penerapan snowball throwing untuk meningkatkan pembelajaran IPA kelas IV SDNU Kecamatan Bangil Kabupaten Pasuruan / Nafisah
605Penggunaan media audio visual pada model pembelajaran student facilitator and explaining (SFAE) untuk meningkatkan hasil belajar IPS siswa kelas V SDN Bareng 4 Kecamatan Klojen Kota Malang / Fiky Zuliana
606Penerapan model pembelajaran learning cycle untuk meningkatkan aktivitas dan hasil belajar IPA kelas V di SDN Kasin Malang / Unsa Amiroh
607Penerapan model pembelajaran Addie untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV A SDN Pendem 02 Kecamatan Junrejo Kota Batu / Avis Nurtyaningsari
608Penerapan model pembelajaran inside outside circle (IOC) untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV SDN Purwantoro 2 Malang / Dyah Rismawanti
609Penerapan model pembelajaran kooperatif tipe stad untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SD Negeri Bandulan 05 Malang / Andri Hermawan
610Implementasi pembelajaran matematika realistik untuk meningkatkan penguasaan konsep perkalian dan keaktifan siswa kelas II SDN Pateguhan Pasuruan / Nisa'ul Khurin Khasanah
611Penerapan model pembelajaran Talking Stick untuk meningkatkan kemampuan membaca pemahaman siswa kelas V SDN Jetis 1 Kabupaten Nganjuk / Zenny Dwi Lutfita
612Hubungan supervisi kepala sekolah dengan kinerja guru SD di Gugus 3 Kecamatan Kedungkandang Malang / Dian Catur Wibowo
613Penerapan model pembelajaran problem solving untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Tempuran 1 Ngawi / Pratika Tungga Dewi
614Penggunaan teknik permainan bahasa category bingo untuk meningkatkan kemampuan menulis puisi siswa kelas V di SDN Tumpakrejo 03 Kecamatan Gedangan Kabupaten Malang / Harvey Agil Aprianto
615Penggunaan model kooperatif terpadu membaca dan menulis untuk meningkatkan keterampilan menulis deskripsi pada siswa kelas IV SD Srigading I / Rizky Budi Utami
616Penerapan model pembeljaran MAKE A MATCH untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Ardimulyo 03 Singosari Malang / Eurika Adinda
617Penerapan model numbered heads together (NHT) untuk meningkatkan aktifitas kerja kelompok siswa kelas IV pada pembelajaran IPS SDN Manaruwi II Kecamatan Bangil / Ari Fachrudiana
618Penerapan media benda konkrit untuk meningkatkan kemampuan menulis kalimat sederhana siswa kelas II SDN Mendalanwangi 01 Kecamatan Wagir Kabupaten Malang / Sri Wahyuni
619Penggunaan media solar sistem dan CD interaktif untuk meningkatkan hasil belajar mengidentifikasi sistem tata surya siswa kelas VI SDN Sumberoto 05 Kecamatan Donomulyo Kabupaten Malang / Felina Devi Cacilia
620Meningkatkan aktivitas dan hasil belajar PKn melalui pembelajaran berbasis masalah pada siswa kelas V SDN Ardimulyo 03 Singosari Malang / Dian Meirafita
621Pengembangan model pembelajaran dengan media gambar untuk meningkatkan kemampuan menyusun kalimat Bahasa Indonesia / oleh Restianingsih
622Penerapan model pembelajaran VCT untuk meningkatkan proses dan hasil belajar siswa kelas IIIB pada mata pelajaran IPS di SDN Purwantoro 2 Kota Malang / Ratna Julianti
623Penerapan pendekatan Somatic, Auditory, Visually, Intelectually (SAVI) untuk meningkatkan hasil belajar operasi hitung campuran pada siswa kelas II SDN Sumbersari 2 Malang / Dian Puspitasari
624Peningkatan keterampilan menulis deskripsi melalui penggunaan lingkungan alam sekitar pada siswa kelas IV SDN Sumbersari 01 Kabupaten Blitar / Vina Anesha
625Penerapan pembelajaran kontekstual dengan menggunakan model numbered heads together (NHT) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Ketawanggede 2 Malang / Wibi Gilang Saputro
626Peningkatan pembelajaran matematika materi sudut dengan menggunakan media jam untuk siswa kelas IV SDN Jombok 1 Kesamben Jombang / Zakaria Agung Setyawan
627Penerapan model advance organizer untuk meningkatkan keterampilan berbicara siswa kelas V SDN Lesanpuro I Kecamatan Kedungkandang Kota Malang / Windasari Waly
628Peningkatan kemampuan membaca permulaan melalui media audio visual pada anak kelompok B TK Dharma Wanita Bulus Kabupaten Tulungagung / Rezkyka Damayanti
629Penerapan model pembelajaran SAVI untuk meningkatkan hasil belajar siswa kelas IVA pada mata pelajaran PKn SDN Madyopuro 4 Kecamatan Kedungkandang Kota Malang / Lencie Kilikily
630Penggunaan model pembelajaran course review horay dalam meningkatkan hasil belajar bilangan pecahan pada siswa kelas IV SDN 1 Besole Kabupaten Tulungagung / Hendra Sanjaya
631Penerapan metode inkuiri sosial untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn di kelas IV SD Negeri Sukoharjo 2 Kota Malang / Nasrum Lagulagu
632Pengembangan instrumen asesmen proyek pada tema Tempat Tinggalku kelas IV sekolah dasar / Enya Dibna Dirigwa
633Peningkatan kemampuan berhitung permulaan melalui permainan ikan di akuarium pada anak kelompok A TK Satu Atap Rampal Celaket 2 Malang / Zainul Arifin
634Penerapan model pembelajaran mind mapping untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Tunggulwulung 3 Kecamatan Lowokwaru Kota Malang / Aburoiham Albiruni
635Upaya meningkatkan pembelajaran IPA melalui penerapan model pembelajaran guide inquiry di kelas IV SDN Pogar III Kecamatan Bangil Kabupaten Pasuruan / Sri Budiarti
636Meningkatkan kemampuan menulis permulaan dengan pemanfaatan media permainan flash card di kelas I SDC Klampok 1 Singosari Kabupaten Malang / Efata Kusumawati
637Penerapan metode demonstrasi menggunakan kartu bilangan bulat untuk meningkatkan hasil belajar matematika dalam menyelesaikan penjumlahan bilangan bulat pada siswa kelas IV SDN Kebotohan Pasuruan / Ruri Ayu Widowati
638Penerapan pendekatan STM untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kedungringin II Kecamatan Beji Kabupaten Pasuruan / Siti Riyadah
639Penerapan media gambar seri untuk meningkatkan kemampuan bercerita dalam pembelajaran bahasa Indonesia siswa kelas III SDN Madyopuro 5 Kecamatan Kedungkandang Kota Malang / Wehelmina Kauy
640Penerapan model pembelajaran think-talk-write (TTW) untuk meningkatkan hasil belajar siswa kelas IV pada mata pelajaran PKn di SDN Sukuharjo I kota malang / Alexander Ngilamele
641Penggunaan pendekatan pembelajaran inkuiri untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kauman 2 Kecamatan Klojen kota Malang / Pius Tokndekut
642Penerapan metode outbond untuk meningkatkan hasil belajar PKn siswa kelas III SD Dandanggendis I Kecamatan Nguling Kabupaten Pasuruan / Ari Kurniawati
643Penerapan the power of two strategy untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Sukoharjo II Kecamatan Klojen Kota Malang / Muharam Wahkofan
644Penerapan pembelajaran matematika realistik untuk meningkatkan kemampuan memahami konsep penjumlahan dan pengurangan bilangan bulat siswa kelas V SDN Kotalama 1 Malang / Galih Saputra Cahyaning Nugroho
645Penerapan strategi pembelajaran think talk write untuk meningkatkan aktivitas dan hail belajar PKn siswa kelas IV SDN Madyopuro 3 Kec. Kedungkandang Kota Malang / Siti Hajar Sangaji
646Penggunaan media peta untuk meningkatkan aktivitas dan hasil belajar siswa mata pelajaran IPS kelas IVB SDN Sawijajar 1 Malang / Umi Nina Yaroh
647Meningkatkan pemahaman siswa kelas V terhadap jaring-jaring bangun ruang dengan pembelajaran kontekstual / Edy Riyanta
648Penerapan pendekatan discovery untuk meningkatkan pembelajaran IPA di kelas IV SDN Pandanwangi 04 Kecamatan Blimbing kota Malang / Friska Ayu Nurawati
649Penerapan model permainan mencari pasangan dalam meningkatkan pemahaman konsep IPS di kelas V SDN Tumpang 04 / Dwi Cahyono
650Penerapan model pembelajaran kreatif-produktif untuk meningkatkan kemampuan membuat benda konstruksi dari bahan bekas siswa kelas IVC SDN Wringin 01 Bondowoso / Erita Febri Lestari
651Penggunaan media batang cuisenaire untuk meningkatkan hasil belajar matematika operasi penjumlahan dan pengurangan pecahan kelas IV / Vencya Sabella Nafsi
652Penerapan pakem untuk meningkatkan prestasi belajar IPA siswa kelas IV SDN Sungikulon Kecamatan Pohjentrek Kabupaten Pasuruan / Indah Widyastuti
653Penerapan pembelajaran kooperatif model Think Pair Share (TPS) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Madyopuro II Kecamatan Kedungkandang Kota Malang / Endang Goulap
654Penerapan model pembelajaran Van Hiele untuk meningkatkan hasil belajar geometri di kelas V SDN Ranggeh Pasuruan / Deden Yunus
655Penerapan model talking stik untuk meningkatkan hasil belajar IPS kelas IV di SDN Blabak 3 Kota Kediri / Winarsih
656Pengembangan modul pembelajaran tema Energi dan Perubahannya subtema Energi Alternatif kelas III SDN Kotalama 3 Kota Malang / Rizki Puji Agustin
657Meningkatkan kemampuan motorik halus melalui kegiatan menggambar bebas di TK Permata Bunda Malang / Wahyuningsih
658Penerapan model Children Learning in Science untuk meningkatkan aktivitas dan hasil belajar siswa kelas V di SDN Dawuhansengon 02 Pasuruan / Endah Kurniati
659Pengembangan media fraction puzzle pada pembelajaran matematika materi pecahan senilai untuk siswa kelas IV sekolah dasar / Hana Rosita
660Penerapan model two stay two stray untuk meningkatkan hasil pembelajaran IPA siswa kelas IV SDN Plinggisan I Kecamatan Kraton Kab. Pasuruan / Rabia Bugis
661Penerapan model pembelajaran Group Investigation (GI) untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPA kelas IV SDN Kasin Malang / Fitria Nurmala Dewi
662Penerapan pembelajaran peta konsep untuk meningkatkan hasil belajar siswa kelas IV SDN Minggir Winongan Psuruan dalam pembelajaran PKn / Junet
663Peningkatan hasil belajar IPS melalui model pembelajaran talking stick pada siswa kelas IV di SDN Sumberejo Kabupaten Kediri / Destira Anugrahini Kuswidian
664Penggunaan media CD interaktif untuk meningkatkan hasil belajar IPS kelas IV di SDN Pakisaji 02 / Dian Novita Anggraeni
665Pengembangan permainan petualangan di rumah warna dalam pembelajaran motorik kasar pada anak kelompok A / Khilyatun Nur Fadhilah
666Penerapan model learning tournament untuk meningkatkan kualitas pembelajaran IPA siswa kelas IV SDN Binangun 2 Blitar / Nayla Nurul Husna
667Pelaksanaan pembelajaran kooperatif model numbered heads together (NHT) untuk meningkatkan hasil belajar IPS siswa kelas V SDN Luwuk Kecamatan Kejayan Kabupaten Pasuruan / Dian Kurniasih Wahyusari
668Pemanfaatan media maket untuk meningkatkan kemampuan berbicara siswa dalam memahami denah di kelas IV MI Miftahul Huda Dukuhsari Sukorejo Pasuruan / Nur Cholifah
669Penerapan model Guided Discovery (GD) pada pembelajaran Keindahan Alam Negeriku di kelas IV A SDN Karangtengah 01 Kota Blitar / Rengganis Elok Dwi Cahya Wulandari
670Penerapan model pembelajaran deep dialog/critical thinking (DD/CT) untuk meningkatkan proses dan hasil belajar PKn kelas V di SDN Pakisaji 2 tahun pelajaran 2009/2010 / Dita Sari Handariyanti
671Meningkatkan pemahaman siswa tentang aturan di masyarakat melalui permainan kata berantai pada mata pelajaran PKN kelas III di SDN Tegalwaru Kecamatan Dau Kabupaten Malang / Titik Restuningsih
672Penerapan metode eksperimen untuk meningkatkan hasil dan aktivitas belajar IPA siswa kelas VI SDN Sidorejo 02 Kecamatan Jabung Kabupaten Malang / Rendi Agus Triono
673Pemanfaatan media alam sekitar untuk meningkatkan hasil belajar siswa dalam pembelajaran tematik tema lingkungan di kelas II C SDN Percobaan 2 Malang / Toni Tulus Santoso
674Penerapan metode bermain peran untuk meningkatkan keterampilan berbicara unggah-ungguh basa jawa di kelas V SDN Sumbermanjing Kulon I Pagak Malang / Fatty Purwantie
675Meningkatkan kemampuan menulis pengalaman melalui proses menulis siswa kelas V di SD Kepanjenkidul 1 Kota Blitar / Siti Mubayanah
676Meningkatkan hasil belajar matematika pengukuran sudut melalui pendekatan cooperatif learning tipe stad bagi siswa kelas V-B di SDN Pakunden 2 Kecamatan Sukorejo Kota Blitar / Eka Yunaningsih
677Meningkatkan kemampuan menulis deskripsi melalui media gambar pada siswa kelas IV SDN Turi 01 Kota Blitar / Nining Mariana F Unawekla
678Meningkatkan hasil belajar PKn dengan model pembelajaran kooperatif tipe numbered heads together pada siswa kelas V SD Negeri Kauman 1 Kota Blitar / Andreas Hendrek Ngarbingan
679Penerapan model guided inquiry untuk meningkatkan aktivitas dan prestasi belajar matematika tentang sifat-sifat bangun datar di kelas III SDN Bandulan 2 Malang / Rina Octaviani
680Penerapan pembelajaran kooperatif tipe stad untuk meningkatkan aktivitas dan hasil belajar IPS bagi siswa kelas IV SDN Majangtengah 02 Dampit kab. Malang / Ulfa Erik Kristanti
681Implementasi tri-focus technique untuk meningkatkan keterampilan membaca cepat pada siswa kelas V SDN Tlogomas I Kota Malang / Anna Harizatul Iffah
682Meningkatkan keterampilan berbicara melalui metode tim kuis dengan media gambar siswa kelas IV MI Darul Ulum Kisik Kalirejo Kraton Pasuruan / Arif Rahman Hakim
683Penerapan model pembelajaran stad dalam meningkatkan penguasaan keterampilan menulis tegak bersambung melalui kegiatan dikte pada siswa kelas I SDN Kedung Boto Kecamatan Beji Kabupaten Pasuruan / Nur Afifah
684Penerapan metode permainan "Vampir Bilangan" untuk meningkatkan hasil belajar membilang loncat siswa kelas 1 SDN Blimbing 4 Malang / Sri Wahyuni
685Penggunaan media kartu kalimat rumpang untuk meningkatkan keterampilan menceritakan kembali isi bacaan secara tertulis pada siswa kelas II SDN Warungdoyo I Pohjentrek Pasuruan / Supikati
686Penerapan model pembelajaran kontekstual dengan metode inkuiri untuk meningkatkan hasil belajar IPA siswa kelas III SDN kalipang 01 kecamatan sutojayan kabupaten Blitar / Suhariningsih Eko
687Penerapan pendekatan pembelajaran komunikatif untuk meningkatkan keterampilan berbicara pada siswa kelas II SDN Kendalrejo 04 Kecamatan Talun Kabupaten Blitar tahun 2009/2010 / Suyati
688Penerapan Pembelajaran kooperatif type stad untuk meningkatkan penguasaan konsep waktu pada mata pelajaran matematika kelas 1 SDN Mronjo 02 kecamatan selopuro kabupaten Blitar / Umi niswatin
689Penerapan model pembelajaran inquiri sebagai upaya meningkatkan prestasi belajar matematika siswa kelas IV Sekolah Dasar Negeri Pagergunung 03 Blitar tahun pelajaran 2009/2010 / Nanik Guntariati
690Penerapan model pembelajaran mind mapping sebagai upaya meningkatkan hasil belajar matematika siswa kelas VI SD Negeri Tepas 01 Kesamben Blitar tahun pembelajaran 2009/2010 / Misti Dwiana
691Penerapan model pembelajaran kooperatif teknik jigsaw untuk meningkatkan hasil belajar IPS pada siswa kelas V SDN Panggungrejo 01 kec.Panggungrejo Kab.Blitar tahun pelajaran 2009/2010./Djoko Prajitno
692Penerapan pembelajaran paken untuk meningkatkan penguasaan konsep perkalian siswa kelas II SDN Pakisrejo 2 kecamatan Sregat kabupaten Blitar / Umar
693Penerapan pembelajaran IPA dengan media gambar untuk meningkatkan prestasi siswa kelas II SDN Gunungsari kecamatan Tajinan kabupaten Malang / Luluk Miftakhul Ulumiyah
694Penerapan model role-playing untuk meningkatkan pemahaman kedisiplinan tema kehidupan sehari-hari siswa kelas 2 SDN Kauman 3 kecamatan Klojen kota Malang / Harnanik
695Penerapan model pembeljaran pakem untuk meningkatkan hasil belajar IPA pokok bahasan penyesuaian diri mahluk hidup dengan lingkungannyan pada siswa kelas V SDN Sumberboto 03 kec. Wonotirto kab. Blitar tahun pelajaran 2009/2010 / Teguh Widodo
696Meningkatkan hasil belajar siswa kelas III tentang pecahan sederhana melalui manipulasi benda konkret di UPT SDN Panggungrejo Kota Pasuruan / Lik Anah
697Pengembangan permainan sirkuit geometri pada pembelajaran kognitif di Kelompok A Taman Kanak-Kanak Gugus Kecamatan Donomulyo / Puput Restu Pengesti
698Penerapan teknik reinforcement untuk meningkatkan motivasi dan hasil belajar bahasa daerah dengan pokok bahasan tembung lan seselan siswa kelas IV SDN Ciptomulyo 2 Malang / Slamet Ponidi
699Pemanfaatan lingkungan sekitar untuk meningkatkan prestasi belajar bahasa Indonesia tentang menulis surat undangan kelas V SDN Sudimulyo I Kecamatan Nguling Kabupaten Pasuruan / Wahyoe Nisfuanah
700Penggunaan media kartu huruf dan kartu kata melalui permainan untuk meningkatkan kemampuan membaca permulaan siswa kelas I SDN Sudimoro 01 Kecamatan Bululawang / Nur Farikatul Fitriyah
701Upaya meningkatkan keterampilan menulis melalui media gambar seri pada siswa kelas III SDN Soko I Kabupaten Bojonegoro / Juliana
702Penerapan pendekatan kontekstual untuk meningkatkan pembelajaran IPA siswa kelas V SDN Curahdukuh II / Supardi
703Penggunaan media pembelajaran "Pohon pintar" dengan teknik permainan untuk meningkatkan keaktifan dan penguasaan konsep FPB dan KPK pada siswa kelas IVA SDN Ngerong Kab. Pasuruan / Evin Dwi Angelina
704Penerapan mind mapping untuk meningkatkan hasil belajar siswa pada pembelajaran IPS kelas IV SDN Binangun 03 / Endang Setyaningsih
705Meningkatkan hasil belajar siswa melalui media specimen pada mata pelajaran IPA kelas III MI Zainiyah Tempel Kecamatan Gempol Kabupaten Pasuruan / Erik Silamsari
706Penerapan pendekatan kontekstual untuk meningkatkan hasil belajar IPS perkembangan teknologi transportasi pada siswa kelas IV semester II SDN Pandean 1 Rembang Pasuruan / Ferry Hardiyanto
707Penerapan pendekatan proses untuk meningkatkan keterampilan menulis narasi siswa kelas IV SDN Plandirejo 03 Kabupaten Blitar / Heni Kartika Dewi
708Meningkatkan kemampuan berbahasa Indonesia menyusun paragraf melalui morfologi bahasa jawa bagi siswa kelas III SDN Pogar II kecamatan Bangil Kabupaten Pasuruan / Mas'udah
709Penerapan pembelajaran kooperatif model student team achievement division untuk meningkatkan kerjasama dan hasil belajar IPS siswa kelas V NI Miftahul Huda Kec. Prigen Kab. Pasuruan / Nanik Widiawati
710Penggunaan media kongkrit dan gambar untuk meningkatkan hasil belajar IPA siswa kelas I SDNU Bangil / Saidah Misdiana
711Pembelajaran pemecahan masalah untuk meningkatkan hasil belajar pengukuran satuan waktu di kelas IV SD Negeri Pogar III Pasuruan / Siti Rochmah
712Penggunaan media konkrit untuk meningkatkan pembelajaran IPA tentang bagian-bagian tumbuhan pada siswa kelas IV SDN Sumber Banteng Kejayan Pasuruan / Mariyatul Kiptiyah
713Meningkatkan hasil belajar dengan menggunakan asesmen portofolio pada pembelajaran IPA siswa kelas III SDN Glagahsari III Sukorejo Pasuruan / Ina Purwati
714Penerapan model pembelajaran bermain peran untuk meningkatkan hasil belajar PKn materi sistem pemerintahan pusat di kelas IV SDN Candibinangun 01 Kecamatan Sukorejo Kabupaten Pasuruan / Siti Maisaroh
715Penerapan model pembelajaran eksperimen untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kandung Pasuruan / Lukman Hakim
716Penerapan model pembelajaran kooperatif numbered head together (NHT) untuk meningkatkan hasil belajar IPS siswa kelas V SDN Sukolilo II Kecamatan Prigen Kabupaten Pasuruan / Anis Muftisyah
717Pemanfaatan media gambar untuk meningkatkan hasil belajar IPA kelas I SDN Sidogiri I Kecamatan Kraton Kabupaten Pasuruan / Nur Anita
718Peningkatan hasil belajar pecahan sederhana pada pembelajaran kooperatif tipe stad (Student Teams Achievement Division) untuk meningkatkan hasil belajar siswa kelas III SDN Ngaringan 03 / Rahayu Sulistiyani
719Penggunaan peralatan seqip untuk meningkatkan pembelajaran sains siswa kelas V SDN Tidu I Kecamatan Pohjentrek Kabupaten Pasuruan / Romlah
720Penggunaan media benda konkret bangun ruang untuk meningkatkan hasil belajar matematika siswa kelas IV SDN Rejoso Lor II Kecamatan Rejoso Kabupaten Pasuruan / Sumarni
721Penggunaan media peta untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Cemorokandang 3 Malang / Wahyu Triwidhianto
722Peningkatan hasil beljar IPS melalui model cooperative scrip pada siswa kelas IV SDN Kedungwungu 01 Kabupaten Blitar / Risya Rizki Candrasari
723Hambatan guru dalam mengembangkan pengelolaan kelas di SDN Blimbing I Kota Malang / Hanun Kusuma Rokhmania
724Penggunaan media komik untuk meningkatkan aktivitas dan hasil belajar PKn materi pokok keputusan bersama kelas V SDN Jintel 1 Nganjuk / Eko Fahrudi Purwandini
725Pengaruh model pembelajaran make a match terhadap hasil belajar siswa materi bilangan desimal di kelas IV SDN Gurah 1 Kabupaten Kediri / Yunus Tanthowi
726Penerapan model learning cycle pada pembelajaran IPA untuk meningkatkan pemahaman konsep siswa tentang gaya magnet di kelas V SDN Kendalpayak / Ayu Kusuma Murti
727Penerapan pendekatan esperiental learning untuk meningkatkan hasil belajar sifat cahaya di kelas V SDN Plososari III Pasuruan / Dwi Purwanto
728Penerapan pembelajaran model problem based learning untuk meningkatkan kemampuan pemecahan masalah mata pelajaran IPS siswa kelas IV SDN Lebak Winongan Pasuruan / Nafisah
729Penerapan model rotating trio exchange untuk meningkatkan hasil belajar PKn siswa kelas IV SD Negeri Gejugjati I Pasuruan / Syafarudin Lewataka
730Penerapan model pembelajaran synectics untuk meningkatkan hasil belajar IPS siswa kelas V SDN Sladi Kecamatan Kejayan Kabupaten Pasuruan / Afif Afrudin Uar
731Penggunaan media monopoli berkata untuk meningkatkan kemampuan bahasa anak pada kelompok B TK-SDN Satu Atap Merjosari 5 Malang / Tanti Yulita
732Muatan nilai karakter dalam buku ajar untuk guru kelas IV SD tema Indahnya Kebersamaan pada kurikulum 2013 / Livianinda Adrianova
733Meningkatkan kemampuan penggunaan KPK dan FPB siswa kelas IV SDN.PAKUNDEN 2 KOTA BLITAR melalui pendekatan koopertif model stad./Puji Rahayu
734Analisis kemampuan siswa mengidentifikasi unsur-unsur intrinsik cerpen di kelas V SDN 1 Pandak Kecamatan Balong Kabupaten Ponorogo / Arin Nita Astuti
735Hubungan gaya kepemimpinan kepala sekolah dengan morale kerja guru SD se-kecamatan Pujer Kabupaten Bondowoso / Rosita Rahmaniar Rizki
736Implementasi pendidikan karakter melalui program sekolah di SDN Lesanpuro 3 Malang / Merinta Diah Purwaningrum
737Meningkatkan keterampilan menulis karangan deskripsi siswa kelas IV melalui media lingkungan sekitar di SDN Ngawonggo 02 Tajinan-Malang / Maria Ulfa
738Pengembangan modul pembelajaran IPA materi penggolongan makhluk hidup di kelas III SD Islam Wahid Hasyim Pakisaji / Dotik Agus Irnawati
739Peningkatan hasil belajar melalui media kartu cerdas pada subtema hewan di sekitarku di kelas 2 SDN Tawangrejo Kabupaten Blitar / Evi Kurniasih
740Hubungan kemampuan membaca cerita dengan kemampuan menulis narasi pada siswa kelas V SDN Madyopuro Malang / Friska Dwi Yusantika
741Penerapan metode pembelajaran diskusi untuk meningkatkan aktivitas siswa dan penguasaan materi mata pelajaran IPS kelas III SDN Lebakrejo III Pasuruan / Bagus Koko Wicaksono
742Penggunaan media papan magnet untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS di kelas V MI Hubbul Wathon Pandaan Pasuruan / Shobahul Fajariah
743Pengembangan media wayang kdi dalam pembelajaran kognitif kelompok B di Taman Kanak-kanak Kota Malang / Silvia Putri Anggraeni Winindarti
744Profil tulisan narasi siswa kelas V MIn Janti Kecamatan Slahung Kabupaten Ponorogo / Aditya Dyah Puspitasari
745Peningkatan hasil belajar IPS perjuangan para tokoh melawan Belanda Jepang melalui model picture and picture kelas V SDN Sumberdiren 02 Kabupaten Blitar / Arif Fauzi
746Meningkatkan kemampuan menulis puisi dengan teknik penggambaran di kelas III SDN Jatiguwi 05 Kecamatan Sumberpucung Kabupaten Malang / Kurnia Rahmatullah Muh. Haqqul yakin Satya Praja
747Analisis kesalahan penulisan ejaan dalam karangan narasi siswa kelas IV SDN Bangunrejo 01 Kabupaten Malang / Viki Wulandari
748Meningkatkan kemampuan menulis karangan melalui media pembelajaran gambar seri pada siswa kelas IV SDN Sumberejo I Kecamatan Winongan Kabupaten Pasuruan / Atik Susanti
749Peningkatan pemahaman konsep bangun datar melalui model CTL siswa kelas II SDN Slamet 01 Kecamatan Tumpang Kabupaten Malang / Fatmawati BT. Baba
750Persepsi guru sekolah dasar terhadap evaluasi hasil belajar kurikulum 2013 se-gugus I Kecamatan Jabon Kabupaten Sidoarjo / Mokhammad Afif Al-Ayyubi
751Studi kasus pelaksanaan pembelajaran tematik di kelas IVA SDN Madyopuro 1 Malang / Anggie Kurniawati
752Problema pelaksanaan pembelajaran terpadu di kelas I dan IV SDN Pandanwangi 3 dan 5 Kecamatan Blimbing Kota Malang / Sinahika Sajar
753Analisis LKS matematik kelas II semester 1 yang digunakan di sekolah dasar se gugus 2 Kecamatan Kedungkandang Kota Malang / Emy Diana Eko Andani
754Pengembangan permainan kartu kuartet sebagai media pembelajaran IPS materi jual beli untuk siswa kelas III semester 2 SD Gugus II Kecamatan Kedungkandang Kota Malang / Meita Candra Dewi
755Pengembangan media pembelajaran CD interaktif sub tema cara hidup manusia, hewan, dan tumbuhan untuk kelas VB SDN Lesanpuro 03 Kota Malang / Fera Yanurita
756Pengembangan Cd interaktif pada subtema hebatnya cita-citaku untuk kelas IV smester 2 sekol;ah dasar / Maulidia Fientya Ikrima
757Pengembangan media CD interaktif pada subtema aku bangga dengan daerah tempat tinggalku untuk kelas IV di SDN Cemorokandang 2 Malang / Nurul Laily Yunitasari
758Penerapan model pembelajaran berbasis alam untuk meningkatkan kemampuan motorik halus anak Kelompok B di TKK Mardi Wiyata Malang / Maria Angela Winarsih Prihartini
759Peningkatan pemahaman konsep bilangan melalui permainan detektif cilik pada anak Kelompok A TK Al-Fadholi Malang / Lia Wahyuningsih
760Penerapan permainan sains sederhana untuk meningkatkan kemampuan kognitif anak usia 4-5 tahun TK Muslimat NU 21 Malang / Siti Zulaikhah
761Peningkatan kemampuan motorik kasar melalui permainan egrang pada Kelompok B di TK Al-Hidayah 02 Kaweron Kabupaten Blitar / Ely Dwi Ratna Sari
762Pengembangan permainan misteri dadu dalam pembelajaran kognitif mengenal konsep bilangan 1-10 pada anak Kelompok A di TK Bhima Putra Malang / Intan Kusuma Bekti
763Pengembangan media papan baca tombol geser untuk anak Kelompok B Taman Kanak-Kanak / Luluk Rohmatul Laili
764Implementasi pendidikan karakter melalui pendekatan saintifik di kelas IV semester genap sekolah dasar negeri gugus V Kecamatan Blimbing Kota Malang / Ayip Herdima
765Peningkatan kemampuan membaca cerita melalui pemanfaatan buku cerita bergambar big book pada siswa kelas I SDN Karangrejo 02 Kabupaten Malang / Andrias
766Partisipasi masyarakat dalam pelaksanaan program sekolah di SDN segugus 5 Kecamatan Blimbing Kota Malang / Agustina Putri Setia Mardika
767Pengembangan media pembelajaran CD interaktif sub tema indahnya peninggalan sejarah pembelajaran 2 di kelas IV SDN Lowokwaru 3 Kota Malang / Chofifatul Azizah
768Peningkatan pemahaman operasi hitung campuran melalui model Realistic Mathematic Education (RME) di kelas II SDN Karangtengah 4 Kota Blitar / Ryska Dewi Ratnasari
769Profil kesalahan dalam mengerjakan soal pengukuran sudut pada siswa kelas III SDN Tumpang 03 Kecamatan Tumpang Kabupaten Malang / Septi Selfia Ajang
770Profil kesalahan dalam mengerjakan soal cerita operasi hitung campuran pada siswa kelas II SDN Tumpang 03 Kecamatan Tumpang Kabupaten Malang / Deby Natalia Marten
771Peningkatan keterampilan membaca nyaring dengan menggunakan media flash card pada siswa kelas I SDN Karangrejo 02 Kecamatan Kromengan Kabupaten Malang / Susilawati
772Penerapan video dokumenter untuk meningkatkan aktivitas dan hasil belajar muatan IPS siswa kelas V SDN Pandanwangi 4 Kecamatan Blimbing Kota Malang / Ahmad Rizki Hidayat
773Penerapan model pembelajaran kooperatif teams games tournament (TGT) untuk meningkatkan hasil belajar operasi hiyung pecahan kelas V SDN Puewodadi 3 kota Malang / Lidya Trie Maharani
774Penerapan metode role playing untuk meningkatkan hasil belajar IPS siswa kelas V SDN Ledug II Kecamatan Prigen Kabupaten Pasuruan / Jumadi
775Penggunaan media ritatoon untuk meningkatkan hasil belajar IPA materi cara hewan menyusaikan diri dengan lingkungan kelas V SDN Tambak Kalisogo I Sidoarjo / Arofatul Azizah
776Penerapan model pembelajaran inkuiri dalam meningkatkan keterampilan membuat kalimat tanya siswa kelas II di SDN Madyopuro 02 Kecamatan Kedung Kandang Kota Malang / Apriani
777Penerapan pendekatan keterampilan proses untuk meningkatkan kemampuan menulis karangan narasi siswa kelas V di SDN Sawojajar VI Kota Malang / Eri
778Penerapan metode inkuiri sosial untuk meningkatkan hasil belajar PKn siswa kelas III SDN Petung I Kecamatan Pasrepan Pasuruan / Nikmatul Luailik
779Penerapan model Problem Based Learning (PBL) untuk meningkatkan pembelajaran IPA kelas V SDN Pojok 1 Kecamatan Campurdarat Kabupaten Tulungagung / Neti Novitasari
780Penerapan model discovery untuk meningkatkan pembelajaran IPA pada siswa kelas III SDN Bokor Kecamatan Tumpang, Kabupaten Malang / Irmawiherlina
781Pengembangan media monopoli pintar pada pembelajaran tematik tema Sejarah Peradaban Indonesia di kelas V SDN Madyopuro 5 Kota Malang / Ikhlasul Idris Sasongko
782Penerapan peta konsep untuk meningkatkan hasil belajar IPA siswa kelas V-A SDN Tanjungrejo 2 Kota Malang / Siti Ana Misula
783Peningkatan kreativitas seni melalui teknik cetak tembus menggun akan screen pada kelompok mB di TK Satu Atap Bunulrejo 3 Malang / Latifatul Amalia
784Penerapan model inquiry untuk meningkatkan hasil belajar IPA pada pembelajaran gaya di kelas IV SDN Pejangkungan I Kecamatan Rembang / Rusman
785Penerapan model realistic mathematics education (RME) untuk meningkatkan hasil belajar matematika siswa kelas IV SDN Pandanmulyo 01 Kecamatan Tajinan Kabupaten Malang / Parni
786Penerapan model quantum learning untuk meningkatkan hasil belajar pada mata pelajaran IPA di kelas V SDN Tulusrejo 02 Malang / Maya Puspita Indah Sari
787Pengaruh penggunaan multimedia interaktif (Macromedia Flash) terhadap hasil belajar siswa pada pembelajaran tematik kelas III SDN Sawojajar 2 Kota Malang / Romadhoni Mahardika
788Penerapan pembelajaran penemuan terbimbing untuk meningkatkan hasil belajar IPA siswa kelas V SDN Ngawongso 01 Kecamatan Tajinan Kabupaten Malang tahun pelajaran 2009/2010 / Chotidjah Hidayati
789Peningkatan kemampuan motorik halus anak kelompok B melalui kegiatan kolase dengan menggunakan cangkang telur di TK Kartika IX-4 1A Malang / Bety Permata Wahyuningtyas
790Pengembangan media CD interaktif pembelajaran ilmu pengetahuan alam materi sifat-sifat cahaya kelas V SDI Al Ikhlas Lumajang / Asri Diyah Putranti
791Pengembangan media pembelajaran bowling pintar untuk pembelajaran kognitif anak TK kelompok A / Ria Kartika Dewi
792Penerapan model pembelajaran quantum learning untuk meningkatkan hasil belajar pada mata pelajaran matematika di kelas IV SD Negeri Bajang 02 Kecamatan Talun Kabupaten Blitar / Fitria Linda Kurniawati
793Penerapan pendekatan kontekstual untuk meningkatkan hasil belajar IPA siswa kelas 2 SDN Pandanwangi 1 Kota Malang / Dian Rahmani
794Penerapan model pembeljaran concept attainment untuk meningkatkan pemahaman siswa tentang globalisasi di kelas IV SDN Rembang Kecamatan Rembang Kabupaten Pasuruan / Esterlina Watratan
795Peningkatan perkembangan fisik motorik anak usia dini melalui permainan lewati rintanganmu pada kelompok A di TK Al-Hidayah Klampok Kota Blitar / Nova Meiyanasari
796Penerapan model pembelajaran jigsaw untuk meningkatkan prestasi belajar IPS materi perkembangan teknologi, pada siswa kelas IV SDN Duren II Nganjuk / Nurul Anwar
797Peningkatan kemampuan meringkas teks tulis melalui model pembelajaran CIRC (Cooperative, Integrated, Reading, and Composition) pada kelas V tema 8 SDN Bunulrejo 1 Kota Malang / Yohana Krisna Ariesta Sudarmadi
798Penerapan pembelajaran model murder untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelasa V SDN Arjosari 3 Kecamatan Blimbing Kota Malang / Khusnul Khotimah
799Penerapan metode karya wisata untuk meningkatkan prestasi belajar tema perdagangan pada siswa kelas V SDN Baron V Nganjuk / Mardjuni
800Penerapan strategi multiple games untuk meningkatkan kemampuan membaca permulaan siswa kelas 1 SD Negeri Penanggungan Malang / Sri Agustin Mulyani
801Kemampuan mengoperasikan hitung pecahan pada siswa kelas V Sekolah Dasar Negeri Se Kecamatan Kedungkandang Kota Malang tahun pelajaran 2004/2005 / oleh Harini Bhirowaty
802Penerapan kooperatif STAD untuk meningkatkan hasil belajar PKn siswa kelas V SDN Randuagung 05 Kecamatan Singosari Kabupaten Malang / Sumartini
803Penerapan pembelajaran kooperatif model stad dalam pembelajaran IPS untuk meningkatkan hasil belajar siswa kelas IV SDN Pogar III Kecamatan Bangil Pasuruan / Rusika
804Penerapan pembelajaran tenatik tema kesehatan untuk meningkatkan berbagai kemampuan siswa kelas II SDN Ampelsari I Kabupaten Pasuruan / Sunartin
805Penggunaan alat musik ritmis untuk meningkatkan kemampuan motorik kasar anak kelompok B di TK Kartika IX-41 A Malang / Makdalena Salmanu
806Perbedaan perkembangan sosial emosional antara permainan tradisional dan modern bagi anak usia dini di TK An-Nur Sawojajar Malang / Kartika
807Penggunaan metode kerja kelompok untuk meningkatkan prestasi belajar ilmu pengetahuan sosial siswa kelas V SDN Tegalweru Kecamatan Dau Kabupaten Malang / Donna Sutrisna
808Penerapan pembelajaran tematik dengan tema lingkungan untuk meningkatkan hasil belajar siswa kelas III di SDN Purwantoro 7 Kecamatan Blimbing Kota Malang / Rasmi Patty
809Penerapan pembelajaran kooperatif model numbered heads together (NHT) untuk meningkatkan hasil belajar ilmu pengetahuan sosial siswa kelas IV SDN Klampok III Singosari / Sri Soekarni
810Kesulitan-kesulitan guru kelas I dan IV dalam menerapkan kurikulum 2013 di SD se-Kota Malang / Rohmaniyah
811Penerapan senam yoga fantasi untuk meningkatkan kemampuan motorik kasar pada anak kelompok B di TK Aisyiyah 33 Cita Insani Malang / Ani Dwi Agustina
812Penerapan think pair share menggunakan media puzzle untuk meningkatkan keterampilan membaca siswa kelas 1 SDN 2 Ngelo Kecamatan Cepu Kabupaten Blora / Dia Roro Fadila
813Peningkatan hasil belajar subtema Keindahan Alam Negeriku melalui media pohon pintar pada siswa kelas IV SDN 5 Ngunut Kabupaten Tulungagung / Fitria Andriyani
814Penerapan model pembelajaran group investigation untuk meningkatkan aktivitas dan hasil belajar siswa kelas V tema Sejarah Peradaban Indonesia di SDN Sawojajar 02 Malang / Moh Farid Nurul Anwar
815Peningkatan hasil belajar operasi hitung campuran bilangan bulat melalui model numbered heads together siswa kelas IV SDN Karangtengah 4 Kota Blitar / Retno Manggali
816Pengaruh kebiasaan membaca terhadap hasil belajar siswa kelas IV SDN Cemorokandang 2 Kecamatan Kedungkandang Kota Malang semester II tahun pelajharan 2015/2016 / Rangga Saputra
817Penerapan media komik untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn materi lembaga pemerintahan tingkat pusat kelas IV di SDN Sitirejo 1 Wagir / Muhammad Gusti Rizkian
818Hubungan perhatian orag tua dengan prestasi belajar siswa kelas IV SDN Sekarpuro Kecamatan Pakis Kabupaten Malang / Supriono Antonius Tekege
819Penerapan media asli untuk meningkatkan aktivitas dan hasil belajar siswa kelas III SDN Gading Kasri pada pelajaran IPA materi penggolongan tumbuhan / Siti Nurhidayati
820Problematika pembelajaran menulis puisi di kelas IV sekolah dasar se gugus I dan VII Kecamatan Blimbing Kota Malang / Nanang Kurniawan
821Penggunaan model pembelajaran recoprocal teaching untuk meningkatkan prestasi belajar siswa dalam mata pelajaran IPS di kelas IV SDN Gejugjati I Kecamatan Lekok Kabupaten Pasuruan / Kota Rumuar
822Pemanfaatan media pembelajaran sedotan dan karet gelang dalam penanaman konsep nilai tempat puluhan dan satuan pada kelas I di SDN Tawangrejeni 01 Kec. Turen / oleh Ninuk Irianti
823Hubungan antara pendidikan dirumah dengan prestasi siswa di SDN Dinoyo IV tahun pelajaran 2003/2004 / oleh Sere Raya Sianturi
824Perbedaan kemampuan penguasaan konsep udara dalam
pengajaran IPA dengan media papan flanel dan tanpa media
papan flanel (ceramah) di kelas III SDN Karangbesuki III
Kecamatan Sukun Kota Malang / oleh Valentina Siti Mariyam
825Pemanfaatan media pembelajaran IPS kelas III-IV di SDN
Ketawanggede Lowokwaru Kota Malang / oleh Musiyah
826Hubungan tingkat pendidikan dengan prestasi belajar siswa
mata pelajaran PPKn di SDN Sukun VI Kecamatan Sukun Malang / oleh Herlina Yusminingsih
827Pemanfaatan potensi masyarakat dalam pembelajaran muatan
lokal di SDN Kotalama I / oleh Ratnaningsih
828Hubungan antara persepsi siswa terhadap disiplin kerja guru
dengan prestasi belajar IPS siswa kelas VI SDN Tanjungrejo
VI Kecamatan Sukun Malang / oleh Rukayah, Siti
829Upaya menstimulasi kecerdasan visual spasial melalui penciptaan properti dan aksesoris tari dolanan anak kelompok B TK Aisyiyah Bustanul Athfal 01 Bululawang Malang / Susy Yuli Arfanti
830Penerapan model role playing pada mata pelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Purwodadi 3 Kecamatan Blimbing kota Malang / Adellia Shinta Dewi
831Meningkatkan pembelajaran IPA siswa kelas IV SDN Sawojajar 5 melalui pembelajaran kooperatif model two stay two stray / Sulikin Agus Purwanto
832Pengembangan permainan "alphabet scrabble" untuk menstimulasi kemampuan membaca pada anak kelompok B di taman kanak-kanak / Qudsi Cahyani Putri
833Penggunaan media boneka wayang untuk meningkatkan keterampilan berbicara anak kelompok A di TK Al Hidayah Tingal Kecamatan Garum Kabupaten Blitar / Andri Prasetyani
834Peningkatan kemampuan mengenal lambang bilangan 1-10 melalui permainan media kipas angka pada kelompok A TK Al Hidayah Klampok Kota Blitar / Siti Nur Hanifah
835Pemanfaatan media papan magnet untuk meningkatkan kemampuan pramembaca anak kelompok A TK Taman Indria 1 Malang / Intan Anggraeni
836Profil guru dalam melakukan evaluasi pembelajaran di kelompok A TK Angkasa VII Pringgodani Singosari Malang / Unun Amalia
837Pola asuh orang tua dan sikap emosi anak usia dini (studi kasus pada anak yang memiliki emosi stabil dan anak yang memiliki emosi kurang stabil) / Bilqis Nur Zaqia
838Peningkatan potensi kreatif anak kelompok B melalui media playdough di TK Dharma Wanita 2 Drokilo Kecamatan Kedungadem Kabupaten Bojonegoro / Anggitiya Okta Wiyanti
839Analisis kesesuaian isi buku siswa kelas II SD tema 1: hidup rukum subtema 1: hidup rukun di rumah dengan kurikulum 2013 / Dwi Fithri Nur Jannah
840Penerapan model pembelajaran menulis terbimbing untuk meningkatkan keterampilan menulis karangan narasi siswa kelas IV SDN Darurejo 1 Kecamatan Plandaan Kabupaten Jombang / Nila Runtika Sari
841Pengembangan media CD interaktif pada tema cita-citaku subtema aku dan cita-citaku kelas IV di SDN Lowokwaru 2 Kota Malang / Rizky Septa Fauzi
842Pengembangan media powerpoint interaktif pada subtema giat berusaha meraih cita-cita untuk siswa kelas IV di SDN Lesanpuro 3 Malang / Anna Wahyuni Fajarwati
843Peningkatan pemahaman jenis-jenis pekerjaan melalui model mind mapping pada kelas III SDN Sumber 02 Kabupaten Blitar / Erlinda Puspitasari
844Analisis kemampuan guru kelas dalam menerapkan delapan keterampilan dasar mengajar di SDN Gampengrejo Kecamatan Gampengrejo Kabupaten Kediri / Mar'ati Lutfi
845Pengembangan media CD pembelajaran tema sejarah peradaban Indonesia subtema kerajaan Islam di Indonesia kelas VB SDN Buring Kota Malang / Sri Ratna Wahyuni
846Analisis kemampuan menulis karangan narasi bahasa Indonesia siswa kelas V di SDN Seduri 1 dan 2 Kecamatan Balongbendo Kabupaten Sidoarjo / Tiara Sevi Nurmanita
847Pelaksanaan pendidikan budi pekerti melalui budaya 5S pada siswa kelas V SDN Tegowangi Kec. Plemahan Kab. Kediri / Ary Tria Pramudyani
848Problematika guru dalam pembelajaran keliling dan luas persegi dan persegi panjang pada siswa kelas III Seokolah Dasar se Kecamatan Singosari Kabupaten Malang / Danik Riasari
849Pengembangan media papan flanel pada pembelajaran subtema Lingkungan Sekolahku kelas 1 SDN Tumpang 01 Kabupaten Malang / Fatma Khoirun Nisa
850Implementasi pendidikan karakter dalam pembelajaran PKn pada siswa kelas V SDN Pulorejo 01 Kabupaten Jombang / Fitri Farlina
851Pemahaman guru SDN terhadap kurikulum 2013 se-Kecamatan Bangsal Kabupaten Mojokerto / Desy Yanuari Anamia
852Hubungan perhatian orang tua dan ketersediaan sumber belajar di rumah dengan hasil belajar siswa kelas V SDN Segugus VI Kecamatan Turen Kabupaten Malang / Nurriza Budiastri
853Penerapan pembelajaran sains teknologi masyarakat untuk meningkatkan hasil belajar siswa kelas 3 di SDN Mergosono 4 Kota Malang / Ririn Andriyani
854Analisis kesesuaian buku guru kelas IV semester 1 dengan standar isi kurikulum 2013 / Wahyu Vakhuriroh
855Pengembangan modul pembelajaran tema Indahnya Kebersamaan untuk siswa kelas IV SDN Girimoyo 3 Kabupaten Malang / Lina Septian Puspitasari
856Pengembangan media buku cerita flanel zig-zag dalam pembelajaran berbahasa anak Kelompok B RA Al-Islam 1 Turirejo Kewcamatan Beji Kabupaten Pasuruan / Rosyidatul Aminah
857Pengembangan media maze bermagnit dalam pembelajaran kognitif pada anak Kelompok B di Taman Kanak-Kanak / Nia Lestyorini
858Pemanfaatan media kubus bergambar untuk meningkatkan kemampuan kognitif anak usia dini Kelompok B TK PGRI 01 Bululawang / Amila Rahayu Mardikaningsih
859Peningkatan kemampuan membaca permulaan anak melalui permainan sandi warna pada Kelompok B di TK Al Hidayah Klampok Blitar / Fitria At Tasaufi
860Pemanfaatan media kartu angka untuk meningkatkan pemahaman konsep bilangan pada anak Kelopok A di TK Negeri Pembina 2 Tuban / Ritmaratrie Sekar Sari
861Pengembangan media pembelajaran Kantong Ajaib untuk pembelajaran kognitif anak usia 4-6 tahun di Taman Kank-Kanak Kecamatan Gondanglegi / Nikmahtul Khoir Tri Yulia
862Pengembangan aktivitas belajar fisik motorik halus menggunakan bahan bokasam anak kelompok B di Raudhatul Athfal / Ramadhani Priyasaloka
863Penggunaan media Pop Up Story untuk meningkatkan kemampuan bahasa anak usia 3-4 tahun di PAUD As Sholihin Wonorejo Kabupaten Blitar / Surya Pandini
864Pengembangan permainan Sirkuit Happy Circle pada pembalajaran fisik motorik anak / Chanifah Chomsah
865Hubungan pola asuh orangtua dengan perkembangan sosial anak Kelompok B di TK PKK Bandulan Malang / Kholis Shotul Avivah
866Peningkatan kemampuan motorik kasar melompat melalui permainan Engklek pada anak Kelpmpok A TK PGRI Srengat Kabupaten Blitar / Ofsi Nova Lindariana
867Penerapan think pair share (TPS) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Segaran 03 Kecamatan Gedangan Kabupaten Malang / Luluk Umiatin
868Pengembangan media Flash Card Pintar untuk meningkatkan kemampuan kognitif anak Kelopok A / Nur Jannah Brinasari
869Peningkatan kemampuan motorik halus anak Kelompok A melalui bermain Bubur Koran di TK PKK Srikandi Bantaran Probolinggo / Primintiyan Sandy Metasari
870Penerapan permainan bowling bilangan untuk meningkatkan kemampuan membilang benda pada anak kelompok A di TK Shining Star Malang / Dessy Natalia
871Peningkatan kemampuan membilang melalui pemanfaatan alat permainan edukatif buku hitung anak kelompok A TK Agape Malang / Farida Susmiarti
872Peningkatan kemampuan berbahasa anak kelompok B melalui media buku flanel di TK Muslimat NU 45 Sukun - Malang / Rina Afriyanti
873Hubungan pola asuh orangtua dengan kemandirian anak di TK PKK Bandulan Malang / Retno Wulansari
874Peningkatan kemampuan motorik kasar melalui permainan sirkuit "temukan aku" pada anak kelompok B di TK Pertiwi 02 Ponggok Kabupaten Blitar / Dwi Alfitasari
875Peningkatan pemahaman unsur-unsur bangun datar melalui model guided discovery siswa kelas II di SDN Padangan Kabupaten Tulungagung / Andika Viani
876Penerapan pendekatan keterampilan proses untuk meningkatkan pembelajaran IPA siswa kelas V SDN Sumurgung II Tuban / Nafiatus Syafa'ati
877Pengembangan media CD interaktif subtema manfaat makanan sehat dan bergizi kelas IV semester 2 SDN Gadang I Kota Malang / Winda Nur Irfani
878Pemanfaatan rubrik kerj sama dengan orang tua dalam buku siswa tematik terpadu di kelas IV B SDN Purwantoro 1 Malang / Ranny Rachmani Safitri
879Implementasi pendidikan karakter melalui kegiatan rutin di SDN Pulorejo 1 Kecamatan Prajuritkulon Kota Mojokerto / Cici Purwanti
880Perbedaan kemandirian penyelesaian soal cerita materi pecahan siswa kelas III SDN 01 Prigi sebelum dan sesudah diberi scaffolding / Jerisma Dwi Saputri
881Persepsi guru sekolah dasar tentang penilaian autentik pada kurikulum 2013 di Kecamatan Wonorejo Kabupaten Pasuruan / Tita Nur Azizah
882Pola asuh orang tua dan kemandirian anak (studi kasus pada ananda dan dinda di TK Permatan Iman 3 Malang) / Rini Suharti
883Peningkatan kemampuan membaca permulaan melalui pemanfaatan media permainan kartu huruf pada anak Kelom,pok B TK Dharma Wanita Desa Gebang Pakel Kabupaten Tulungagung / Desy Erma Saputri
884Persepsi guru tentang penilaian autentik pada kurikulum 2013 di SD se-kecamatan Jombang Kabupaten Jombang / Mohammad Iwan Ulil Abshor
885Penggunaan media "kaleng baca" untuk meningkatkan kemampuan keaksaraan anak kelompok B di TK Satu Atap SDN Ciptomulyo 2 Malang / Yuyun Wahyuni
886Peningkatan kemampuan motorik kasar melalui permainan sirkuit Aku Bisa pada Kelompok B di TK Al Hidayah Centong Kabupaten Blitar / Herma Fery Rosadi
887Peningkatan kemampuan calistung melalui metode demonstrasi di kelompok B di RA Abdus Salam Bekacak Kolursari Bangil Pasuruan / Siti Aisyah Tavip
888Pengembangan permainan tradisional lempar karet modifikasi untuk meningkatkan kemampuan motorik anak Kelompok B di TK Tunas Karya Jombang / Teresya Royaninda Afilia
889Pengembangan tari kreasi baru Meri Megol dalam pembelajaran seni anak usia dini / Ayu Vrismia Ningrum
890Penerapan permainan sirkuit bola pelangi untuk mningkatkan kemapuan motorik kasar anak Kelompok B di TK Kemala Bhayangkari 44 Kota Blitar / Fitta Nurisma Riswandi
891Pengembangan bermaoin sirkuit Kartu Angka dalam mengoptimalkan kognitif anak Kelompok A dio TK Dharma Wanita 05 Wajak Malang / Luluk Arofah
892Profil kesalahan siswa dalam menyelesaikan soal cerita matematika kelas IV di SDN ser-[gugus 08 Kecamatan Lowokwaru Malang / Anggun Putri Maharani
893Penggunaan media komik untuk meningkatkan aktivitas dan hasil belajar tema Tempat Tinggalku pada siswa kelas IV SDN Bandungrejosari 3 Kecamatan Sukun Kota Malang / Nila Aula Ervina
894Peningkatan keterampilan menulis karangan deskripsi menggunakan model picture and picture kelas IV SDN Sentul IV Blitar / Mukti Intan Indriani
895Kemenarikan pelaksanaan pembelajaran tematik terpadu di sekol;ah dasar wilayah Kecamatan Lumajang Kabupaten Lumajang / Fahrur Rozi
896Peningkatan kemampuan kerjasama anak melalui permainan estafet ceria di kelompok B TK Satu Atap SDN Kotalama 2 Malang / Siti Khoiriyah
897Perilaku sosial emosional anak di TK PKK 7 Bakalan Durensewu Pandaan / Nesya Wulan Sari
898Penggunaan media dadu untuk meningkatkan kemampuan membaca perm,ulaan pada anak Kelompok A di TK Kartika IV-80 Malang / Titik Mulyani
899Penerapan metode struktural analitik sintetik untuk meningkatkan keterampilan membaca menulis permulaai pada siswa kelas II SDN Penanggungan Kota Malang / Ery Ervyna Vadia Frinda
900Penerapan model pembelajaran talking stick untuk meningkatkan hasil belajar IPS pada siswa kelas V SDN Blitar Kecamatan Sukorejo Kota Blitar / Tatik Darlia
901Penerapan pendidikan karakter pada pembelajaran tematik terpadu kurikulum 2013 di SDN Blimbing 3 Kota malang / Rhapsona Indi Bernati
902Pemanfaatan media dan sumber belajar dalam pembelajaran tema Air, Bumi, Matahari subtema Alam Sekitar Kita kelas II di SDN Clumprit 03 Kecamatan Pagelaran Kabupaten Malang / Maulidya Safitri
903Analisis implementasi kurikulum 2013 pada kelas V SDn Panggungrejo 04 Kecamatan Kepanjen Kabupaten Malang / Lutfiya Hanifah
904Penerapan pembelajaran dengan teknik learning community untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pada pembelajaran IPS SDN Gempolan Kecamatan Gurah Kabupaten Kediri / Dina Fatkhul Janah
905Penerapan model Team Assisted Individualization (TAI) pada pembelajaran matematika kelas II SDN Karangtengah 4 Kota Blitar / Fuad Prahastomo
906Pelaksanaan penilaian autentik kurikulum 2013 di kelas IV Sekolah dasar Negeri se-Kecamayan Sukun Kota Malang / Desinta Nur Amalina
907Kegiatan pembelajaran kelompok dan perkembangan sikap sosial siswa kelas V MIN Janti Kecamatan Slahung Kabupaten Ponorogo / Nova Estu Harsiwi
908Pengembangan media pembelajaran CD interaktif subtema Komponen Ekosistem di kelas V SDN Sawojajar 2 Malang semester 2 / Rachmad Dhedy Prasetya
909Penerapan model pembelajaran Student Team Achievement Devision (STAD) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Suwaluh 2 Tulungagung / Susi Novitasari
910Peningkatan keterampilan berbicara melalui media gambar bergerak pada siswa kelas III SDN Podoroto 1 Kecamatan Kesamben Kabupaten Jombang / Whilda Andiah
911Analisis kesesuaian isi buku siswa tematik terpadu kurikulum 2013 kelas IV tema Pahlawanku / Muhammad Nur Miftahul Tsalasa
912Pengembangan buku tematik berbasis lokal tema Ekosistem subtema Komponen Ekosistem untuk siswa kelas V di SDN Mojoagung II Kabupaten Nganjuk / Ellok Ardhyanti Hidayatulloh
913Analisis pelaksanaan pembelajaran kurikulum 2013 di SDN Gugus V Kecamatan Blimbing Kota Malang / Fitroh Bagus Samudro
914Studi kasus pembelajaran matematika materi geometri pada kelas III di SDN Buring Kecamatan Kedungkandang Kota Malang / Egananda Jatiguruh Pradana
915Pengembangan media pembelajaran berbasis TIK untuk siswa kelas V SDN Pandanwangi 4 Malang subtema organ tubuh manusia dan hewan / Annisa Nur Irfayani
916Problematika penerapan buku panduan guru kelas V di Sekolah Dasar Gugus VIII Kecamatan Blimbing Kota Malang / Rischa Dwi Khurotul A'in
917Analisis unsur afektif dalam karangan narasi siswa kelas V SDN Meri 1 Kota Mojokerto / Vemi Eliaristi
918Pengembangan media ritatoon pada subtema aku dan cita-citaku semester 2 untuk kelas IV SDN Purwantoro 8 Malang / Putri Yunisda Mawarni
919Peningkatan pemahaman isi cerita anak melalui membaca pemahaman pada siswa kelas V SDN Selokajang Kabupaten Blitar / Qomaruzzaman
920Analisis Rencana Pelaksanaan Pembelajaran (RPP) guru bersertifikat pendidik pada sekolah dasar negeri se-kecamatan Tumpang Kabupaten Malang / Siti Mufidah
921Pengembangan media CD interaktif subtema Keunikan Daerah Tempat Tinggalku untuyk siswa kelas IV di SDN Arjosari 2 Kota Malang / Rizka Mentari Putri
922Penerapan media kartu domino perkalian untuk meningkatkan keterampilan berhitung perkalian pada siswa kelas IV SDN Sumberanyar I Nguling Pasuruan / Sakdullah
923Penerapan model pembelajaran student teams-achievement divisions (STAD) untuk meningkatkan hasil belajar IPA siswa kelas IV MI Darul Ulum Rembang Kabupaten Pasuruan / Siti Kholilatul Jannah
924Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar IPA siswa kelas V SDN Brambang Kecamatan Gondangwetan Kabupaten Pasuruan / Khuriyatul Aisyiyah
925Penerapan pendekatan informal untuk mengembangkan kemamouan bercerita anak kelompok B di Children Centre Brawijaya Smart School Malang / Ismi Ravena Ochtavia
926Penerapan pendekatan pakem untuk meningkatkan hasil belajar IPA kelas VI SDN Watukosek Gempol Pasuruan / Danang Fatkhur Rohman
927Pemanfaatan media ritatoon untuk meningkatkan hasil belajar SBK bidang seni rupa kelas IV MU Hubbul Wathon Kec. Pandaan Kab. Pasuruan / Novia Irmawati
928Pengembangan modul pembelajaran tema lingkungan sahabat kita untuk peserta didik kelas V sekolah dasar / Astari Ulfa
929Meningkatkan hasil belajar matematika pokok bahasan kecepatan melalui model pembelajaran kooperatif tipe STAD (Student Teams Achievement Division) pada siswa kelas V SDN Tepas 03 Kabupaten Blitar / Anang Winariyanto
930Penerapan media peta untuk meningkatkan hasil belajar IPS kelas IV SDN Wrati II Kecamatan Kejayan Kabupaten Psuruan / Leksono Minto Utomo
931Pengembangan permainan sirkuit pohon ajaib dalam pembelajaran fisik motorik anak kelompok A di TK PKK Bandulan Malang / Fitri Aniz Zahroh
932Pengembangan media fun recycle sircuit untuk pembelajaran aspek fisik motorik di Taman Kanak-kanak kelompok B / Chonia Via Khurniawati
933Problema penerapan pendekatan saintifik yang dihadapi guru kelas IV SDN Gugus 2 Kecamatan Kedungkandang Kota Malang / Nawandha Dwika Yuniar
934Pengembangan media pembelajaran CD interaktif materi kenampakan permukaan bumi untuk siswa kelas III SDN Panggungrejo IV Kepanjen / Nisfatul Istiqomah
935Penerapan media edukatif "permainan monopoli cerdas" pada pembelajaran IPS di kelas III B SDN Karangtengah 01 Kota Blitar / Moh. Ali Yafi
936Implementasi kurikulum 2013 dalam pembelajaran tematik terpadu kelas IV di SDN Sumberrejo 1 Kecamatan Sumberrejo Kabupaten Bojonegoro / Fajar Mega Ayu Septiyana
937Pengembangan gerak dan lagu untuk pembelajaran kognitif di TK PKK Bandulan Malang / Alvin Nurhayati
938Penerapan model mind mapping untuk meningkatkan pembelajaran IPA pada kelas V SDN Pandesari 05 Kabupaten Malang / Sucy Aprillia Wahyuningtyas
939Persepsi guru terhadap evaluasi pembelajaran berbasis kurikulum 2013 SD Negeri se Kecamatan Klojen Kota Malang / Alwi Basofi
940Peningkatan pembelajaran IPS melalui media buklet pada siswa kelas V di SDN Sumber 02 Kabupaten Malang / Rezita Rahma Puspaningrum
941Peningkatan keterampilan menulis narasi melalui model example non example siswa kelas V di SDN Sentul 4 Blitar / Dino Arum Hari Ristanto
942Hubungan pola asuh otoriter dengan perkembangan sosial emosional anak kelas A di TK Dharma Wanita 07 Mulyorejo Malang / Lina Dwi Prastyawati
943Peningkatan kemampuan motorik halus anak melalui kegiatan menganyam di Kelompok A TK Bhakti Persada Kabupaten Malang / Dwi Yuyut Sariningrum
944Pengembangan permainan sirkuit "Warna Bersinar" pada pembelajaran kognitif untuk anak Kelompok B TK Mardi Siwi 1 Kecamatan Bumiaji Kota Batu / Aldini Agustyar Aji
945Penerapan permainan sirkuit rimba untuk meningkatkan kemampuan motorik kasar anak Kelompok B TK Taman Indria 1 Kecamatan Klojen Kota Malang / Yuvi Indrawati Purwaningsih
946Penerapan model pembelajaran learning cycle untuk meningkatkan aktivitas da hasil belajar siswa kelas V SDN Karangbesuki 4 Malang materi pokok sifat-sifat cahaya / Erni Pujayanti
947Penerapan metode simulasi untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn di kelas IV SDN Kemiri Kecamatan Puspo Kabupaten Pasuruan / Siti Fatimah
948Upaya guru kelas rendah melestarikan bentuk Lagu Anak yang bermakna pendidikan di Sekolah Dasar Kecamatan Klojen Kota Malang / Herni Etikasari
949Penerapan pendekatan proses dengan pemanfaatan lingkungan sekitar untuk meningkatkan keterampilan menulis deskripsi siswa kelas IV SDN Permisan Jabon / Syarifatul Umariyah
950Penerapan permainan kartu kata bergambar untuk meningkatkan keterampilan membaca dan menulis di kelas I tema 1 SDN Dinoyo 4 Kota Malang / Suranto Hariadi
951Penerapan model pembelajaran STAD untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SDN Wirogunan Kota Pasuruan / Icca Nurika Lalita
952Peningkatan kecerdasan musikal pada anak melalui pembelajaran lagu "Bintang Kejora" kelompok B1 di Taman Kanak-kanak Katolik Sang Timur Malang / Mesrika Aknes Sigiro
953Penerapan bermain sains sederhana benda terapung, tenggelam, dan melayang untuk meningkatkan kemampuan kognitif anak kelompok B2 di TK Katolik Sang Timur Malang / Ekaristiana Sihombing
954Peningkatan hasil belajar operasi hitung campuran bilangan bulat melalui media garis bilangan bagi siswa kelas IV SDN Sumberejo I Sidoarjo / Ismi Lestari
955Pengembangan media CD interaktif subtema organ tubuh manusia dan hewan untuk siswa kelas V di SDN Arjosari 2 Kota Malang / Dessy Ira Kristina
956Penggunaan kartu kata dan gambar untuk meningkatkan kemampuan membaca permulaan siswa kelas I SDN Banjarimbo 02 Kecamatan Lumbang Kabupaten Pasuruan / Herlina
957Penerapan model pembelajaran snowball throwing untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Oro-oro Dowo Malang / Azaika Hafiidyaningtyas
958Ketersediaan media pembelajaran bagi peserta didik di SDN Bandulan 2 Kota Malang tahun ajaran 2014/2015 / Elfaudya Firbasari
959Penerapan model problem based learning (PBL) untuk meningkatkan motivasi dan hasil belajar siswa pada mata pelajaran PKn kelas V SDN Jatimulyo 1 Kota Malang / Willis Rahayuningtyas
960Meningkatkan hasil belajar IPS melalui metode brainstorming bagi siswa kelas IV SDN Turi 2 Kota Blitar / Marta Kristy Herluly
961Penggunaan model mnemonik untuk meningkatkan kemampuan menghafal dengan efektif dan menyenangkan dalam pelajaran PKn kelas IV SDN Sumbersari 1 Malang / Patricia Anjani Sari
962Penerapan model talking stick untuk meningkatkan pembelajaran IPS siswa kelas V SDN Pandanwangi 4 kecamatan Blimbing kota Malang / Heppi Sasmoko
963Penerapan model pembelajaran kooperatif time token arends untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV SDN Jatimulyo 01 Malang / Muhammad Fitra Rasyadianto
964Penerapan pemecahan masalah untuk meningkatkan hasil belajar operasi hitung campuran siswa kelas IV B SDN Ngulankulon 1 Kabupaten Trenggalek / Asih Kurniawati
965Penerapan permainan outbound untuk meningkatkan proses dan hasil belajar dalam tema kerjasama siswa kelas I SDN Bareng 5 Malang / Suci Wilujeng Widiati
966Pemanfaatan media lingkungan sekitar pada penjumlahan dan pengurangan untuk meningkatkan hasil belajar matematika siswa kelas I SDN Ketawanggede 1 kota Malang / Khusnul Khotimah
967Penerapan model problem solving untuk meningkatkan hasil belajar IPA kelas V SDN Tulusrejo 02 Malang / Gita Septyanna Wulandari
968Penerapan model project-based learning untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Ketawanggede 2 Malang / Dewi Nofita Sari
969Penerapan model pembelajaran controversial issues untuk meningkatkan motivasi dan hasil belajar IPS siswa kelas IVB di SDN Kasin kota MAlang / Novita Verdiantika
970Penerapan model inductive thinking dengan menggunakan kliping untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas V SDN Ketawanggede 2 kota Malang / Nirmala Puspita Sari
971Penerapan pendekatan whole language untuk meningkatkan kemampuan membaca cerita pada siswa kelas V SDN Bareng 4 Kecamatan Klojen kota Malang / Putri Manggiasih
972Model pembelajaran inkuiri sosial untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Pagentan 02 Kecamatan Singosari Kabupaten Malang / Adi Prayogo
973Upaya meningkatkan pemahaman konsep faktorisasi prima melalui pembelajaran think-pair-share pada siswa kelas V MI Annidhomiyah Pasuruan / Siti Fauziyah
974Penerapan permainan pita bilangan untuk meningkatkan hasil belajar matematika pada siswa kelas V SD Hasanuddin Dilem 02 Kepanjen / Alfiah
975Peningkatan pembelajaran IPA dengan menggunakan model Make A Match di kelas III SDN Jatimulyo 2 Kota Malang / Ani Mushafidah
976Penerapan metode karya wisata untuk meningkatkan kemampuan menulis laporan kunjungan siswa kelas VA SDN Ketawanggede I / Ayu Artika Putri
977Penerapan model quantum writing untuk meningkatkan keterampilan siswa dalam menulis karangan deskripsi di kelas V SDN Tulusrejo 2 Malang / Wahyu Krismayanti
978Penggunaan media audio rekaman untuk meningkatkan kemampuan menulis puisi pada siswa kelas V SDN Bareng 4 Malang / Rita Indayati
979Peningkatan kemampuan membaca teks narasi dengan strategi Survey, Question, Read, Recite, Review (SQ3R) di kelas V SDN Pojok 02 Kabupaten Blitar / Latifatul Chariroh
980Penerapan pemecahan masalah matematika yang berorientasi pda Polya untuk meningkatkan hasil belajar pengukuran siswa kelas IV di SDN Sumbersari 06 Kabupaten Blitar / Rurin Usnawati
981Pola muatan nilai-nilai karakter dalam bahan ajar kelas III sekolah Dasar / Nur Hidayat
982Penerapan media neraca bilangan untuk meningkatkan hasil operasi perkalian pada siswa kelas II SDN Bugul Lor Pasuruan / Ika Nur Hidayah
983Upaya meningkatkan aktivitas dan hasil belajar IPA melalui model jigsaw pada siswa kelas V SD Negeri Latek Bangil tahun pelajaran 2010/2011 / Silfia Safriani
984Penerapan model quantum teaching pada pembelajaran PKn untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Pungging Pasuruan / Siti Rohanah
985Penerapan pendekatan problem posing untuk meningkatkan kemampuan mengukur panjang dengan satuan tidak tentu siswa kelas IV SDN Ketawanggede 2 Malang / Sukma Jati Raras
986Penerapan model permainan puzzle, hangman dan bingo untuk meningkatkan penguasaan kosakata siswa kelas IV SDN Pagentan 01 Singosari / Warnindah
987Penerapan model reciprocal teaching untuk meningkatkan pembelajaran IPA siswa kelas V SDN Pisang Candi 2 Kota Malang / Ericha Ayu EW.
988Pola bimbingan guru dalam menanamkan kemandirian pada anak di TK Satu Atap Rampal Celaket 2 Malang / Ivani Florentina Liwe
989Penerapan model learning cycle untuk meningkatkan hasil belajar IPA materi pokok posisi bulan bagi siswa kelas IV SDN Pisang Candi 2 Malang / Dian Risa Pratiwi
990Peningkatan keterampilan menulis ringkasan melalui metode penugasan pada siswa kelas V SDN Kunir 01 Kabupaten Blitar / Jundallah Srinata
991Hubungan antara keaktifan dengan hasil belajar siswa kelas V SDN Pisangcandi 1 Kota Malang / Dwi luluk Indrawati
992Pakem dalam implementasi manajemen berbasis sekolah di kelas IV SDN Punten 01 Kecamatan Bumiaji Kota Batu / Gadis Laras Santi Triwulandari
993Pengembangan media powerpoint interaktif untuk kelas V subtema organ manusia dan hewan di SDN Sawojajar 4 Kecamatan Kedungdandang Kota Malang / Rizky Hidayat
994Penerapan model problem based learning (PBL) untuk meningkatkan pembelajaran IPA siswa kelas V SDN Plintahan II Kecamatan Pandaan Kabupaten Pasuruan / Pipit Mau Ria
995Analisis kesulitan-kesulitan guru kelas V sekolah dasar dalam menerapkan penilaian autentik kurikulum 2013 di Gugus 3 Kecamatan Lowokwaru / Dewi Nur Rohmah
996Penerapan metode proyek untuk meningkatkan kemampuan kognitif anak kelompok B3 TK Al-Hidayah XI Bendogerit Kota Blitar / Osa Dian Prastica Sari
997Pengembangan instrumen penilaian autentik pada pembelajaran membaca pmahaman kelas IV SDN Sawojajar 4 Kota Malang / Wahyu Nurmalasari
998Peningkatan hasil belajar matematika materi pecahan melalui model make a match di kelas V SDN Majan 2 Kabupaten Tulungagung / Ayu Shabrinash Thofinaya
999Implementasi pembelajaran tematik dalam kurikulum 2013 di SDN Percobaan 2 Kota Malang / Fitri Suciari
1000Penerapan pendidikan karakter melalui pembiasaan di SDN Percobaan 2 Malang / Moch. Hasanuddin Jaelani
1001Penerapan model pembelajaran problem based learning tema 7 untuk meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Pandean 3 Kecamatan Karanganyar Kabupaten Ngawi / Erma Deffi Ratnasari
1002Implementasi pendekatan saintifik dalam pembelajaran tema Indahnya persahabatan kelas III SDN Merjosari 02 Kota Malang / Fitri Nur Azizah
1003Pemanfaatan lingkungan di dalam sekolah sebagai sumber belajar yang kontekstual bagi siswa kelas III SDN Blimbing 1 Kota Malang / Anita Rahmawati
1004Pengembangan media Pop Up Book dalam pembelajaran menulis narasi kelas V tema Sejarah Peradaban Indonesia / Ulfiyah Anis
1005Meningkatkan pemahaman konsep menghargai keputusan bersama dalam pembelajaran PKn melalui metode role playing siswa kelas V SDN Glangang I Malang / Erna Kusrini
1006Peningkatan kemampuan membaca permulaan anak kelompok B melalui permainan sandi kata di PAUD Brillian Sumberjo Kabupaten Blitar / Eka Purwanti
1007Pengembangan media pembelajaran ular tangga kebun binatang untuk membantu perkembangan sosial emosional anak mkelompok B / Dewi Risky Rachim
1008Peningkatan hasil belajar kegiatan ekonomi melalui model student team achievement divisions diu kelas IV SDN Pojok 02 Kabupaten Bliitar / Pramesti Arimbi Putri
1009Penerapan model discovery learning untuk meningkatkan aktivitas dan hasil belajar siswa subtema Komponen Ekosistem kelas V SDN Cemorokandang 1 Malang / Evi Septia Yuliyanti
1010Penerapan model pembelajaran make a match untuk meningkatkan aktivitas belajae siswa tema Indahnya Negeriku kelas IV semester 2 di SDN Nguling 1 Kabupaten Pasuruan / Musdalifah Mithasari
1011Implementasi penanaman nilai karakter melalui pembelajaran Sirah Nabawi di kelas rendah SDIT Mutiara Ummat Desa Ngadisuko Kecamatan Durenan Kabupaten Trenggalek / Ike Sulistyowati Putri
1012Hubungan intensitas pemanfaatan gadget dengan prestasi belajar siswa kelas V SDN se-Gugus VIII Kecamatan Blimbing Kota Malang / Maya Ferdiana Rozalia
1013Penerapan pendekatan saintifik pada pembelajaran bahasa Indonesia untuk meningkatkan keterampilan menulis karangan narasi melalui gambar seri di kelas 3 SDN Bandungrejosari 1 Kecamatan Sukun Kota Malang / Wulan Romasari
1014Penerapan strategi pair check dengan menggunakan media gambar seri untuk meningkatkan kemampuan mengarang siswa kelas III SDN Pagentan 05 Singosari / Nurul Rahmawati
1015Penerapan kegiatan menari untuk meningkatkan konsentrasi anak Kelompok A TK Al-Fadholi Kota Malang / Linda Siswati
1016Penerapan model siklus belajar (learning cycle) untuk meningkatkan pembelajaran IPS siswa kelas V SDN Jimbaran I Puspo Kabupaten Pasuruan / Elok Dwi Isty Qomah
1017Penerapan metode field trip untuk meningkatkan kemampuan menulis karangan deskripsi pada siswa kelas V SDN Bukir Pasuruan / Catur Rahayu Kurniawati
1018Peningkatan hasil belajar matematika materi sudut melalui model course review horay kelas III SDN Kedungbanteng 3 Kabupaten Blitar / Wahyu Fildiansyah
1019Pengembangan bahan pembelajaran interaktif subtema Tumbuhan Sahabatku kelas III smester 2 di sekolah dasar / Kiki Paramudita Sari
1020Analisis kesalahan penulisan kalimat langsung dan tidak langsung pada tulisan siswa kelas IV SDN Bumiayu 4 Kota Malang / M. Irfan Mahrus
1021Peningkatan keterampilan bercerita siswa pada subtema Hebatnya Cita-citaku melalui media boneka tangan kelas IVB SD negeri Tamping Mojo Jombang / Reham Resti Anggraeni
1022Penerapan model pembelajaran kooperatif tipe stad untuk meningkatkan aktivitas dan hasil belajar pada pelajaran IPS kelas III SDN Pakijangan 01 Kecamatan Wonorejo Kabupaten Pasuruan / Maulia Indra Permata
1023Peningkatan hasil belajar IPS materi aktivitas ekonom,i melalui model make a match di kelas IV SDN II Aryojeding Kabupaten Tulungagung / Farraz Putri Febriani
1024Hubungan kebiasaan disiplin di sekolah dengan hasil belajar siswa kelas III SD se-Gugus 4 Kecamatan Blimbing Kota Malang / Indra Cahyani
1025Peningkatan hasil belajar IPS tentang Perjuangan Melawan Penjajah melalui model Jigsaw di kelas V SDN Pojok 02 Kabupaten Blitar / Dika Astika Anggraini
1026Meningkatkan hasil belajar matematika pada operasi hitung campuran melalui model Numbered Heads Together (NHT) di kelas IV SDN Bumirejo 01 Kabupaten Blitar / Wennes Fina Hartoyo
1027Peningkatan hasil belajar PKn melalui model pembelajaran Teams Games Tournament pada kelas IV SDN Salamrejo Kabupaten Blitar / Novrita Winda Priyanty
1028Analisis muatan karakter dalam buku siswa kelas I sekolah dasar tema Kegiatanku / Mujahidin Farid
1029Pendidikan kepramukaan sebagai pembentukkan karakter siswa kelas V SDN Ngletih 1 Kota Kediri / Wahyu Nur'aida
1030Penggunaan media komik untuk meningkatkan aktivitas dan hasil belajar siswa kelas V subtema Peninggalan-peninggalan Kerajaan Islam di Indonesia SDN Purwodadi 2 Kota Malang / Arif Ardian
1031Penigkatan keterampilan menulis narasi melalui model pembelajaran picture and picture pada siswa kelas IV SDN 01 Rejosari Kabupateng Tulungagung / Oknampia Putri Lestaritera
1032Peningkatan keterampilan menulis deskripsi melalui model example non example pada siswa kelas IVB SDN Kedungkandang 2 Kota Malang / Fitri Lidyawati
1033Penerapan model make a match untuk meningkatkan kemampuan melakukan pembagian pada siswa kelas III MI Miftahul Huda Gerongan Kraton Pasuruan / Robiatul Adawiyah
1034Penerapan model make A match untuk meningkatkan pembelajaran IPA kelas V SDN Pandanwangi 04 Malang / Dwi Retnowati
1035Penggunaan media Lollypop untuk meningkatkan pemahaman konsep perkalian pada siswa kelas III SDN Sekarpuro Pakis Malang / Zahratul Hayati
1036Penerapan model kooperatif tipe stad untuk meningkatkan prestasi belajar pecahan siswa kelas V SDN Pandanrejo 1 Kecamatan Wagir Kabupaten Malang / Sri Ramai
1037Meningkatkan pembelajaran IPA menggunakan pendekatan contextual teaching and learning siswa kelas VB SDN Madyapuro 4 Kecamatan Kedungkandang kota Malang / Paulina Karam
1038Penerapan model pembelajaran scramble untuk meningkatkan hasil belajar siswa kelas VA pada mata pelajaran PKn SDN Madyopuro 4 Kecamatan Kedungkandang kota Malang / Febri Belandina Lay
1039Pemanfaatan metode drill untuk meningkatkan apresiasi puisi pada siswa kelas IV c SDN Klojen kota Malang / Markus Marthen Djontar
1040Pengembangan permainan ular tangga raksasa untuk menstimulasi kemampuan kognitif anak usia 5-6 tahun di Kota Malang / Ayuni Thohirotunisa
1041Problematika pembelajaran menulis karangan pada kelas IV Sekolah Dasar di Gugus 2 Kecamatan Kedungkandang Kota Malang / Daniesta Cempaka Ayuningtyas
1042Penerapan model induktif kata bergambar untuk meningkatkan kemampuan siswa dalam menulis karangan deskripsi di kelas IV SDN Kauman II Kecamatan Klojen kota Malang / Moh. Ramli Daeng Parany
1043Penerapan permainan tradisional damparan untuk mengembangkan pemahaman lambang bilangan kelompok A di TK PKK Bandulan Malang / Desya Amalia Riandini
1044Penerapan pembelajaran kontekstual untuk meningkatkan kemampuan kognitif anak kelompok B TK Berdikari Kota Pasuruan / Luluk Fauziah
1045Penerapan model Team Game Tournament (TGT) untuk meningkatkan pembelajaran tematik siswa kelas VB SDN kedungkandang 2 Kecamatan Kedungkandang Kota Malang / Riisa Nisfi Laili
1046Peningkatan penguasaan kosakata sederhana melalui media wayang kardus pada anak kelompok B di TK Al-Ikhlas Kabupaten Lumajang / Diansa Sandy Pawukir
1047Peningkatan hasil belajar IPS materi teknologi produksi. komunikasi. dan transportasi melalui model mind mapping siswa kelas IV SDN Batuaji 1 Kabupaten Kediri / Chusnul Huda
1048Peningkatan kemampuan mengenal lambang bilangan 1-10 menggunakan media papan panah pada kelompok A di TK Hidayah Klampok Kota Blitar / Ika Yuliana
1049Implementasi pendidikan karakter melalui ekstrakurikuler pramuka di kelas V SDN Blimbing 3 Kota Malang / Robby Nor Camarul Mukarom
1050Penggunaan media gambar seri untuk meningkatkan kemampuan menulis karangan pada siswa kelas III SDN Mergosono II Malang / Sriyati
1051Pengembangan media pembelajaran katrol bilangan materi bilangan bulat Sekolah Dasar / Haris Wisudiatma
1052Pengembangan model permainan "Quick and Fun" pada pembelajaran menulis pantun untuk siswa kelas IV SDN Bedali 01 Kecamatan Lawang Kabupaten Malang / Rodiatul Fida
1053Peningkatan kemampuan motorik halus anak melalui kegiatan menganyam daun pisang pada kelompok b di TK Dharma Wanita Langenharjo Kecamatan Plemahan Kabupaten Kediri / Fadilatul Fitria
1054Penerapan metode role playing untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS kelas V SDN Wajak 01, Kabupaten Malang / Nuri Kurniawati
1055Penggunaan model webbed dalam pembelajaran terpadu untuk meningkatkan pemahaman berbagai kompetensi pada tema keluarga siswa kelas II SDN Gondowangi III Kecamatan Wagir Kabupaten Malang / Lilik Nurmawati
1056Penggunaan model kontekstual untuk meningkatkan pembelajaran IPA siswa kelas IV di SDN Jatisari IV Kecamatan Purwodadi Kabupaten Pasuruan / Firda Firdaus Arianto Putri
1057Pelaksanaan pembelajaran IPS dengan menggunakan pembelajaran kooperatif model problem solving yang dapat meningkatkan motivasi dan prestasi hasil belajar siswa kelas V SDN Lecari-Sukorejo-Pasuruan / Petrus Foudubun
1058Pemberian kesempatan representasi bebas siswa untuk meningkatkan kemampuan representasi soal cerita siswa kelas V SDN Kendalpayak / Lidya Tri Wijayanti
1059Penerapan model mind mapping untuk meningkatkan hasil belajar PKn siswa kelas IV SDN Kalipare 06 Kecamatan Kalipare Kabupaten Malang / Tri Indah Mariana
1060Penerapan model pembelajaran preview, question, read, reflecty, recite, review (PQ4R) pada pembelajaran _PKn untuk meningkatkan aktifitas dan hasil belajar siswa kelas III SDN Rangge Pasuruan / Novi Prabawanti
1061Problematika pembelajaran tematik terpadu bagi guru di SDN Sukabumi II Kota Probolinggo / Indra Suhamdani Ishaq
1062Penggunaan media gambar seri untuk meningkatkan kemampuan mengembangkan kerangka karangan menjadi paragraf bagi siswa kelas V MI Maarif Ngering Gempol Pasuruan / Ruri Rahayu
1063Penerapan skrip kooperatif untuk meningkatkan keaktivan dan hasil belajar dalam menyusun percakapan pada siswa kelas VI SDN Jimbaran II Kecamatan Puspo Kabupaten Pasuruan / Khafid
1064Penerapan model picture and picture (gambar seri) untuk meningkatkan keterampilan menulis karangan narasi siswa kelas IV SDN Karangrejo 02 Kecamatan Kromengan / Supriady
1065Penerapan metode simulasi untuk meningkatkan aktivitas belajar siswa pada mata pelajaran PKn di kelas IV MI Hubbul Wathon Pandaan Pasuruan / Ahmad Subhan
1066Penerapan model contextual teaching and learning (CTL) untuk meningkatkan pembelajaran IPS siswa kelas III E MIN Malang I / Mutik Atul Khoiriyah
1067Meningkatkan prestasi belajar IPS melalui media televisi pada siswa kelas V SDN Kraton 06 Kabupaten Magetan / Lesi Apriani
1068Penerapan pendekatan sains-teknologi-masyarakat untuk meningkatkan hasil belajar ilmu pengetahuan alam tentang hubungan kegiatan manusia dan ekosistem pada siswa kelas VI di SDN Ciptomulyo 2 / Sri Budyo Cahyono
1069Pengembangan media papan flanel animal story pada minat bercerita anak TK Kelompok B / Vidya Khansha
1070Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA pada siswa kelas IV SDN Sundil Kecamatan Praya Kabupaten Lombok Tengah / Muh. Syukri Ghazali
1071Penggunaan model clis untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Karangbesuki 4 kota malang / Femmy Ludrian Afrinda
1072Penerapan model pemerolehan konsep untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IV di SDN Purwodadi 1 Malang / Saeful Mizan
1073Penerapan metode inkuiri sosial pada pembelajaran IPS untuk meningkatkan aktivitas belajar, kemampuan berpikir dan hasil belajar siswa kelas VI SDN Manaruwi-I Bangil / Siti Khotimah
1074Penerapan media compact disk (CD) interaktif untuk meningkatkan pemahaman konsep luas segitiga pada siswa kelas IV SDN Landungsari I Dau Malang / Oktavia Verawati Fajerin
1075Pemanfaatan multimedia melalui model pembelajaran CLIS untuk meningkatkan hasil belajar sains pada siswa kelas V SDN Pakisaji 02 Malang / Novi Rusma Noverta Gandhi
1076Penerapan model discovery nelalui metode eksperimen dalam pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas IV SD Negeri Bareng 5 Kecamatan Klojen Kota Malang / Samsudin Rumateor
1077Penerapan model pembelajaran learning community tema lingkungan pada pembelajaran tematik guna meningkatkan hasil belajar siswa kelas III SDN Mulyoagung Kecamatan Dau Kabupaten Malang / Luluk Ika Wahyuni
1078Penerapan model pembelajaran concept attainment untuk meningkatkan hasil belajar siswa kelas IV pada mata pelajaran PKn di SDN Madyopuro 3 Kota Malang / Saloy Rosina Taliak
1079Penggunaan papan magnet untuk meningkatkan kemampuan menulis narasi siswa kelas V MI, Miftahul Ulum Kecicang Kabupaten Pasuruan / Syafiuddin Akbar
1080Penarapan pembelajaran problem solving untuk meningkatkan hasil belajar matematika sisw kelas III SDN Mergosono 3 Malang / Riadi
1081Penggunaan media komik untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV tema cita-citaku di SDN Gadungan 4 Kacamatan Puncu Kabupaten Kediri / Diah Ayu Widoresmi
1082Peningkatan keterampilan menulis puisi melalui media lingkungan sekolah bagi siswa kelas V SDN Jambepawon 02 Kecamatan Doko Kabupaten Blitar / Devi Nurvitasari
1083Peningkatan hasil belajar IPS melalui model Think Pair Share (TPS) pada siswa kelas IV SDN 1 Tambakrejo Kabupaten Tulungagung / Riski Oktavia Permana Putri
1084Penigkatan pemahaman sejarah uang melalui model pembelajaran mind mapping di kelas III semester 2 SDN Gaprang 01 Kabupaten Blitar / Luvia Indriani
1085Pengaruh pengaturan tempat duduk formasi U terhadap hasil belajar siswa kelas V SD Negeri 2 Surodakan Kabupaten Trenggalek / Meinar Khoirun Nisa
1086Penerapan pendekatan sains teknologi masyarakat untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Kebonsari 4 Kota Malang / Windra Septi Mulyanti
1087Peningkatan hasil belajar siswa melalui model pembelajaran kontekstual tentang jenis dan besar sudut kelas III MI Al Huda Kebonrejo Kecamatan Selopuro Kabupaten Blitar / Himatul Aliyah
1088Penerapan model pembelajaran langsung untuk meningkatkan hasil belajar bilangan romawi siswa kelas IV SDN Lesanpuro 1 kota Malang / Rahayu Iskandar
1089Peningkatan keterampilan menulis karangan narasi melalui media gambar seri pada siswa kelas IV SDN Sukolilo 01 Kecamatan Jabung di Kabupaten Malang / Lailatul Mukarromah
1090Peningkatan hasil belajar IPS melalui model pembelajaran kooperatif group investigation siswa kelas V SDN Gilang Kabupaten Tulungagung / Rahayuningtyas Handayani
1091Penggunaan media komik pada tema Sejarah Peradaban Indonesia untuk meningkatkan hasil belajar siswa kelas VA SDN Madyopuro 3 Kota Malang / Selvi Nur Lailiyah
1092Peningkatan keterampilan menulis narasi melalui model pembelajaran visualization, auditory, kinesthetic pada siswa kelas V dalam tema sejarah peradaban Indonesia di SDN Blimbing 1 Kota Malang / Ayu Vidya Rakhmawati
1093Pengembangan media pembelajaran CD interaktif tema Sejarah Peradaban Indonesia pada siswa kelas V semester 2 di SDN Madyopuro 4 Kota Malang / Nurul Khomariyati
1094Peningkatan hasil belajar siswa melalui model think pair share pada pemnbelajaran IPS kel;as V SDN 01 Rejosari Kabupaten Tulungagung / Okvia Hayuningtyas
1095Analisis kemampuan siswa dalam menemukan nilai-nilai moral pada bacaan bahasa Jawa kelas IV MIN Demangan Kota Madiun / Itsna Maulida Sa'adah
1096Peningkatan hasil belajar IPA materi Gaya melalui model discovery learning pada siswa kelas V SDN Sukorejo III Kota Blitar / Eva Veronika Sugiono
1097Implementasi pendekatan saintifik dalam pembelajaran pada kelompok B TK Kartika IX-41 Kota Malang / Ayu Dwi Jayanti
1098Peningkatan keterampilan menulis cerita pengalaman melalui model induktif kata bergambar di kelas IV SDN Tlogowaru 1 Malang / Ervia Roisatal Amaliah
1099Peningkatan keterampilan berbicara melalui media boneka tangan pada siswa kelas I SDN Kalitengah 03 Kecamatang Panggungrejo Kabupaten Blitar / Lusi Aminati
1100Peningkatan keterampilan menulis puisi melalui metode karya wisata pada pembelajaran bahasa Indonersia kelas V SDN Ngadirenggo IV Kabupaten Blitar / Agnes Prabaningrum
1101Peningkatan kemampuan kognitif berfikir logis melalui metode eksperimen pada anak kelompok B di PAUD Laboratorium UM Kota Blitar / Lilis Prasetia Rini
1102Penerapan model quantum writing untuk meningkatkan kemampuan menulis karangan deskripsi siswa kelas IVA SDN Martopuro 1 Kecamatan Purwosari Kabupaten Pasuruan / Mella Dwi Pengestu
1103Pengembangan perangkat pembelajaran berbasis proyek tema Indahnya Persahabatan di kelas III SD / Hikmatul Fitri
1104Pengembangan media pembelajaran permainan ular tangga pada pembelajaran matematika materi pecahan kelas 5 SD / Mochammad Sofyan Ali
1105Peningkatan kemampuan menulis puisi melalui model discovery learning pada kelas V di SDN Plosokerep 02 Kota Blitar / Ardina Dewi Sartika
1106Peningkatan keterampilan deklamasi puisi melalui metode demonstrasi pada siswa kelas 2 SD Negeri Pakisaji 2 Kabupaten Malang / Hendra Yulianto
1107Pengembangan media hamparan teratai dalam pembelajaran kognitif materi berhitung permulaan anak kelompok A di TK An-Nur Malang / Indraswari
1108Upaya meningkatkan kemampuan motorik kasar melalui gerak dan lagu pada anak kelompok A di TK Negeri Pembina 2 Malang / Siska Martarahayu
1109Pengembangan bahan ajar CD interaktif subtema Sahabat Satwa pada kelas III sekolah dasar / Minhah Mufidah
1110Pengembangan media pembelajaran diorama berputar berbasis kecerdasan visual spasial untuyk anak kelompok B / Rara Agista Olivantina
1111Pengembangan permainan suku kata tersembunyi dalam pembelajaran pengenalan membaca permulaan sesuai tingkat pencapaian perkembangan bahasa anak usia 5-6 tahun di Malang / Miftakhul Rokhmawati
1112Penerapan permainan kartu tersembunyi untuk meningkatkan kemampuan memahami konsep bilangan dan lambang bilangan pada anak TK A Dharma Wanita 03 Sonosari Malang / Dita Puspita Sari
1113Pengembangan permainan engklek angka berbasis kognitif pada anak TK kelompok A di Kecamatan Wagir Malang / Afifa Qirota A'yunin
1114Pengembangan permainan sirkuit "Colour Trick" pada pembelajaran fisik motorik untuk anak usia 4-5 tahun di Kota Malang / Tiara Mei Astuti
1115Peningkatan hasil belajar IPS melalui media monopoli pintar pada siswa kelas V SDN Plosokerep 02 KOta Blitar / Sebi Redian Prasetya
1116Peningkatan keterampilan menulis deskripsi melalui pemanfaatan media lingkungan sekolah kelas IV SDN Plumpungrejo 02 Kabupaten Blitar / Mar'atin Solikah
1117Pengalaman siswa kelas V dalam mengikuti pembelajaran dengan pendekatan saintifik di SDN Gugus 7 Kecamatan Blimbing Malang / Ria Suciniranti
1118Peningkatan kemampuan mengenal huruf melalui permainan mencari pasangan pada kelompok A PAUD Laboratorium UM Kota Blitar / Dian Novitasari
1119Pembelajaran sains pada anak usia dini kelompok A di PG dan TK Laboratorium UM Malang / Desi Ranita Sari
1120Kesulitan guru sekolah dasar dalam penerapan penilaian autentik di Sekolah Dasar Negeri Purwodadi IV Kota Malang / Erlin Nafita Rizki
1121Problematika pembelajaran tematik terpadu di kelas IV SDN Dinoyo 01 Kecamatan Lowokwaru Kota Malang / Alif Via Pradana
1122Persepsi guru Sekolah Dasar Negeri pada penilaian potofolio kurikulum 2013 se-Gugus II Kecamatan Blimbing Kota Malang / Pratiwi Wahyuningtyas
1123Peningkatan keterampilan menulis karangan narasi melalui model pembelajaran concept sentence pada siswa kelas IV SDN Gilang Kabupaten Tulungagung / Dhika Tri Rizkanata
1124Meningkatkan kemampuan memahami isi bacaan dengan strategi belajar PQ4R pada siswa kelas VI SDN Kalrejo II kec. Sukerejo / Siti Zulaikhah
1125Analisis unsur-unsur intrinsik dalam karangan narasi siswa kelas IV SDN Rampal Celaket I Kota Malang / Dwi Yulianti
1126Meningkatkan hasil belajar matematika pada siswa kelas VI dalam pengerjaan hitung campuran melalui model kooperatif tipe jigsaw di SDN 1 Sedayugunung Tulungagung / Yiyin Anggarini
1127Penerapan metode eksperimen pencampuran warna untuk meningkatkan kognitif pada kelompok A TK PGRI 1 Pecalukan Prigen Pasuruan / Istikomah
1128Pengembangan permainan sirkuit geometri fun pada pembelajaran fisik motorik kasar kelompok B / Ratri Kartikasari
1129Pengembangan media monopoli edukatif di kelas IV sekolah dasar / Zaky Ghufron
1130Penerapan gerak dan lagu untuk meningkatkan kecerdasan kinestetik pada kelompok B di TK Dharma Wanita Plosokidul Kabupaten Kediri / Putri Kurnia
1131Pemanfaatan media boneka tangan untuk meningkatkan keterampilan bercerita pada siswa kelas III SD Negeri Pakisaji 2 Kabupaten Malang / Vidia Septidear
1132Penerapan model pembelajaran STAD untuk meningkatkan aktivitas dan hasil belajar IPA pada siswa kelas V SDN Pagak 04 Kabupaten Malang / Rizky Ulla Eka Destiana
1133Pengembangan alat permainan keranjang pintar dalam pembelajaran berbicara anak kelompok BV di Taman Kanak-Kanak / Mega Fitria Herdiati
1134Peningkatan pemahaman isi cerpen melalui kegiatan membaca cepat pada siswa kelas IV SDN Pandanwangi 04 Kota Malang / Erick Muzaqi
1135Penerapan strategi pemecahan masalah heuristik II untuk meningkatkan balajar hitung penjumlahan di kelas I SD / Neni Lita Herminati
1136Pengembangan kemampuan motorik kasar melalui permainan balap mobil mencari bola pada anak kelompok B di TK Permata Bunda Sawojajar Malang / Annisa Mawaddah Mutiara Sari
1137Pemanfaatan bentuk geometri ceria dalam meningkatkan kecerdasan matematis pada Kelompok B TK PKK Setya Putra Bokor Tumpang / Ulfa Khutamul Laili
1138Penerapan metode eksperimen untuk meningkatkan prestasi belajar IPA pada siswa kelas V SDN Bareng 4 Kecamatan Klojen Kota Malang tahun pelajaran 2009/2010 / Rahayu Hendaruti
1139Penerapan model bermain peran untuk meningkatkan aktivitas dan hasil belajar IPS materi Kegiatan Jual Beli kelas III di SDN Mulyoagung 02 Dau Kabupaten Malang / Riza Alifiyah Rahmawati
1140Penerapan pendekatan whole language dengan media buku harian untuk meningkatkan kemampuan menulis karangan sederhana pada siswa kelas III C SDN Dupak V Surabaya / Indaryani
1141Penerapan pembelajaran kooperatif model tgt (team game tournament) untuk meningkatkan hasil belajar matematika siswa kelas V SDN Kauman 3 kecamatan kepanjen kidul kota Blitar / Wiji Wijayanti
1142Peningkatan kemampuan motorik halus melalui kegiatan bermain 3M (mewarna, menggunting, dan menempel) kelopmpok A di RA Muslimat NU 24 Malang / Yulistia Susanti
1143Pemanfaatan lingkungan sekitar sebagai media pembelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas III SDN Wonorejo 02 Madiun / Wahyu Trisnaning Dewi
1144Penerapan model pembelajaran deep dialpgue critical thinking untuk meningkatkan hasil belajar PKn dan keaktifan siswa kelas IV SDN Randumerak Probolinggo / Fitka Nuria Dewanti
1145Penerapan pembelajaran tematik untuk meningkatkan hasil belajar pengukuran berat siswa kelas III SDN Gondowangi 01 Kecamatan Wagir / Endang Rusnanik
1146Penerapan metode simulasi untuk meningkatkan hasil belajar siswa kelas V dalam pembelajaran PKn di SDI Al-Yasini Ngabar Kraton Pasuruan / Miftahurrohmah
1147Penggunaan media kartu bilangan untuk meningkatkan kemampuan menentukan kelipatan suatu bilangan kelas IV SDN Satriyan 03 Kanigoro Blitar / Wahyu Tri Setiani
1148Pengerjaan soal cerita lima langkah untuk meningkatkan hasil belajar penjumlahan dan pengurangan pecahan siswa kelas V SDN Sumberkembar 02 Blitar / Erik Dwi Widowati
1149Penggunaan hyperlink pada mind mapping untuk meningkatkan proses dan hasil belajar IPS kelas V di SD Negeri Karang Besuki 1 Kecamatan Sukun kota malang / Praharisti Kurniasari
1150Penerapan model pembelajaran make a match untuk meningkatkan hasil belajar PKn siswa kelas III SDN Bareng 5 Kota Malang / Rita Dwi Anggraini
1151Penerapan model pembelajaran kooperatif talking stick untuk meningkatkan hasil belajar PKn siswa kelas 3 SDN Tanjungrejo 5 Malang / B. Shinta Marga Astarina
1152Penerapan metode bermain peran untuk meningkatkan kemampuan berbicara pada siswa kelas V di SDN Bandulan 5 Malang / Arni Gemilang Harsanti
1153Penerapan model pembelajaran stad untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn di kelas V SDN Pungging Kecamatan tutur Kabupaten Pasuruan / Ani Suprini
1154Penerapan collaborative learning melalui permainan mencari gambar untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Cepokomulyo 2 Kepanjen / Rahmawati
1155Meningkatkan hasil belajar PKn melalui pendekatan paikem pada siswa kelas IV di SDN Karangsari 1 Kota Blitar / Rohmi Zunaida
1156Penerapan model pembelajaran the power of two untuk meningkatkan aktivitas dan hasil belajar IPS pada siswa kelas IVA SDN 1 Moyoketen Kabupaten Tulungagung / Septin Dwi Elianasari
1157Metode pembelajaran image streaming untuk meningkatkan kemampuan mengarang bahasa Indonesia pada siswa kelas V SDN Tulus Rejo 2 MAlang / Mochammad Hedi Prasetyo
1158Penerapan model pembelajaran guided note talking (GNT) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Bareng 3 Malang / Arini Ilma
1159Meningkatkan hasil belajar melalui inquiring mind whats to know dalam pembelajaran IPS pada kelas V SDN Kepanjenlor 02 kota Blitar / Faizal Mahmud
1160Penerapan teknik pembelajaran mind map untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Pisang Candi 3 kota Malang / Yuli Tulistiyani
1161Penerapan model peta konsep untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Pandanwangi 04 Kecamatan Blimbing kota Malang / Dhian Dwi Nur Wenda
1162Meningkatkan hasil belajar PKn melalui metode simulasi sosial pada siswa kelas V SDN Turi 1 kota Blitar / Devi Dwi Wulandari
1163Penerapan bermain label untuk meningkatkan kemampuan membaca awal anak kelompok A di TKN Pembina 3 Malang / Chicha Henny Damayanthi
1164Penerapan model pembelajaran sains teknologi masyarakat untuk meningkatkan pembelajaran IPA siswa kelas V di SDN Bumiayu 3 Kecamatan Kedungkandang kota Malang / Eva Chandra Qodarsih
1165Penerapan model pembelajaran problem based learning untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS kelas IV B di SDN Bareng 1 Kecamatan Klojen kota Malang / Arif Budi Saputra
1166Implementasi model peta konsep (Concept Mapping) untuk meningkatkan aktivitas dan hasil belajar siswa kelas III pada pembelajaran PKn di SDN Pandanwangi 4 kota Malang / Diana Saridewi
1167Penerapan pembelajaran kooperatif model two stay two stray untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV di SDN Bareng 5 Malang / Rica Indriani
1168Penerapan model group investigation untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Jabung 1 Kab. Malang / Dwi Setyo Muji Lestari
1169Penerapan model pembelajaran Problem Based Learning (PBL) untuk meningkatkan aktivitas dan hasil belajar subtema keunikan daerah tempat tinggalku pada siswa kelas IVa SDN Mergosono 1 Kedungkandang Malang / Achmad Shidiq Ichwan
1170Penerapan model sinektik untuk meningkatkan aktivitas dan hasil belajar siswa dalam pembelajaran IPS kelas V SDN Ketawanggede 2 Malang / Suhartini
1171Penerapan model cooperative integrated reading and composition untuk meningkatkan kemampuan membaca pemahaman pada siswa kelas V SDN BAndungrejosari 1 Malang / Dewi Fensiska Mardiah
1172Pemanfaatan surat kabar sebagai media media pembelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV di SDN Pandanwangi 4 Malang / Agus Irawan
1173Penggunaan permainan tebak misteri untuk meningkatkan kemampuan menulis deskripsi siswa kelas III SDN Bareng 3 Malang / Lailaturrohmatin
1174Penerapan model learning cycle untuk meningkatkan pembelajaran IPA kelas IV SDN Jatimulyo 01 Malang / Hariza
1175Penerapan model pembelajaran team games tournament (TGT) untuk meningkatkan hasil belajar siswa kelas IV pada pembelajaran IPS di SDN Jatimulyo 1 Kecamatan Lowokwaru Kota Malang / Dwi Mariza Mustikasari
1176Penerapan pembelajaran berprogram untuk meningkatkan hasil belajar pendidikan kewarganegaraan pada siswa kelas IV SDN Karangtengah 1 kota Blitar / Dewi Sanianti
1177Penerapan model POE (Predict. Observe, explain) untuk meningkatkan pembelajaran IPA siswa kelas III SDN Karangbesuki 4 Malang / Setyaningtyas Wahyu Nugraheni
1178Pemanfaatan media animasi audio visual untuk meningkatkan keterampilan menyimak cerita anak pada siswa kelas V SDN Bareng 4 Malang / Lina Rohma Yunita
1179Penerapan strategi direct reading thinking activities (DRTA) untuk meningkatkan kemampuan membaca pemahaman dalam pembeljaran bahasa Indonesia siswa kelas V SDN Kasin Malang / Yuni Sulistiyowati
1180Upaya meningkatkan pembelajaran IPA melalui model somatic auditory visualization intellectualy pada siswa kelas V SDN Sumberagung I Kecamatan Plosoklaten / Amalia Rohmatu Mafida
1181Pendekatan pemecahan masalah untuk meningkatkan kemampuan operasi hitung campuran pada siswa kelas V SD / Sri Hartatik
1182Penerapan media kartu gambar untuk meningkatkan kemampuan bercerita pada siswa kelas II SDN Bandungrejosari 1 Kecamatan Sukun Kota Malang / Abdul Rosyid
1183Penggunaan saringan eratosthenes untuk meningkatkan hasil belajar bilangan prima di kelas IV SDN Bareng V Kota Malang / Tutik Hariati
1184Penggunaan pembelajaran pemecahan masalah yang berorientasi pada Polya untuk meningkatkan prestasi belajar matematika pokok bahasan FPB siswa kelas IV SDN Ngeni 06 Kabupaten Blitar / Triya Manika Putra
1185Penerapan model sains teknologi masyarakat (STM) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Tanjungrejo 2 Malang / Dita Ayu Putri Permatasari
1186Implementasi model LRD (Listen-Read-Discuss) untuk meningkatkan keterampilan berbicara dalam pelajaran bahasa Indonesia siswa kelas IV SDN Sumbersari 2 Malang / Yusni Dian Rakhmawati
1187Penerapan pendekatan sains teknologi masyarakat untuk meningkatkan hasil belajar IPA siswa kelas III SDN Gondangwetan II Kabupaten Pasuruan / Risna Wirawan
1188penggunaan media abakus (dekak-dekak) untuk meningkatkan kemampuan "menyelesaikan soal pengurangan dua bilangan dengan meminjam" pada siswa kelas 2 SDI Nurul Izzah Kota Malang / Dewi Kinanti Puspasari
1189Penerapan model pembelajaran deep dialog untuk meningkatkan hasil belajar PKn bagi siswa kelas V SDN Turi 01 Kota Blitar / Muin Sinamona
1190Penerapan model eksperimen untuk meningkatkan pembelajaran IPA siswa kelas V SDN Randuagung 02 / Sarini
1191Penerapan model pembelajaran kooperatif Jigsaw untuk meningkatkan hasil belajar PKn bagi siswa kelas III SDN Turi 1 Kota Blitar / Kristian S Labobar
1192Peningkatan keterampilan menulis melalui menulis deskripsi di kelas IV SDN Kotes 01 Kabupaten Blitar / Neni Ermawati
1193Penerapan pembelajaran tematik untuk meningkatkan hasil belajar calistung siswa kelas 1 MI Abdussalam berkacak kolursari Kecamatan Bangil Kabupaten Pasuruan / Siti Muawanah
1194Penggunaan media batang cuisenaire untuk meningkatkan hasil belajar konsep penjumlahan pecahan siswa kelas IV SD Negeri Oro-oro Dowo Kota Malang / Rima Ernawati
1195Pemanfaatan majalah dinding untuk meningkatkan kemampuan menulis karangan deskripsi pada siswa kelas IV di SDN Bareng 4 Kecamatan Klojen Kota Malang / Nury Yuniasih
1196Meningkatkan kemampuan memecahkan masalah melalui model Polya pada materi pecahan siswa kelas IV SDN Pisang Cansi 3 Kota Malang / Dwi Sudarsih
1197Pemanfaatan media televisi untuk meningkatkan keterampilan berbicara pada siswa kelas VA SDN Bareng 1 Kota Malang / Rizka Riana
1198Penggunaan media alphabet card untuk meningkatkan aktivitas belajar membaca siswa kelas I di SDN Arjosari 01 Kecamatan Kalipare Kabupaten Malang / Anelia Yuniandari
1199Penerapan pendekatan komunikatif dalam pembelajaran bahasa Indonesia untuk meningkatkan keterampilan berbicara pada siswa kelas III SDN Pisangcandi 2 Malang / Nur Zubaidah
1200Pemanfaatan obyek-obyek konkrit untuk meningkatkan kemampuan menulis puisi bagi siswa kelas V SDN Jodipan Kecamatan Blimbing Kota Malang / Santi Sari
1201Penerapan media piramida cerita untuk meningkatkan kemampuan menulis siswa kelas IV SDN Pagentan 05 Singosari / Frosriana Wahyu Wilujeng
1202Peningkatan hasil belajar IPS materi Koperasi melalui model two stay-two stray pada siswa kelas IV SDN I Karanganom Kabupaten Tulungagung / Desy Natalia Shandy
1203Penerapan model STAD untuk meningkatkan aktivitas siswa pada Tema 4 Subtema 1 Pembelajaran 2 di kelas II SDN Mojolangu 1 Malang / Iis Afriani
1204Peningkatan keterampilan menulis deskripsi dengan model cooperative script pada siswa kelas IV SDN I Pakel; Kabupaten Tulungagung / Aziz Ichwan Rosadi
1205Penerapan model pembelajaran debate untuk meningkatkan hasil belajar siswa kelas V SDN Gejugjati II Kecamatan Lekok. Kabupaten Pasuruan pada mata pelajaran PKn / Paris Massa
1206Penggunaan media kartu kata untuk meningkatkan keterampilan membaca permulaan siswa kelas I di SDN Senggreng 01 Kecamatan Sumberpucung Kabupaten Malang / Nadia Joan Rahmadhani
1207Meningkatkan kemampuan menyelesaikan masalah pecahan melalui langkah-langkah Polya di kelas IV SDN Plinggisan Pasuruan / Desi Tri Handayani
1208Peningkatan kecerdasan interpersonal melalui permainan tukar kartu pada anak usia 3-4 tahun di PAUD Laboratorium UM Kota Blitar / Fitriani
1209Peningkatan hasil belajar IPS materi Koperasi melalui media ular tangga pada siswa kelas IV SDN Binangun 01 Kabupaten Blitar / Luky Andriya Ningsih
1210Pengembangan e-modul berbasis adobe flash CS6 padamata pelajaran Penataan Barang Dagang (studi pada siswa kelas XI Pemasaran di SMKN 1 Boyolangu Tulungagung) / Indah Zahrotul Fauziah
1211Pembelajaran PPKn pokok bahasan keyakinan dengan
menggunakan media permainan ular tangga siswa kelas III SDN
Tanjungrejo VI / oleh Heri Susanto
1212Penerapan model inkuiri untuk meningkatkan pemahaman konsep pengaruh perubahan lingkungan fisik terhadap daratan pada siswa kelas IV SDN Bumiayu 3 Malang / Indah Siatin
1213Penerapan model Coorporative Integrated, Reading, and Composition (CIRC) untuk meningkatkan pembelajaran tematik siswa kelas IV SDN Lesanpuro 01 Malang / Deni Kurniawan
1214Problematika dalam mengolah bahan pustaka di perpustakaan sekolah tingkat SDN Kota Malang / Choirul Wakhidatun Nisa
1215Penerapan model quantum writing untuk meningkatkan keterampilan menulis narasi pada pembelajaran Bahasa Indonesia siswa kelas IV SDN Slamet 01 Kecamatan Tumpang Kabupaten Malang / D. Ramos
1216Penerapan picture and picture untuk meningkatkan aktivitas dan hasil pembelajaran ekosistem subtema komponen ekosistem pada siswa kelas V SDN Lesanpuro 1 kota Malang / Agus Maulana
1217Pengembangan permainan sirkuit warna-warni ceria menggunakan bahan-bahan bekas pada pembelajaran fisik motorik anak di TK Senaputra Malang / Rikza Azharona Susanti
1218Peningkatan keterampilan menyimak dongeng melalui penggunaan boneka jari siswa kelasa II SDN Slamet 01 Kecamatan Tumpang Kabupaten Malang / Antiora
1219Meningkatkan hasil perkalian bilangan cacah dengan media kantung bilangan di kelas IV SDN Puspo IV Kecamatan Puspo / Na'imah
1220Peningkatan hasil belajar IPS melalui model discovery learning pada siswa kelas IV SDN Gadungan 05 Kabupaten Blitar / Nurfiana Dewi
1221Implementasi model CLIS (Children Learning in Science) untuk meningkatkan pembelajaran IPA siswa kelas V SDN dukuh II Kecamatan Ngadiluwih Kabupaten Kediri / Mifta A. Yunita E.A.
1222Peningkatan hasil belajar IPS tentang aktivitas ekonomi melalui model mind mapping di kjelas IV SDN 2 Pelem Kabupaten Tulungagung / Arista Wijayanti
1223Peningkatan hasil belajar siswa melalui model pembelajaran problem based learning di kelas IV SD Negeri Buring Kota Malang / Hengki Hidayat
1224Penerapan model jigsaw untuk meningkatkan aktivitas dan hasil belajar siswa melalui tema 2 peristiwa dalam kehidupan subtema 1 macam-macam peristiwa dalam kehidupan kelas V SDN Cemorokandang 02, Kecamatan Kedungkandang, Kota Malang / Herry Cristhenson
1225Peningkatan hasil belajar tentang koperasi melalui model make a match di kelas IV SDN Pandean Kabupaten Trenggalek / Ivan Astontiatama
1226Penerapan model pembelajaran Contextual Teaching and Learning (CTL) untuyk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn kelas III Wignya Mandala Kecamatan Tumpang Kab. Malang / Doni
1227Penerapan model pembelajaran assure pada mata pelajaran IPS untuk meningkatkan aktivitas dan hasil belakar siswa kelas V SD Negeri Sukoharjo 2 Kota Malang / Muhammad Amin Yusuf
1228Meningkatkan keterampilan menyimak mellui media rekaman tayangan berita pada siswa kelas V SDN 1 Sobo Kabupaten Trenggalek / Yudista Patriat Budi
1229Penerapan pendekatan modelling untuk meningkatkan kemampuan membacakan puisi siswa kelas V SDN Sambitan 02 Pakel Tulungagung / Ida Marlina Sanyoto
1230Peningkatan kemampuan berbahasa melalui media buku cerita bergambar seri anak kelompok B TK Lukmanul Hakim Kademangan Blitar / Li'ayatul Nehayah
1231Upaya meningkatkan pembelajaran IPA menggunakan model problem based instruction (PBI) siswa kelas IV SDN Madyopuro V Kecamatan Kedungkandang kota Malang / Lisa Sedubun
1232Penerapan model pembelajaran clis untuk meningkatkan kualitas pembelajaran dan hasil belajar IPA siswa kelas III SDN Pisangcandi II malang / Akbar Tanjung M. D. A.
1233Penerapan model round club untuk meningkatkan aktivitas dan hasil belajar PKn pada siswa kelas IV SDN Madyopuro 4 Kecamatan Kedungkandang Kota Malang / Agustina Oratmangun
1234Identifikasi penggunaan media pembelajaran pada kelas IV semester genap di SDN Sawojajar 1 Kecamatan Kedungkandang Kota Malang / Moris
1235Peningkatan keterampilan menulis narasi melalui pendekatan keterampilan proses pada siswa kelas III SDN Tlogowaru 1 Kecamatan Kedungkandang Kota Malang / Wahyu Purbiantari
1236Peningkatan kemampuan membaca permulaan melaqlui media flanelgraft pada kelompok B di TK Muslimat Nu 11 Gadang / Wiwik Rahmawati
1237Peningkatan hasil belajar siswa melalui model pembelajaran mind mapping pada mata pembelajaran PKn kelas III SDN Kunir 01 Kabupaten Blitar / Heny Anas Ubaidi
1238Penerapan model pembelajaran ADDIE untuk meningkatkan hasil belajar siswa kelas VA mata pelajaran IPS SDN Madyopuro 1 Kecamatan Kedungkandang Kota Malang / Rika Sonya Malagwar
1239Pengembangan bahan pembelajaran berbasis TIK untuk pembelajaran nilai karakter siswa kelas III SDN Panggungrejo 4 Kepanjen / Ita Mar'atus Febriana
1240Peningkatan kemampuan mengenal lambang bilangan 1-10 melalui permainan puzzle jam anak kelompok A di TK al-Hidayah Cabean Kota Blitar / Anisya Tivna
1241Peningkatan kemampuan mengenal lambang bilangan 1-10 melalui media batu berwarna pada kelompok A di RA Harapan Bangsa Kota Blitar / Ilma Nafiatul Mahmudah
1242Penerapan permainan kantong Doraemon dalam pembelajaran fisik motorik pada kelompok A usia 4-5 tahun di TK Dharma Wanita Gedeg Kabupaten Mojokerto / Putri Ayu Oktavianti
1243Kesesuaian implementasi pendidikan karakter dengan tujuan pendidikan nasional di Sekolah Dasar Islam Terpadu Insan Permata Kelurahan Tunggulwulung Kota Malang / Hanafi
1244Peningkatan kreativitas anak usia dini dengan permainan lego untuk kelompok B TK Permata Bunda Sawojajar Malang / Bagus Candra Perdana
1245Analisis kesalaha EYD pada karangan narasi siswa kelas IV SD Negeri segugus I Kecamatan Lowokwaru Kota Malang / Khairu Ummah Mulya Dwi Putri
1246Peningkatan hasil belajar matematika materi bangun ruang melalui model Student Teams Achievment Divisions (STAD) kelas IV SDN Pojok 02 Kabupaten Blitar / Qusnul Cahyati Aisyah
1247Pengembangan media gambar seri cerdas pada pembelajaran berbahasa anak usia 5-6 tahun / Ulumiyah
1248Pengembangan permainan colour stick geometri dalam pembelajaran kognitif anak TK kelompok B / Yulinda Paripurnanti
1249Peningkatan kemampuan berbasa Inggris dasar melalui kegiatan talking stick kelompok B TK Laboratorium Universitas Negeri Malang (Lab UM) / Alviona Hermayanti
1250Penerapan pendekatan keterampilan proses untuk meningkatkan pembelajaran IPA di kelas V SDN Madyopuro 3 Kota Malang / Syamsia Siwa Siwan
1251Peningkatan kemampuan menyimak siswa melalui permainan pesan berantai dalam pembelajaran bahasa Indonesia di kelas IV SDK Wignya Mandala Kecamatan Tumpang Kabupaten Malang / Jesly
1252Pengembangan permainan eat ball untuk mengembangkan kemampuan berhitung anak usia 4-5 tahun / Meita Devi Pangestika
1253Peningkatan hasil belajar persegi dan persegi panjang melalui model inkuiri pada siswa kelas III di SDN Tanen Rejotangan Tulungagung / Anna Devi Nur Azizah
1254Peningkatan hasil belajar bilangan Romawi melalui model team quiz pada siswa kelas IV SDN Babadan 04 Kecamatan Wlingi Kabupaten Blitar / Wasi'atul Islamiyah
1255Penerapan model pembelajaran problem solving untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas III SDN Lesanpuro I Kecamatan Kedungkandang Kota Malang / Jamina Limau
1256Penerapan model pengajaran langsung setting berkelompok untuk meningkatkan hasil belajar keliling dan persegi panjang siswa kelas IIIb SDN Lesanpuro 3 Malang / Berlinda Ngoranmele
1257Penerapan model discovery learning pada pembelajaran organ tubuh manusia dan hewan kelas VA SDN Karantengah 1 Blitar / Mustika Perdana Putri
1258Penggunaan media Ritatoon untuk meningkatkan aktivitas dan hasil belajar Pkn materi pokok ke[utusan bersaama siswa kelas VB SDN Lesanpuro 3 Malang / Anis Raudhatul Maghfiroh
1259Penerapan model pembelajaran role playing untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV dengan pokok bahasan sistem pemerintahan pusat di SDN Kiduldalem 1 Kota Malang / Zet Sirloy
1260Analisis kesesuaian isi buku siswa kelas III SD tema 8 bumi dan alam semesta dengan esensi kurikulum 2013 / Fufa Masruro
1261Pemanfaatan metode pembelajaran role playing untuk meningkatkanj aktivitas dan hasil belajar IPS siswa kelas 5 SDN Kemirisewu 2 Kecamatan Pandaan Kabupaten Pasuruan / Sandhi Sirna Prahara
1262Analisis keterpaduan muatan buku tematik terpadu untuk siswa kelas IV semester 2 tema Pahlawanku / Danas Budhi Arto
1263Peningkatan prestasi belajar matematika pada materi pecahan melalui model team assisted individualization di kelas VC SDN Sentul 2 Kota Blitar / Eviq Reni Melinda
1264Pengembangan permainan bowling angka dalam pembelajaran kognitif mengenal konsep bilangan 1-10 pada anak Kelompok A di Tk Tunas Bangsa Jombang / Palupi Galih Sesuleh
1265Penggunaan media gambar untuk meningkatkan pemahahaman konsep perkalian siswa kelas II SDN Gondowangi 02 Kecamatan Wagir / Renti Yoika Novarera
1266Peningkatan keterampilan menceritakan peristiwa yang dilihat melalui pemutaran video pada siswa kelas III di SDN Karangrejo 4 Kabupaten Blitar / Eka Saputri Pramik Agusningtyas
1267Penerapan permainan bilangan untuk meningkatkan pemahaman konsep perkalian kelas II SDN Jedong 02 Kecamatan Wagir / Andi Pratiwi
1268Meningkatkan kemampuan bercerita dengan menerapkan teknik senam otak (brain gym) pada mata pelajaran bahasa indonesia kelas III SDN Sumberingin 3 Kabupaten Trenggalek / Ratna Arumsari
1269Penerapan teknik permainan bahasa crossword untuk meningkatkan keterampilan menulis puisi di kelas IV SDN Madyopuro 5 Kecamatan Kedungkandang kota Malang / Tina Wamona
1270Hubungan tentang intensitas pendampingan belajar dari orang tua dengan prestasi belajarnya kelas IV di SDN se-gugus I Desa Depok Kecamatan Panggul Trenggalek / Herwin
1271Peningkatan kemampuan kognitif melalui kegiatan eksplorasi pada anak Kelompok A di TK Kartika IX-41 Malang / Dine Damayanti
1272Pengembangan strategi pembelajaran fonik dalam peningkatan berbicara anak Kelompok A di TK Tunas Harapan Kota Probolonggo / Dea Rahmania
1273Peningkatan aktivitas dan hasil belajar siswa tema Indahnya Negeriku melalui problem based learning pada siswa kelas IV SDN Senggreng 04 Kecamatan Sumberpucung Kabupaten Malang / Marina Filayanti
1274Penerapan strategi Graphic Organizer (GO) untuk meningkatkan kemampuan menulis karangan siswa kelas IV SDN Purwantoro 2 Malang / Faizatul May Mahmudah
1275Penerapan model pembelajaran talking stick untuk meningkatkan aktivitas belajar IPS siswa kelas IV SDN Sidorejo 01 Kecamatan Doko Kabupaten Blitar / Rifi Astuti Widyaningrum
1276Penerapan model complete setence berbasis gambar untuk meningkatkan kemampuan mendeskripsikan benda siswa kelas II SDN Karang Besuki 01 kota Malang / Yuliawati Ma'sum
1277Penerapan model think pair share untuk meningkatkan pembelajaran IPA siswa kelas V SN Lesanpuro I Kecamatan Kedungkandang Kota Malang / Nur Ulfa
1278Peningkatan kemampuan motorik kasar melalui permainan "The Big Ant" pada anak kelompok A TK PGRI 02 Sutojayan Kabupaten Malang / Dwi Anggraeny Puspita Sari
1279Penerapan model power teaching dan cooperative script untuk meningkatkan keterampilan menulis bahasa Indonesia dalam meringkas isi wacana cerita kelas V SDN Ketawanggede I Kota Malang / Mertha Tyananda Putri
1280Upaya meningkatkan kemampuan bahasa melalui metode bermain menggunakan truk pintar pda anak kelompok B di TK Dharma Wanita Persatuan VII Tenggilisrejo Winongan Pasuruan / Watini
1281Pemanfaatan media audi visual power point sound slide dalam pembelajaran materi globalisasi untuk meningkatkan motivasi dan hasil belajar PKn siswa kelas IV SDN Sawojajar 4 Malang / Dwigita Eva Noviarizky
1282Penerapan pendekatan ilmu teknologi masyarakat (ITM) untuk meningkatkan aktivitas dan hasil belajar siswa pada IPS kelas IV SDN Klojen Kota Malang / Aminadap Djetul
1283Penggunaan media ular tangga untuk meningkatkan pemahaman dan aplikasi konsep norma kehidupan pada siswa kelas III SDN Jetis II Nganjuk / Suparmiati
1284Peningkatan hasil belajar IPS melalui model pembelajaran think pair share pada kelas III SDN Blimbing 01 Kabupaten Tulungagung / Any Sa'ada Kamila
1285Penerapan model cooperative script untuk meningkatkan kemampuan menjelaskan isi bacaan pada siswa kelas III di SDN Bareng 4 Kota Malang / Dyah Retno Hartati
1286Penerapan model pembelajaran elaborasi untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran PKn SDN Madyopuro II Kecamatan Kedungkandang Kota Malang / Usia Faifet
1287Penerapan pembelajaran konstruktivistik untuk meningkatkan penguasaan menyelesaikan soal-soal kontekstual bangun datar siswa kelas V Sekolah Dasar Negeri Gadang I Kota Malang tahun pelajaran 2007-2008 / Alfan Andri Chrisdianto
1288Penerapan pendekatan kontekstual untuk meningkatkan keterampilan berbicara dan hasil belajar bahasa Indonesia pada siswa kjelas V SDN Jugo 02 tahun pelajaran 2010-2011 / Agus Devid Elfaidin
1289Penerapan metode penemuan terbimbing melalui pemberian bantuan (scaffolding) untuk meningkatkan pemahaman siswa kelas V SD dalam mata pelajaran matematika / Ika Rahmawati
1290Pengembangan media kotak misteri pada pembelajaran tematik subtema manusia dan lingkungan kelas 5 SD Kota Malang / Rara Yuliantika Arrochmah
1291Pengembangan media Bola Badut dalam pembelajaran kognitif anak kelompok A TK PKK Bandulan Malang / Novita Oktaviana
1292Penggunaan teori belajar Van Hielle untuk meningkatkan hasil belajar siswa tentang geometri di kelas 3 SDN Lesanpuro 2 Kota Malang / Agus Supriyono
1293Penerapan model learning cycle untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas VI di SD Islam Nurul Izzah Malang / Etik Wunarwulan
1294Implementasi penilaian autentik dalam pelaksanaan pembelajaran tematik kelas IV kurikulum 2013 di SDN Tumpang 1 Kecamatan Tumpang Kabupaten Malang / Dian Pratiwi
1295Peningkatan kemampuan menemukan kalimat utama dalam paragraf melalui model cooperative integrated, reading and composition di kelas IV SDN Pojok 02 Kabupaten Blitar / Evy Inka Tresyasari
1296Penerapan model pembelajaran kooperatif tipe STAD untuk meningkatkan aktivitas dan hasil belajar siswa pada tema 7 cita-citaku di kelas IV SDN Gadungan 04 Kecamatan Puncu Kabupaten Kediri / Kristin Dwi Oktavia
1297Penerapan metode mind mapping untuk meningkatkan keterampilan menulis narasi siswa kelas V SDN Purwantoro 02 Malang / Bayu Dwi Septiawan
1298Hubungan antara penghasilan orang tua dengan hasil belajar siswa SDN Madyopuro 5 Kecamatan Kedungkandang Kota Malang / Marselius Yerkohok
1299Pemanfaatan media mading untuk meningkatkan keterampilan menulis puisi pada siswa kelas V SDN Sawojajar 4 Kota Malang / Intan Puspita Sari
1300Penerapan pendekatan CTL untuk meningkatkan aktivitas dan hasil belajar IPS pada siswa kelas II SDIT Mutiara Hati Kota Malang / Erlia Burul Fatmawati
1301Meningkatkan hasil belajar IPS dengan memanfaatkan media peta di kelas IV SD Negeri Gununggangsir III Kecamatan Beji Kabupaten Pasuruan / Rahama Wati Suatkab
1302Penerapan model pembelajaran JIGSAW untuk meningkatkan keterampilan berbicara siswa kelas V MI As-Sholihin Kecamatan Grati Kabupaten Pasuruan / Dewi Ainur Rizqiyah
1303Penggunaan timbangan kodok untuk meningkatkan hasil belajar matematika materi pokok pengukuran berat bagi siswa kelas III MI Al-Hamidiyah Gondangwetan Pasuruan / Nur Aini
1304Hubungan pemberian reward terhadap minat belajar siswa kelas IV pada mata pelajaran PKn SDN Sutojayan 02 Kabupaten Blitar / Okyana Dewi Gendari
1305Upaya meningkatkan pembelajaran IPA siswa kelas IV SDN Bandungrejosari I Kota Malang melalui model Attention Relevance Confidance Satisfaction (ARCS) / Riyani
1306Persepsi guru kelas I s/d VI sekolah dasar terhadap evaluasi pembelajaran berbasis kurikulum 2013 se-Gugus III Kecamatan Kedungkandang Kota Malang / Ririn Arista
1307Pengembangan media Fun Magnetic Alphabet dalam pembelajaran membaca permulaan pada anak usia 5-6 tahun di TK / Rahmatika
1308Penerapan model dicovery untuk meningkatkan pemahaman konsep IPA dan aktivitas siswa kelas V SDN Oro-oro Dowo Kota Malang / Reni Anasari
1309Pengembangan media kartu merawat hewan untuk kelas 2 di Gugus 4 SDN Sawojajar Kota Malang / Saidah Lutfiyah
1310Penerapan model pembelajaran Sains Teknologi Masyarakat (STM) untuk meningkatkan pembelajaran IPA siswa kelas 4 SDN Bandulan 4 Kota Malang / Lutfia Nur Azizah
1311Meningkatkan prestasi belajar siswa pada pembelajaran IPS dengan metode diskusi di kelas V semester I SDN Benerwojo Kecamatan Kelayan Kabupaten Pasuruan / Sugianto
1312Penerapan model problem solving untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas IV SDN Kedungkandang 2 Kota Malang pada pembelajaran IPA / Imroatul Latifah
1313Penerapan model pembelajaran Think Pair Share untuk meningkatkan keterampilan menulis cerita siswa kelas III SDN Toyomarto 01 Singosari Kabupaten Malang / Rahmawati
1314Penerapan model two stay two stray untuk meningkatkan kemampuan bertanya dan menjawab pada siswa kelas V SDN 2 Curahsuri Kabupaten Situbondo / Agung Widyatama
1315Peningkatan kemampuan menulis bahasa Indonesia dengan metode pemberian tugas bagi siswa kelas V SDN Dinoyo II Kecamatan Lowokwaru Kota Malang / oleh Inkuntum Hotimah
1316Kemampuan menulis surat izin siswa kelas V SDN Bandulan I
Sukun Malang tahun pelajaran 2003/2004 / oleh Mulana Agnes Samosir
1317Peningkatan kemampuan berbahasa ekpresif anak melalui aplikasi model Beyond Center and Circle Time (BCCT) pada anak kelompok B TK al Hidayah Jajar Kabupaten Blitar / Oktavia Ditasari
1318Peningkatan kemampuan motorik kasar melalui gerak dan lagu pada anak usia 5-6 tahun di TK Al-Hidayah Cabean Kota Blitar / Ira Tusti Tris Triani
1319Penggunaan media pembelajaran flash card untuk meningkatkan
prestasi belajar dalam pembelajaran bahasa Inggris kelas IV
si SDN Karangbesuki III / oleh Rulikah
1320Peningkatan keterampilan membaca pemahaman melalui media koran dengan teknik scanning dan skimming tema 7 subtema 1 kelas V SDN Watuagung Trenggalek / Dian Fitri Susetyo
1321Penerapan model talking stick untuk meningkatkan kemampuan berbicara siswa kelas II SDN Tamanbaru Banyuwangi / Frisca Savitri
1322Peningkatan keterampilan motorik halus melalui metode demonstrasi mencetak tanaman hias pada anak kelompok A di TK Negeri Pembina Kota Blitar / Popy Adityaningrum
1323Pengembangan media papan gantung peta Indonesia untuk pembelajaran subtema Indahnya Keragaman Budaya Negeriku kelas IV SDN Bareng 5 Kota Malang / Chyntia Destriana
1324Penggunaan pendekatan contekstual teaching and learning (CTL) dengan teknik inkuiri dalam meningkatkan motivasi siswa pada pembelajaran IPA kelas V MI Hidayatul Mubtadi'in Kabupaten Pasuruan / Iin Indrawati
1325Peningkatan hasil belajar matematika materi pokok bilangan pecahan melalui pembelajaran kooperatif model jigsaw di kelas V SDN Kaulon 01 Kabupaten Blitar / Irma Agustin Mufidah
1326Penerapan model quantum teaching rancangan tandur untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPS di SDN Madyopuro 2 Kota Malang / Ketsia Galanggoga
1327Penerapan pakem untuk meningkatkan hasil belajar siswa pada mata pelajaran IPS kelas IV SDN Lecari Kecamatan Sukorejo Pasuruan / Ahmad Syairur Rozi
1328Pengembangan instrumen asesmen perkembangan bahasa anak usia 4-5 tahun / Siti Nur Aini
1329Peningkatan pemahaman pengaruh globalisasi melalui model example non example pada siswa kelas IV SDN 08 Ngunut Kabupaten Tulungagung / Yesi Enjang Mulyaningsih
1330Penerapan pendekatan kooperatif model jigsaw untuk meningkatkan hasil belajar IPA siswa kelas V di SDN Pakisaji 02 Kabupaten Malang / Zainal Abdi
1331Penerapan model kooperatif TAI (team assisted individualization) untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IV di SDN Purwantoro 2 kota Malang / M. Ali Ridlo S.
1332Penerapan model inkuiri untuk meningkatkan hasil belajar siswa kelas III materi pecahan sederhana SDN Sitirejo 01 Wagir / Ferdy Setiyawan
1333Studi kasus pelaksanaan asessment kurikulum 2013 pada kelas tinggi di SDN Blimbing 1 Kota Malang / Dini Ludfira Aisyah
1334Peningkatan hasil belajar IPA pada materi energi bunyi melalui model guided inquiry di kelas IV SDN Gaprang 01 Kabupaten Blitar / Aminatul Laili
1335Penerapan model pembelajaran think pair share untuk meningkatkan hasil belajar IPA siswa kelas V SDN Bendo 2 Kecamatan Kepanjenkidul Kota Blitar / Albina Djondjonler
1336Peningkatan hasil belajar pembagian bilangan bulat positif melalui model pembelajaran STAD pada siswa kelas II SDN Karangtengah IV Kota Blitar / Moh Rifan Hunaifi
1337Penerapan model pembelajaran course review horay untuk meningkatkan pembelajaran IPA siswa kelas VC SDN Bandungrejosari 1 Kota Malang / Davis Dwi Cahyo Nugroho
1338Penerapan pakem untuk meningkatkan keterampilan membaca pemahaman pada siswa kelas V SDN Kedungdowo I Kabupaten Nganjuk / Eko Adi Nugroho
1339Peningkatan keterampilan membaca intensif melalui model cooperative script pada siswa kelas IV SDN Purwodadi 4 Kecamatan Blimbing Kota Malang / Stevani Agis Octavia Harsatya
1340Penerapan model pembelajaran berbasis masalah untuk meningkatkan kemapuan siswa kelas V memecahkan masalah dalam pembelajaran IPA di SDN Tlumpu Kota Blitar / Ririd Dwi Rahayu
1341Penerapan contextual teaching and learning untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SN Baujeng II Kecamatan Beji Kabupaten Pasuruan / Susanto
1342Pemanfaatan barang bekas sebagai media edukatif untuk mengembangkan kemampuan kognitif anak kelompok A di RA Iskandar Sulaiman, Batu / Tutik Suparmi
1343Persepsi guru terhadap perkembangan emosional anak melalui kegiatan pembelajaran yang diiringi musik klasik pada anak kelompok A di Taman Kanak-kanak Dharma Wanita 2 Kecamatan Turen Kabupaten Malang / Ferdina Yessitadevi
1344Peningkatan keterampilan berbicara melalui metode role playing pada siswa kelas IV SDN Tanggung 1 Kota Blitar / Barbalina Benamen
1345Meningkatkan hasil belajar PKn melalui media gambar ilustrasi cerita bagi siswa kelas V SDN Sumbersari 05 Kabupaten Blitar / Zeni Farida Maslukhotin
1346Penerapan model inkuiri untuk meningkatkan kualitas belajar IPA pada siswa kelas 4 gunungrejo 2 Singosari kabupaten Malang / Erwin Priandono
1347Penerapan model problem based learning (PBL) untuk meningkatkan pembelajaran IPA siswa kelas V SDN Pringapus 2 kecamatan Dongko Kabupaten Trenggalek / Linda Rachmawati
1348Penerapan pembelajaran kontekstual untuk meningkatkan pemahaman siswa tentang konsep pengukuran waktu di SDN Klumpit 01 Soko Tuban / Nita Retno Wahyuningati
1349Penerapan model index card match untuk meningkatkan IPA pada siswa kelas IV SDN Tulusrejo 2 kota Malang / Alfan Yuniawan
1350Penerapan pembelajaran kooperatif problem posing untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Jatimulyo 1 Malang pada mata pelajaran IPS / Vicky Dwi Wicaksono
1351Pemanfaat benda-benda di lingkungan kelas untuk meningkatkan hasil belajar menggambar ekspresi siswa kelas 2 SDN Kasin MAlang / Winda Dyah Puspitasari
1352Penerapan model pembelajaran concept mapping untuk meningkatkan prestasi belajar IPS pada siswa kelas 3 SDN I Pucungkidul Kabupaten Tulungagung / Niken Vidya Novitasari
1353Pemanfaatan media torso untuk meningkatkan aktivitas siswa dan hasil belajar di kelas 4 SDN Lesanpuro 1 Kota Malang / Wulan Nuzulul Isnaini
1354Pemanfaatan media gambar untuk meningkatkan keterampilan menulis puisi pada siswa kelas III SDIT Insan Permata Malang / Sri Handayani
1355Penerapan metode demonstrasi untuk meningkatkan kemampuan siswa dalam membuat kolase pada siswa kelas I SDN Sukoharjo 02 Kota Malang / Rizka Dewi Wulansari
1356Penerapan pendekatan kontekstual pada pembelajaran IPA untuk meningkatkan aktifitas dan hasil belajar siswa kelas IV SDN Ardimulyo 03 Singosari Malang / Eva Agustine Yusnita Sari
1357Penerapan model pembelajaran CIRC untuk meningkatkan mutu pembelajaran membaca dan meningkatkan mutu pembelajaran membaca dan menulis paragraf siswa kelas IV SDN Tamanharjo 1 Singosari / Shinta Dwi Ayuna Adiesti
1358Pemanfaatan media VCD untuk meningkatkan aktivitas dan hasil belajar IPA pada siswa kelas V SDN Madyopuro 6 Kec. Kedungkandang Kota Malang / Indah Rohmawati
1359Pengembangan media ular tangga misteri dalam pembelajaran berbicara anak usia 5-6 tahun / Vidia Norita Hapsari
1360Pemecahan masalah strategi heuristik I untuk meningkatkan hasil belajar penjumlahan dan pengurangan bilangan bulat siswa kelas IV SDN Jatimulyo 01 Malang / Luluk Wahyuning Okfitasari
1361Penerapan pendekatan konstruktivisme dengan media lingkungan sekitar untuk meningkatkan keterampilan menulis karangan narasi siswa kelas IV SDN Ampelgading 3, Blitar / Mira Puspita Candra Dewi
1362Peningkatan keterampilan berbicara dengan media gambar pada siswa kelas IV SDN Tanggung 2 KOta Blitar / Desemrina Kostansa Lagiaduay
1363Penerapan teknik cerita berantai untuk meningkatkan keterampilan berbicara pada siswa kelas IV SDN Kedungrejo Kecamatan Winongan Kabupaten Pasuruan / Fira Khurliyah
1364Penerapan model Talking Stick untuk meningkatkan aktivitas dan hasil belajar IPS kelas IV SDB Karangtgondang 01 Kecamatan Udanawu Kabupaten Blitar / Levy Priambodo
1365Penerapan media gambar dengan power point untuk meningkatkan aktivitas dan hasil belajar IPS pada siswa kelas V SDN Bunulrejo 5 Kota Malang / Kadarno
1366Penerapan media permainan monopoli untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IVB SDN Bareng 1 Kecamatan Klojen Kota Malang / Rizki Dini Indiarti
1367Penggunaan modul pembelajaran untuk meningkatkan prestasi hasil belajar dalam pelajaraan IPA siswa kelas IV di SD Negeri Purwantoro XIV kecamatan Blimbing Kota Malang / oleh Muslikhatin
1368Penerapan pendekatan proses untuk meningkatkan kemampuan menulis karangan narasi siswa kelas IV SDN Mulyoarjo 02 Lawang / Dina Nur Aisyah
1369Penerapan model Group Investigation untuk meningkatkan aktivitas dan hasil belajar IPA pada materi sifat-sifat cahaya di kelas V SDN Gadingkulon 01 Malang / Achmad Rifai
1370Penerapan model role playing untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas III SDN Bareng 1 Kecamatan Klojen Kota Malang / Aries Noerfitha Ramadhan
1371Penerapan media teka-teki silang untuk meningkatkan partisipasi dan hasil belajar siswa kelas IV pada mata pelajaran IPS di SDN Jatimulyo 1 Kecamatan Lowokwaru Kota Malang / Suprapti
1372Penerapan model pembelajaran example non example untuk meningkatkan penguasaan konsep perkembangan teknologi siswa kelas IV SDN Kebonduren 02 Ponggok Blitar / Caesar Aan Anggraini
1373Penerapan mind mapping berbasis eksperimen untuk meningkatkan pembelajaran IPA siswa kelas IV di SDN Sombron Kabupaten Nganjuk / Gagik Adi Wibowo
1374Penggunaan media benda konkrit untuk meningkatkan pembelajaran siswa kelas IV tentang gaya di SDN Rampal Celaket 2 Malang / Erna Juwariyah
1375Pengembangan permainan "Ants Coloniest" untuk menstimulasi aspek perkembangan sosial emosional anak usia 5-6 tahun / Riska Ayu Widya Murdhani
1376Analisis karakter dalam Antologi Cerita Rakyat Jawa Timur karya Sungkowati Yulistin, dkk / Michael Yonatan Sunaryo
1377Penerapan model sets untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Bandungrejosari 2 Malang / Hermin Suswati
1378Profil pendidikan karakter SDIT Baitul Izzah Kelurahan Kauman Kecamatan Nganjuk Kabupaten Nganjuk / Dian Cahya Puspita
1379Penerapan model pembelajaran team assisted individualization (TAI) untuk meningkatkan pembelajaran IPA materi sifat-sifat cahaya siswa kelas V SDN Purworejo 1 Tulungagung / Yunia Mikawati
1380Pembinaan guru PAUD/TK alumni PG-PAUD Universitas Negeri Malang di Kota Malang / Desi Widya Arum
1381Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar IPA siswa kelas V di MI Mifthaul Huda Pohjentrek Pasuruan / Nur Yulianti
1382Penerapan model investigasi kelompok untuk meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Wonokoyo 2 Malang / Irfan Efendi
1383Peningkatan hasil belajar IPS materi Koperasi melalui model Problem Based Learning (PBL) pada siswa kelas IV SDN Kunir 01 Kabupaten Blitar / Novim Aivianita Hanifi
1384Implementasi pendidikan karakter pada pembelajaran tematik (studi kasus di kelas IV SDN Rampal Celaket 1 Kota Malang) / Endah Sri Rahayu
1385Penggunaan media ular tangga sebagai media pembelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas V di SDN Sumberpucung 07 Kabupaten Malang / Evi Triwahyuni
1386Penerapan model pembelajaran kooperatif untuk meningkatkan keterampilan menulis karangan deskripsi siswa kelas IV SDN Slamet 01 Tumpang Kecamatan Tumpang / Lerianto
1387Penerapan pendekatan quantum learning untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Bangoan 1 Kabupaten Tulungagung / Enggar Fitrianingrum
1388Penerapan model pembelajaran Mind Mapping untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V MI Ta'limusshibyan Karangpandan Rejoso Pasuruan / Faizah
1389Penerapan permainan jari-jari tangan untuk meningkatkan hasil belajar perkalian bilangan cacah siswa kelas IV SD Negeri Minggir Kecamatan Winongan Kabupaten Pasuruan / Nur Lailiyul Mualudiyah
1390Penerapan model pembelajaran SAVI untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Bareng 4 Malang / Achmad Bagus Suprio
1391Penerapan model pembelajaran assure untuk meningkatkan hasil belajar siswa kelas V pada mata pelajaran PKn SDN Madyopuro 3 kota Malang / Ludia Kailem
1392Peningkatan perkembangan motorik kasar anak dengan permainan engklek pada kelompok B TK Dharma Wanita Bangunmulyo Kecamatan Pakel Kabupaten Tulungagung / Ayun Ratna Fajarwati
1393Penerapan model Explicit Instuction untuk meningkatkan kualitasa pembelajaran IPA siswa kelas IV A Sdn Lesanpuro 3 Kota Malang / Ayuk Susilaning Stiyas
1394Peningkatan hasil belajar IPS pada siswa kelas III melalui model mind mapping di SDN Kademangan 5 Kabupaten Blitar / Dwi Rahmawati
1395Analisis pemanfaatan tunjangan sertifikasi terhadap kompetensi profesional guru di SDN se-Gugus II Kecamatan Watulimo Kabupaten Trenggalek / Bobby Agam Romdhoni
1396Penerapan pendekatan discovery untuk meningkatkan aktivitas dan hasil belajar IPA konsep kenampakan bulan siswa kelas IV SDN Sukoharjo II Kota Malang / Mashuri Warat
1397Penerapan model pembelajaran make-a-match untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Bandaran II Kecamatan Winongan Kabupaten Pasuruan / Lutvia Chusni
1398Peningkatan keterampilan membaca pemahaman dalam pembelajaran tematik dengan menggunakan metode SQ3R pada siswa kelas VB SDN Pare 1 Kabupaten Kediri / Liza Apriliyana
1399Penerapan model mind mapping dalam meningkatkan keterampilan menulis karangan narasi siswa kelas IUI SDN Slamet 01 Kecamatan Tumpang Malang / Leiny
1400Meningkatkan kemampuan mengerjakan operasi penjumlahan dan pengurangan pecahan siswa kelas IV melalui penerapan teori Jerome Bruner / Dian Hery Sucipto
1401Peningkatan kemampuan motorik halus melalui kegiatan menggambar bebas anak kelompok B TK PGRI Pojok 01 Garum Kabupaten Blitar / Nurjarwati
1402Penerapan model pembelajaran ARCS untuk meningkatkan aktivitas dan hasil belajar mata pelajaran IPS siswa kelas IV SDN Kotalama I Kecamatan Kedungkandang Kota Malang / Kunardjiono
1403Hubungan antara interaksi sosial antar siswa dengan hasil belajar IPS siswa kelas V SDN 1 Botoran Kabupaten Tulungagung / Novy Prapti Pratiwi
1404Penerapan model pembelajaran practice rehearsal pairs untuk meningkatkan aktivitas dan hasil belajar IPA kelas V SDN Kebonduren 02 Ponggok Kabupaten Blitar / Ade Satrio Nugroho
1405Penerapan model pembelajaran Preview, Question, Read, Reflect, Recite, Review (PQ4R) untuk meningkatkan kemampuan memahami isi cerita pada siswa kelas V SDN Karangbesuki 4 Kota Malang / Ike Eva Sovina
1406Penerapan model savi untuk meningkatkan pembelajaran IPA siswa kelas IVA SDN Madyopuro 1 Kecamatan Kedungkandang kota Malang / Theresia Natasian
1407Penerapan model example non example dapat meningkatkan prestasi belajar IPS kelas III SDN 1 Ngulankulon Kabupaten Trenggalek / Nur Fithroh Hidayati
1408Penerapan pendidikan karakter pada kelas 2 SDN Blimbing Kabupaten Kediri / Aprilya Dwi Lestari
1409Penerapan model STAD untuk meningkatkan aktivitas dan hasil belajar siswa pokok bahasan pecahan kelas IV SDN Ktawanggede I malang / Julis Yayah Rizki
1410Implementasi teori Van Hiele untuk meningkatkan hasil belajar siswa tentang bangun datar di kelas V SDN Kemiri Pasuruan / Basori
1411Karakteristik pola asuh orang tua dan guru dalam pembentukan karakter disiplin pada anak di TK Al Ikhlash Kabupaten Lunajang / Reza Novaliani
1412Peningkatan pemahaman kerjasama melalui media pembelajaran monopoli pintar pada siswa kelas VB SDN Blitar Kota Blitar / Ragil Mei Rahayu
1413Penerapan metode eksperimen untuk meningkatkan prestasi belajar IPA tentag cahaya merambat lurus pada siswa kelas V di SDN Baturetno IV Kecamatan Singosari Kabupaten Malang / Sunarto
1414Pembelajaran matematika pokok bahasan pecahan dengan
menggunakan media benda konkrit dan gambar kelas III SDN
Polehan VII No.67 Kecamatan Blimbing Kota Malang tahun
pelajaran 2003-2004 / oleh Rini Wasitah
1415Meningkatkan kemampuan memecahkan masalah dengan model Polya pada materi operasi hitung campuran siswa kelas III SDN Wirotaman 02 Kecamatan Ampelgading Kabupaten Malang / Harmawan
1416Analisis kesesuaian buku siswa kelas III SD tema Energi dan Perubahannya dengan esensi kurikulum 2013 / Mohammad Rafiq Haririh
1417Implementasi model SAVI (Somatic, Auditory, Visualization, Intelellectualy) untuk meningkatkan pembelajaran IPA kelas V SDN Bedali 03 Lawang Malang / Zahrotul Afiah
1418Penerapan model pembelajaran permainan scrabble untuk meningkatkan kualitas pembelajaran IPS siswa kelas IV SDN Karangbesuki 4 Kota Malang / Muhammad Sulton
1419Penerapan model pakem untuk meningkatkan hasil blajar keliling dan luas bangun datar segitiga pada siswa kelas IV SDN Karangtengah I kota Blitar / Agustina Rahayu
1420Penerapan model pembelajaran Two Stay Two Stray (TSTS) untuk meningkatkan kualitas pembelajaran IPA siswa kelas IV SDN Tanjungrejo 2 Malang, / Dwi Hinda Wiratna
1421Pemberdayaan lembar kerja siswa untuk meningkatkan aktivitas belajar siswa pada pembelajaran IPA kelas IV SDN Popoh 3 Kecamatan Selopuro Kabupaten Blitar / Irfa Nurohmah
1422Meningkatkan ketrampilan menulis deskripsi melalui group field tour (GFT) pada kelas 5 SDN Binangun 2 Kabupaten Blitar / Dian Andik Saputra
1423Penerapan pendekatan heuristik IV untuk meningkatkan kemampuan siswa menyelesaikan masalah matematika klas V A SDN Penanggungan / Widawati
1424Meningkatkan hasil belajar matematika melalui model problem based larning )PBL) siswa kelas IV SDN Salamrejo Blitar / Gugi bagus Abimanyu
1425Penerpan model pembelajaran cooperative integrated reading and compsition (CIRC) untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn kelas V SDN Balearjosari 2 Malang / Puguh Hadi Ismanto
1426Penerapan pembelajaran matematika realistik untuk meningkatkan kemampuan pemecahan masalah siswa kelas III SDN Gadang I Kota Malang / Cholifatul Ulfa
1427Penerapan model pembelajaran arias untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas VD SDN Kesatrian 1 kota Malang / Dian Prasma Anggraini
1428Pengembangan permainan monopoli pintar pada pembelajaran kemampuan berbicara anak usia 5-6 tahun di kota Malang / Rifka Annisa Ariani
1429Meningkatkan hasil belajar IPS melalui pembelajaran kooperatif model Teams Games Tournament (TGT) di SDN Kauman 01 Kota Blitar / Haleks Bastian Pardjer
1430Penerapan model pembelajaran kooperatif tipe STAD pada mata pelajaran IPS untuk meningkatkan aktivitas hasil belajar siswa kelas IV SDN Sidomulyo Kecamatan Purwoasri Kabupaten Kediri / Lina Rianingrum
1431Meningkatkan hasil belajar IPS melalui pembelajaran kooperatif model stad di kelas IV SDN Sambigede 01 Kecamatan Binangun Kabupaten Blitar / Yulia Desiindrasari
1432Hubungan antara tingkat pendidikan orang tua dengan hasil belajar siswa kelas IV A SDN Madyopuro 5 Kecamatan Kedungkandang Kota Malang / Stefanus Yerkohok
1433Penerapan pendekatan CTL (Contextual Teaching And Learning) untuk meningkatkan pemahaman konsep bangun ruang siswa kelas I SDN Slumbung 01 Kecamatan Gandusari Kabupaten Blitar tahun pelajaran 2007/2008 / Lilis Fatmawati
1434Penerapan model pembelajaran active learning untuk meningkatkan aktivitas dan hasil belajar IPS pada siswa kelas IV SDN Tulusrejo 2 Kota Malang / Astri Yuanita Budiarti
1435Permainan ular tangga meningkatkan hasil belajar siswa dalam pembelajaran bilangan bulat siswa kelas IV SDN Kebonagung 06 Pakisaji Malang / Nanik Agustina
1436Penggunaan media audio visual untuk meningkatkan proses dan hasil belajar siswa pada mata pelajaran IPS kelas V SDN Bakalan Krajan 1 kecamatan Sukun kota Malang / Eni Arifatun Ni'mah
1437Penerapan model pembelajaran TGT (Team game tournament) untuk meningkatkan hasil belajar matematika materi kelipatan persekutuan terkecil dan faktor persekutuan terbesar pada siswa kelas IV SD Tambakrejo 02 Kabupaten Blitar / Angga Rendi Eva Permana
1438Meningkatkan keterampilan menulis deskripsi siswa kelas IV SD Islam Sabilillah Malang melalui strategi roulette writing / Erna Febru Aries S.
1439Peningkatan hasil belajar IPS pada kelas II dengan menggunakan media visual (gambar, foto dan bagan) di SDN Karangtengah 3 Kota Blitar / Engky Figarintis
1440Penerapan model inductive thinking untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV SDN Jatimulyo I Kota Malang / Eva Lia Mitania Dewi
1441Pembiasaan perilaku moral untuk anak usia dini pada Program Bina Keluarga Balita (BKB) di kelompok BKB Melati Kecamatan Wlingi Kabupaten Blitar / Rizky Putri
1442Penerapan model problem solving untuk meningkatkan pembelajaran IPA di kelas VI SDN Bangelan 04 Kecamatan Wonosari Kabupaten Malang / HUda
1443Penggunaan media cetak koran sebagai media pembelajaran IPS untuk meningkatkan kreativitas dan hasil belajar siswa kelas IV di SDN Senggreng 5 Kecamatan Sumberpucung / Popi Imaniar
1444Meningkatkan hasil belajar IPS melalui pemanfaatan media lingkungan masyarakat di kelas IV SDN Sawentar IV / Deni Firmansyah
1445Peningkatan keterampilan menulis karangan deskripsi melalui pemanfaatan lingkungan sekolah siswa kelas IV SDN Karangrejo 02 kabupaten Malang / Novita Sari
1446Penggunaan pendekatan humanistik model Mangunwijaya untuk meningkatkan aktivitas dan hasil belajar sains pada siswa kelas V SDN Bandungrejosari I kecamatan Sukun kota Malang / Wahyu Firmansyah
1447Model pembelajaran kooperatif jigsaw untuk meningkatkan hasil belajar IPS siswa kelas IV SDN Pasina I Lekok Pasuruan / Angga Arinta Luftika
1448Penerapan model pembelajaran investivigasi kelompok untuk meningkatkan hasil belajar siswa mata pelajaran sains kelas IV semester ganjil di SDN Kaliboto tahun ajaran 2008/2009 / Dwi Indra Purnamawati
1449Penerapan model pembelajaran learning cycle untuk meningkatkan hasil belajar IPS siswa kelas IV di SDN Karangbesuki 04 Malang / Yayuk Supatmi
1450Meningkatkan prestasi belajar IPS melalui pendekatan pembelajaran kontekstual pada siswa kelas IV SDN Katerban II Kecamatan Baron Kabupaten Nganjuk / Yunita Kristanti
1451Penerapan pembelajaran model siklus belajar untuk meningkatkan kemampuan berfikir dan hasil belajar ilmu pengetahuan sosial di SDN Candirenggo 02 Kecamatan Singosari Kabupaten Malang / Kristin Sujiati
1452Pengembangan instrumen penilaian sikap dalam aktivitas kelompok kelas IV SDN Sawojajar VI Kota Malang / Lesperi
1453Pembelajaran terpadu model connected untuk meningkatkan pemahaman materi pelajaran IPS kelas IV SDN Karangploso 02 Kabupaten Blitar / Henny Pusporini
1454Penerapan pendekatan multikultural untuk meningkatkan rasa cinta tanah air pada pembelajaran PKn kelas III SDN Sukomoro I Kecamatan Sukomoro Kabupaten Nganjuk / Tri Ratna Sari
1455Penerapan metode pembelajaran bermain peran untuk meningkatkan prestasi belajar PKn pokok nahasan sistem pemerintahan siswa kelas IV SDN Sepanjang 04 Kecamatan Gondanglegi Kabupaten Malang / Nurul Qomariyah
1456Penggunaan KIT IPA untuk meningkatkan hasil belajar pokok bahasan rangkaian listrik siswa kelas VI di SDN Ngenep 03 Kecamatan Karangploso Kabupaten Malang / Bedy Rudyansyah Jai
1457Meningkatkan kemampuan menulis dengan model pembelajaran cooperative integrated reading compotition (CIRC pada siswa kelas 3 SDN Banaran 1 Kota Kediri / Ashlihatun Nikmah
1458Peningkatan kemampuan berbahasa melalui metode bercakap-cakap pada anak kelompok B di RA Plus Al-Irsyad Ponggok Blitar / Nurul Hidayati
1459Penerapan pendekatan inquiri dalam meningkatkan hasil prestasi belajar pada mata pelajaran sains siswa kelas IV SDN Gogodeso 01 Kecamatan Kanigoro Kabupaten Blitar / Retno Dwi Budi Cahyanti
1460Penggunaan media pembelajaran kartu bercerita untuk meningkatkan kemampuan menulis narasi Siswa Kelas V SD Negeri Plosorejo 03 Kabupaten Blitar / Nurul Malikah
1461Penerapan pembelajaran kooperatif Jigsaw untuk meningkatkan hasil belajar siswa kelas IV pada IPS pokok bahasan hubungan kenampakan alam, sosial dan budaya, serta gejalanya di SDN Gambirkuning Kecamatan Kraton Kabupaten Pasuruan / Sitti Safiah Rumakey
1462Peningkatan keterampilan menulis karangan deskripsi melalui media gambar seri pada siswa kelas III SDN Slamet 01 Kecamatan Tumpang Kabupaten Malang / Selvi Astuti
1463Penerapan pakem dengan metode eksperimen untuk meningkatkan hasil belajar IPA materi benda dan sifatnya di kelas V SDN Kebonsari 4 Kota Malang / Martini Dwi Purnama
1464Penggunaan permainan tradisional "gotri ala gotri" untuk meningkatkan penguasaan konsep perkalian mata elajaran matematika pada siswa kelas II SDN Penanggungan Malang / Eri Tri Murtini
1465Peningkatan hasil belajar matematika materi bilangan pecahan melalui model pembelajaran jigsaw di kelas IV SDN 1 Bendosari Tulungagung / Ekawati Putri Handayani
1466Meningkatkan keterampilan berbicara melalui percakapan dalam pembelajaran Bahasa Indonesia bagai siswa kelas IV SDN Selotambak Kecamatan Kraton Kabupaten Pasuruan / Basaria Voth
1467Penerapan model Team assisted Individualization (TAI) untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IV di SDN Gandekan 01 Kabupaten Blitar / Zuliati
1468Penggunaan internet sebagai media pembelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Sawojajar 4 Kota Malang / Efi Sutrisnawati
1469Peningkatan motorik kasar anak Kelompok A melalui permainan sirkuit tebak rasa di TK Pertiwi Kawedusan 01 Ponggok Kabupaten Blitar / Citra Zelvia Geovani Handoko
1470Melalui model numbered heads together dapat meningkatkan prestasi belajanr PKn pada siswa kelas III SDN Candirejo 04 Kecamatan Ponggok / Eni Rohmadiyah
1471Studi kasus gangguan perkembangan bahasa anak usia dini di kelompok A RA Miftahul Huda Kota Batu / Minayu
1472Melalui model Numbered Heads Together (NHT) dapat meningkatkan prestasi belajar IPS pada materi sumber daya alam bagi siswa kelas IV SDN 1 Ngulankulon Kabupaten Trenggalek / Henny Ernani Rofida
1473Penggunaan metode bercerita dengan boneka jari tangan untuk meningkatkan kemampuan berbahasa anak Kelompok A di TA Pesan Ibu Malang / Novita Dewi
1474Penerapan model pembelajaran make a match untuk meningkatkan prestasi belajar IPS siswa kelas IV SDN Pandanwangi 2 Kota Malang / Mariatul Kibtiyah
1475Penerapan model pembelajaran picture and picture untuk meningkatkan keterampilan menulis narasi tema 5 subtema 4 kelas II SDN Buring Kota Malang / Nikmaturohmah
1476Penerapan model pembelajaran cooperative learning tipe stad untuk meningkatkan aktivitas dan hasil belajar tematik pada siswa kelas II SDN Kemirisewu II Pasuruan / Eko Budi Santoso
1477Penerapan model pembelajaran telaah yurisprudensi inquiri untuk meningkatkan hasil belajar PKn siswa kelas V SDN Beji II Pasuruan / Nelma Voth
1478Penerapan model Problem Based Learning (PBL) untuk meningkatkan pembelajaran IPA siswa kelas V-C di SDN Model Kota Malang / Novita Wulandari
1479Penggunaan dekak-dekak untuk meningkatkan penguasaan penjumlahan bilangan cacah pada siswa kelas II SDN Rampal Celaket I Kecamatan Klojen Kota Malang tahun pelajaran 2007/2008 / Lailul Indrawati
1480Perilaku bullying pada anak sekolah dasar (study kasus pada anak sekolah dasar kelas 4 di SDN 1 Gondang Kecamatan Gondang Kabupaten Mojokerto) / Wikan Tri Restu Yanuarti
1481Penerapan model pembelajaran apresiasi seni melalui telaah karya (ASMTK) untuk meningkatkan kemampuan mengapresiasi karya seni rupa pada siswa kelas V SDN Subersari II malang / Aditya Dwi Hanggara
1482Penerapan teori J. Bruner untuk meningkatkan aktivitas dan hasil belajar pengurangan pecahan siswa kelas V SDN Tanjungrejo 5 Malang / Nanik Suryaningsih
1483Penggunaan model pembelajaran learning cycle dan peta konsep untuk meningkatkan aktivitas dan hasil belajar IPA kelas IV SDN Oro-oro Pule Kecamatan Kejayan Kabupaten Pasuruan / Ika Puji Lestari
1484Penerapan metode permainan ular tangga pada pembelajaran sumber daya alam Indonesia untuk meningkatkan hasil belajar IPS kelas IV SDN Bareng I kota Malang / Agus Saiful Aziz
1485Penggunaan model Van Hiele untuk meningkatkan hasil belajar sifat bangun datar kelas III SDN Bandungrejosari 1 Malang / Eva Keni Puspita Sari
1486Penerapan model mind mapping untuk meningkatkan kemampuan menulis karangan deskripsi siswa kelas IV SDN Pagentan 01 Singosari / Ravita Hadi Ayuningwulan
1487Peningkatankemampuan membaca permulaan melalui media balok suku kata pada anak kelompok B di TK Tauladan Pare3 kabupaten Kediri / Emy Zuraida
1488Implementasi pendekatan whole language untuk meningkatkan pemahaman isi teks bacaan pada siswa kelas VA SDN Bareng 1 Kota Malang / Nur Rohma Andalasari
1489Penerapan kegiatan bermain gelembung warna untuk meningkatkan kemampuan sosial emosional anak kelompok di RA Muslimat NU 17 Kota Malang / Zahratul Aulia Rahmani
1490Penerapan model pembelajaran interaktif untuk meningkatkan hasil belajar operasi hitung bilangan bulat siswa kelas IV SD Islam Kardina Massa Blitar / Mohammad Khafid Irsyadi
1491Peningkatan kemampuan motorik halus melalui kegiatan meronce pada kelompok B TK Al-Hidayah Sanankulon Kabupaten Blitar / Laelatul Fitria
1492Pengembangan media lembar balik pada pembelajaran subtema sahabat satwa tema indahnya persahabatan di kelas III SD / Diana Widia Ningsih
1493Penerapan model pembelajaran jigsaw untuk meningkatkan proses dan hasil belajar siswa kelas IV SDN Madyopuro 4 kota malang pada mata pelajaran IPS / Sarah Karatem
1494Pengaruh model pembelajaran kooperatif Team Assisted Individualization terhadap hasil belajar materi luas dan keliling bangun datar kelas III SDN Kanigoro 03 Kabupaten Blitar / Kukuh Pramono
1495Pemanfaatan sumber belajar lingkungan terdekat siswa melalui observasi untuk meningkatkan hasil belajar materi norma yang berlaku di masyarakat bagi siswa kelas III A SDN Kotalama 5 Malang / Rifa Nurdiana
1496Peningkatan aktivitas dan hasil belajar IPS melalui model kooperatif tipe TGT pada siswa kelas IV SDN Saptorenggo 3 Kabupaten Malang / Elis Choridah
1497Penggunaan pendekatan inkuiri untuk meningkatkan keaktifan dan hasil belajar IPA pada siswa kelas V SDN Sumbersari II Kabupaten Pasuruan / Arina Indriani
1498Penggunaan media konkrit untuk meningkatkan hasil belajar IPA siswa kelas III SDN Sidodadi II Lawang / Revi Lujeng Rahayu
1499Permainan kartu huruf untuk meningkatkan keterampilan membaca nyaring siswa kelas I SDN Ngajum 05 Kecamatan Ngajum Kabupaten Malang / Siti Sarofah
1500Penerapan model pembalajaran kooperatif jigsaw untuk meningkatkan aktivitas dan kerjasama siswa pada mata pelajaran IPA kelas V di SDN Bareng 3 Malang / Eka Dian Wulandari
1501Pengembangan media interaktif pada pembelajaran sub tema Makananku Sehat dan Bergizi di kelas IV semester 2 SD Negeri Pandanwangi 4 Malang / M. Luthfi Oktarianto
1502Meningkatkan kemampuan menyelesaikan soal cerita matematika siswa kelas IV SDN 3 Pancor melalui pendekatan realistik / Suaibun
1503Pengembangan media pembelajaran CD interaktif tema pengalamanku sub tema pengalaman di sekolah siswa kelas I semester 2 sekolah dasar / Dhieni Melinda P
1504Pemanfaatan cd interaktif untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Kebonagung II Malang / Didin khoirun Nikmah
1505Penerapan media diorama untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Klangrong I / Samsul Arifin
1506Penggunaan metode speed reading untuk meningkatkan kemampuan membaca cepat siswa kelas V pelajaran bahasa Indonesia SDN Sumbersari 1 Lowokwaru Malang / Fifin Nurhayati
1507Penggunaan media gambar seri untuk meningkatkan aktivitas, motivasi belajar, dan pemahaman teks cerita anak pada siswa kelas V SDN Kebonagung 2 Malang / Norma Farida Ariani
1508Penerapan model pembelajaran jigsaw untuk meningkatkan aktivitas dan hasil belajar IPA materi struktur tumbuhan pada siswa kelas IV di SD Islam Nurul Izzah Kota Malang / Heri Hermanto
1509Penerapan pendekatan tim kuis untuk meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Kedung Banteng I Kecamatan Rembang Kabupaten Pasuruan / Agustina Rokhmawati
1510Penggunaan media macromedia flash professional 8 untuk meningkatkan pembelajaran IPA siswa kelas VI SDN Tunjungsekar 1 Malang / Wildan Akhsana
1511Penerapan metode eksperimen untuk meningkatkan hasil belajar IPA konsep benda dan sifatnya siswa kelas IV SDN Plososari III Kecamatan Grati Kabupaten Pasuruan / Nurul Ulum
1512Penggunaan media flash card untuk meningkatkan keterampilan berbicara bahasa Inggris siswa kelas IV MI TPI Tambnakrejo Gurah Kediri / Muhammad Ainur Rofiq
1513Pemanfaatan media flip chart untuk meningkatkan kemampuan berbicara anak usia 4-5 tahun TK PGRI 02 Kromengan / Dian Ayuningtyas
1514Aplikasi contextual learning untuk meningkatkan prestasi belajar PKn tentang pemahaman sistem pemerintahan desa dan kecamatan siswa kelas IV SDN Lawang 02 / Rina Kusumawati
1515Meningkatkan prestasi belajar ilmu pengetahuan sosial melalui pembelajaran kontekstual pada siswa kelas IV SDN Kedungringin IV Kecamatan Beji Kabupaten Pasuruan / Kasiono
1516Penerapan pembelajaran model kontektual untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pada mata pelajaran IPS SDN Oro-oro Omba Kulon II Kecamatan Rembang Pasuruan / Yulia Andriana
1517Penerapan contextual teaching and learning untuk meningkatkan keterampilan menulis puisi bagi siswa kelas 5 SDN Ketawanggede 1 Kota Malang / Betty Rosmalina Pribadi
1518Pemanfaatan media LCD sound slide untuk meningkatkan motivasi dan hasil belajar siswa mata pelajaran IPS kelas V SDN Pagerejo II Kab. Pacitan / Diyan Novita Prastiana
1519Penerapan model belajar investigasi kelompok (group investigation) untuk meningkatkan pembelajaran IPA pada siswa kelas V SDN Soso 03 Kecamatan Gandusari Kabupaten Blitar / Nining Ramadani Apriliana
1520Pelaksanaan penilaian autentik kurikulum 2013 pada kelas IV semester II tahun ajaran 2015/2016 di SDN se-kecamatan Blimbing Kota Malang / Alif Febrinia Rahayu
1521Penerapan media flipchart untuk meningkatkan aktivitas dan hasil belajar siswa kelas V tema 7 subtema 2 SDN Pisangcandi 1 Kecamatan Sukun Kota Malang / Azza Balqis Suroyya
1522Peningkatan hasil belajar IPS melalui strategi cooperative script pada siswa kelas 5 SDN Pulosari 1 Kabupaten Tulungagung / Ana Wahyu Kurnia
1523Penggunaan media gambar untuk meningkatkan kemampuan memahami isi bacaan siswa kelas III SDN Lumbang 03 Kecamatan Lumbang Kabupaten Pasuruan / Sampirno
1524Peningkatan pemahaman kedudukan dan peran anggota keluarga melalui model role playing di kelas II SDN 1 Doroampel Tulungagung / Ayu Devia Miftahul Hasanah
1525Peningkatan hasil belajar PKn materi organisasi melalui model mind mapping pada siswa kelas V SDN Sentul 2 Kota Blitar / Zahwa Ul Navisarini
1526Penggunaan media audio visual berbasis hyperlink untuk meningkatkan hasil belajar PKn kelas V di SDN Karangbesuki I Kecamatan Sukun Kota Malang / Silvi Aprilia Indah Kurniawati
1527Penerapan pendekatan daur belajar )Learning cycle) untuk meningkatkan hasil belajar IPA kelas III di SDN Suberjo Kulon II Ngunut Tulungagung / Nina Sayyidah
1528Pengembangan media boneka ayam berkancing untuk pembelajaran motorik halus anak usia 3-4 tahun / Fryanne Saulina Yohani
1529Peningkatan hasil belajar matematika materi keliling persegi dan persegi panjang melalui media papan berpaku kelas III SDN 2 Gedangan Kabupaten Tulungagung / Trio Arista
1530Peningkatan kemampuan menulis karangan narasi berdasarkan pengalaman pribadi siswa kelas IV MINU Misbahul Ulum Kecamatan Beji Kabupaten Pasuruan / Akhmad Syahrul Mubarok
1531Analisis muatan nilai-nilai karakter pada buku siswa kelas V tema sejarah peradaban Indonesia edisi 2014 berdasarkan kurikulum 2013 / Candra Septi Retno Sari
1532Peningkatan keterampilan membaca kata sederhana menggunakan media flash card pada anak usia 3-4 tahun di PAUD Cerah Kota Blitar / Raeh Niken Baghiroh
1533Penerapan model pembelajaran jigsaw untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas VB SDN Rejosari 01 Kecamatan Bantur Kabupaten Malang / Rendyana Mulya Prayogi
1534Problematika implementasi buku panduan guru kelas IV tema indahnya negeriku di SDN se-kecamatan Lowokwaru Kota Malang / Randika Putra Sowantama
1535Penerapan model pembelajaran konsiderasi untuk meningkatkan hasil belajar PKn pokok bahasan gotong royong siswa kelas II MI Ma'arif Ngering Kecamatan Gempol Kabupaten Pasuruan / M. Zainal Arifin
1536Pengembangan media pohon warna dalam pembelajaran tema tanaman untuk usia 4-5 tahun / Qurrota A'yun
1537Pengembangan media papan karpet tiga dimensi untuk menyusun huruf menjadi kata pada anak kelompok B Taman Kanak-Kanak / Isnaini Khoirun Puspitasari
1538Peningkatan hasil belajar matematika sifat bangun datar melalui model Numbered Heads Together (NHT) pada siswa kelas V SDN II Plandaan Kabupaten Tulungagung / Rika Yunitasari
1539Penggunaan media diorama untuk meningkatkan kesadaran membuang sampah pada tempat sampat di TK B Al-Hidayah Singosari / Luluk Masruroh
1540Pengembangan instrumen asesmen motorik kasar anak usia 5-6 tahun di Taman Kanak-Kanak / Ekky Putri Meirinda Sari
1541Peningkatan keterampilan berbicara melalui model pembelajaran Student Team Achievement Division (STAD) pada siswa kelas V SDN 3 Doko Kabupaten Tulungagung / Tutut Agustyarini
1542Pengembangan media pembelajaran the multiplication play untuk keterampilan perkalian siswa kelas III sekolah dasar / Lusia Chandra Sari
1543Penggunaan media pohon berbuah angka untuk meningkatkan kemampuan kognitif anak dalam mengenal konsep bilangan pada kelompok A di TK Islam Assalam Tlogomas Malang / Novia Dwi Jayanti
1544Penerapan model pembelajaran word square pada mata pelajaran PKn untuk meningkatkan aktivitas dan hasil belajar siswa kelas V SDN Cemorokandang 01 Kota Malang / Ali Mulia
1545Peningkatan kemampuan berbicara melalui permainan grab bag pada anak kelompok B TK PGRI Bandung Kabupaten Tulungagung / Mia Dwi Lestari
1546Pengembangan bahan pembelajaran CD interaktif tema energi dan perubahannya subtema sumber energi kelas III semester 2 Sekolah Dasar / Dwi Cahyono
1547Peningkatan keterampilan motorik kasar melalui permainan media bola di kelompok A TK Dharma Wanita Minggirsari Kabupaten Blitar / Ela Musrifah Jati
1548Peningkatan keterampilan ,menulis karangan deskripsi menggunakan model picture and picture di kelas IV SDN Kalirejo Kecamatan Lawang Kabupaten Malang / Al Aliyyu Riyantika
1549Penggunaan kartu kata bergambar untuk meningkatkan kemampuan membaca permulaan anak kelompok B di TK Al-Hidayah XI Bendogerit Kota Blitar / Arini Milla Chanifa
1550Pemanfaatan kegiatan bermain bola lagu untuk meningkatkan kemampuan bahasa anak kelompok A TK An-Nur Malang / Dwi Rakhmawati
1551Pengembangan media pembelajaran interaktif pada tema indahnya persahabatan sub tema tumbuhan sahabatku kelas III semester 2 Sekolah Dasar / Daniar Yoga Arisandi
1552Peningkatan keterampilan menulis karangan narasi siswa melalui media big book dalam cerita fabel siswa kelas III SDN Sidoharjo 2 Mojokerto / Nofita Wulandari
1553Peningkatan kemampuan menyebut bilangan 1-10 untuk anak usia 3-4 tahun melalui metode bernyanyi di PAUD Harapan Bangsa Sukorejo Kota Blitar / Nova British Putri Permata Sari
1554Pengembangan media pop-up book pada pembelajaran subtema lingkungan tempat tinggalku kelas IV SDN Bulukerto 02 Batu / Nurlaely Fazariya
1555Peningkatan kemampuan membaca permulaan anak usia dini melalui media kartu kata dan gambar di TK B PGRI Srengat Kabupaten Blitar / Dawidz Zulva
1556Penerapan permainan kotak pos Spongebob untuk mengembangkan pemahaman konsep bilangan di kelompok A TK Satu Atap Rampal Celaket 02 Malang / Lusy Dwi Apriliyatama
1557Problematika pelaksanaan proses pembelajaran kurikulum 2013 SD tahun ajaran 2015/2016 di Kabupaten Jombang / Hamam Faridatush Shofianti
1558Penerapan strategi scaffolding level 1 untuk pengembangan pemahaman konsep bilangan anak kelompok A di TK Negeri Pembina 5 Malang / Sholihatul Faizah
1559Penerapan model inkuiri untuk meningkatkan pembelajaran IPA materi daur air kelas V SDN Bandungrejosari 1 Malang / Siska Prabhandhari
1560Penerapan pembelajaran tematik tema kesehatan untuk meningkatkan hasil belajar siswa kelas III SDN Rebalas III Kecamatan Grati Kabupaten Pasuruan / Fatkhur Rozi
1561Peningkatan hasil belajar IPA melalui model coorperative learning tipe Jigsaw kelas V SDN Gadungan 05 Kabupaten Blitar / Tika dara Mareta
1562Peningkatan keterampilan motorik halus melalui teknik kolase pada anak kelompok A di PAUD Mekar Bangsa Kota Blitar / Ratna Mustika Dewi
1563Peningkatan kemampuan membaca permulaan melalui model cooperative learning make a match pada kelompok B TK PKK II Sukorejo Kota Blitar / Arnila Sekti Mega Putri
1564Penerapan model pembelajaran kooperatif tipe think pair share untuk meningkatkan pembelajaran IPS siswa kelas III di SDN Jenggot Kecamatan Krembung Kabupaten Sidoarjo / Maulidia Rokhmi
1565Meningkatkan aktifitas dan hasil belajar IPS kelas IV SDN Madyopuro 5 Malang dengan menggunakan model pembelajaran problem basic intruction (PBI) / Yubelina Elsurun
1566Penerapan pendekatan komunikatif dalam meningkatkan keterampilan berbicara siswa pada pelajaran bahasa Indonesia siswa kelas V SDN Sungiwetan Kecamatan Pohjentrek Kabupaten Pasuruan / Makruf Suroso
1567Penerapan model learning cycle untuk meningkatkan pembelajaran IPA siswa kelas IV SDIT Wildan Mukholladun Kecamatan Nglegok Kabupaten Blitar / Khusnul Khotimah
1568Pengembangan media monogi dalam pembelajaran nilai, agama, dan moral anak di TK kelompok B / Laily Nurjannah
1569Pengalaman guru terhadap implementasi pembelajaran dengan pendekatan saintek dalam kurikulum 2013 di SDN se-Gugus II Kecamatan Kedungkandang Kota Malang / Jeffry Anggy Lukmana
1570Profil kesesuian buku siswa kelas IV SD dengan kurikulum 2013 semester 1 tema Indahnya Kebersamaan di SDN Pandanwangi 4 Kota Malang / Agustinawan Purwitarini
1571Peningkatan kemampuan bahasa anak Kelompok B melalui pendekatan saintifik di TK Madinah Malang / Siti Nur Komariyah
1572Peningkatan kemampuan membaca puisi siswa dengan menggunakan metode modeling di kelas 3 SDN oro-oro Ombo Kulon I Kecamatan Rembang Kabupaten Pasuruan / Rizky Rahmaniah
1573Peningkatan kemampuan motorik halus anak melalui kegiatan 3M pada kelompok B1 TK negeri Pembina Kepanjenkidul Kota Blitar / Restu Nur Cholidah
1574Penerapan penilaian kinerja pada pembelajaran di kelas V SDN Blimbing 3 Kota Malang / Risa Listyaningrum
1575Penerapan model group investigation untuk meningkatkan aktivitas dan hasil belajar siswa pada pembelajaran IPA di kelas V SDN Mabung 2 Kabupaten Nganjuk / Wachiddaning Tiara Supardi
1576Penerapan model problem based learning untuk meningkatkan pembelajaran siswa kelas IV A SDN Ketawanggede Kota Malang / Nurul Hendra Wahyudi
1577Studi perbandingan prestasi belajar antara murid dengan latar belakang orang tuanya sebagai pengajar dan non pengajar di kelas V dan VI MINU Al-Usman Tlogowaru Kedungkandang Kota Malang / oleh Budi Susiyanto
1578Peningkatan kemampuan motorik kasar anak usia 3-4 tahun melalui permainan sirkuit mengenal binatang di PAUD Ciluk-Baa Tulungagung / Elok Dwi Kusumowardani
1579Peningkatan hasil belajar PKn melalui metode bermain peran (role playing) siswa kelas IV SDN Tuliskriyo 02 Blitar / M. Ubaidillah Al Ayyubi
1580Meningkatkan keterampilan menulis narasi melalui model pakem bagi siswa kelas V SDN Rejoso 03 Kabupaten Blitar / Tutin Setyo Rini
1581Pemanfaatan permainan sulap untuk meningkatkan pemahaman konsep bilangan anak kelompok A di TK Wisnuwardhana Wonosari Kabupaten Malang / Koko Diana
1582Penerapan metode drill untuk meningkatkan kemampuan membaca pemahaman puisi bagi siswa kelas V SDN Kayoman Purwosari Pasuruan / Anik Wijiati
1583Pemanfaatan media powerpoint dalam pembelajaran tema 6 Indahnya Persahabatan di kelas III SDN Bareng 5 Kota Malang / Dian Lestari
1584Penerapan model pembelajaran ADDIE untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V-B SDN Madyopuro 4 Kota Malang / Anthonia Seltit
1585Pemanfaatan permainan dadu untuk meningkatkan kemampuan membaca permulaan anak kelompok A TK Kartika IX-41 Malang / Masita Asih Putri
1586Pengembangan rencana pelaksanaan pembelajaran berbasis saintifik kelas III SD tema Energi dan Perubahannya subtema Perubahan Ebergi / Almia Novianti Rusma
1587Penerapan teknik learning by doing untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IV SDN Purwantoro 2 Kota Malang / Eni Widiyati
1588Penggunaan media kartu pantun untuk meningkatkan keterampilan menulis pantun siswa kelas IV MI Miftahul Ulum 2 Kecamatan Nguling Kabupaten Pasuruan / Karin Suryaningrum
1589Hubungan keterampilan membaca pemahaman dengan hasil menulis ringkasan pada siswa kelas V SDN Banjararum 01 Kecamatan Singosari Kabupaten Malang / Willa Adhawia
1590Pelaksanaan pendidikan karakter melalui pendekatan saintifik di kelas III SDN Dinoyo 03 Kota Malang / Har Furi Yuliantika
1591Pola asuh orang tua dan pendidikan anak dalam keluarga studi kasus Mawar pada keluarga Femila di SDN SDN Bandungrejosari 04 Kota Malang / Novie Yaniar Azzahra Dewi
1592Pengembangan metode permainan edukatif detektif cilik pada pembelajaran keindahan alam negeriku di kelas IV SDN Bendogerit 01 Kota Blitar / Titis Angga Rini
1593Penerapan model cooperative script untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IV SDN Kebonagung 06 Kecamatan Pakisaji Kabupaten Malang / Trias Indiantika
1594Pebelajaran konseptual dan prosedural untuk meningkatkan hasil belajar penjumlahan pecahan siswa kelas IV SDN Kasin Malang / Aulia Eva
1595Penerapan model number head together untuk meningkatkan hasil belajar pokok bahasan sejarah kerajaan Hindu, Budha dan Islam di Indonesia siswa kelas V IPS MI Hubbul Wathon Pasuruan / Robi'atul Muharromah
1596Peningkatan kemampuan kognitif melalui permainan warna balon pada anak usia 3-4 tahun di PAUD Widya Kharisma Kabupaten Blitar / Wiji Rahayu
1597Penerapan model pembelajaran talking stick untuk meningkatkan pembelajaran IPA kelas IV SDN 2 Pringapus Kecamatan Dongko Kabupaten Trenggalek / Winda Sustyanita Mutarto
1598Peningkatan keterampilan membaca permulaan menggunakan metode SAS pada siswa kelas I SDN Taji 01 Karas Magetan / Ika Damayanti
1599Penerapan permainan tepuk tebak kata beruntun untuk meningkatkan kemampuan berbicara anak kelompok B di TK Dharma Wanita Persatuan III Pasuruan / Fauziah Rizky Wikandari
1600Penggunaan media lingkungan untuk meningkatkan keterampilan menulis kalimat berita transitif bahasa Indonesia di kelas II SDN Arjosari 1 Malang / Siti Amzah
1601Penggunaan metode role playing untuk meningkatkan hasil belajar siswa pada mata pelajaran PKn kelas III SDN Benerwojo Kecamatan Kejayan Kabupaten Pasuruan / Rulasmini Khotimah
1602Peningkatan kemampuan komunikasi sosial anak dengan bermain peran pada kelompok B1 di PAUD Al Quran Kabupaten Malang / Aisyah Nur Atika
1603Penerapan model pembelajaran think pair share (TPS) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas 5 SDN Donomulyo 07 Kabupaten Malang / Tri Sulistiani
1604Problematika pelaksanaan pembelajaran tematik berdasarkan kurikulum 2013 di SDN Senggreng 04 Kecamatan Sumberpucung Kabupaten Malang / Nur Habibi Ardiansyah Agustian
1605Penerapan model pembelajaran role playing untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pada mata pelajaran IPS di SDN Nambakan Kecamatan Ringinrejo Kabupaten Kediri / Yudha Kurniawan
1606Penggunaan media blok Dienes untuk meningkatkan hasil belajar pengurangan bilangan cacah pada siswa kelas III SDN Tlogomas 2 Malang / Rupi'ah
1607Penggunaan media komik untuk meningkatkan ketrampilan membaca nyaring pembelajaran bahasa Indonesia kelas III SDN Tawangrejo I Kecamatan Pandaan Kabupaten Pasuruan / Jumiati
1608Penerapan permainan acak geometri berwarna untuk meningkatkan kemampuan kognitif anak kelompok A di TK PKK Bandulan Malang / Mutiara Oka Sofyani
1609Penerapan model TAI (Team Assisted Individualization) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV B SDN Candirenggo 04 Singosari Kabupaten Malang / Lailatul Nikmah
1610Peningkatan hasil belajar PKn melalui model Think Pair Share pada siswa kelas V SDN Pakunden 02 Kota Blitar / Toto Djetul
1611Penerapan model peta konsep (Concept Mapping) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Beji II Kecamatan Beji Kabupaten Pasuruan / Ella Yulanda Komariyah
1612Penerapan model pembelajaran index card match untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Begendeng 3 Kabupaten Nganjuk / Gatut Saputro
1613Peningkatan keterampilan berbicara melalui sajian cerita fabel dalam bentuk big book siswa kelas II di SDN Sukolilo 01 Kabupaten Malang / Nisa'ul Yonida Masruroh
1614Pengembangan modul pembelajaran tematik pada tema tempat tinggalku kelas IV SDN Kedungkandang 2 kota Malang / Dian Sukmawati
1615Pemanfaatan lingkungan sebagai sumber belajar untuk meningkatkan keaktifan dan hasil belajar siswa kelas IV pada mata pelajaran IPS di SDN Mulyorejo Kec. Kraton Kab. Pasuruan / Sri Endah Wahyuningsih
1616Meningkatkan hasil belajar dimensi tiga melalui media pembelajaran komputer siswa kelas V MI Nurul Hidayah Sukorame Pasuruan / Syuhadak
1617Meningkatkan aktivitas dan hasil belajar IPA dengan menggunakan pendekatan kontekstual pada siswa kelas V di SDN Bungur II Kecamatan Sukomoro Kabupaten Nganjuk / Yoessena
1618Penerapan teknik mind MAP untuk meningkatkan hasil belajar IPS siswa kelas V pokok bahasan persiapan kemerdekaan dan proklamasi kemerdekaan Indonesia SDN Tamansatriyan 02 Tirtoyudo Kab.MAlang / Ummu Rosidah
1619Meningkatkan hasil belajar PKn melalui model pembelajaran demokratis siswa kelas V SDN Batuaji 2 Ringinrejo Kabupaten Kediri / Zulfia Waliati
1620Penggunaan media video untuk meningkatkan kemampuan menyimak cerita pada siswa kelas V SDN Sekarpuro Kabupaten Malang / Mei Puspita Dewi
1621Penerapan pendekatan komunikatif untuk meningkatkan kemampuan menulis naskah pidato pada siswa kelas VI SDN Tampung I Kecamatan Lekok Kabupaten Pasuruan / Diana Wahyuni
1622Penggunaan model Snowball Throwing untuk meningkatkan pembelajaran IPA kelas V SDNU Bangil / Achmad Zahron
1623Penerapan model Contetextual Teaching and Learning (CTL) untuk meningkatkan pembelajaran IPA kelas IV SDN Sambigede 01 Sumberpucung-Malang / Yayuk Yuliawati
1624Penggunaan media papan magnet untuk meningkatkan hasil belajar IPS materi keragaman suku bangsa dan budaya di Indonesia kelas V SDN Kupang Sidoarjo / Tatik Maulidah
1625Penerapan model discovery untuk meningkatkan pembelajaran IPA di kelas IV MI Bahrul Ulum Kecamatan Pandaan / Li'ana
1626Peningkatan keterampilan menulis karangan narasi melalui model picture and picture pada siswa kelas III SDN Karangrejo 02 Kecamatan Kromengan Kabupaten Malang / Grace Christina
1627Meningkatkan prestasi belajar IPA melalui pendekatan keterampilan observasi media benda konkrit pada siswa kelas II SDN Taman Harjo III kec.Singosari kab.Malang / Nurjannah
1628Penerapan model pembelajaran talking stick untuk meningkatkan aktivitas dan hasil belajar siswa pada materi PKn kelas V SDN Karangrejo 02 Kabupaten Malang / Devi Jumiati
1629Penerapan metode eksperimen untuk meningkatkan hasil belajar siswa kelas IV pada materi fungsi panca indera manusia di SDN Sukoharjo I Malang / Eko Dwi Cahyono
1630Penerapan metode experimen untuk meningkatkan hasil belajar matematika pada siswa kelas 4 sekolah dasar negri bendogerit 2 kota blitar./Tri harjani
1631Penggunaan cerita di majalah anak untuk meningkatkan kemampuan membaca intensif dalam menyimpulkan cerita kelas V semester 2 SDN Karangbesuki 4 Malang / Indrawati
1632Analisis kesalahan siswa dalam penulisan karangan deskripsi di kelas V SDN Kedungkandang 2 kota Malang / Hamka
1633Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar siswa tentang konsep pengukuran waktu di kelas III SDN Kaweron 02 Talun Blitar / Luluk Nur Hamidah Ulfa
1634Penggunaan media benda asli untuk meningkatkan hasil belajar bagian-bagian tumbuhan di kelas IV SD Negeri Selokgondang 02 Kecamatan Sukodono Kabupaten Lumajang / Idha Dwi Agustin
1635Meningkatkan penguasaan konsep operasi penjumlahan dan pengurangan bilangan bulat melalui bermain pada siswa kelas V MI Miftahul Ulum 01 Wonorejo Kabupaten Pasuruan / Helna Nuri Faridiah
1636Penggunaan model pembelajaran kooperative berperspektif gender untuk meningkatkan hasil belajar IPS siswa kelas III SDN Wedoro 1 Kecamatan Pandaan Kabupaten Pasuruan / Tomy Fredek Tildjuir
1637Problematika penerapan pendekatan saintifik pada pembelajaran tematik kelas 1 SDN Gugus 3 Kecamatan Blimbing Kota Malang / Rizky Tyas Aria Kurniasari
1638Penerapan model pembelajaran Problem Based Introduction (PBI) untuk meningkatkan hasil belajar siswa kelas V pada mata pelajaran PKn di SDN Tanggung I Kota Blitar / Fransina Masela
1639Pengembangan permainan tradisional engkleng kincir angin untuk pembelajaran fisik motorik kasar anak kelompk B di TK Dharma Wanita Persatuan 1 Kepanjen / Rixana Salvia
1640Pemanfaatan pelepah dalam pembelajaran seni rupa untuk meningkatkan kemampuan berkarya seni mencetak timbul siswa kelas II SDN Merjosari 1 Malang / Carina Tania Astuti
1641Meningkatkan disiplin kelas melalui penerapan pendekatan analitik pluralistik pada pembelajaran ips kelas v sdn cemorokandang 02 malang / Noviana Putri Naryuniasari
1642Peningkatan keterampilan bercerita melalui aktivitas bercerita berbasis video dan teks cerita di kelas III Madrasah Ibtidaiyah Cemorokandang Malang / Melki
1643Hubungan perhatian orangtua dan prestasi belajar siswa kelas IV semester genap tahun pelajaran 2015/2016 SDN Madyopuro Kota Malang / Dorce
1644Penerapan media kartu huruf untuk meningkatkan keterampilan membaca nyaring dengan metode SAS siswa kelas 1 SD Negeri Slamet 01 Kecamatan Tumpang Kabupaten Malang / La'an
1645Penerapan metode pembelajaran inkuiri untuk meningkatkan aktivitas dan hasil belajar IPS kelas II MI Cemorokandang Kecamatan Kedungkandang Kota Malang semester II tahun pelajaran 2015/2016 / Samuji
1646Peningkatan keterampilan berbicara melalui penerapan metode bermain peran pada siswa kelas III SDN Madyopuro 2 Kota Malang / Desi Pranatalia
1647Meningkatkan hasil belajar perkalian bilangan cacah melalui pembelajaran discovery pada siswa kelas IV SDN Minggir, Kecamatan Wingongan, Kabupaten Pasuruan / Sugiyono
1648Pemanfaatan media blok pecahan pada penanaman konsep pecahan untuk meningkatkan pemahaman konsep pecahan di kelas III SDN Sisir 06 Kota Batu / Rini Lidiawati
1649Penerapan guided discovery learning dalam pembelajaran IPA untuk meningkatkan penguasaan konsep bagian-bagian tumbuhan pada siswa kelas II SDN Pringo kecamatan Bululawang kabupaten Malang / Yulis Purwati
1650Penerapan model concept sentence untuk meningkatkan hasil belajar siswa kelas IV pada mata pelajaran IPS di SDN Ranggeh Kecamatan Gondangwetan Kabupaten Pasuruan / Dessy Maria Kaidel
1651Penerapan mpdel course review horay pada penyederhanaan penjumlahan dan pengurangan pecahan pelajaran matematika kelas IV SDN Sumber 2 Blitar / Wahyu Saptadi
1652Peningkatan hasil belajar matematika tentang operasi pecahan melalui model teams games tournaments pada siswa kelas IV SDN Kaulon 01 Kabupaten Blitar / Pangestu Restu Pinanggih
1653Meningkatkan hasil belajar berhitung siswa kelas III SDN Mergosono 3 Kota Malang melalui pembelajaran dengan model jigsaw / Sumini
1654Penerapan model discovery untuk meningkatkan hasil belajar siswa kelas IV SDN Minggir dalam mengidentifikasi daur hidup hewan / Ahmad Sufiyan
1655Meningkatkan pembelajaran menulis deskripsi dengan model pakem pada siswa kelas V SDN Tlumpu kota Blitar / Ulya Hasanah
1656Penggunan model discovery untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Menyarik Winongan Pasuruan / Zainul Arifin
1657Penerapan model role playing untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Bokor Kecamatan Tumpang Kabupaten Malang / Septiana
1658Penerapan pembelajaran kontekstual untuk meningkatkan hasil belajar matematika pada siswa kelas V SDN Selodono Kecamatan Ringinrejo Kabupaten Kediri / Rahadian Sofianto
1659Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA siswa kelas V di SDN Buring Kecamatan Kedungkandang Kota Malang / Eko setia Budi
1660Analisis kesesuaian buku siswa kelas V tema 5 Bangga Sebagai Bangsa Indonesia dengan struktur kurikulum 2013 / Rizka Rahmawati
1661Penerapan strategi pembelajaran kooperatif kodel STAD untuk meningkatkan keterampilan bertanya siswa pada pembelajaran bahasa Indonesia kelas II di SDN Gadang I Kecamatan Sukun Kota Malang / Komsatun
1662Penerapan model pembelajaran CTL untuk meningkatkan hasil belajar IPA di kelas IV SDN Kandung Pasuruan / Arif Wicaksono
1663Meingkatkan hasil belajar IPA siswa melalui teknik quick on the draw di kelas V SDN Mandesan 01 Selopuro Kabupaten Blitar / Rizki Nindi Handayani
1664Melalui model roel playting dapat meningkatkan prsetasi belajar materi kegiatan jual beli di kelas III SDN I Tambakrejo Kabupaten Tulungagung / Fycha Febrianti
1665Peningkatan keterampilan menulis deskripsi melalui media ligkungan sekolah kelas IV SDN Bacem 03 Sutojayan Kabupaten Blitar / Ida Putriani
1666Penerapan model pembelajaran TPS untuk meningkatkan hasil belajar siswa kelas V mata pelajaran IPS di SDN Klojen kota Malang / Ruben Yosua Siarukin
1667Peningkatan hasil belajar mengenal unsur-unsur bangun datar sederhana menggunakan model example non example kelas II SDN Mandesan 01 Selopuro / Citra Nasucha Analinta Hadi
1668Peningkatan kemampuan motorik halus melalui kegiatan membuat pop up sederhana pada anak kelompok B di TK Al Hidayah Sumberbuntung Kecamatan Sanankulon Kabupaten Blitar / Ulfa Khoiril Mala
1669Penerapan pembelajaran kontekstual untuk meningkatkan pemahaman konsep sumber daya alam mata pelajaran IPS siswa kelas IV SDN Parasrejo I Pohjentrek Pasuruan / Maisaroh
1670Pendekatan sains teknologi masyarakat (STM) untuk meningkatkan hasil belajar sains siswa kelas III SDN Sukorejo Kecamatan Pohjentrek Kabupaten Pasuruan / Setyowati
1671Penggunaan media boy-boyan pada pembelajaran IPS untuk meningkatkan aktivitas belajar peserta didik kelas V di SDN Arjosari 02 Kecamatan Kalipare Kabupaten Malang / Tri Wahyuni
1672Penerapan model self directed learning untuk meningkatkan kualitas pembelajaran siswa kelas V tema 9 SDI Terpadu Nurul An-shar Kecamatan Mimbaan Kabupaten Situbondo / Rizal Tanzil Afgani
1673Penerapan model belajar inkuiri untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Alastlogo III Kecamatan Lekok Kabupaten Pasuruan / Ifa Murtiningsih
1674Penerapan model siklus belajar (learning cycle) untuk meningkatkan pembelajaran IPS siswa kelas IV SDN Karangbesuki I Kecamatan Sukun Kota Malang / Anik Faoziyah
1675Penerapan model pembelajaran cooperative script untuk meningkatkan aktivitas dan hasil belajar IPS kelas IV SDN Jatimulyo 5 Kota Malang / Riska Yuni Puspitasari
1676Pemanfaatan media gambar untuk meningkatkan prestasi belajar matematika siswa kelas I di SDN Kauman I Kota Malang / oleh Indarwati
1677Pembelajaran konseptual dan prosedural untuk meningkatkan hasil belajar pecahan senilai siswa kelas IV SDN Wonocatur Kediri / Angger Yudha Utama
1678Meningkatkan hasil belajar IPS dengan menggunakan model sinetik siswa kelas IV SD Negeri Martoporu II Kecamatan Purwosari Kabupaten Pasuruan / Nur Ain Rumaratu
1679Pemanfaatan media kartu kata untuk meningkatkan kemampuan menulis kalimat pada siswa kelas V SDN Sawojajar 1 Malang / Yanita
1680Penerapan research training model untuk meningkatkan pembelajaran IPA siswa kelas VA SDN Ketawanggede Kota Malang / Indah Kusuma Budiarti
1681Pembelajaran konsep luas segitiga dengan metode penemuan terbimbing (Guide Discovery) untuk meningkatkan alih belajar siswa kelas IV SDN 2 Ngadirenggo Kabupaten Trenggalek / Novia Anjarwati
1682Penerapan model quantum teaching untuk meningkatkan hasil belajar IPA siswa kelas V SDN Parangargo 1 Kecamatan Wagir Kabupaten Malang / Selvy Krisnasari
1683Penerapan model pembelajaran Student Team Achievement Division (STAD) untuk meningkatkan aktivitas dan hasil belajar IPS SDN Sumberpetung 01 Kabupaten Malang / Dior Ali Etha Nalynda
1684Penerapan model tari bambu pada pembelajaran berbicara untuk meningkatkan kemampuan berfikir kreatif siswa kelas V SDN 2 Pringapus Kabupaten Trenggalek / Kardiana Metha Rozhana
1685Pengembangan permainan Dadu Huruf pada kemampuan membaca berbasa anak Kelompok A di Radudhatul Athfal / Nuryanti Musdalifatus Syamsiyah
1686Penerapan model Sains Teknologi Masyarakat (STM) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Sendang I Kecamatan Senori Kabupaten Tuban / Diah Novitasari Jauhari
1687Persepsi guru SD Negeri Gugus 2 Kecamatan Klojen, Kota Malang tentang pembelajaran dalam kurikulum 2013 / Dewik Wulan Prihatiningsih
1688Penerapan model eksperimen untuk meningkatkan pembelajaran IPA kelas IVB di SDN Sawojajar 1 Kota Malang / Lulu Andriyani
1689Penggunaan media gambar foto untuk meningkatkan aktivitas dan hasil belajar siswa pada pembelajaran IPS materi kegiatan ekonomi kelasw IV SDN Rejosokidul Rejoso Pasuruan / Asia Ningsih
1690Penerapan model pembelajaran JIGSAW untuk meningkatkan kemampuan membaca dalam memahami isi cerita pendek pada siswa kelas V SDN Gedog 1 Sananwetan Blitar / Fibrian Kusuma Arumanti
1691Meningkatkan kemampuan belajar siswa pada mata pelajaran PKn dengan menggunakan model pembelajaran pembentukan konsep di kelas IV SDN Manaruwi II Kecamatan Bangil Kabupaten Pasuruan / Fatmah Letsoin
1692Pengembangan permainan "tornado binatang" dalam pembelajaran kognitif anak TK Dharma Wanita Persatuan 01 Dinoyo Malang / Mubakhatul Jannah
1693Penggunaan modul untuk meningkatkan pembelajaran IPA pada siswa kelas IV MI Bhrul Ulum Pakisaji Kabupaten Malang / Ahmad Junaidi
1694Penerapan model pembelajaran Dick and Carey untuk meningkatkan hasil belajar siswa mata pelajaran IPS kelas IV SDN Bandulan 5 Kecamatan Sukun Kota Malang / Ika Ayu Kumalasari
1695Pengembangan media pembelajaran peta keberagaman budaya Kota Malang mata pelajaran IPS kelas IV SDN Cemorokandang 2 Kecamatan Kedungkandang Kota Malang semester II tahun pelajaran 2015/2016 / Milson
1696Pemanfaatan media pembelajaran berbasis microsoft power point untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas III SDN Cemorokandang 2 Malang / Ike Oktaria
1697Penerapan model pembelajaran problem based instruction (PBI) untuk meningkatkan hasil belajar penjumlahan pecahan siswa kelas IV SDN Madyopuro 3 Kecamatan Kedungkandang Kota Malang / Rembulan Parsin
1698Penerapan metode demonstrasi untuk meningkatkan kemampuan membuat hiasan teknik mozaik pada pembelajaran SBK kelas IV SDN Dampit 02 Kabupaten Malang / Aminnatul Widyana
1699Penerapan model jigsaw dalam meningkatkan pembelajaran IPA kelas IV SDN Citrodiwangsan 01 Lumajang / Vivi Arum Lestari
1700Penerapan metode sosiodrama untuk meningkatkan kemampuan bersosialisasi anak kelomp[ok A TK An-Nur Kelurahan Sawojajar Kecamatan Kedungkandang Kota Malang / Dewi Amelia Christanti
1701Pembelajaran membaca dan menulis permulaan dengan perpaduan metode bunyi dan SAS bagi siswa sekolah dasar kelas awal / oleh Luluk Herminaty
1702Perbedaan prestasi belajar siswa pada pokok bahasan kepentingan umum yang diajar dengan metode solving dan metode ceramah (penelitian di SDN Sawojajar VI Kota Malang) oleh Erna Wahyuni
1703Pembentukan konsep perkalian bilangan cacah pada siswa
kelas II SDN Beji Kecamatan Junrejo Batu Tahun 2004 / oleh Sutriyarni
1704Penggunaan media foto seri untuk meningkatkan kemampuan menulis cerita pengalaman pada mata pelajaran bahasa Indonesia di kelas III SDN Lowokwaru 3 Malang / Iftitah Ainur Rozidah
1705Pengembangan permainan engklek geometri pada pembelajaran fisik motorik anak Kelompok B di TK Muslimat 8 Singosari / Afin Fitani
1706Pengembangan sirkuit jelajah alam memanfaatkan lingkungan sekolah untuk melatih kemandirian pada anak Kelompok A / Ella Rifka Adhadila
1707Peran guru dalam pembentukan karakter peserta didik di SDN Pulungdowo 2 Kecamatan Tumpang Kabupaten Malang / Rizky Rahmalia
1708Penggunaan media wayang kulit sebagai upaya peningkatan nilai-nilai karakter siswa kelas 4 di SDN Mergosono 4 Kota Malang / Ari Nur Aini
1709Meningkatkan hasil belajar dalam pembelajaran IPA pokok
bahasan bunyi dengan menggunakan metode eksperimen bagi
siswa kelas IV SDN Kotalama 10 / oleh Muji Lestari
1710Penerapan brain gym untuk meningkatkan kemampuan menulis permulaan anak di kelompok A Taman Kanak-kanak Negeri Pembina Bumiaji / Wuri Hartanti
1711Pengembangan media CD interaktif pada subtema prestasi sekolahku untuk siswa kelas II di SDK Santa Maria 3 Malang / Yuni Setya Rini
1712Penggunaan batang cuisenaire untuk meningkatkan pemahaman konsep pecahan pada siswa kelas III SDN Baron 1 Nganjuk / Diyana Riyani
1713Pemanfaatan lingkungan alam sekitar untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Gadang 1 Kecamatan Sukun Kota Malang / Ely Kristiyana Cahyaningtrang
1714Hubungan antara budaya membaca dengan keterampilan menulis cerita pendek siswa kelas 5 SDN se-Kecamatan Lowokwaru Kota Malang / Dinni Putri Ningtyas
1715Penerapan model pembelajaran terpadu tipe connected untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Martopuro II / Maria Theresia Kilmas
1716Penerapan model pembelajaran group resume untuk meningkatkan hasil belajar PKn di kelas IV SDN Madyopuro II Kecamatan Kedungkandang Kota Malang / Habida Tuburpon
1717Penerapan pembelajaran sosiodrama untuk meningkatkan keaktifan proses belajar IPS siswa kelas IV SDN Cemorokandang 1 Malang / Kristina Putri Ayu Rahayu
1718Penerapan model problem solving untuk meningkatkan kemampuan berpikir kritis dan hasil belajar siswa kelas IV SDN Kebonagung 06 Kec. Pakisaji pada mata pelajaran IPS / Wahyu Widyastuti
1719Pemanfaatan perpustakaan untuk meningkatkan kemampuan membaca siswa kelas II SDN Sidogiri I Kraton Pasuruan / Jami'ati
1720Meningkatkan hasil belajar IPS dengan menerapkan model pembelajaran peta konsep pada siswa kelas V MI Roudlotul Banat Sladi Kejayan Pasuruan / Riris Lailiyah
1721Meningkatkan kemampuan pemecahan masalah matematika dengan langkah Polya pada siswa kelas VI SDN Ketawang Kecamatan Gondanglegi / Sulis Prastyowati
1722Penerapan metode eksperimen dalam pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas III-B SDN Pagentan 02 Singosari - Malang / Witayah
1723Penerapan pendekatan kontekstual untuk meningkatkan keterampilan menulis puisi siswa kelas V di SDN Grati 2 Kabupaten Pasuruan / Aditya Rizky Pradana
1724Implementasi model integrated untuk meningkatkan pemahaman konsep dan menyusun laporan hasil musyawarah siswa SDN Sladi Kecamatan Kejayan Kabupaten Pasuruan / Damianus Rahawarin
1725Penerapan model inkuiri terbimbing untuk meningkatkan kualitas pembelajaran IPA siswa kelas IV MI Miftahul Ulum Banjarkejen Pandaan / Moh. Fauzi
1726Meningkatkan hasil belajar PKn melalui model Think Pair and Share (TPS) di kelas IV SDN Plosoarang 02 Kecamatan Sanankulon Blitar / Endang Sri Wulandari
1727Penggunaan kartu kata bergambar untuk meningkatkan kemampuan membaca dan menulis siswa kelas I SDN Sumbergondo 02, Bumiaji Kota Batu / Susanti
1728Pemanfaatan media kartu gambar untuk meningkatkan aktivitas dan hasil belajar siswa kelas V tentang persebaran flora dan fauna wilayah Indonesia di SDN Kandung, Kecamatan Winongan, Kabupaten Pasuruan / Agus Budiono
1729Penerapan media gambar untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV pada pembelajaran PKn di SDN Lakarsantri I/472 Surabaya / Mujarofah
1730Persepsi guru tentang implementasi pembelajaran tematik terpadu di SD Negeri se-kecamatan Kedungkandang Kota Malang / Lavita Erni Munikasari
1731Penerapan model CIRC berbantuan media boneka tongkat untuk meningkatkan kemampuan bercerita dalam dongeng di kelas III SDN Kanigoro 02 Kecamatan Pagelaran / Dwi Agus Setiawan
1732Pengembangan media CD interaktif pembelajaran subtema Aku Bangga dengan Daerah Tempat Tinggalku kelas IV SDN Lowokwaru 02 Kota Malang / Angga Pradana
1733Penerapan model pembelajaran inkuiri dalam meningkatkan hasil belajar menghitung luas bangun datar persegi panjang pada siswa kelas III SDN Maa'rif kota Blitar / Ninik Marya Ulfa
1734Penerpan model numbered head together untuk meningkatkan kemampuan membaca pemahaman siswa kelas IV SDN Pasanggrahan 02 kota Batu / Vita Dwi Agustina
1735Penelitian tindakan kelas penerapan metode demontrasi dalan ilmu pengetahuan alam tentang sifat-sifat cahaya dapat meningkatkan prestasi belajar pada siswa kelas V SDN Kolomayan 02 kecamatan Wonodadi kabupaten Blitar / Komsatun
1736Implementasi model cooperative integrated reading and composition (CIRC) untuk meningkatkan pembalajaran IPA siswa kelas V SDN Bareng 5 Malang / Luthfi Muthmainah
1737Penerapan model Group Investigation (GI) untuk meningkatkan aktivitas dan hasil belajar IPS kelas IV di SDN Rampal Celaket 2 Kecamatan Klojen Kota Malang / Siti Mahmudah
1738Meningkatkan pemahaman operasi hitung campuran melalui problem solving pada siswa kelas V SDN Tunggulwulung I Pandaan Pasuruan / Dirjo
1739Penerapan media teka-teki silang untuk meningkatkan hasil belajar IPS kelas 5 SDN Lebakrejo 03 Purwodadi Pasuruan / Setyo Budi Hartanto
1740Penerapan pendekatan keterampilan proses untuk meningkatkan pemahaman konsep luas segitiga pada matapelajaran matematika siswa kelas IV SDN Rampal Celaket I Kota Malang / Purnamasari Pertiwi
1741Penggunaan permainan kartu bilangan untuk meningkatkan aktivitas dan hasil belajar penjumlahan bilangan dua angka pada siswa kelas I SDN Turupinggir II Megaluh Jombang / Endi Pertama Putra
1742Penerapan model pembelajaran team assisted individualization untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas IV SDN Candirenggo IV Singosari Malang / Rijfa Hadita
1743Penggunaan media manik "POS NEG" untuk meningkatkan aktivitas dan hasil belajar matematika siswa kelas IV SDN Tanjungsekar 1 Malang / Riski Novita Sari
1744Penerapan model pembelajaran Predict, Observe, and Explain (POE) untuk meningkatkan kualitas pembelajaran IPA kelas V SDN Pisangcandi 4 Malang / Winda Ayu Ningtyas
1745Penerapan model pembelajaran Two Stay Two Stray (TSTS) untuk meningkatkan kualitas pembelajaran IPA kelas VA SDN Pakunden 2 Kota Blitar / Arifendi Ahwanto
1746Pemanfaatan media gamar bangun datar untuk meningkatkan prestasi belajar matematika siswa kelas I di SDN Blimbing II Malang / oleh Kurniasih Endah Supatmi
1747Penerapan CTL untuk meningkatkan motivasi, aktivitas dan prestasi belajar siswa kelas IV SDN Tangkilsari I Kecamatan Tajinan Kabupaten Malang pada pembelajaran sains pokok bahasan engeri dan perubahannya / Qurrotul Aini
1748Penerapan model Learning Cycle (LC) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN 2 Bloro Kecamatan Besuki Kabupaten Situbondo / Fitriana Dwi Kartika
1749Penerapan pendekatan CTL untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Wonorejo I kecamatan Lumbang / Nur Aisah
1750Penerapan pembelajaran Contextual Teaching & Learning (CTL) untuk meningkatkan hasil belajar matematika pokok bahasan penjumlahan pada siswa kelas II SDN Pohgaji 03 kecamatan Selorejo kabupaten blitar / Sri Winarti
1751Penerapan pendekatan kontekstual untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Sawojajar 2 Kota Malang / Warti
1752Upaya meningkatkan kemampuan siswa dalam menentukan KPK melalui karta bilangan teratur pada siswa kelas IV SDN Plososari 3 Grati Pasuruan / Badiatuz Zumroh
1753Pembelajaran konseptual da prosedural untuk meningkatkan hasil belajar perkalian bersusun siswa kelas IV SDN Tumpang 02 Blitar / Lely Mayasari
1754Penerapan model pembelajaran time token arends untuk meningkatkan keterampilan berbicara siswa kelas V SDN Ketawanggede 2 Kota Malang / Rata Sari Dewi
1755Penerapan pendekatan quantum learning untuk meningkatkan pembelajaran IPA siswa kelas IV A SDN Bareng 01 kota Malang / Dwi Ana Lestari
1756Penerapan SQ3R untuk meningkatkan kemampuan membaca pemahaman siswa kelas V di SDN Ketawanggede 2 MAlang / Fitri Setyorini
1757Upaya meningkatkan pembelajaran IPA melalui model pembelajaran ARCS (Attention, Relevance, Confidence, Satisfaction) pada siswa kelas IV SDN Jatimuluo 1 Kecamatan Kauman Kabupaten Tulungagung / Widha Bhinartika
1758Pengembangan bahan pembelajaran CD interaktif dengan subtema keindahan alam negeriku kelas IV Sekolah Dasar / Susanti Aulia Dewi
1759Penggunaan media pembelajaran interaktif berbasis CD untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Nongkojajar I Pasuruan / Siti Fatimah
1760Peningkatan kemampuan kognitif melalui permainan tebak namaku pada kelompok B TK Dharma Wanita Desa Sekargadung Kecamatan Pungging Kabupaten Mojokerto / Nina Veronica
1761Penerapan pembelajaran model cooperative learning dengan NHT untuk meningkatkan hasil belajar PKn siswa kelas III SDN Kertajaya V Surabaya / Elly Andriani
1762Pengembangan media kartu kata untuk melatih keterampilan membaca permulaan pada siswa kelas 1 SDN Wonokerto 01 Kecamatan Bantur Kabupaten Malang / Roza Tiya Andhini
1763Upaya meningkatkan kemampuan menentukan KPK dan FPB melalui pembelajaran matematika realistik pada siswa kelas IV SDN Lesanpuro 3 kota Malang / Didik Rohmani Prasetiawan
1764Peningkatan keterampilan membaca teks melalui metode permainan bahasa siswa kelas I SDN Slamet 01 Kecamatan Tumpang / Deo Oktavia J.
1765Pendekatan kooperatif model TGT untuk meningkatkan hasil belajar IPA siswa kelas V MI Nurul Ulum Sebalong Nguling Pasuruan / Siti Fahroh
1766Penerapan model pembelajaran ctl dengan metode inquiri dalam meningkatkan hasil belajar IPA siswa kelas IV SDN Ngrejo 01 Kec. Bakung Kab. Blitar tahun pelajaran 2009/2010 / Mariyatim
1767Penerapan model pembelajaran make a match untuk meningkatkan aktivitas dan hasil belajar siswa mata pelajaran IPS kelas VB SDN Percobaan I Kota Malang / Nike Fatma Ristantia
1768Analisis buku siswa kelas 1 SD kurikulum 2013 dengan tema Kegiatanku edisi revisi / Miftah Mudhita
1769Peningkatan kemampuan kognitif tentang konsep bilangan melalui permainan "karpet angka" pada anak kelompok A di TK Negeri Pembina / Lia Dwi Apriliani
1770Pemanfaatan media tiruan kebun binatang pada pembelajaran IPA untuk meningkatkan hasil belajar siswa kelas IV MI Ma'arif Legok-Gempol / Achmad Bustanul Arifin
1771Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar materi skala siswa kelas V SDN Jeladri I Kecamatan Winongan Kabupaten Pasuruan / Maria Ulfa
1772Penggunaan media film dan video interaktif untuk meningkatkan kualitas pembelajaran metamorfosis hewan di kelas IV SDN Sumbermanjingkulon 05 Kecamatan Pagak Kabupaten Malang / Dina Rosikkawati
1773Peningkatan kemampuan motorik halus anak Kelompok B melalui kegiatan kreasi kertas kokoru di TK Muslimat NU Sumbersuko 01 Lumajang / Adiningsih Kartika Sari
1774Peningkatan hasil belajar IPS melalaui modeel make a match di kelas 4 SDN Selokajang 3 Kabupaten Blitar / Ahmad Dennis Widya Pradana
1775Hubungan kemampuan membaca pemahaman dengan penyelesaian soal cerita matematika siswa kelas III SD se-kecamatan Jabung Kabupaten Malang / Intan Syahara
1776Penerapan model advance organizer untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas V SDN Cemorokandang 02 Kota Malang / Anisa Susetyaningrum
1777Penerapan pembelajaran model deep dialogue/critical thinking untuk meningkatkan aktivitas dan hasil belajar PKn siswa kelas VI SDN Arjosari 2 Kecamatan Blimbing Kota Malang / Twista Ria
1778Penugasan membaca di perpustakaan untuk meningkatkan kemampuan menulis karangan siswa kelas VI SDN Ngrombot I Kecamatan Patianrowo Kabupaten Nganjuk / Pipit Pudji Astutik
1779Penggunaan media wayang kancil untuk meningkatkan pemahaman terhadap isi dongeng dalam mata pelajaran bahasa jawa kelas II SDN Kedawung II Blitar / Tyadita Fitria Wardani
1780Penerapan permainan "Mana Aku" untuk meningkatkan kemampuan kognitif memahami konsep lambang bilangan pada anak kelompok B di TK Aisyiyah 7 Kota Malang / Nuril Lailatun Khabiba
1781Pengembangan permainan petak umpet ceria pada pembelajaran berbicara anak usia 4-5 tahun / Dwi Lismiyanti
1782Penggunaan media pembelajaran peta kabupaten setempat untuk meningkatkan hasil belajar IPS kelas IV tentang kegiatan ekonomi dan sumber daya alam di SDM Ampelsari III Kecamatan Pasrepan Kabupaten Pasuruan / Surtini
1783Pennigkatan hasil belajar IPS tentang kegiatan jula beli dengan metode bermain peran pada siswa kelas 3 di SDN Tanggung II Kota Bliitar / Zakky Maftuhur Rizaq
1784Penerapan model pembelajaran guided discovery inquiry untuk meningkatkan kemampuan mengkonstruksi konsep IPA pada siswa kelas IV SDN Ngaglik II / Reti Febriana
1785Hubungan antara prestasi belajar bahasa Indonesia dengan kemampuan menyelesaikan soal cerita dalam matematika siswa kelas IV SDN Tanjungrejo I Kecamatan Sukun Kota Malang / oleh Komarodin
1786Penggunaan media papan flanel buaya lapar untuk meningkatkan kemampuan kognitif memahami konsep lebih banyak dan lebih sedikit pada anak kelompok B TK Kartika IV-I Malang / Ummi Nadhiroh
1787Penerapan media flashcard untuk meningkatkan keterampilan membaca permulaan siswa kelas 1 SDLB Autis Laboratorium UM / Santi
1788Penerapan model STAD dengan permainan kuis "KHT" dalam pembelajaran IPS untuk meningkatkan partisipasi siswa kelasV SDN Gedogkulon 01 Kabupaten Malang / Dewi Sukma Ningrum
1789Penggunaan mind map (peta pikiran) untuk meningkatkan pembelajaran IPA kelas V SDN Bareng 5 Malang / Oktoyuana Hardian Perwitasari
1790Peningkatan hasil belajar IPS melalui model pembelajaran snowball throwing di kelas IV A SDN 1 Ngulankulon Kabupaten Trenggalek / Raneza Mundi Warih
1791Penerapan pembelajaran inquiry untuk meningkatkan hasil belajar IPA siswa kelas V SDN Tutur 1 Pasuruan / Ponidi
1792Peningkatan perkembangan bahasa menggunakan model scramble pada kelompok B TK Dharma Wanita Minggirsari Kabupaten Blitar / Adinda Tri Tabah Juang Pangestuti
1793Pengembangan media pembelajaran berbasis powerpoint pada aspek nilai, agama, dan moral untuk abak TK kelompok B / Renja Dwi Andika
1794Pengembangan media manik-manik hitung untuk pengenalan pada anak kelompok A / Kartika Ananda
1795Meningkatkan hasil belajar IPA siswa melalui pendekatan kontekstual di kelas IV SDN Karang Besuki I Kecamatan Sukun Kota Malang tahun ajaran 2008/2009 / Dita Purwoadi Susanto
1796Pemanfaatan bahan alam untuk meningkatkan kemampuan mencetak timbul siswa kelas II SDN Karangbesuki 1 Sukun Malang / Fadilla Zuhria Prista
1797Pengembangan media buku flanel seri pada pembelajaran bercerita anak kelompok B di Taman Kanak-kanak Kabupaten Lumajang / Agustiarini Eka Dheasari
1798Peningkatan kemampuan kognitif AUD melalui kegiatan meronce berpola pada kelompok usia 4-5 tahun diPAUD Brillianm Sumberjo Kabupaten Blitar / Devi Diantika Mutiara
1799Peningkatan kemampuan berbahasa melalui media bantal cerita pada anak Kelompok A TK Al-Hidayah 01 Tawangrejo Kabupaten Blitar / Yuni Indarwati
1800Peningkatan hasil belajar mengenal teknologi produksi melalui metode karyawisata pada siswa kelas IV SDN 3 Beji Kabupaten Tulungagung / Dwi Wahyuning Tiyas
1801Penerapan peta konsep untuk meningkatkan prestasi belajar IPA pada pokok bahasan benda dan sifatnya siswa kelas IV di SDN Maguan 1 Kecamatan Ngajum Kabupaten Malang / Fakih Dian Tri Kuncahyo
1802Pengembangan flipbook elektronik pada pembelajaran literasi subtema peninggalan-peninggalan kerajaan islam di Indonesia untuk kelas V SDN Sawojajar 4 Kota Malang / Khalida Hardani
1803Penerapan peta konsep untuk meningkatkan kemampuan menceritakan kembali teks bacaan 10-15 kalimat siswa kelas II A SDN Bunulrejo 1 Malang / Vivitalia Prabatasari
1804Perbedaan penggunaan media narasi bergambar dengan media narasi tidak bergambar terhadap kemampuan siswa dalam menulis karangan narasi kelas V SDN Singopadu Kecamatan Tulangan Kabupaten Sidoarjo / Muhammad Arifuddin
1805Peningkatan kemampuan motorik halus melalui kegiatan menganyam sederhana kelompok B TK Dharma Wanita Kabupaten Blitar / Rysza Putri Rohmatul Hidayati
1806Penerapan model pembelajaran quantum learning untuk meningkatkan hasil belajar IPA di kelas IV SDN Pandean I Kecamatan Gondang Kabupaten Nganjuk / Sumiatin
1807Peningkatan hasil belajar matematika tentang bangun datar melalui media sirkuit pintar pada kelas III SDN Sidomulyo 02 Kabupaten Blitar / Dimas Rachmad Aziz
1808Penerapan permainan detektif koin untuk mengembangkan keterampilan berhitung permulaan pada anak kelompok B TK PKK Bina Ana Prasa Pakis / Feni Wulandari
1809Penggunaan metode silabel untuk meningkatkan kemampuan membaca permulaan di kelas I SDN Lemahbang Kecamatan Pasrepan Kabupaten Pasuruan / Sukhaifa Jum'ati
1810Hubungan penguasaan kosa kata dengan kemampuan menulis cerita pengalaman siswa kelas IV di gugus 2 Kecamatan Sampung Kabupaten Ponorogo / Dheny Wahyuningtyas
1811Penerapan pembelajaran tematik-tema lingkungan untuk meningkatkan prestasi belajar siswa kelas II SDN Penanggunan Malang / Nurainy Soraya
1812Penerapan pendekatan problem posing untuk meningkatkan kecakapan berpikir (Thinking skill) dan prestasi belajar matematika siswa kelas V SDN Belotan I / Tri Susilowati
1813Penerapan strategi DRTA untuk meningkatkan hasil belajar membaca pemahaman subtema komponen ekosistem siswa kelas V SDN Percobaan 2 Malang / Kardiani Izza Ell Milla
1814Penerapan model pembelajaran modification of resiprocal teaching untuk meningkatkan hasil belajar IPA siswa kelas III SDN Tawangargo 02 Kecamatan Karangploso Kabupaten Malang / Ike Maulida Andini
1815Strategi pengembangan sosial emosional di TK Satu Atap Rampal Celaket 2 Malang / Ryska Mey Dysmayanti
1816Penerapan permainan kata berantai untuk meningkatkan pemahaman siswa tentang harga diri pada PKn kelas III SDN Banjararum 03 Malang / Sulicha
1817Penerapan pendekatan sains teknologi masyarakat (STM) dalam meningkatkan hasil belajar siswa mata pelajaran IPA kompetensi dasar proses daur air dan kegiatan yang mempengaruhinya di kelas V SDN Gadang I Kota Malang / Septiana Dyah Winanty
1818Penerapan pembelajaran kooperatif model stad berbantuan bahan manipulatif yang dapat meningkatkan pemahaman konsep penjumlahan dan pengurangan pecahan pada siswa SD kelas IV / Maria Emanuela Ewo
1819Pelaksanaan penilaian autentik pada kurikulum 2013 di SD Kota Mojokerto / Etika Roudhatul Khasanah
1820Penerapan strategi bermain kartu domino perkalian untuk meningkatkan hasil belajar matematika siswa kelas III SDN Sepanjang II Kecamatan Gondanglegi Kabupaten Malang / Inin Ma'rifa
1821Penerapan pembelajaran realistic mathematics education (RME) untuk meningkatkan penguasaan konsep operasi perkalian bilangan cacah pada siswa kelas II SDN Sumberbening I Kabupaten Ngawi tahun pelajaran 2008/2009 / Milanita Puspita Willyanti
1822Penggunaan media gambar seri untuk meningkatkan kemampuan menulis karangan narasi siswa kelas III SD Negeri 46 Parepare / Tasrif Akib
1823Penerapan model mind mapping untuk meningkatkan keterampilan menulis karangan naratif pada siswa kelas V SDN Tulusrejo 4 Kecamatan Lowokwaru Kota Malang / M. Ziyan Takhqiqi Arsyad
1824Pemanfaatan media alam sekitar untuk meningkatkan prestasi belajar IPA siswa kelas 4 SD / Arief Destyan Faisal M.
1825Penerapan media ritatoon untuk meningkatkan aktivitas dan hasil belajar mata pelajaran IPS siswa kelas IV SDN Bumiayu 2 Malang / Nikmatul Mufidah
1826Penerapan pembelajaran kontekstual dengan metode inkuiri untuk meningkatkan aktivitas dan hasil belajar sains siswa kelas V Madrasah Ibtidaiyah Darussalam Malang / Septavia Dewi Savitri
1827Penerapan model pembelajaran Assurance, Relevance, Interest, Assessment, Satisfaction (ARIAS) untuk meningkatkan kemampuan memerankan tokoh drama di kelas V SDN Tanjungrejo 5 Kec. Sukun Kota Malang / M. Ridwan Asyrofy
1828Pemanfaatan kartu huruf untuk meningkatkan keterampilan membaca permulaan siswa kelas 1 SDN Tulusrejo V Kecamatan Lowokwaru Kota Malang / Sri Wahyuningsih
1829Penerapan model direct instruction (DI) untuk meningkatkan hasil belajar dan keaktifan siswa dalam pembelajaran IPA kelas V SDN Sukoharjo 1 Kota Malang / Ris Talaohu
1830Penerapan teknik bublle blower painting untuk meningkatkan kemampuan mengenal warna anak kelompok A2 TK Kartika IX-41 Malang / Yudiana Damayanti
1831Penerapan model deep learning untuk meningkatkan hasil pembelajaran IPS siswa kelas III SDN Lesanpuro 3 Kecamatan Kedungkandang Kota Malang / Lodia Wayerjuari
1832Peningkatan keterampilan membaca permulaan melalui media big book multiple activities pada siswa kelas 1 SDN Madyopuro 2 Malang / Suci Anggraeni
1833Penerapan model think pair share (TPS) untuk meningkatkan pembelajaran IPA kelas V SDN Sedayu 03 Kecamatan Turen Kabupaten Malang / Ana Najmatul La'ali,
1834Penerapan model pembelajaran Picture and Picture untuk meningkatkan aktivitas dan hasil belajar IPS kelas 3 di SDN Tumpang 02 Kecamatan Tumpang Kabupaten Malang / Ida Nurdiana
1835Permainan Kartu Acak untuk Meningkatkan Kosa Kata Anak Kelompok B TK Negeri Pembina I Kota Malang
1836Penggunaan media poster untuk meningkatkan keterampilan menulis puisi siswa kels V SDN Sumbersari 2 Malang / Reni Puspitasari
1837Penerapan model siklus belajar (learning cycle) untuk meningkatkan aktivitas dan hasil belajar IPA materi gaya pada siswa kelas V SDN Pagelaran 02 Malang / Vivi Sumanti
1838Pemanfaatan media permainan wayang kartun untuk meningkatkan keterampilan berbicara pada siswa kelas II SDN Oro-oro Dowo Malang / Galuh Setyowati
1839Perbedaan hasil belajar IPS siswa kelas IV melalui model pembelajaran jigsaw dengan pembelajaran konvensional di SDN se-gugus 4 Kecamatan Pagak Kabupaten Malang / Khoirul Arifin
1840Penerapan pembelajaran matematika realistik untuk meningkatkan hasil belajar siswa pada pokok bahasan pembagian di kelas II SDN. Siyar Kec. Rembang / Sohifah
1841Peningkatan hasil belajar aktivitas ekonomi melalui media video interaktif pada siswa kelas IV SDN Panggungduwet 01 Kabupaten Blitar / Eko Wulandari
1842Pemanfaatan lingkungan untuk meningkatkan keterampilan menulis deskripsi siswa kelas V SDN Panggungrejo I Blitar / Yeni Arista
1843Penggunaan media kartu gambar seri untuk meningkatkan kemampuan bercerita anak mata pelajaran Bahasa Indonesia kelas II SDN menampu 03 Kecamatan Gumukmas Kabupaten Jember / Anis Mawati
1844Peningkatan kemampuan motorik halus melalui teknik menjiplak bentuk pada kelompok A TK nurul Huda Banjarejo Kabupaten Tulungagung / Faida Khoirun Nisa
1845Meningkatkan kemampuan menulis jurnal pribadi dengan strategi pemodelan siswa kelas V SD Negeri Bareng 5 Kecamatan Klojen Kota Malang / Maya Noya
1846Penerapan model Learning Cycle (LC) 5 fase untuk meningkatkan pembelajaran IPA siswa kelas IV B SDN Penanggungan Kota Malang / Choirul Anam
1847Pengembangan permainan Dakon Binatang untuk mengembangkan kemampuan kognitif anak Kelompok A TK Permata Bunda sawojajar Malang / Nur Irfayanti
1848Peningkatan hasil belajar IPS melalui model picture and picture bagi siswa kelas IV SDN Turi II Kota Blitar / Jakobus Bruno Rumlus
1849Meningkatkan kemampuan memahami isi bacaan melalui penerapan teknik guided reading pada siswa kelas IV SDN Toyomarto 02 Kecamatan Singosari / Novi Mauludyah
1850Penggunaan lingkungan sekitar sebagai media pembelajaran untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Rejosari 1 Kecamatan Bantur Jabupaten Malang / Endri Kurniadi
1851Penerapan pendekatan inkuiri untuk meningkatkan kemampuan siswa menggambar ilustrasi dengan tema benda alam pada siswa kelas IV SD Islam Kota Blitar Kecamatan Kepanjen Kidul Kota Blitar / Danan Kholid Sahaka
1852Penerapan pakem untuk meningkatkan prestasi belajar IPA pada siswa kelas IV di SDN Tlogowaru 2 / Suci Fitriana
1853Penerapan model jigsaw untuk meningkatkan pemahaman belajar siswa tentang globalisasi di kelas IV SDN Kauman 2 Kecamatan Klojen Kota Malang / Mesak Apalem
1854Penerapan teori belajar Van Hiele untuk meningkatkan pemahaman konsep balok dan kubus siswa kelas IV SDN Polowijen 2 Kecamatan Blimbing Kota Malang / Shofa Ardiana
1855Implementasi model learning cycle untuk meningkatkan pembelajaran IPA pada materi pesawat sederhana di kelas V SDN Sawojajar 2 Malang / Bunga Lena Mayangsari
1856Penggunaan media ritatoon untuk meningkatkan hasil belajar daur hidup serangga di kelas IV SDN Patuguran 1 Kabupaten Pasuruan / Aini Zukhria
1857Penggunaan strategi survey, question, read, record, recite, dan review (SQ4R) untuk meningkatkan keterampilan membaca pemahaman di kelas V SDN Kasin Kota Malang / Riska Puspita Sari
1858Penggunaan media gambar seri untuk meningkatkan hasil belajar mata pelajaran IPS siswa kelas V SDN Pancur 01 Pasuruan / Umiarsih
1859Peningkatan kemampuan kognitif melalui permainan mencari angka pada kelompok A di TK Kartini Tenggur Kecamatan Rejotangan Kabupaten Tulungagung / Melga Dwi Rohmah
1860Peningkatan keterampilan menulis huruf tegak bersambung melalui metode Struktural Analitik Sintetik (SAS) pada siswa kelas II SDN Saptorenggo 3 Kabupaten Malang / Nuril Qurroti A'yun
1861Pembelajaran kontekstual untuk meningkatkan hasil belajar IPS siswa kelas II-B SDN Mergosono I Kota Malang / Suhartini
1862Meningkatkan prestasi belajar matematika tentang soal cerita dengan pemecahan masalah model Polya siswa kelas III SDN Nglundo 1 Sukomoro / Gatot Subroto
1863Persepsi guru tentang penilaian pembelajaran pada kurikulum 2013 di SD Negeri Kota Malang / Rizki Ari Rahmawati
1864Penerapan model quantum teaching untuk meningkatkan kualitas pembelajaran pada mata pelajaran IPS kelas V MI Islamiyah Kebonsari Kota Malang / Evy Rosalina Susanti
1865Peningkatan hasil belajar tentang penjajahan Belanda dan Jepang melalui model mind mapping pada siswa kelas V SDN Karangrejo 04 Kabupaten Blitar / Tiara Yusuf
1866Keefektifan penggunaan metode diskusi dalam meningkatkan prestasi belajar sains di kelas IV SDN Kotalama 2 Kota Malang / Upit Witasari
1867Penggunaan metode eksperimen untuk meningkatkan hasil belajar siswa pada pembelajaran IPA pokok bahasan sifat-sifat cahaya kela V SDN Tekung 02 Lumajang / Dhia Suprianti
1868"Penerapan model pembelajaran bermain peran untuk meningkatkan hasil belajar PKn siswa kelas IV SDN Duwet 04 Kecamatan Tumpang Kabupaten Malang" / Tri Tutus Ikhwandaru
1869Penerapan pendekatan realistik mathematics education untuk meningkatkan pemahaman konsep pecahan pada siswa kelas III SDN Ampelgading 02 Blitar / Dwi Nursamsyudin
1870Penerapan metode eksperimen untuk meningkatkan hasil dan aktivitas belajar IPA siswa kelas III SDN Bakalan II Kec. Purwosari Kabupaten Pasuruan / Wido Sumarno
1871Penerapan problem based learning (PBL) untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas III SDN Kebonagung 2 Kabupaten Malang / Bambang Setyadi
1872Meningkatkan hasil belajar siswa kelas IV SDN Sawojajar 6 pada pembelajaran PKn melalui penerapan team assisted individualization / Atna Tiningrum
1873Peningkatan pemahaman koperasi dalam menyejahterakan masyarakat melalui model mind mapping di kelas IV SDN Gaprang 01 Kabupaten Blitar / Chilya Anora Puspitasari
1874Penggunaan model in other people's shoes Peter McPhail untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran PKn kelas IV SDN 1 Serut Kabupaten Tulungagung / Eka Yuliana Sari
1875Peningkatan keterampilan pemberian komentar persoalan faktual dengan model SAVI pada siswa kelas V MI al huda Kebonrejo Kabupaten Blitar / Dewi Wulansari
1876Penerapan model stad untuk meningkatkan aktivitas dan hasil belajar siswa pokok bahasan koperasi kelas IV SDN Ketawanggede 1 Malang / Dedi Wahyudi Istanto
1877Pemanfaatan lingkungan sekolah untuk meningkatkan keterampilan menulis puisi siswa kelas V MI Sunan Gunung Jati Kecamatan Sukun Kota Malang / Irfatul Laila
1878Meningkatkan kemampuan membaca karya sastra: penelitian tindakan kelas dengan strategi directed reading thinking activity di kelas V SDN Gajahbendo Kecamatan Beji Kabupaten Pasuruan / Ismiasih
1879Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Sumbersari I Kecamatan Beji Kabupaten Pasuruan / Yuli Panca Intarti
1880Penggunaan model pembelajaran tematik untuk meningkatkan prestasi belajar siswa kelas III MI Miftahul Ulum Kanigoro Kecamatan Pagelaran Kabupaten Malang / Imroatul Mufidah
1881Penggunaan media SEQIP siklus air untuk meningkatkan hasil belajar IPA siswa kelas V SDN Kedungsalam II Kecamatan Donomulyo Kabupaten Malang / Agisty Nirmalasari Rosyidah
1882Muatan materi karakter dalam buku ajar untuk guru kelas II pada kurikulum 2013 / Renzy Ismi Wijayanti
1883Penerapan model SAVI untuk meningkatkan pembelajaran IPA kelas IV di SDN Wates 6 Mojokerto / Dewi Oktaviana
1884Penerapan model interaktif untuk meningkatkan pembelajaran IPA siswa kelas V SDN Kalisongo 3 Kecamatan Dau Kabupaten Malang / Afifah Surohmah
1885Penerapan model example non example untuk meningkatkan hasil belajar IPS siswa kelas IV SDN Madyopuro 5 Kota Malang / Albertina Marlay
1886Meningkatkan hasil belajar PKn melalui metode role playing di kelas IV SDN Ardirejo 3 Kecamatan Kepanjen Kabupaten Malang / Ita Afni Mubalihah
1887Pembelajaran kooperatif tipe teams games tournament (TGT) sebagai upaya peningkatan kemampuan membaca pemahaman siswa kelas III SDN Podokoyo 2 Kecamatan Tosari Kabupaten Pasuruan / Endang Juwitaningsih
1888Penggunaan model pembelajaran inquiry terbimbing untuk meningkatkan prestasi belajar siswa pada mata pelajaran IPS kelas V SDN Kedawungkulon I Kecamatan Grati Kabupaten Pasuruan / Ery Faridah
1889Peningkatan hasil belajar PKn dengan menggunakan model pembelajaran problem based learning pokok bahasan berorganisasi siswa kelas V SDN Rejosalam I Kecamatan Pasrepan Kabupaten Pasuruan / Yulia Nuryani Candra
1890Peningkatan kemampuan membaca siswa kelas 1 dengan media standar lembar balik di SDN sentul kecamatan Tanggulangin kabupaten Sidoarjo / Heri Luky Indrawati
1891Penerapan model Jigsaw untuk mneingkatkan kualitas pembelajaran tema Tempat Tinggalku subtema Lingkungan Tempat Tinggalku di kelas IV SDN Madyopuro 5 Malang / Henik Nur Khofiyah
1892Pemanfaatan alat ukur dengan pembelajaran kontekstual metode inkuiri dalam meningkatkan hasil belajar matematika di kelas III UPT SDN bangilan kota Pasuruan / Anis Setiyowati
1893Penggunaan group investigation untuk meningkatkan hasil belajar keliling dan luas bangun datar kelas IV SDN Sumberboto 05 Kabupaten Blitar / Beny Kurniawati
1894Penerapan metode "paired storytelling" untuk meningkatkan ketrampilan berbicara siswa kelas V SDN Bareng 3 Kota Malang / Fitri Cahyo Arini
1895Penerapan metode demonstrasi untuk meningkatkan hasil belajar matematika pada siswa kelas IV SDN Purwantoro 8 Malang / Yunita Mardianingrum
1896Penerapan model pembelajaran deep dialogue/critical thinking dalam pembelajaran PKn untuk meningkatkan aktivitas dan hasil belajar siswa kelas IV SDN Bareng 03 Kecamatan Klojen kota Malang / Silvia Fransisca Sukma
1897Penerapan model pembelajaran generatif untuk meningkatkan hasil belajar IPA siswa kelas V SDN Oro-Oro Dowo Malang / Elminawati Sutomo
1898Penerapan model TSTS untuk meningkatkan pembelajaran IPA siswa kelas V SDN Bandungrejosari 1 Kota Malang / Zulfa Nur Urida
1899Penerapan media sound slide pada pembelajaran IPS untuk meningkatkan aktivitas dan hasil belajar siswa kelas VB SDN Bandungrejosari I kota Malang / Rufi' Nur Rahmawati
1900Penggunaan media terrarium untuk meningkatkan hasil belajar IPA siswa kelas II SDN Nguling 02 Kecamatan Nguling Kabupaten Pasuruan / Khodiatus Suaibah
1901Penggunaan model permainan berbasis teori dienes untuk meningkatkan pemahaman konsep perkalian pada siswa kelas II SDN Dadaprejo 01 Batu / Dwi Nastiti Lestari
1902Penerapan media monopoli untuk meningkatkan aktivitas dan hasil belajar siswa pada pembelajaran IPS kelas V SDN Sukolilo 01 Kecamatan Jabung Kabupaten Malang / Iftia Amilatus Sholikah
1903Penerapan model pembelajaran salingtemas untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas V SDN Karangbesuki 4 Malang / Devi Pratiwi
1904Penerapan model quantum learning untuk meningkatkan pembelajaran IPA siswa kelas V SDN Turus Kecamatan Gampengrejo Kabupaten Kediri / Hanik Aida
1905Penerapan pembelajaran pemecahan masalah untuk meningkatkan aktivitas dan hasil belajar siswa pada materi perbandingan dan skala kelas V MI Nabatul Ulum Kediri / Kharisa Oktavia
1906Penggunaan media model bangun ruang untuk meningkatkan hasil belajar geometri dan pengukuran siswa kelas V SDN Ampelsari I Pasrepan Kabupaten Pasuruan / Mokhamad Ghozali
1907Meningkatkan pemahaman konsep perubahan benda melalui metode discovery pada siswa kelas V SDN Tundosoro Kabupaten Pasuruan / Sri Astutik
1908Penerapan pendekatan kontekstual untuk meningkatkan hasil belajar matematika mengenal satuan waktu siswa kelas IIB SDN Bandungrejosari I Kecamatan sukun Kota Malang /Syarifah Evi Nurhayati
1909Pemanfaatan media rekaman televisi untuk meningkatkan aktivitas dan hasil belajar siswa kelas III di SDN Kiduldalem 2 Malang pada mata pelajaran IPS / Mahallisa Dyah Pristanti
1910Penerapan model two stay two stray (TSTS) untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Tulusrejo 2 Malang / Nety Agustin Walantika
1911Penerapan model group investigation untuk meningkatkan pembelajaran IPA kelas IV SDN Blayu 01 Kecamatan Wajak Kabupaten Malang / Citra Rusanti
1912Penerapan origami untuk meningkatkan hasil belajar bangun ruang pada siswa kelas IV SDN Ketindan 04 Kabupaten Malang / Dyah Komalasari
1913Penerapan model concept sentence untuk meningkatkan proses dan hasil belajar siswa kelas IV mata pelajaran IPS di SDN Lesanpuro III Kecamatan Kedungkandang Kota Malang / Wilhelma Fenanlampir
1914Penggunaan permainan joepardy untuk meningkatkan kemampuan membuat pertanyaan tertulis pada siswa kelas III SDN Kedawungwetan IV Grati-Pasuruan / Ainur Syafrilia
1915Implementasi nilai-nilai karakter dalam pembelajaran kelas III berdasarkan kurikulum 2013 di SDN Kesatrian 02 Kecamatan Blimbing Kota Malang / Ninuk Dwi Setyowati
1916Penggunaan media film untuk meningkatkan keterampilan menyimak unsur-unsur cerita dalam cerita anak pada siswa kelas V SDN Penanggungan Kota Malang / Riki Wijayanto
1917Pengembangan kecakapan klasifikasi benda berdasarkan sifat-sifat tertentu melalui permainan engklek anak kelompok A di RA Muslimat NU 24 Malang / Titis Purwiyanti
1918Penggunaan media tape recorder untuk meningkatkan kemampuan mendengarkan pada siswa kelas V SDN Talang Suko 03 Kecamatan Turen Kabupaten Malang / Dwi Ma'rifatika
1919Peningkatan hasil belajar IPS melalui model Jigsaw pada siswa kelas IV SDN Siraman 03 Kabupaten Blitar / Yunita Sari
1920Penerapan model pembelajaran telaah yurisprudensi inquiri untuk meningkatkan aktivitas dan hasil belajar siswa kelas V pada mata pelajaran IPS SDN Sukoharjo 2 Kota Malang / Husin Voth
1921Pengembangan permainan pulau kata untuk mengembangkan kemampuan berbahasa anak usia 5-6 tahun / Yuni Prima Kusumawardhani
1922Pengembangan bahan pembelajaran CD interaktif tema lingkungan sahabat kita subtema usaha pelestarian lingkungan untuk kelas V semester 2 sekolah dasar / Arini Farikhatul Jannah
1923Penerapan model investaigasi kelompok untuk meningkatkan pembelajaran IPA kelas V SDN Suwayuwo I Kecamatan Sukorejo Kabupaten Pasuruan / Ninik Fatmawati
1924Penerapan model pembelajaran Role Playing untuk meningkatkan keterampilan bermain drama pada siswa kelas V SDN Penanggungan Kota Malang / Muhammad Azhari
1925Penerapan model kooperatif tipe Think Pair Share untuk meningkatkan kemampuan siswa mengembangkan sikap ilmiahnya dalam pembelajaran IPA kelas IV MI Al-Muslihuun 01 Tlogo / Nur Fatwa Khoirun Hanim
1926Meningkatkan keterampilan berbicara melalui metode role playing pada siswa kelas III SDN Turi 01 Kodya Blitar / Ika Fitrikuslina Dewi
1927Penerapan permainan lompat nama untuk meningkatkan kemampuan fisik motorik anak kelompok B di TK Muslimat Khodijah Wandanpuro Bululawang Malang / Nurul Mufidah
1928Penerapan model discovery untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Kiduldalem I Kecamatan Bangil Kabupaten Psuruan / Endang Melati
1929Peningkatan kemampuan bahasa anak melalui permainan tebak benda dengan kartu huruf kelompok A TK dan PAUD Nurul Fikri Kecamatan Sutojayan Kabupaten Malang / Navi' Atul Mu'aziroh
1930Penerapan model quantum writing untuk meningkatkan keterampilan menulis karangan deskripsi dalam pembelajaran Bahasa Indonesia siswa kelas V SDN Karangbesuki I Kota Malang / Pertariasti Hernantiyas
1931Pengembangan media pembelajaran cerita bergambar PARJA (Paramasastra-Aksara Jawa) pada siswa kelas V SDN Petungsri 1 Kecamatan Pandaan Kabupaten Pasuruan/ Nico Indra Permana
1932Pengembangan media CD interaktif pada subtema lingkungan sekolahku untuk siswa kelas I SDN Pataan I Lamongan / Sri Susi Susanti
1933Pemberian motivasi melalui kerja kelompok pada pembelajaran PKn untuk meningkatkan prestasi belajar siswa kelas V SDN Segaran I Kecamatan Gedangan Kabupaten Malang tahun ajaran 2009/2010 / Ninik Sriwihayati
1934Pengembangan handout pembelajaran tematik terpadu pada subtema manusia dan lingkungan untuk kelas V sekolah dasar / Styo Mahendra Wasita Aji
1935Problematika pelaksanaan penilaian autentik kurikulum 2013 pada tema Tempat Tinggalku di kelas IV SD Negeri Sukun 3 Kota Malang / Shofi Nur Amalia
1936Penerapan metode membaca terbimbing untuk meningkatkan kemampuan literasi siswa kelas III SDN II Wonorejo Kabupaten Tulungagung / Isna Khuni Mu'alimah
1937Meningkatkan hasil belajar IPS melalui media gambar pada siswa kelas II SDN Turi 1 Kota Blitar / Umi Nikmatu Rohmah
1938Peningkatan keterampilan menulis kalimat sederhana menggunakan cerita gambar berseri pada siswa kelas I SDK Wignya Mandala Kecamatan Tumpang Kabupaten Malang / Lidya
1939Penerapan model pembelajaran inside outside circle (IOC) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas 5 SDN Ketawanggede 2 Kota Malang / Rizky Hanifudin
1940Penerapan model pembelajaran berbasis masalah pada mata pelajaran PKn untuk meningkatkan hasil belajar siswa kelas IV SDN Tirtomarto IV Kecamatan Ampelgading Kabupaten Malang / Jati Krisna Murti
1941Penerapan pembelajaran berbasis masalah untuk meningkatkan kemampuan berpikir kritis siswa materi operasi hitung di kelas IV SDN Tanjungrejo V Malang / Rakhmawati Lestari
1942Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar PKn kelas V semester I pokok bahasan NKRI MI Miftahul Ulum Pandaan Pasuruan / Sokhip
1943Penggunaan role playing untuk meningkatkan pemahaman dan penerapan konsep IPS siswa kelas V SDN Langon 02 Blitar / Angga Yuanita Ratna Sari
1944Penerapan problem solving menurut polya untuk meningkatkan hasil belajar luas persegi panjang pada siswa kelas III SDN Pojok 01 Kabupaten Blitar / Yekti Tri Seto Palupi
1945Studi kasus tentang kesulitan siswa dalam memahami sifat-sifat bangun datar di kelas V MI Baitur Rohman Kalipang Grati Pasuruan / Musta'in
1946Meningkatkan kemampuan berbicara dengan pembelajaran kooperatif model struktural pada siswa kelas IV SDN Rebalas Grati Pasuruan / Muhammad Arifin
1947Penerapan model kooperatif tipe group investigation untuk meningkatkan hasil belajar IPS siswa kelas IV SDN Susukanrejo Kec. Pohjentrek Kab. Pasuruan / Penina Tildjuir
1948Meningkatkan kemampuan siswa menjelaskan dalam pembelajaran IPA kelas V melalui model siklus belajar 5E di SDN Karangtengah 3 Kota Blitar / Windra Jemi Rokhmad
1949Penerapan pendekatan CTL untuk meningkatkan hasil belajar IPA siswa kelas III SDN Kandung Kecamatan Winongan Kabupaten Pasuruan / Nur Faizah
1950Pengembangan permainan papan berbintang pada pembelajaran berhitung anak TK kelompok A di Kota Malang / Ajeng Kurniasari
1951Penerapan cognitive style mapping (CSM) untuk meningkatkan hasil belajar IPS materi kenampakan alam fauna Indonesia siswa kelas V MI Miftahul Ulum Tambakrejo Kecamatan Tongas Kabupaten Probolinggo / Alfiyah
1952Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar IPA siswa kelas IV SDN Selotambak Kraton Pasuruan / Khoirun Nisak
1953Peningkatan hasil belajar IPS melalui penggunaan media boneka tangan pada siswa kelas III di SDN Ngetrep Kecamatan Mojo Kabupaten Kediri / Randy Widi Prayoga
1954Penerapan pendekatan keterampilan proses untuk meningkatkan hasil belajar IPA siswa kelas VI SDN Tampung II Kecamatan Lekok Kabupaten Pasuruan / Katiyo
1955Penerapan model pembelajaran snowball throwing untuk meningkatkan aktivitas dan hasil belajar siswa pada mata pelajaran IPS kelas IIIB SDN Semanding Kabupaten Kediri / Uluul Khakiim
1956Penerapan model kooperatif tipe cooperative script untuk meningkatkan aktivitas dan hasil pembelajaran PKn pada siswa kelas IV Madrasah Ibtidaiyah Kecamatan Cemorokandang Kota Malang / Mega Hairunnisa
1957Penerapan strategi pembelajaran peningkatan kemampuan berpikir (SPPKB) untuk meningkatkan kualitas pembelajaran IPA kelas III di SDN Ketawanggede 2 Malang / Ira Indrianika
1958Implementasi nilai-nilai karakter dalam pembelajaran di kelas IV SDN Bulukerto 02 Kota Batu / Rida Novi Wahyuningtyas
1959Peningkatan kemampuan memecahkan soal cerita dengan pembelajaran matematika realistik di kelas V SDN Bangelan 02 Kabupaten Malang / Lika Novianti
1960Pemanfaatan media pembelajaran benda konkrit untuk meningkatkan hasil belajar IPA kelas III SD Negeri Ketangirejo I Kecamatan Kejayan Kabupaten Pasuruan / Endang Sri Ratnawati
1961Meningkatkan keterampilan menyimak isi teks cerita rakyat melalui model pembelajaran snowball throwing kelas VC SDN Kesatrian 1 Kota Malang / Edy Budianto
1962Pemanfaatan media pembelajaran benda konkrit untuk meningkatkan hasil belajar matematika pokok bahasan pecahan siswa kelas III SD Islam Nurul Karomah Kecamatan Rejoso Kabupaten Pasuruan / Suhartatik
1963Penerapan pembelajaran kooperatif model Group Investigation untuk meningkatkan kualitas pembelajaran IPA siswa kelas V SDN Talangsuko 02 Turen / Wina Wahyuni Wina
1964Pemanfaatan sumber belajar lingkungan sekitar sekolah untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Gawang 1 Kebonagung Pacitan / Heru Wironoto
1965Penggunaan model picture and picture untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Gadingkulon 03 Dau Malang / Erva Wulandari
1966Penerapan metode jaritmatik untuk meningkatkan keaktifan dan pemahaman konsep perkalian pada siswa kelas II SDN Kolursari I Banagil / Nanik Ruqoiyah
1967Pola kulturasi nilai-nilai moral di SDN Ngaglik 01 Batu / Dicky Palwa Sandhi
1968Penerapan model Student Team Achievement Divisions (STAD) untuk meningkatkan aktivitas dan hasil belajar matapelajaran IPS kelas IV SN Sawojajar 1 Kota Malang / Reni Ayu Megawati
1969Penerapan metode eksperimen untuk meningkatkan hasil belajar IPA pokok bahasan tumbuhan hijau siswa kelas V SDN Dandanggendis Kecamatan Nguling Kabupaten Pasuruan / Samsul Arif
1970Pengembangan permainan teka-teki gambar dalam pembelajaran bahasa Arab mengernalkan nama anggota tubuh du Kelompok B TK Islam terpadu "Mutiara Hati" Malang / Ritna Dyah Wiyatsari
1971Penerapan model mnemonik untuk meningkatkan aktivitas dan hasil belajar dalam pembelajaran IPS kelas IV SDN Cemorokandang 1 Kecamatan Kedungkandang Kota Malang / Novida Virgiana
1972Penerapan model course review horay untuk meningkatkan aktivitas dan hasil belajar PKn kelas IV SDN Ngajum 01 Malang / Tia Diana Perwitasari
1973Penerapan pembelajaran kooperatif model numbered heads together (NHT) untuk meningkatkan hasil belajar IPS pada siswa kelas IV SDN Madyopuro 1 kecamatan Kedungkandang kota Malang / Lenora Boger
1974Pengembangan kreativitas anak melalui teknik finger painting pada kelompok B di TK ABA 3 Kedungpring Kabupaten Lamongan / Tia Wahyu Erissanti
1975Pengembangan model permainan sirkuit "Fantastic Bamboe" dalam pembelajaran fisik motorik anak kelompok B di TK Gugus II Kanigoro Kecamatan Kanigoro Kabupaten Blitar / Nurul Laily
1976Pembelajaran membaca permulaan melalui permainan bahasa untuk meningkatkan kemampuan membaca permulaan siswa kelas I MI Nurul Burhan Lumbang Pasuruan / Wiwin Nursiswati
1977Media gambar seri untuk meningkatkan kemampuan mengarang siswa kelas IV SDN Sokowiyono 02 Kecamatan Karangrejo Kabupaten Tulungagung / Handari Winingsih Salit
1978Penggunaan team games tournament dalam pembelajaran PKn tentang pelaksanaan pemeliharaan lingkungan alam dapat meningkatkan hasil belajar siswa kelas II di SDN Lambangkuning I Kecamatan Kerosono Kabupaten Nganjuk / Yan Kurniawan
1979Model pembelajaran kolaboratif tipe kooperatif learning dapat meningkatkan aktivitas belajar dan berbicara siswa kelas V SDN Bantur Malang / Eni Nur Afidah
1980Penggunaan media book wheel untuk meningkatkan keterampilan menulis ringkasan isi bacaan mata pelajaran bahasa Indonesia siswa kelas V SDN Bareng 4 Kota Malang / Dyah Vija Rukminingrum
1981Pembelajaran model polya untuk meningkatkan hasil belajar soal cerita siswa kelas 4 SDN Tanjungrejo 2 Malang / Rina Sulistyowati
1982Pengembangan media komik dalam pembelajaran subtema keanekaragaman hewan dan tumbuhan untuk kelas IV SDN Waturejo 02 Ngantang / Lenasti Zlarah Purwitasari
1983Upaya mengatasi kesulitan-kesulitan menyelesaikan soal
cerita pokok bahasan pecahan dengan gaya belajar kognitif
siswa kelas IV SDN Karangbesuki III Kota Malang / oleh Suipna
1984Pemanfaatan kemasan habis pakai untuk meningkatkan keterampilan mengarang persuasi pada siswa kelas IV SDN Cemorokandang I Kota Malang / Siti Aisyah Khumairoh
1985Penggunaan media benda asli dan manipulatif untuk meningkatkan hasil belajar IPA konsep organ tubuh manusia dan hewan di kelas V SDN Karangasem 2 Kecamatan Lumbang Kabupaten Pasuruan / Muhamad Munir
1986Penerapan pembelajaran kontekstual untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV semester II SDN Merjosari 1 Malang / Eka Setiawati
1987Pengembangan permainan engklek cerita untuk meningkatkan kemampuan motorik kasar anak Keliompok A di TK Gugus IV Srengat Kabupaten Blitar / Diana Ratna Ningtyas
1988Kesiapan sekolah dasar dalam mengimplementasikan kurikulum
berbasis kompetensi (studi kasus di SDN Arjosari I
Kecamatan Blimbing Kota Malang) / oleh Nagilah
1989Peningkatan kemampuan kognitif melalui permaian Roda Putar pada anak Kelompok A di TK PKK 01 Sentul Kota Blitar / Nurul Chotimah
1990Penerapan role playing untuk meningkatkan pemahaman teks cerita rakyat pada pembelajaran bahasa indonesia siswa kelas V SDN Tegalweru Kabupaten Malang / Rika Evalia Ariyanti
1991Penerapan model pembelajaran snowball throwing untuk meningkatkan hasil belajar IPS siswa kelas IV SDN Madyopuro 2 Kecamatan Kedungkandang Kota Malang / Dewi K. Bothmir
1992Peningkatan hasil belajar IPS melalui model pembelajaran kooperatif snowball throwing pada siswa kelas V SDN Jatinom 03 Kabupaten Blitar / Dewi Puspitasari
1993Penerapan model pembelajaran inkuiri untuk meningkatkan hasil belajar PKn tentang globalisasi pada siswa kelas IV SDN Kedungrejo Winongan Pasuruan / Asrip Rianto
1994Peningkatan hasil belajar IPS melalui model pembelajaran jigsaw pada siswa kelas V di SDN Sumberdiren 1 Kabupaten Blitar / Satrio Kurnia Angriawan
1995Studi kasus tentang kesulitan belajar siswa dalam menyelesaikan soal FPB dan KPK di kelas IV SDN Tugu Kecamatan Purwoasri Kabupaten Kediri / Ratih Agustina Rahayu
1996Penerapan model pembelajaran advance organizer untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Madyopuro III Kecamatan Kedungkandang Kota Malang / Rugaya Al-Mahdaly
1997Penggunaan metode pembelajaran bermain peran ( Role playing ) untuk meningkatkan aktifitas dan hasil belajar siswa ips kelas IV di MI Miftahul Ulum 02 Curah Dukuh Kraton Pasuruan / Robi'atul Adawiah
1998Peningkatan keterampilan menulis narasi dengan menggunakan model pivture and picture pada siswa kelas II SDN Arjowinangun 1 Kota Malang / Fausin Dadang Seitiawan
1999Penggunaan media domino bilangan untuk meningkatkan kemampuan berhitung perkalian dengan teknik permainan pada siswa kelas III SDN Percobaan 2 Malang / Titik Wijiastutik
2000Pemahaman kedisiplinan dalam mentaati tata tertib pada siswa kelas tinggi SDN Punten 01 Kecamatan Bumiaji Kota Batu / Widya Larasati
2001Penerapan penekatan komunikatif untuk meningkatkan kemampuan menulis cerita pengalaman siswa kelas V di MI Miftahul Falah Kecamatan Purwodadi Kabupaten Pasuruan / Mariyah Ulfa
2002Penerapan model eksperimen untuk meningkatkan pembelajaran IPA pada siswa kelas V di SDN Kotalama 2 Malang / Sofya Aries
2003Pemanfaatan media boneka tangan untuk meningkatkan kemampuan bercerita anak kelompok B RA Nurul Hikmah Kabupaten Pamekasan / Gusti Imaniar Rakhmadini
2004Penerapan pendekatan quantum teaching sebagai upaya meningkatkan pembelajaran tema cita-citaku di kelas IV SD Muhammadiyah 1 Babat / Rizka Rahmawati
2005Penggunaan metode eksperimen berbasis verifikasi untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran IPA konsep gaya SDN Gejugjati I Kecamatan lekok Kabupaten pasuruan / Saiful Rumain
2006Analisis kesesuaian LKS matematik kelas IV tema 4 buku insan bermartabat dengan kurikulum 2013 di SDN Arjosari 1 Kecamatan Blimbing Kota Malang / Novita Ayu Yuliansari
2007Pelaksanaan pembelajaran tematik dengan scientific approach di SDN Tulungrejo 01 Kota Batu / Andrianto Bagus Kurniawan
2008Keefektifan pendekatan bertahap dalam pembelajaran menulis karangan deskripsi siswa kelas IV SDN Balongbesuk I dan II Kecamatan Diwek Kabupaten Jombang / Inayatur Rohmah
2009Penerapan permainan sains sederhana untuk meningkatkan kognitif anak Kelompok A di TK Perharsia Tujuh Malang / Muhimmah
2010Penggunaan media pembelajaran papan seluncur bergambar untuk meningkatkan kemampuan kognitif anak Kelompok A di TK PIG Malang / Anik Sulistikowati
2011Pengembangan media buku puzzle untuk meningkatkan kemampuan kognitif anak Kelompok A di Taman Kanak-Kanak Malang / Rani Indrawati
2012Penanganan perilaku agresif anak autis oleh guru di TKLB River Kids Kota Malang / Rima Yovita
2013Pengembangan permainan "Flower Circuit" pada pembelajaran fisik motorik kasar untuk anak Kelompok B di Taman Kanak-kanak Kecamatan Gudo-Jombang / Tacera Esa Kharisma
2014Pengembangan permainan sirkuit rotan ceria untuk pembelajaran fisik motorik kasar anak Kelompok B di Raudhatul Athfal (RA) / Tri Aisyah
2015Pengembangan komik ASEB (Aku Senang Belajar) untuk pembelajaran anak TK Kelompok B / Umi Rohmatika
2016Peningkatan keterampilan menulis karangan narasi melalui gambar seri pada siswa kelas III SDN Bandungrejosari 3 Malang / Rendy Mega Pratiwi
2017Kemampuan menemukan kesalahan penulisan kata bentuk siswa kelas IV SDN Bumiayu 3 Kecamatan Kedungkandang Kota Malang / Thooriq Irtifa' Fathuddin
2018Analisis buku siswa kelas 1 kurikulum 2013 berdasarkan relevansi terhadap kompetensi dasar, pendekatan saintifik dan kaidah bahasa / Dhisi Herlistasari
2019Penerapan pendidikan karakter melalui pembiasaan di SDN Bunulrejo 03 Malang / Eni Muji Rahayu
2020Pengembangan rencana pelaksanaan pembelajaran berbasis saintifik kelas IV tema tempat tinggalku di SDN Madyopuro 5 Kota Malang / Moh. Fiqry Harum S.
2021Peningkatan kemampuan mengidentifikasi unsur intrinsik cerita melalui media audio pembelajaran pada siswa kelas V SDN Panggungduwet 01 Kabupaten Blitar / Evan Ardi Prayoga
2022Penerapan metode diskusi kelompok dalam meningkatkan keterampilan berbicara pada siswa kelas V SDN Sambirejo Kecamatan Gampengrejo Kabupaten Kediri / Siskha Amalia Dwi Cahyani
2023Pengembangan media flip chart pada tema Sejarah Peradaban Indonesia untuk kelas V semester II di SDN Karang Besuki II Kota Malang / Dyah Purwitriana
2024Peningkatan kemampuan bahasa anak prasekolah Kelompok B melalui media kongrit di TK Permatan Iman 3 Malang / Eka Srisuhartati
2025Pengembangan media flash untuk mengembangkan kreativitas anak taman kanak-kanak / Hariddha Yuni Sulistyaningrum
2026Pemanfaatan media VCD pembelajaran untuk meningkatkan proses dan hasil belajar IPS siswa kelas V SDN Sumberagung II Tulungagung / Hanim Nafingah
2027Upaya meningkatkan kemampuan menyelesaikan soal cerita penjumlahan dan pengurangan pada siswa kelasw III SDN Jetis I melalui metode polya / Vita Dewi Susanti
2028Penerapan model pembelajaran team game tournament untuk meningkatkan aktivitas dan hasil belajar IPA di SDN Tegalweru Malang / Nurul Khoiriyah
2029Penerapan model pembelajaran peta konsep untuk meningkatkan aktivitas siswa dan penguasaan materi IPS kelas III di SDN Percobaan 2 Kota Malang / Dwi Pujiastutik
2030Upaya meningkatkan prestasi belajar IPA dengan metode "penemuan terbimbing" pada siswa kelas VI SDN Ardimulyo I Kecamatan Singosari Kabupaten Malang / Sugiarti
2031Meningkatkan kemampuan membaca cerita berbahasa Indonesia melalui buku cerita bergambar Big Book di kelas I MI Al Islamiyah Kauman-Bangil / Zainab
2032Penerapan pembelajaran inkuiri untuk meningkatkan hasil belajar PKn kelas V SDN Beji II Kecamatan Beji Kabupaten Pasuruan / Sufa'at
2033Penerapan pembelajaran tematik tema lingkungan sekolah untuk meningkatkan keaktifan dan hasil belajar siswa kelas III di MI Darul Ulum Kecamatan Rembang Kabupaten Pasuruan / M. Ridwanulloh
2034Penerapan peta konsep untuk meningkatkan hasil belajar IPS kelas IV di SDN Sentul 4 Kota Blitar / Beti Purwitasari
2035Penerapan model pembelajaran discovery untuk meningkatkan pembelajaran IPA siswa kelas V di MI Miftahul Ulum Kejapanan / Ismaul Chusnah
2036Pemanfaatan media permainan monopoli untuk meningkatkan hasil belajar IPS siswa kelas 3 MI Sabilunnajah Pasrepan / Nur Fauzia
2037Penerapan pakem untuk meningkatkan hasil belajar PKn materi pokok pemerintahan pust dan pemerintahan daerah kelas VI MI Bustanul Ulum Pakisaji Malang / Nugroho Dwi Cahyono
2038Meningkatkan hasil belajar debit melalui pemecahan masalah model Polya di kelas VI SDN Plumbangan 03 Kecamatan Doko / Dyah Sekti Pratiwi
2039Pengembangan media papan lempar sebagai sarana pembelajaran nilai agama dan moral anak usia 5-6 tahun / Nova Tamril
2040Penerapan model pembelajaran advance organizer untuk meningkatkan proses dan hasil belajar pembelajaran PKn pada siswa kelas V SDN Sumber Banteng Kecamatan Kejayan Kabupaten Pasuruan / Titik Puspitasari
2041Penggunaan media bobeka tangan untuk meningkatkan kemampuan bercerita pada siswa kelas II SDN Bareng 1 Kota Malang / Nurhidayati
2042Upaya meningkatkan pembelajaran IPA melalui penerapan model pembelajaran Savi (Somatis Auditori Visual Intelektual) pada siswa kelas III SDN Pesanggrahan 02 kota Batu / Evi Aulia Rizka
2043Penerapan model talking stick untuk meningkatkan keterampilan berbicara dalam pembelajaran bahasa Indonesia kelas V SDN Jatimulyo 1 kota Malang / Putri Dwi Cahyaningsih
2044Penerapan permainan kooperatif untuk meningkatkan kmampuan sosial emosional anak TK Kelompok A di TK Dharma Wanita Persatuan Sengkaling / Sulistyowati
2045Penerapan model picture and picture untuk meningkatkan pembelajaran IPA siswa kelas IV SDN Gampingan 01 Pagak / Dewi Diansari
2046Peningkatan hasil belajar IPS materi koperasi melalui model numbered heads together di kelas IV SDN Sumberdiren 01 Kabupaten Blitar / Ratih Putri Absari
2047Penerapan model pembelajaran kooperatif tipe Think Talk Write (TTW) untuk meningkatkan keterampilan menulis deskripsi pada siswa kelas IV SDN 5 JOmbok Kabupaten Trenggalek / Tsamrotun Niswah
2048Penerapan model kreatif produktif untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas IV SDN Plosoharjo II Kecamatan Pace Kabupaten Nganjuk / Andra Dewi Lestari
2049Pengembangan media kubus aksara Jawa dalam pembelajaran bahasa Jawa di kelas III SDN Gogorante Kabupaten Kediri / Lilian Puspa Sari
2050Peran guru dalam mengintegrasikan nilai-nilai karakter pada pembelajaran tematik kurikulum 2013 di kelas 1 SDN Bunulrejo 02 Malang / Endah Purnamasari
2051Pengembangan modul tema Energi dan Perubahannya subtema Perubahan Energi di kelas III SDN Kedungkandang 2 Malang / Ludvy Kharisma Dewi
2052Peningkatan hasil belajar IPS melalui model mind mapping di kelas V SDN Sentul 02 Kota Blitar / Agustiningsih
2053Analisis muatan nilai-nilai karakter pada buku siswa kelas VI semester 2 sekolah dasar / Latifatul Chabibah
2054Penggunaan model pembelajaran cooperative reading and composition (CIRC) untuk meningkatkan pemahaman isi bacaan kelas 3A SDN Kotalama 3 Malang / Ervinah
2055Peningkatan kemampuan motorik halus anak kelompok B melalui penggunaan play dough karakter di TK PGRI Kecamatan Srengat Kabupaten Blitar / Aina Lailatul Fitriyah
2056Pengembangan permainan Gedrik Huruf untuk pembelajaran fisik motorik kasar anak TK B / Jefry Novita Sari
2057Peningkatan keterampilan memerankan tokoh drama melalui metode Role Playing di kelas V SDN 1 Gilang Kabupaten Tulungagung / Noveta Elga Meinina
2058Pengembangan instrumen penilaian interaktif untuk kelas V SD tema 5 Bangga Sebagai Bangsa Indonesia sub tema 5.2 Indonesiaku, Bangsa yang Berbudaya / Vindy Widi Astika
2059Peningkatan kemampuan motorik kasar anak melalui permainan ular naga di TK Al Hidayah Kelompok A Bagelenan Srengat Kabupaten Blitar / Yuniar Chlara Teja Sukmana
2060Penerapan SQ3R (Survey, Question, Read, Recite, Review) untuk meningkatkan kemampuan membaca pemahaman siswa kelas VA SDN Tegowangi Kabupaten Kediri / Prisma Iga Madani
2061Peningkatan keterampilan menulis pantun melalui model pembelajaran Think Pair Sharae (TPS) kelas IV SDN 2 Pelem Kabupaten Tulungagung / Efita Kusuma Sanjaya
2062Peningkatan kemampuan motorik halus melalui kegiatan bermain dengan media koran bekas pada anak kelompok B di PAUD Insan Al Firdaus Kabupaten Kediri / Aulia Novida Kusumadewi
2063Penerapan model problem based learning (PBL) untuk meningkatkan pembelajaran IPA pada siswa kelas V SDN Madyopuro 3 Kecamatan Kedungkandang kota Malang / Ebti Lusiana Dumgair
2064Pengembangan media flash card aksara Jawa dalam pembelajaran membaca aksara Jawa siswa kelas III SDN Sentonorejo Kecamatan Trowulan Kabupaten Mojokerto / Winy Walida
2065Peningkatan kemampuan menulis puisi melalui pemanfaatan kartu larik di kelas V SDN Bumiayu 04 Kota Malang / Dimas Agung Prasetya
2066Peningkatan hasil belajar tentang jual beli melalui metode role playing pada siswa kelas III di SDN Kedungbanteng 3 Kabupaten Blitar / Ardy Candra Wirawan
2067Peningkatan keterampilan menulis teks laporan dengan memanfaatkan lingkungan sekolah sebagai sumber belajar pada siswa kelas II B SDN Madyopuro 05 Kota Malang / Diajeng Nurmala Cahyaningrum
2068Peningkatan hasil belajar matematika penjumlahan pecahan melalui model quantum learning tipe tandur pada siswa kelas V SDN 1 Sukorejo Wetan Kabupaten Tulungagung / Hafidz Ali Azmi
2069Pengembangan media video interaktif untuk pemahaman bilangan pada anak usia 4-5 tahun / Melinda Maharani
2070Peningkatan hasil belajar IPA melalui model Contextual Teaching and Learning (CTL) pada siswa kelas V SDN Podorejo 1 Kabupaten Tulungagung / Ahmad Jalil Afandi
2071Peningkatan keterampilan berhitung permulaan melalui permainan dadu bergambar pada kelompok A TK Muslimat NU 11 Gadang / Sri Wahyuningsih
2072Pengembangan media monopoli pada pembelajaran IPS materi mengenal Sejarah Uang di kelas III SDI Sunan Drajat Kecamatan Tutur Kabupaten Pasuruan / Umi Salamatus Zahro
2073Penerapan model quantum teaching untuk meningkatkan pembelajaran IPA kelas V SDN 4 Besuki Kabupaten Trenggalek / Eka Putri Lestari
2074Peningkatan kemampuan bercerita melalui media animasi pada kelompok B TK Negeri Pembina Kota Blitar / Dwi Pusmiyati
2075Analisis kesesuaian bukuguru dan buku siswa tema Peduli Lingkungan Sosial pada kurikulum 2013 di kelas III SD / Rindy Fiva Astuti
2076Pengembangan media papan flanel lengkapi aku dalam pembelajaran bahasa anak usia 5-6 tahun di Kota Malang / Yatimmatul Islammia
2077Penggunaan media big book untuk meningkatkan kemampuan memahami isi teks narasi pada siswa kelas IIIB SDN Ciptomulyo I Kota Malang / Anisah
2078Peningkatan keterampilan menulis karangan narasi melalui media flip chart tema 6 indahnya negeriku subtema 2 keindahan alam negeriku pada siswa kelas IV SDN Merjosari 02 Malang / Eka Yulistyani
2079Penerapan model pembelajaran STAD untuk meningkatkan hasil belajar siswa kelas IV mata pelajaran PKN di SDN Lesanpuro 3 Kota Malang / Epi Yuni Badelwair
2080Pengembangan media pembelajaran "House of Mickey" pada aspek kognitif dan bahasa untuk kelompok B / Stefani Maria Ade Putri Pamungkas
2081Peningkatan rasa percaya diri melalui metode sosiopreneur pada anak kelompok B di TK Aisyiyah Bustanul Athfal 17 Kota Malang / Arum Murniati Sakinah
2082Pemanfaatan lingkungan sekolah untuk meningkatkan kemampuan menulis kalimat sederhana kelas II MI Darussalam Rembang Pasuruan / Erna Irawati
2083Implementasi nilai-nilai karakter pada kegiatan pembelajaran di SDN Pare Kediri / Sukma Dwi Pusparini
2084Penerapan Model quantum teaching untuk meningkatkan motivasi dan hasil belajar IPS pada siswa kelas V SDN Madyopuro I Kecamatan Kedungkandang Kota Malang / Yermia M Laelaem
2085Penerapan model pembelajaran kooperatif jigsaw II untuk meningkatkan aktivitas dan hasil belajar IPA di kelas IV SDN Purwoasri 01 Kabupaten Malang / Faridha Susanti
2086Penerapan pendekapan realistic mathematic education (RME) untuk meningkatkan pemahaman konsep bangun ruang pada siswa kelas IV SDN Mojokambang 1 Jombang / Henny Candrawati
2087Permasalahan anak dalam program toilet training (studi kasus pada siswa kelompok B TK Satu Atap SDN Tanjungrejo 5 Malang) / Putri Wulandari
2088Penerapan metode bernyanyi untuk meningkatkan kosakata bahasa Inggris anak kelompok B TK PGRI I Pecalukan Kabupaten Pasuruan / Helda Astrilia
2089Meningkatkan hasil belajar PKn melalui model inkuiri yurisprudensial pada siswa kelas IV SDN Turi 02 Kota Blitar / Barteck Efraim Romkeni
2090Pembelajaran teori Van Hiele untuk meningkatkan hasil belajar siswa tentang sifat bangun ruang di kelas V MI Nurul Ulum Nguling / Ayok Priyanto
2091Pengembangan permainan sirkuit hip hip hura untuk pembelajaran fisik motorik anak kelompok A di TK ABA 6 Malang / Nur Hidayati
2092Peningkatan hasil belajar IPS melalui model pembe3lajaran Two Stay Two Stray (TSTS) pada siswa kelas III SDN Kolomayan 02 Kecamatan Wonodadi Kabupaten Blitar / Diyan Krisnawati
2093Pengembangan permainan sirkuit hulahop dalam pembelajaran fisik motorik anak Kelompok B di TK Gugus II Kecamatan Srengat Kabupaten Blitar / Eva Noviana
2094Pengaruh penggunaan alat peraga terhadap hasil belajar siswa kelas V SDN Kauman 3 Kota Blitar / Didit Amir Mahmud
2095Peningkatan kemampuan membaca puisi melalui model pembelajaran SAVI pada siswa kelas III di SDN Buring Kota Malang / Herman
2096Penerapan model cooperative script untuk meningkatkan hasil belajar IPS siswa kelas V SDN Ngaglik 03 Srengat Kabupaten Blitar / Elok Nikmathu Rhomah
2097Peningkatan hasil belajar IPS melalui model pembelajaran talking stick pada siswa kelas III SDN Blitar Kota Blitar / Arif Satryo Utomo
2098Pengembangan kemampuan pemecahan masalah melalui bermain maze pada anak Kelompok B TK Kartika IX-41 Malang / Aminatul Faidah
2099Pengembangan media kartu pintar untuk mengenalkan huruf Hijaiyah di Taman Kanak-kanak / Fithriyah Hanim
2100Studi tentang pelaksanaan pembelajaran mata pelajaran IPS di kelas V SDN Watugede 01 Kabupaten Kediri / Ayuning Rahma Hati
2101Peningkatan keterasmpilan berbicara melalui metode memerankan tokoh pada siswa kelas V SDN Bendogerit 2 Kecamatan Sananwetan Kota Blitar / Binti Nurlaili
2102Analisis kesalahan siswa kelas V dalam mengerjakan soal cerita pecahan di SDN Kedungringin III Beji Kabupaten Pasuruan / Presti Ciptaning Septiana Putri
2103Peningkatan kemampuan motorik halus melalui kegiatan menggunting pada anak Kelompok B di TK PKK Srikandi Bantaran Kabupaten Probolinggo / Eka Ameylia
2104Penerapan model numbered head together untuk meningkatkan hasil belajar pecahan pada siswa kelas 3 SDN Sumber Sekar 02 Kabupaten Blitar / Lela Liliana
2105Peningkatan hasil belajar IPS melalui model pembelajaran Jigsaw di kelas V SDN Kademangan 5 Kabupaten Blitar / Catur Palupi Ratna Pamungkas
2106Peningkatan hasil belajar IPS tentang koperasi melalui model discovery learning di kelas IV SDN Karangtengah 4 Kota Blitar / Galuh Gufita
2107Penerapan media standar lembar balik untuk meningkatkan aktivitas dan hasil belajar tematik terpadu siswa kelas V SDN Tunggal Pager Kecamatan Pungging Kabupaten Mojokerto / Iin Lutfi Kurniawati
2108Kesulitan guru sekolah dasar se Gugus I Kecamatan Blimbing Kota Malang dalam mengimplementasikan kurikulum 2013 / Mega Hariri Arofah
2109Problematika pembelajaran tematik terpadu di SDN Bunulrejo 01 Malang / Faridahtul Jannah
2110Peningkatan hasil belajar siswa kelas IV pada pelajarean IPS melalui model pembelajaran mind mapping di SDN Blitar Kota Blitar / Dyah Muya Sharoh
2111Peningkatan keterampilan menulis karangan sederhana melalui model picture and picture pada kelas III SDN Sentul 2 Kecamatan Kepanjen Kidul Kota Blitar / Danang Gusti Puja Sakti
2112Peningkatan hasil belajar IPS melalui model numbered heads together di kelas III SDN Ngaglik 03 Kabupaten Blitar / Efsi Prastiwi
2113Peningkatan hasil belajar matematika pada materi pecahan melalui model guided discovery di kelas III SDN Ngaglik 03 Kabupaten Blitar / Nivea Ayu Rugista
2114Implementasi pendekatan saintifik dalam pembelajaran kelas II SDN Pandanwangi 4 Kota Malang / Devi Novita Sari
2115Hubungan antara kemampuan membaca intensif dengan kemampuan menceritakan kembali isi teks cerita pada siswa kelas IV SDN Catakgayam 1 Kabupaten Jombang / Evi Fatmasari
2116Peningkatan hasil belajar IPS melalui model example non example di kelas IV SDN Purworejo 1 Kabupaten Tulungagung / Anang Nur Ikhtiar
2117Analisis kesalahan penulisan huruf tegak bersambung pada karangan siswa kelas II SDN Lesanpuro 3 Kota Malang / Dita Rara Anggraini
2118Implementasi pendekatan saintefik dalam pembelajaran tematik terpadu di kelas IVA SDN Madyopuro 5 Malang / Ismawati
2119Peningkatan hasil belajar IPS melalui model Student Team Achievement Division (STAD) pada siswa kelas IV B SDN Blitar Kota Blitar / Mery Fitriastutik
2120Peningkatan hasil belajar Ilmu Pengetahuan Sosial (IPS) melalui model problem based learning di kelas IV A SDN Kademangan 5 Kabupaten Blitar / Yumina Ana Ruziqoh
2121Peningkatan hasil belajar matematika tentang bilangan pecahan melalui model Team Games Tournament (TGT) pada siswa kelas IIIA SDN Bendo 1 Kecamatan Kepanjen Kidul Kota Blitar / Nuning Kristiani
2122Analisis organisasi materi pada buku ajar tematik kelas IV SD / Nila Tri Ardiana
2123Peran Komite Sekolah dalam keunggulan pelaksanaan manajemen sekolah (studi kasus di SDN Madyopuro 1 Kecamatan Kedungkandang Kota Malang) / Ira Rokayah
2124Peningkatan kemampuan menyimak anak Kelompok B melaluipermainan sirkuit bisik berantai di RA Perwanida Kabupaten Kediri / Aimah Curutul Uyun
2125Peningkatan kemampuan membaca permulaan melalui media pohon kata pada anak Kelompok B TK Kemala Bhayangkari 44 Kota Blitar / Fiftia Rofiani
2126Pengembangan model permainan kotak pintar untuk mengembangkan kemampuan kognitif anak usia 4-5 tahun di PAUD Bumi Darun Najah Jatirejo Kecamatan Lekok Kabupaten Pasuruan / Nadiroh
2127Peningkatan kemampuan berpikir dalam pengenalan sains melalui model quantum teaching anak kelas B RA Plus Qiraati Iqbal Jepara / Farah Kamelia Ali Putri
2128Keefektifan penggunaan buku cerita bergambar pada perkembangan bahasa anak Kelompok B TK Negeri Pembina Kota Blitar / Ike Nur Wijayanti
2129Pengembangan permaianan mencari kotak koin emas dalam pembelajaran sosial emosional anak kelompok B / Aldila Fadhillah
2130Peningkatan kemampuan motorik kasar melalui "Games Circuit Circus" pada anak Kelompok B1 di TK Dharma Wanita 02 Keadwung Kabupaten Blitar / Yunita Tri Wulandari
2131Implementasi pakem melalui olah pikir sejoli untuk meningkatkan kemampuan siswa menulis pantun di kelas IV SDN Kepanjenlor III kota Blitar / Hari Tutik Purwanti
2132Penerapan model pembelajaran Inside Outside Circle (IOC) untuk meningkatkan aktivitas dan hasil belajar IPS siswa kelas IV SDN Banjararum 02 Singosari / Mutholliah
2133Pemanfaatan surat kabar sebagai sumber belajar untuk meningkatkan kemampuan membaca pemahaman siswa kelas V SDN Sekarpuro Malang / Devia Fitra Ahyari
2134Penerapan model pembelajaran peta konsep untuk meningkatkan aktivitas dan hasil belajar IPA siswa kelas Vd SDN Madyopuro 1 Kota Malang / Diana Resikahil
2135Pengembangan permainan sirkuit keseimbangan untuk pembelajaran fisik motorik anak kelompok B TK Al-Hidayah Sawentar II Kec. Kanigoro Kab. Blitar / Imroatus Sholihah
2136Peningkatan kemampuan menulis puisi melalui metode sugesti imajinasi lagu pada siswa kelas V SDN Blimbing 3 Malang / Titik Eka Probowati
2137Penggunaan media audio visual untuk meningkatkan aktivitas dan kemampuan siswa dalam menyimak bahasa Indonesia di kelas V SDN Bareng 5 Malang / Listiana
2138Penerapan pembelajaran kooperatif tipe number head together (NHT) untuk meningkatkan kemampuan berbicara pada siswa kelas V SDN Mlaten I Kecamatan Nguling Kabupaten Pasuruan / Kurniawan Ujianegara
2139Peningkatan kemampuan membaca permulaan melalui alat permainan edukatif dadu huruf pada anak Kelompok A di TK Kemala Bhayangkari 44 Kota Blitar / Anggita Dwi Karismaning Putri
2140Pengembangan permainan kursi musik untuk mengembangkan